WorldWideScience

Sample records for atomica ao acordo

  1. Fisica atomica

    CERN Document Server

    Spolskij, Eduard Vladimirovic

    1986-01-01

    Volume I : questo è il primo dei due volumi del corso di fisica atomica scritto da E. V. Spolskij. Quest'opera fondamentale è, per il suo carattere, un'enciclopedia di fisica atomica. Il primo volume, in linea di principio, tratta il basi sperimentali della fisica del micromondo.

  2. Fisica atomica

    CERN Document Server

    Born, Max

    1976-01-01

    Nato sotto forma di una corso di fisica atomica e successivamente ampliato per tener conto dei più recenti progressi nel campo della fisica, il libro di Max Born costituisce una tappa obbligata nella formazione culturale di ogni studente o ricercatore. L'autore, del quale è sufficiente ricordare che è stato una delle massime personalità scientifiche del nostro secolo, ha mirato soprattutto, sviluppando i capitoli fondamentali della fisica nucleare e della fisica quantistica, a delineare con la massima chiarezza i princìpi fisici. Il lettore non è mai distratto da complesse dimostrazioni matematiche; queste sono date in apposite appendici in fondo al volume, e in tal modo sono accresciute la leggibilità del libro e la sua utilità come valida opera di studio e di consultazione.

  3. Obstacles to the nuclear technology development in Brazil: from the beginning of atomic age to the Brazil-Germany Nuclear Agreement; Entraves ao desenvolvimento da tecnologia nuclear no Brasil: dos primordios da era atomica ao Acordo Nuclear Brasil-Alemanha

    Energy Technology Data Exchange (ETDEWEB)

    Medeiros, Tharsila Reis de

    2005-07-01

    This paper intends to comprehend the Brazilian social actors' efforts applied to the nuclear energy control, from the beginning of Atomic Age to Brazil-Germany Nuclear Agreement. It tries to demonstrate that the limits of The Brazilian nuclear development in this period derive from the capitalist development dynamics in Brazil and from the absence of continuity on the motivations of its nuclear policy. (author)

  4. Notificações aos acordos TBT e SPS: diferentes objetivos e resultados sobre o comércio internacional de agroalimentos

    Directory of Open Access Journals (Sweden)

    Fernanda Maria de Almeida

    2014-03-01

    Full Text Available O objetivo deste trabalho é identificar os efeitos que os diferentes objetivos contidos nas notificações aplicadas aos acordos TBT e SPS da Organização Mundial do Comércio tiveram sobre o comércio internacional de diferentes produtos agroalimentares, entre 1996 e 2010. Para tanto, utilizou-se um modelo de gravidade que foi estimado pelo método de Seleção Amostral. Os resultados apontaram que as notificações com objetivos de aumento de informações aos consumidores contribuíram para o aumento do comércio da maioria dos produtos selecionados. Do mesmo modo, as notificações cujos objetivos utilizaram justificativas do combate à disseminação de eventos amplamente divulgados, como a Gripe Aviária, Brucelose Bovina, dentre outras doenças, favoreceram o comércio. Para os demais objetivos, tais como segurança do alimento, saúde animal, proteção de plantas e avaliações de conformidade, os efeitos não se mostraram padronizados. Por meio destes resultados, pode-se concluir que a divulgação do atendimento às medidas exigidas pelos países pode beneficiar o comércio. Assim, novas políticas comerciais e estratégias empresariais podem utilizar-se das embalagens e de diferentes meios de comunicação para divulgar as medidas adotadas no atendimento dos objetivos contidos nas notificações, de tal modo que os ganhos com o comércio possam ser ampliados.

  5. Spettroscopia atomica e processi radiativi

    CERN Document Server

    Degl’Innocenti, Egidio Landi

    2009-01-01

    Il volume si propone lo scopo di fornire al lettore i concetti fisici fondamentali che stanno alla base della spettroscopia atomica e dei processi di emissione e assorbimento della radiazione nei plasmi di laboratorio e astrofisici, coprendo argomenti fondamentali quali gli spettri atomici di atomi a uno o più elettroni, la quantizzazione del campo elettromagnetico, l'interazione fra materia e radiazione (trattata sia dal punto di vista classico che quantistico), le transizioni radiative, i fenomeni di equilibrio e non-equilibrio nei plasmi, la teoria del trasporto radiativo, l'emissione della radiazione di ciclotrone, di sincrotrone e di frenamento, e la diffusione Compton relativistica (trattata col formalismo della seconda quantizzazione). Il contenuto del volume e la sua impostazione generale, basata sui principi fisici, ne fanno un testo ideale per un insegnamento monografico semestrale, annuale o biennale (a seconda degli argomenti scelti) in un Corso di Laurea Specialistica o in una Scuola di Dottorat...

  6. Análise do Nível de Transparência das Instituições Financeiras Brasileiras em Relação ao Acordo com o Novo Acordo de Capitais (Basiléia II- Um estudo de caso múltiplo

    Directory of Open Access Journals (Sweden)

    Elizabeth de Almeida Neves Di Beneditto

    2008-01-01

    instituições, e analisados à luz da literatura sobre disclosure e das recomendações do acordo de Basiléia II sobre transparência e disclosure. Nesse sentido, o presente estudo pretende analisar qual é o nível de aderência do disclosure praticado pelas instituições financeiras em relação às recomendações do Comitê, de forma a permitir uma melhor percepção das informações apresentadas nos relatórios anuais dessas instituições financeiras.

  7. Brazil and the strengthening of safeguard system of the International Atomic Energy Agency: from the four-part agreement to the additional protocol; O Brasil e o fortalecimento do sistema de salvaguardas da Agencia Internacional de Energia Atomica: do acordo quadripartite ao protocolo adicional

    Energy Technology Data Exchange (ETDEWEB)

    Moura, Carmen Lidia Richter Ribeiro

    2001-07-01

    The main objective of this paper is to analyse the evolution of IAEA verification system, that constitutes one of the main fundaments of the Non-proliferation nuclear weapons regimen, and to point out elements that contribute to inform the Brazilian position related to the Model Protocol additional to agreements for safeguard application: instrument that comprehend the most recent multilateral efforts of the nuclear verification

  8. Os tratados de livre comércio e o acordo TRIPS

    OpenAIRE

    Silva, Francisco Viegas Neves da

    2009-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Ciências Jurídicas. Programa de Pós-graduação em Direito A adesão ao Acordo sobre Aspectos dos Direitos de Propriedade Intelectual relacionados ao Comércio (Acordo TRIPS) em 1994, no âmbito da Organização Mundial do Comércio, representava o fortalecimento da proteção da propriedade intelectual, notadamente das patentes farmacêuticas, a nível mundial. No entanto, no Acordo TRIPS foram incluídas cláusulas que permitem...

  9. Lealdade a um acordo estabelecido entre os escolares

    Directory of Open Access Journals (Sweden)

    Nelson Pedro-Silva

    Full Text Available Resumo Com o presente estudo objetivamos saber se os alunos consideravam a lealdade um valor mais importante do que a honestidade e a veracidade. O universo pesquisado foi composto de 40 estudantes matriculados no Ensino Fundamental II de uma cidade do interior paulista. Para a coleta de informações, empregamos duas historietas sobre a lealdade, que serviram de ponto de partida para a entrevista, segundo o modelo piagetiano. Os resultados apontaram os seguintes aspectos: a a lealdade, para ser concebida como valor, não depende do conteúdo, mas das consequências geradoras a outrem; b ela parece ser independente da experiência escolar; e c as meninas se inclinam a ver, mais do que os meninos, a lealdade a um acordo estabelecido como um valor, apesar de condenarem seu conteúdo e serem mais sensíveis aos seus resultados. Concluímos que, a despeito dos resultados, a lealdade deve ser concebida como um valor importante para os estudantes.

  10. Responsabilidade pelo fato do produto de acordo com a disciplina da legislação consumerista

    OpenAIRE

    Pombo, Christine da Rocha

    2013-01-01

    O presente estudo fixa-se na análise do instituto da responsabilidade pelo fato do produto de acordo com a disciplina do Código de Defesa do Consumidor. Trata teoria geral da responsabilidade civil como pano de fundo da responsabilidade pelo fato do produto. Da mesma forma,mostra-se o surgimento da proteção do consumidor na nossa Constituição Federal de 1988,que elevou a defesa do consumidor ao patamar de principio constitucional. Em seguida,fixa-se o âmbito de aplicação do Código de Defesa d...

  11. GESTÃO E DIVULGAÇÃO DO RISCO OPERACIONAL E OS ACORDOS DE BASILEIA: O CASO DOS MAIORES BANCOS PORTUGUESES

    OpenAIRE

    Alves, Maria Teresa; Matias, Francisco José Ferreira

    2014-01-01

    A gestão do risco é uma atividade, cada vez mais, percecionada como sendo indissociável de uma adequada gestão organizacional. Os Acordos de Basileia, particularmente no setor da banca, têm contribuído para o reforço desta visão. O presente estudo procura verificar, especialmente ao nível da gestão do risco operacional, qual a posição em que se encontram as instituições financeiras, tendo em conta a existência dos referidos Acordos. Foca-se a avaliação do estágio de desenvolvimento das ativid...

  12. Acordo ortográfico: o discurso governamental da 5ª Edição

    Directory of Open Access Journals (Sweden)

    Indianara Luzia Peron

    2014-07-01

    Full Text Available O presente artigo é o resultado de uma análise sobre o novo acordo ortográfico, visando o discurso governamental. Desde a colonização linguística tenta-se unificar a língua dos países lusófonos, tendo o poder político como impulsionador desta unificação. O novo acordo ortográfico gera muitas mudanças, como atualização de livros, revistas, jornais e sites. As opiniões sobre a nova ortografia despertam dúvidas, pois os países da comunidade lusófona possuem uma cultura própria. Vários os fatores que contribuem para a busca dessa unificação, uma delas é o uso de duas ortografias, que se torna prejudicial à unidade intercontinental da língua. Palavras-chave: acordo ortográfico; comunidade lusófona; discurso governamental; unificação.

  13. As lacunas do acordo antidumping relacionadas à determinação da prática dumping

    OpenAIRE

    Noman, Rafaela Teixeira Vieira

    2012-01-01

    A dissertação identifica as lacunas e imprecisões presentes no texto do artigo 2 do Acordo Antidumping relacionadas à determinação de dumping. São analisados o contexto do surgimento do conceito de dumping e das medidas antidumping, bem como da regulamentação multilateral sobre a matéria. É apresentada uma análise detalhada do texto do artigo 2 do Acordo Antidumping , em que são avaliadas as orientações do Acordo acerca da apuração da margem de dumping. Esse estudo detalhado...

  14. Adesão ao tratamento da ambliopia

    OpenAIRE

    Arakaki Mara Regina; Schellini Silvana Artioli; Heimbeck Felipe Jorge; Furuya Margareth Tiemi; Padovani Carlos Roberto

    2004-01-01

    OBJETIVO: Avaliar a influência da adesão no resultado do tratamento da ambliopia. MÉTODOS: Foi feito estudo retrospectivo avaliando a resposta ao tratamento da ambliopia em 151 crianças portadoras de ambliopia, tratadas com esquema de oclusão diária, com o número de dias variando de acordo com a idade da criança. Os pacientes foram separados em dois grupos que diferiam entre si pela adesão ou não ao tratamento. RESULTADOS: Observou-se que o tratamento teve melhores resultados nas crianças de ...

  15. Os Acordos de Basiléia e bancos de desenvolvimento no Brasil: uma avaliação do BNDES e do BNB

    Directory of Open Access Journals (Sweden)

    Rogério Sobreira

    2011-04-01

    Full Text Available No Brasil, os bancos de desenvolvimento foram submetidos às exigências regulamentares de Basileia e tratados de modo idêntico às demais instituições componentes do sistema financeiro nacional. Contudo, dada a natureza idiossincrática dos bancos de desenvolvimento, frequentemente se argumenta que a aplicação dos acordos a este tipo de instituição não é adequada, tendo por última implicação impedi-las de cumprir suas funções de modo eficaz. Assim, o presente artigo tem por objetivo avaliar se a submissão dos dois principais bancos de desenvolvimento brasileiros, o BNDES e o BNB, aos procedimentos normativos de Basileia provocou uma perda de dinamismo dessas instituições, de modo a impedir integral ou parcialmente o cumprimento de suas funções. Conclui-se que as duas instituições referidas foram afetadas de modo assimétrico pelas exigências regulamentares associadas a Basileia, permitindo ao BNDES exercer suas funções com alguma pequena limitação, mas prejudicando fortemente o BNB no exercício de suas funções de banco de desenvolvimento.

  16. Ensino superior em administração entre os anos 1940 e 1950: uma discussão a partir dos acordos de cooperação Brasil-Estados Unidos

    Directory of Open Access Journals (Sweden)

    Amon Narciso de Barros

    Full Text Available O presente trabalho tem como objetivo discutir o desenvolvimento dos cursos superiores em Administração no Brasil entre os anos 1940 e 1950 a partir dos acordos de cooperação entre Brasil e EUA. Inicialmente discutimos brevemente a metodologia utilizada para coleta dos dados e, em seguida, apresentamos uma discussão sobre as relações bilaterais entre os países. Posteriormente tecemos considerações sobre os cursos superiores em Administração que contaram com o apoio estadunidense, além de refletirmos sobre os próprios acordos. Concluímos que a dita "americanização" da Administração no Brasil tem raízes profundas e que, para que um saber mais autoconsciente seja construído e fortalecido, devemos refletir sobre a constituição da própria área, sobre como as influências de modelos estrangeiros são recebidas e articuladas. Por fim, sugerimos que futuras pesquisas poderiam aprofundar as discussões realizadas, ao fazer estudos específicos sobre a história dos cursos superiores em Administração brasileiros, especialmente os que participaram de acordos com outras instituições.

  17. PROPRIEDADE INTELECTUAL NO CENÁRIO INTERNACIONAL: ORGANISMOS DE PROTEÇÃO E O ACORDO TRIPS

    Directory of Open Access Journals (Sweden)

    Florisbal de Souza Del’Olmo

    2013-04-01

    Full Text Available O presente artigo tem por escopo estudar a questão da Propriedade Intelectual no cenário internacional, fazendo uma abordagem do histórico desse instituto jurídico e seus desdobramentos, sendo no estudo dos tratados internacionais e na criação dos organismos internacionais que visam dar guarida a esses direitos. A criação da OMPI (Organização Mundial da Propriedade Intelectual foi um grande avanço, pois além de ser um órgão das Nações Unidas especializado na matéria, teve em seu principal objetivo disciplinar e proteger os direitos intelectuais. Consequentemente, com a dinamização do comércio em escala mundial e a intensificação das relações internacionais de cunho comercial, uma otimização dos órgãos competentes se fez necessária, haja vista a criação da OMC (Organização Mundial do Comérico em substituição do já ultrapassado GATT ( Acordo Geral de Tarifas e Comércio. Nesse sentido, também fora necessário a criação de um novo documento internacional sobre a propriedade intelectual, surge então o TRIPS (Trade Related Aspects of Intellectual Property Rights, tendo como seus propósitos centrais a redução de distorções e obstáculos ao comércio internacional e assegurar o cumprimento das medidas e procedimentos de proteção a propriedade intelectual, e, inclusive o ter o propósito de amenizar as tenções entre os países ricos detentores das pesquisas no campo da biodiversidade e os países pobres detentores da biodiversidade.

  18. Impactos dos acordos de liberalização comercial Alca e Mercoeuro sobre os países membros

    Directory of Open Access Journals (Sweden)

    Ângelo Costa Gurgel

    2002-01-01

    Full Text Available O objetivo deste trabalho é determinar os impactos da formação da Alca e de um possível bloco de comércio do Mercosul com a União Européia, para o Brasil em particular e para os demais países envolvidos em tais blocos, enfatizando os efeitos sobre o setor agrícola. O modelo de equilíbrio geral aplicado do Projeto de Análise de Comércio Global (Gtap é usado para implementar as simulações. Os resultados sugerem que a Alca traz aumentos na produção agrícola e superávits comerciais nos países do Mercosul; no entanto, para os produtos manufaturados tais efeitos são negativos. Os EUA e o Canadá apresentam uma pequena redução na balança comercial. O Brasil é o único país do Mercosul com ganhos de bem-estar. Os efeitos do Mercoeuro sobre os países membros são similares aos da Alca, porém em maior magnitude. Os ganhos de bem-estar estão presentes para todos os países do Mercoeuro, sendo este acordo mais favorável para os países do Mercosul do que a Alca.The objective of this paper is to determine the impacts on the international agricultural market of potential trade liberalization agreements such as Americas Free Trade Area (Afta and Mercosul and European Union Free Trade Area (Mercoeuro. The general equilibrium model from the Global Trade Analysis Project (Gtap is applied to run the simulations. The results suggest that Afta increases agricultural production and trade balance for the Mercosul countries, but for manufactures the effects are negative on both production and trade balance. The U.S. and Canada show a small reduction on trade balance. Brazil is the only Mercosul country to obtain welfare gains with Afta. The impacts of Mercoeuro on its member country are similar to those of Afta, but they are greater in magnitude. Also, all countries have welfare gains in the Mercoeuro, which presents greater benefits than Afta to their respective.

  19. Acordo CETA: o Parlamento Europeu fez a diferença

    Directory of Open Access Journals (Sweden)

    Pedro Silva Pereira

    2017-05-01

    Full Text Available O presente artigo visa analisar a temática da influência do Parlamento Europeu na orientação do processo negocial do Acordo Económico e Comercial Global entre a União Europeia e o Canadá, vulgarmente denominado de CETA. Em particular, destaca-se uma matéria em que a pressão exercida pelo Parlamento Europeu foi determinante: a exigência da eliminação do sistema de arbitragem privada (doravante, ISDS. O ISDS trata-se de um mecanismo para a resolução de litígios entre os investidores e os Estados que data de finais da década de 60, tendo, entretanto, generalizado-se a ideia de que este sistema padecia de vários problemas. Assim, após a conclusão das negociações do CETA, e em virtude da pressão do Parlamento Europeu e da opinião pública, o “velho ISDS” foi substituído por um sistema público de arbitragem, designado de Investment Court System. Para se compreender o motivo de a larga maioria dos deputados europeus ter considerado este acordo merecedor de um voto favorável, importa ter presente que a versão final do texto submetido a votação é substancialmente diferente daquele que constava das suas versões iniciais. Na introdução, o artigo em referência apresenta o enquadramento jurídico do papel do Parlamento Europeu na negociação e ratificação dos acordos comerciais celebrados pela União Europeia e descreve, de seguida, os termos da intervenção do Parlamento Europeu no caso concreto do CETA. No contexto deste último ponto, o artigo aborda, num primeiro momento, os temas da transparência e da participação da sociedade civil e, num segundo momento, relata o processo de eliminação do sistema privado de ISDS no CETA. Por último, conclui-se com a avaliação sumária das oportunidades que o acordo CETA representa para a União Europeia e, sobretudo, para Portugal. | CETA: The European Parliament made the difference. This article examines the influence of the European Parliament in driving forward the

  20. Concentração de votos e acordo de acionistas: influências sobre o conservadorismo Voting rights concentration and shareholders agreement: influences on conservatism

    Directory of Open Access Journals (Sweden)

    Alfredo Sarlo Neto

    2010-12-01

    Full Text Available Este estudo investiga como duas características da estrutura de propriedade das empresas brasileiras, a concentração de votos e o acordo de acionistas, estão associados com o conservadorismo condicional proposto por Basu (1997. Essa associação foi fundamentada pelos efeitos entrincheiramento e enforcement. Considerando que o grau de conservadorismo de uma firma está atrelado aos incentivos advindos de mecanismos que reduzem o risco informacional aos stakeholders, este estudo foi desenvolvido sobre a seguinte questão de pesquisa: Qual a influência da concentração de votos e do acordo de acionistas sobre o grau de conservadorismo nas empresas listadas na Bovespa? Cabe ressaltar que o objetivo principal deste trabalho é tratar de fatores ainda não abordados na literatura (nacional e internacional produzida por essa linha de pesquisa, fornecendo evidências acerca da influência da estrutura de propriedade sobre o conservadorismo no mercado brasileiro, que possui conflito de agência entre acionistas majoritários (controlador e minoritários. A amostra do trabalho perfaz 617 observações composta por empresas não financeiras negociadas na Bovespa durante o período de 2000 a 2008. Alternativamente, foi selecionada outra amostra desconsiderando as observações do ano de 2008, de forma a expurgar os efeitos da crise financeira registrada nesse ano. As evidências indicam que a concentração de votos contribui para diminuir o grau de conservadorismo, enquanto, por outro lado, o acordo de acionistas contribui para aumentar. Alternativamente, os resultados considerando o ano da crise global distorcem o funcionamento do modelo de Basu (1997. Espera-se que este estudo contribua para investidores, reguladores, pesquisadores e analistas no entendimento da função da informação contábil no processo de governança das firmas.This study investigates how two features of the ownership structure of Brazilian companies, the voting rights

  1. Atenção ao Suicídio

    Directory of Open Access Journals (Sweden)

    Berenice Rheinreimer

    2015-11-01

    Full Text Available De acordo com a OMS a cada ano ocorrem 1 milhão de mortes causadas por suicídio, número maior que a soma das mortes causadas por guerras e homicídios (1. Até 2030, as mortes por suicídio podem chegar a 1 milhão e quinhentos mil, caso sejam mantidos os índices de crescimento atuais (2, 3. Para cada morte, ocorrem de 10 a 40 tentativas de suicídio, ou seja, 10 a 40 milhões de tentativas de suicídio ao ano (4.

  2. Adesão ao tratamento da Hanseníase: dificuldades inerentes aos portadores

    Directory of Open Access Journals (Sweden)

    Izaildo Tavares Luna

    2010-12-01

    Full Text Available Esta pesquisa, realizada em Guaiúba, CE, Brasil, objetivou identificar as dificuldades de adesão ao tratamento pelos portadores de hanseníase, relacionando os fatores associados. Estudo qualitativo, cujos dados foram coletados a partir de uma visita domiciliária com roteiro de entrevista contendo sete questões norteadoras. Participaram pacientes com diagnóstico de hanseníase e histórico de não adesão ao tratamento. Utilizou-se o Modelo de Atividade de Vida de Roper, Logan e Tierney. As falas dos sujeitos foram categorizadas de acordo com as doze atividades de vida. A utilização do modelo possibilitou uma abordagem holística sobre as barreiras vivenciadas pelo hanseniano na adesão ao tratamento medicamentoso, de modo a conhecer as atividades de vida destes pacientes para possível adequação de ações voltadas a essa clientela.

  3. Conselhos de Empresa Europeus militantes? Obstáculos, acordos e boas práticas à luz da experiência portuguesa na VW

    Directory of Open Access Journals (Sweden)

    Hermes Augusto Costa

    Full Text Available Resumo A organização transnacional de trabalhadores apela a distintas configurações institucionais e modos de atuação. Neste texto analisa-se uma dessas formas de organização: os conselhos de empresa europeus (CEEs, estruturas que dão testemunho do modo como os processos de informação e consulta nas empresas de dimensão comunitária podem reforçar a participação laboral transnacional. Baseando-se no impacto setorial dos CEEs em Portugal, este texto valoriza duas dimensões de análise: por um lado, uma dimensão formal e quantitativa associada a uma análise de conteúdos de acordos de CEEs envolvendo representantes de trabalhadores nos setores metalúrgico, químico e financeiro; por outro lado, uma dimensão qualitativa resultante de entrevistas realizadas junto de representantes de trabalhadores em CEEs, de modo a evidenciar boas práticas associadas ao seu funcionamento. Nesse caso, o CEE do grupo Volkswagen merece atenção especial. Argumenta-se que uma transnacionalização laboral efetiva terá sempre de proceder a um trade-off entre uma gestão de obstáculos persistentes e uma maximização de boas práticas emergentes. Assim, sendo uma realidade com “caminho feito”, os CEEs continuam a perseguir como até aqui (e porventura ainda mais em contexto de crise económica o desafio da construção de uma mais coesa identidade laboral transnacional.**

  4. Incentivos ao investimento estrangeiro

    OpenAIRE

    Mendes, Valter Nuno Dias

    2015-01-01

    Dissertação de Mestrado apresentada ao Instituto de Contabilidade e Administração do Porto para a obtenção do grau de Mestre em Contabilidade e Finanças, sob orientação de Doutor José de Campos Amorim O presente estudo tem por tema os Incentivos ao Investimento Estrangeiro ao nível das pessoas singulares: o Regime Fiscal do Residente Não Habitual (RNH) e a Autorização de Residência para Atividade de Investimento (ARI) – Vistos Dourados (Golden Visa), tendo por objetivo a análise mais po...

  5. A geopolítica e o conflito Palestino-Israelense: dos Acordos de Oslo à Primavera Árabe

    Directory of Open Access Journals (Sweden)

    Jawdat ABU-EL-HAJ

    2014-12-01

    Full Text Available O artigo procura interpretar a continuidade do conflito no Oriente Médio, tendo o intervalo entre as Conferências de Oslo e Camp David como referência. Questiona sobre os motivos que levaram a OLP e Israel a realizar uma drástica revisão de suas doutrinas e, mesmo assim, não terem conseguido fechar um acordo em 2000, apesar da relativa estabilidade política. A análise é tecida em duas etapas. Na primeira, apresenta um histórico diplomático das negociações intermediadas pela Noruega entre palestinos e israelenses. Na segunda, detalha as doutrinas e as estratégias políticas que guiaram as ações dos dois protagonistas desde a década de 1940 e como estes interagiram com o contexto internacional. Argumenta que os acordos de Oslo foram motivados pelo fim da Guerra Fria e as consequências regionais da primeira Guerra do Golfo de 1990. As revisões doutrinárias realizadas por Arafat e Rabin, no entanto, perderam fôlego no final da década de 1990, quando o sistema político regional sofreu uma crise de deslegitimação causada pela permanente crise social. Ausentes do cenário político, o pan-arabismo e a esquerda marxista propiciaram o fortalecimento do fundamentalismo islâmico, passando este a assumir o papel de força aglutinadora de oposição no mundo árabe. Em Israel, uma tendência similar ocorreu com a hegemonia dos partidos ultraconservadores, inimigos declarados dos acordos de Oslo. Palestinos e israelenses mergulham num intervalo de extrema violência, a "segunda Intifada", uma reedição das lutas existenciais da década de 1940. Todavia, as mudanças estruturais na vida política, originadas pela "primavera árabe", abrem hoje uma nova janela que favorece o pleito dos moderados palestinos e das forças progressistas no mundo Árabe. Conclui-se indagando se a esquerda israelense terá ambição e força suficientes para retomar a iniciativa política e negociar um fim pacífico para o conflito.

  6. Adesão ao tratamento da ambliopia

    Directory of Open Access Journals (Sweden)

    Arakaki Mara Regina

    2004-01-01

    Full Text Available OBJETIVO: Avaliar a influência da adesão no resultado do tratamento da ambliopia. MÉTODOS: Foi feito estudo retrospectivo avaliando a resposta ao tratamento da ambliopia em 151 crianças portadoras de ambliopia, tratadas com esquema de oclusão diária, com o número de dias variando de acordo com a idade da criança. Os pacientes foram separados em dois grupos que diferiam entre si pela adesão ou não ao tratamento. RESULTADOS: Observou-se que o tratamento teve melhores resultados nas crianças de 4 a 7 anos e que aderiram ao tratamento; as crianças que aderiram ao tratamento necessitaram de tempo menor de permanência em tratamento. Mesmo crianças com idade superior a 7 anos tiveram resultados positivos com a oclusão. CONCLUSÃO:O tratamento oclusivo é um meio terapêutico eficiente desde que haja a cooperação do paciente.

  7. A Política Comercial Comum à prova no pós-Lisboa - A competência para a celebração de acordos internacionais de comércio da União Europeia

    Directory of Open Access Journals (Sweden)

    Maria João Palma

    2017-05-01

    Full Text Available O alargamento do âmbito da política comercial comum da União Europeia a outros domínios além dos relacionados com o comércio internacional de mercadorias iniciou-se com a entrada em vigor do Tratado de Nice, em 2003. A partir dessa altura passaram a estar incluídos na competência exclusiva da União Europeia (UE a celebração de acordos internacionais relacionados com o comércio de serviços ou os aspetos comerciais da propriedade intelectual. Estas novas competências contribuíram para alargar e reforçar o papel da UE como ator na arena do comércio internacional. A globalização alterou a forma como o comércio mundial passou a ser encarado, articulando-o com outras realidades conexas e que o agilizam. Isso explica a competência adquirida pela UE com o Tratado de Lisboa (2009 relativa ao Investimento Direto Estrangeiro. O Parecer 2/2015 do TJUE sobre o Acordo UE/Singapura irá contribuir para clarificar a questão da articulação das competências entre a UE e os Estados-membros no que se refere à celebração dos acordos de comércio da nova geração. | The Common Commercial Policy under challenge after Lisbon – the EU’s competence for the conclusion of international trade agreements. The enlargement of the scope of the Common Commercial Policy beyond external trade of goods started with the entry into force of the Treaty of Nice, in 2003. From that moment on, domains such as the conclusion of international agreements relating to trade of services and commercial aspects of intellectual property were covered by the European Union (EU exclusive competence. These new competences contributed to enhancing and strengthening EU´s role as an actor at the international trade arena. Globalization impacted on international trade, articulating it with related areas such as international direct investment. That explains the acquisition of this new competence by the UE with the Treaty of Lisbon (2009. Opinion 2/15, which concerns the

  8. Carta ao Editor

    OpenAIRE

    Correia, Miguel

    2017-01-01

    Exmos. Senhores Editores-Chefe,Li com muito interesse o artigo de Sousa R e colaboradores, intitulado “Que fatores levam ao abandono de crianças do serviço de urgência antes da observação médica?”.

  9. Shear bond strength of self-etch and total-etch adhesives to bovine enamel and dentin = Resistência ao cisalhamento de adesivo autocondicionante e convencional ao esmalte e dentina bovinos

    OpenAIRE

    Raposo, Carolina Carramilo; Santana, Ivone Lima

    2012-01-01

    Objetivo: Avaliar a resistência ao cisalhamento de adesivo autocondicionante e adesivo convencional ao esmalte e dentina bovinos Metodologia: As superfícies vestibulares de 28 incisivos mandibulares bovinos foram lixadas, sob refrigeração, para obtenção de superfícies de esmalte ou dentina planas. Um adesivo autocondicionante de passo único e um convencional de três passos foram utilizados de acordo com as instruções dos fabricantes (Adper Easy One and Adper Scotchbond, respectivamente). U...

  10. Competitividade da indústria brasileira no período recente de acordo com a taxonomia de Pavitt

    Directory of Open Access Journals (Sweden)

    Clésio Lourenço Xavier

    2012-11-01

    Full Text Available The aim of this paper is to analyse the performance and competitiveness of Brazilian export according to Pavitt’s taxonomy, highlighting the behavior of higher technological level sectors in the period between 2001 and 2010. We sought to examine both if there was any change in the Brazilian export specialization pattern in the recent period, and in which industries has Brazil increased its market parcels, through “Market Share” indicator, and also ensured Revealed Comparative Advantages, through RCA indicator. The empirical analysis showed that Brazil remains more competitive in the export of goods which demand abundant factors in natural resources. However, some sectors the selected categories revealed that there is an innovative effort to obtain competitiveness gains in the world market for high-tech products.O objetivo deste artigo é analisar o desempenho e a competitividade das exportações brasileiras de acordo com a taxonomia de Pavitt, enfatizando o comportamento de setores com maior grau tecnológico no período entre 2001 e 2010. Buscou-se observar se houve mudança do padrão de especialização das exportações brasileiras no período recente, em quais indústrias o Brasil tem ampliado suas parcelas de mercado, por meio do indicador “market share”, e quais estão garantindo Vantagens Comparativas Reveladas, a partir do indicador VCR. A análise empírica demonstrou que o Brasil continua sendo mais competitivo nas exportações de bens que demandam fatores abundantes em recursos naturais. No entanto, alguns setores das categorias selecionadas revelaram que há um esforço inovativo para obter ganhos de competitividade no mercado mundial de produtos de alta tecnologia.

  11. AO Group Annual Report

    Energy Technology Data Exchange (ETDEWEB)

    Olivier, S

    2005-10-04

    The Adaptive Optics (AO) Group in I Division develops and tests a broad range of advanced wavefront control technologies. Current applications focus on: Remote sensing, High power lasers, Astronomy, and Human vision. In the area of remote sensing, the AO Group leads a collaborative effort with LLNL's Nonproliferation, Arms Control & International Security (NAI) Directorate on Enhanced Surveillance Imaging. The ability to detect and identify individual people or vehicles from long-range is an important requirement for proliferation detection and homeland security. High-resolution imaging along horizontal paths through the atmosphere is limited by turbulence, which blurs and distorts the image. For ranges over {approx}one km, visible image resolution can be reduced by over an order of magnitude. We have developed an approach based on speckle imaging that can correct the turbulence-induced blurring and provide high resolution imagery. The system records a series of short exposure images which freeze the atmospheric effects. We can then estimate the image magnitude and phase using a bispectral estimation algorithm which cancels the atmospheric effects while maintaining object information at the diffraction limit of the imaging system.

  12. Fatores associados ao tempo de tela em estudantes do ensino médio de Fortaleza, região Nordeste do Brasil = Factors associated with screen time among high school students in Fortaleza, Northeastern Brazil

    Directory of Open Access Journals (Sweden)

    Souza, Evanice Avelino de

    2015-01-01

    Conclusões: Fatores sociodemográficos e comportamentais, incluindo hábitos alimentares, estão associados ao tempo de tela em adolescentes. Contudo, os fatores associados diferiram de acordo com o tipo de aparelho mais utilizado (televisão ou computador /videogame. Estes aspectos devem ser considerados em programas de combate ao tempo sedentário no lazer em jovens

  13. Contribuições ao dimensionamento de torres eólicas de concreto.

    OpenAIRE

    Paulo Vitor Calmon Nogueira da Gama

    2015-01-01

    O trabalho dedica-se ao estudo das torres eólicas protendidas de concreto, com a finalidade de promover a discussão sobre os critérios de dimensionamento, tema de grande relevância na atualidade. Para tal, foi considerada uma torre eólica de 100 m de altura provida de turbina de 5 MW, cujas ações foram obtidas da literatura. O carregamento de vento ao longo da torre foi tratado como estático equivalente de acordo com disposições normativas, através de uma forma simplificada para a adoção de u...

  14. Cianorte’s Green Belt Agreement: photography’s usage as denouncing tool “Acordo do Cinturão Verde de Cianorte”: o uso da fotografia como fator de denúncia

    Directory of Open Access Journals (Sweden)

    Norval Baitello Jr.

    2010-03-01

    Full Text Available This paper corresponds to a sample from a master’s degree dissertation titled “Duel of words and images: Cianorte’s Geen Belt agreement and press coverage of local and state newspapers”, presented at PUC/SP in 2010. It concerns the use of photography as social prosecution factor handled by groups in opposition to the “agreement”. In that context, general media and photography have become crucial to draw attention to – and change the course of – a negotiation process that, in exchange for the donation of a green area in Cianorte, allowed deforestation and subdivision in plots of another part of this area, culminating in damage for the region’s environment and biodiversity. Este trabalho é um recorte da dissertação intitulada Duelo de palavras e imagens: o Acordo do Cinturão Verde de Cianorte e a cobertura dos jornais impressos locais e estaduais, defendida na PUC/SP em 2010. Aborda o uso da fotografia, como fator de denúncia, pelos movimentos sociais contrários ao “acordo”. A mídia e a fotografia tornaram-se determinantes para despertar a atenção – e alterar os rumos – para uma negociação que, em troca da doação de uma área verde para o município de Cianorte, permitia o desmatamento e loteamento de outra parte desta área, com prejuízos para o meio ambiente e para a biodiversidade da região.

  15. Retinosquise juvenil ligada ao X

    Directory of Open Access Journals (Sweden)

    Cesar Gomes da Silveira

    2015-08-01

    Full Text Available RESUMO Relatar o caso de um paciente masculino de 28 anos que foi encaminhado ao Centro de Estudos e Pesquisas Oculistas Associados (RJ para avaliação de retina e apresentou os achados típicos de retinosquise juvenil ligada ao cromossomo X: maculopatia cistóide com formação de cistos na fóvea e retinosquise periférica. Foi realizado o manejo conservador, com atenção para as complicações.

  16. MEMS AO for Planet Finding

    Science.gov (United States)

    Rao, Shanti; Wallace, J. Kent; Shao, Mike; Schmidtlin, Edouard; Levine, B. Martin; Samuele, Rocco; Lane, Benjamin; Chakrabarti, Supriya; Cook, Timothy; Hicks, Brian; hide

    2008-01-01

    This slide presentation reviews a method for planet finding using microelectromechanical systems (MEMS) Adaptive Optics (AO). The use of a deformable mirror (DM) is described as a part of the instrument that was designed with a nulling interferometer. The strategy that is used is described in detail.

  17. SUCKLING PIGLETS PERFORMANCE AND MILK YIELD ACCORDING TO NURSING ORDER DESEMPENHO DE LEITÕES LACTENTES E PRODUÇÃO DE LEITE DE ACORDO COM O TETO DA MAMADA

    Directory of Open Access Journals (Sweden)

    Ivo Wentz

    2009-04-01

    Full Text Available The study evaluated the performance of suckling piglets according to the location of the mammary gland and daily milk yield. In the first trial piglets were distributed in birth weight categories: light (?1.4kg, medium (1.41-1.75kg and heavy (>1.75kg. Piglets were weighted at 7, 14 and 21 days of life. Teats were classified in three classes: 1 (first pair, 2 (2nd, 3rd and 4th pairs and 3 (5th, 6th and 7th pairs. In all weight classes, piglets suckling in class 3 presented lower (P<0.05 daily weight gain and weight at weaning. Medium and heavy piglets presented better (P<0.05 performance in class 1, followed by class 2 and 3. Light piglets had no difference when suckling class 1 and 2 teats (P>0.05. Light piglets suckling in class 3 had the worst performance. Milk yield was higher (P<0.05 in mammary glands of classes 1 and 2 than in class 3.

    KEY WORDS: Performance, piglet, milk production, teat, weight gain.
    Os estudos relatados visaram avaliar o desempenho de leitões lactentes de acordo com a localização da glândula no complexo mamário e estimar a produção diária de leite. No primeiro estudo, os leitões foram distribuídos em classes de peso ao nascimento: leves (?1,4kg, médios (1,41-1,75kg e pesados (>1,75kg. As pesagens subsequentes foram realizadas aos 7, 14 e 21 dias de vida. As tetas foram classificadas em: 1 (primeiro par, 2 (pares 2, 3 e 4 e 3 (pares 5, 6 e 7. Dentro de cada classe de peso, os leitões que mamaram na classe de tetas 3 apresentaram menor ganho de peso diário e menor peso ao desmame (P<0,05. Leitões médios e pesados tiveram melhor (P<0,05 desempenho na classe de teto 1, seguidos da classe 2 e 3. Leitões leves não apresentaram diferença entre as classes de tetas 1 e 2 (P>0,05. Leitões leves que mamaram na classe 3 tiveram o pior desempenho de todos os grupos. Na avaliação da produção de leite, a maior foi observada (P<0,05 nas tetas das classes 1 e 2, quando comparada à produção da

  18. CLASSIFICAÇÃO DO BERTOLDI NOS ACORDOS DE ACIONISTAS EM SOCIEDADE ANÔNIMA DE CAPITAL ABERTO - Estudo de caso do Grupo Pão de Açúcar

    Directory of Open Access Journals (Sweden)

    Pedro Rodrigues

    2013-11-01

    Full Text Available O objetivo geral do presente trabalho é o de analisar o acordo de Acionistas entre o Grupo Pão de Açúcar e o grupo francês Cassino pelo controle do Carrefour utilizando as classificações desenvolvidas pelo jurista Marcelo Bertoldi. O caso tornou-se público provocando este trabalho. O acordo de acionistas de uma forma geral possui importância nas relações sociais modernas, sendo um instrumento utilizado para disciplinar os interesses sociais dos acionistas signatários do acordo e com a própria companhia. Nesse sentido, o acordo de acionistas pode ser considerado como documento diferente do estatuto social registrado na sede da empresa, distinto dos outros documentos societários. A metodologia utilizada é a revisão bibliográfica com literatura nacional contraposta a análise legislativa e do próprio acordo de acionista na íntegra.

  19. Vulnerabilidades clínicas e sociais em usuários de crack de acordo com a situação de moradia: um estudo multicêntrico de seis capitais brasileiras

    Directory of Open Access Journals (Sweden)

    Silvia Chwartzmann Halpern

    Full Text Available Resumo: O estudo teve como objetivo avaliar a gravidade do uso de substâncias psicoativas, situações de violência, saúde física e emocional de usuários de crack que buscam atendimento em Centros de Atenção Psicossocial para Álcool e Drogas (CAPSad, em relação ao status de moradia. Trata-se de um estudo multicêntrico em seis capitais brasileiras, com 564 usuários de crack categorizados em dois grupos: (1 usuários que estiveram em situação de rua (n = 266 e (2 nunca estiveram em situação de rua (n = 298. Para avaliar a gravidade do uso de substâncias e as características dos indivíduos utilizou-se o Addiction Severity Index, 6ª versão (ASI-6. Os usuários do grupo 1 demonstraram piores indicadores em relação às subescalas álcool, problemas médicos, psiquiátricos, trabalho e suporte familiar, além de maior envolvimento com problemas legais, violência, abuso sexual, risco de suicídio e problemas de saúde como HIV/AIDS, hepatite e tuberculose, além de possuírem menos renda para pagar necessidades básicas. Após análises multivariadas ajustadas para possíveis confundidores, não possuir renda suficiente para pagar necessidades básicas, apresentar sintomas depressivos e ter sido preso por roubo permaneceram significativos. Este trabalho avaliou de forma mais abrangente a gravidade do uso de drogas e a situação de moradia de usuários de crack. Abordagens desenvolvidas nos dispositivos de tratamento extra-hospitalares devem ser projetadas e adequadas de acordo com perfis e demandas específicos dos usuários, em especial aqueles em situação de rua.

  20. REALIDADE AUMENTADA APLICADA AO DESIGN

    OpenAIRE

    Fernandes, Bruno Chagas Alves; Sánchez, Joaquín Fernández

    2008-01-01

    Este artigo apresenta o atual estado da arte da Realidade Aumentada aplicada ao design. São apresentados exemplos de aplicações da Realidade Aumentada em áreas como design de produtos, arquitetura, indústria automotiva, educação e design colaborativo. Também é apresentada uma rápida visão geral sobre as tecnologias envolvidas na criação de aplicações de Realidade Aumentada.

  1. Realidade aumentada aplicada ao design

    OpenAIRE

    Fernández Sánchez, Joaquín

    2008-01-01

    Este artigo apresenta o estado da arte da Realidade Aumentada aplicada ao design. São apresentados exemplos de aplicações da Realidade Aumentada em áreas como design de produtos, arquitetura, indústria automotiva, educação e design colaborativo. Também é apresentada uma rápida visão geral sobre as tecnologias envolvidas na criação de aplicações de Realidade Aumentada.

  2. Cometas: Das Lendas aos Fatos

    Science.gov (United States)

    Voelzke, M. R.

    O descobrimento de cometas, devido ao seu aparecimento espetacular, tem registro nas mais antigas culturas humanas. A primeira referência situa-se no ano de 1095 antes de Cristo [a.C.; HO; HO, 1962]. A quantidade de registros de descobrimentos cometários, principalmente provenientes do território chinês em particular e do oriente em geral, aumentou gradualmente a partir do quarto século depois de Cristo (d.C.). É de origem chinesa a primeira referência ao cometa P/Halley no ano de 240 a.C. [VOELZKE, 1993]. Com o desenvolvimento da astronomia relativamente às técnicas observacionais os descobrimentos bem como as observações cometárias aumentaram sensivelmente a partir do século XVII, sendo que a partir do século XIX um novo incremento ocorreu devido ao emprego da fotografia e a resultante melhora de sensibilidade na observação.

  3. Efeitos do acordo entre o Mercosul e a União Européia sobre os mercados de grãos

    Directory of Open Access Journals (Sweden)

    Augusto M. Alvim

    2005-12-01

    Full Text Available Este estudo busca mensurar os efeitos do acordo entre o Mercosul e a União Européia (UE sobre a produção, consumo e fluxos comerciais de arroz, milho, soja e trigo nas diversas regiões analisadas. Para avaliar os efeitos deste acordo utilizamos um modelo de alocação espacial apresentado como um Problema de Complementaridade Mista (PCM. Como resultado, o presente estudo identifica as variações no Excedente do Produtor (EP nos cenários Mercosul-UE e Mercosul-UE ampliada considerando a eliminação das barreiras tarifárias e/ou subsídios. Em termos gerais, os maiores ganhos para os produtores de grãos dos países do Mercosul ocorrem no cenário Mercosul-UE com eliminação dos subsídios por parte dos países da UE. No entanto, salienta-se que, embora os ganhos totais para os países do Mercosul sejam positivos, o setor tritícola apresenta perdas significativas neste cenário.This study aims to measure the effects of an agreement between Mercosur and the European Union (EU on production, consumption and trade flows of rice, maize, soybeans and wheat in several regions. To estimate the effects of this agreement we used a spatial allo-cation model presented as a Mixed Complementarity Problem. As a result, we identify the variations in Producer's Surplus for the scenarios Mercosur-EU and Mercosur-extended EU, considering the elimination of tariff barriers and/or subsidies. In general, the highest gains for grain producers in the Mercosur countries happen in the Mercosur-EU scenario with the elimination of subsidies by the European countries. However, we emphasize that total gains for the Mercosur countries are positive, but the wheat sector shows significant losses in this scenario.

  4. Transtorno afetivo bipolar: perfil farmacoterapêutico e adesão ao medicamento

    Directory of Open Access Journals (Sweden)

    Adriana Inocenti Miasso

    2012-06-01

    Full Text Available Este estudo teve como objetivos verificar a adesão de portadores de transtorno afetivo bipolar (TAB à terapêutica medicamentosa e identificar possíveis causas de adesão e não adesão ao medicamento de acordo com o perfil farmacoterapêutico. Trata-se de estudo transversal, descritivo, realizado em Núcleo de Saúde Mental de um município do interior paulista. Participaram do estudo 101 pacientes com TAB. Para coleta dos dados, utilizou-se a entrevista estruturada e o teste de Morisky-Green e, para a análise dos mesmos, o programa Statistical Package for the Social Science. Os resultados mostraram que a maioria (63% dos sujeitos investigados não adere ao medicamento. Apesar de não ter ocorrido diferenças significativas entre o grupo de aderentes e não aderentes, para as variáveis investigadas, foi possível verificar a utilização de polifarmacoterapia e regimes terapêuticos complexos no tratamento do TAB. Permanece como desafio a implementação de estratégias que possam melhorar, na prática, a adesão de pacientes ao tratamento medicamentoso.

  5. AoS28D, a proline-Xaa carboxypeptidase secreted by Aspergillus oryzae.

    Science.gov (United States)

    Salamin, Karine; Eugster, Philippe J; Jousson, Olivier; Waridel, Patrice; Grouzmann, Eric; Monod, Michel

    2017-05-01

    Prolyl peptidases of the MEROPS S28 family are of particular interest because they are key enzymes in the digestion of proline-rich peptides. A BLAST analysis of the Aspergillus oryzae genome revealed sequences coding for four proteases of the S28 family. Three of these proteases, AoS28A, AoS28B, and AoS28C, were previously characterized as acidic prolyl endopeptidases. The fourth protease, AoS28D, showed high sequence divergence with other S28 proteases and belongs to a phylogenetically distinct cluster together with orthologous proteases from other Aspergillus species. The objective of the present paper was to characterize AoS28D protease in terms of substrate specificity and activity. AoS28D produced by gene overexpression in A. oryzae and in Pichia pastoris was a 70-kDa glycoprotein with a 10-kDa sugar moiety. In contrast with other S28 proteases, AoS28D did not hydrolyze internal Pro-Xaa bonds of several tested peptides. Similarly, to human lysosomal Pro-Xaa carboxypeptidase, AoS28D demonstrated selectivity for cleaving C-terminal Pro-Xaa bonds which are resistant to carboxypeptidases of the S10 family concomitantly secreted by A. oryzae. Therefore, AoS28D could act in synergy with these enzymes during sequential degradation of a peptide from its C-terminus.

  6. As consequências dos acordos de livre comércio sobre o setor de lácteos no Brasil

    Directory of Open Access Journals (Sweden)

    Augusto Mussi Alvim

    2010-06-01

    Full Text Available Este artigo analisa os principais efeitos dos acordos de livre comércio sobre o setor de lácteos no Brasil. Utiliza-se um modelo de equilíbrio parcial formulado como um Problema de Complementaridade Mista (MCP na sigla em inglês para avaliar mudanças (ganhos e perdas potenciais em termos de produção, consumo e comércio em cada cenário. Tal modelo considera multirregiões e multiprodutos, o que permite analisar os impactos de políticas de livre comércio para diferentes regiões e diversos produtos lácteos.This paper discusses the main effects of free trade agreements on the dairy sector in Brazil. A partial equilibrium model formulated as a Mixed Complementary Problem (MCP is used to provide some numerical examples of changes (potential gain and losses in terms of production, trade and welfare in each scenario. This model also considers a multiregional and a multi-product dimension, which permits to analyze the impact of trade liberalization upon different regions and diverse processed dairy products.

  7. REALIDADE AUMENTADA APLICADA AO DESIGN

    Directory of Open Access Journals (Sweden)

    Bruno Chagas Alves Fernandes

    2008-07-01

    Full Text Available Este artigo apresenta o atual estado da arte da Realidade Aumentada aplicada ao design. São apresentados exemplos de aplicações da Realidade Aumentada em áreas como design de produtos, arquitetura, indústria automotiva, educação e design colaborativo. Também é apresentada uma rápida visão geral sobre as tecnologias envolvidas na criação de aplicações de Realidade Aumentada.

  8. O sindicalismo mineiro frente aos desafios dos anos 90

    Directory of Open Access Journals (Sweden)

    Antônio Carvalho Neto

    2000-12-01

    Full Text Available O que se analisa neste artigo é como os sindicatos dos bancários, metalúrgicos e trabalhadores em telecomunicações têm negociado o (desemprego, a demanda por qualificação e a remuneração variável. Foram tabuladas/analisadas 3.569 cláusulas de acordos coletivos, e realizadas 26 entrevistas com dirigentes sindicais e empresariais em três Estados (RJ, SP e MG. Os resultados indicam que as mudanças organizacionais foram incomparavelmente mais negociadas no setor metalúrgico do ABC. A flexibilização da jornada foi trocada pela redução (da jornada sem redução de salário nos setores metalúrgicos paulistas, mas não em Minas Gerais. No setor bancário, houve poucos resultados nas negociações sobre jornada. As negociações em torno da remuneração variável vinculada às metas das empresas aconteceram nos setores metalúrgicos, e não nos setores de serviços. As entrevistas apontam para um sindicalismo mais propositivo, no sentido de uma intervenção negociada, predisposição que não é correspondida pelos empresários, grosso modo. O Estado, que poderia utilizar seu poder regulador para induzir os empresários a negociarem nessa direção não tem produzido resultados satisfatórios. Conclui-se que não há maturidade empresarial no Brasil que permita ao Estado ausentar-se das relações de trabalho.

  9. Como responder ao momento presente?

    Directory of Open Access Journals (Sweden)

    Maria Filomena Molder

    2013-12-01

    Full Text Available http://dx.doi.org/10.5007/1984-784X.2013v13n19p13 Foi com esta pergunta — já um efeito de um primeiro encontro entre Irene Pimentel e eu própria — que decidimos desafiar colegas, estudantes e funci­onários da nossa Faculdade, FCSH (Faculdade de Ciências Sociais e Huma­nas, de outras Faculdades da Universidade Nova de Lisboa, de outras Uni­versidades e todos os interessados em con­siderar e discutir em comum aquilo que se passava em Portugal e que no anúncio da Jornada de 6 de De­zembro de 2012 se descrevia como um “processo de desmantela­mento social, económico e cultural sem precedentes — pese embora tantas compara­ções, baseadas na premissa da ‘eterna repetição’ — e cujas consequências não param de exceder as previsões dos responsáveis por esse desmantelamento”. Acedendo com todo o empenho e gratidão ao convite que me foi dirigido por Humberto Brito para fazer uma resenha da Jornada a publicar no primeiro número de Forma de Vida (saúdo a revista e o título, decidi-me, no entanto, a pôr de lado a resenha, que sob a forma de “Editorial” será em breve publi­cada no blogue Responder ao Momento Presente, entre­tanto criado, conjuntamente com os textos escritos pelos nossos convidados, com as parti­cipações de pessoas que corresponderam ao nosso apelo e ainda com contri­bui­ções que se alargaram para lá da Jornada; a que se juntará uma gravação em video, também disponível no Youtube.   Texto publicado originalmente em Forma de Vida, Lisboa, n.1, fev. 2013. Agrade­cemos à autora por permitir a republicação neste número do Boletim. [N.E.

  10. Como responder ao momento presente?

    Directory of Open Access Journals (Sweden)

    Maria Filomena Molder

    2013-06-01

    Full Text Available Foi com esta pergunta — já um efeito de um primeiro encontro entre Irene Pimentel e eu própria — que decidimos desafiar colegas, estudantes e funci­onários da nossa Faculdade, FCSH (Faculdade de Ciências Sociais e Huma­nas, de outras Faculdades da Universidade Nova de Lisboa, de outras Uni­versidades e todos os interessados em con­siderar e discutir em comum aquilo que se passava em Portugal e que no anúncio da Jornada de 6 de De­zembro de 2012 se descrevia como um “processo de desmantela­mento social, económico e cultural sem precedentes — pese embora tantas compara­ções, baseadas na premissa da ‘eterna repetição’ — e cujas consequências não param de exceder as previsões dos responsáveis por esse desmantelamento”. Acedendo com todo o empenho e gratidão ao convite que me foi dirigido por Humberto Brito para fazer uma resenha da Jornada a publicar no primeiro número de Forma de Vida (saúdo a revista e o título, decidi-me, no entanto, a pôr de lado a resenha, que sob a forma de “Editorial” será em breve publi­cada no blogue Responder ao Momento Presente, entre­tanto criado, conjuntamente com os textos escritos pelos nossos convidados, com as parti­cipações de pessoas que corresponderam ao nosso apelo e ainda com contri­bui­ções que se alargaram para lá da Jornada; a que se juntará uma gravação em video, também disponível no Youtube. Texto publicado originalmente em Forma de Vida, Lisboa, n.1, fev. 2013. Agrade­cemos à autora por permitir a republicação neste número do Boletim. [N.E.

  11. Aerosol Observing System (AOS) Handbook

    Energy Technology Data Exchange (ETDEWEB)

    Jefferson, A

    2011-01-17

    The Aerosol Observing System (AOS) is a suite of in situ surface measurements of aerosol optical and cloud-forming properties. The instruments measure aerosol properties that influence the earth’s radiative balance. The primary optical measurements are those of the aerosol scattering and absorption coefficients as a function of particle size and radiation wavelength and cloud condensation nuclei (CCN) measurements as a function of percent supersaturation. Additional measurements include those of the particle number concentration and scattering hygroscopic growth. Aerosol optical measurements are useful for calculating parameters used in radiative forcing calculations such as the aerosol single-scattering albedo, asymmetry parameter, mass scattering efficiency, and hygroscopic growth. CCN measurements are important in cloud microphysical models to predict droplet formation.

  12. Adesão ao tratamento medicamentoso em pacientes do espectro esquizofrênico: uma revisão sistemática da literatura

    OpenAIRE

    Silva,Tatiana Fernandes Carpinteiro da; Lovisi, Giovanni Marcos; Verdolin, Louise Deluiz; Cavalcanti, Maria Tavares

    2012-01-01

    OBJETIVO: Realizar revisão sistemática para avaliar a adesão medicamentosa ao tratamento em pacientes do espectro esquizofrênico. MÉTODO: As buscas dos artigos foram conduzidas nas seguintes bases de dados: PubMed/Medline, Lilacs, SciELO e PePSIC, considerando artigos publicados entre 2001 e 2010. Na estratégia de busca, foram utilizados descritores de acordo com sua definição no DeCS e no MeSH: "schizophrenia" and "patient adherence" or "patient compliance" or "medication adherence". As corr...

  13. Diagnosis of AOS: definition and criteria.

    Science.gov (United States)

    Croot, Karen

    2002-11-01

    Presented in this article is a discussion of current progress in behavioral, cognitive, and neuroanatomic definitions of apraxia of speech (AOS). A behavioral definition summarizes the speech symptoms that should be considered diagnostic of AOS with or without co-occurring aphasia and dysarthria. AOS is defined in cognitive terms as an impairment in the translation of phonological representations into specifications for articulation. Progress toward a neuroanatomic definition of AOS will rely on mapping the processes described by increasingly sophisticated cognitive models of normal speech production to the brain. The article describes criteria that have been proposed for differentiating apraxic from phonological and dysarthric disorders and suggests that syndrome-based approaches to the diagnosis of AOS may obscure important differences between individual presentations of apraxic disruption as well as similarities between AOS and other speech-language disorders.

  14. Características fenotípicas dos pacientes com anemia falciforme de acordo com os haplótipos do gene da βS-globina em Fortaleza, Ceará

    Directory of Open Access Journals (Sweden)

    Lilianne B. Silva

    2010-02-01

    Full Text Available Foram analisados 47 pacientes com diagnóstico clínico, laboratorial e molecular de anemia falciforme, residentes em Fortaleza, Ceará, com a finalidade de fornecer informações sobre a influência dos haplótipos do gene da βS- globina nas características fenotípicas desta doença. A determinação dos valores hematológicos foi realizada em contador automático de células sanguíneas, e os níveis de HbF foram determinados pela técnica da desnaturação alcalina. O DNA foi isolado de leucócitos, a partir de amostras de sangue total. A análise dos haplótipos da mutação βS foi realizada por PCR-RFLP (Polymerase Chain Reaction-Restriction Fragment Lenght Polymorphism, sendo analisados seis sítios polimórficos de restrição. Os pacientes foram divididos em cinco grupos, de acordo com o tipo de haplótipo: Bantu/Bantu, Benin/Benin, Bantu/Benin, Bantu/Atípico e Benin/Atípico. O nível de significância considerado nas análises foi p<0,05. Na comparação entre os haplótipos e as características hematológicas estudadas, apenas os valores de HbF e Ht apresentaram diferença estatisticamente significativa. Os níveis de HbF foram maiores no haplótipo Benin, seguido do haplótipo Bantu, o que está em conformidade com os dados da literatura. Foram demonstrados maior presença de crises vaso-oclusivas e episódios de pneumonia no haplótipo Benin/Atípico do que no haplótipo Bantu/Atípico; e maior presença de crises de infecção urinária no haplótipo Benin/Atípico do que no haplótipo Benin/Benin. Não houve diferença estatisticamente significativa entre os haplótipos Bantu/Bantu e Benin/Benin em relação às complicações clínicas; entretanto, foi observado que o haplótipo Bantu/Bantu tem uma maior frequência em todos os eventos clínicos estudados quando comparado ao Benin/Benin. Os resultados demonstram que o tipo de haplótipo do gene da βS-globina influencia as características fenotípicas dos pacientes com

  15. Resposta fisiológica de sementes de palmeiras ao envelhecimento acelerado

    Directory of Open Access Journals (Sweden)

    Negreiros Gisele de Freitas

    2004-01-01

    Full Text Available O objetivo deste trabalho foi avaliar a qualidade fisiológica de sementes de quatro espécies da família Palmae submetidas ao envelhecimento acelerado. Sementes recém-colhidas de cada uma das espécies foram expostas às condições de envelhecimento acelerado em câmara a 45ºC e 100% de UR, durante os períodos de 0 (controle, 12, 24, 36 e 48 horas. Sementes de Euterpe edulis e Dypsis lutescens foram sensíveis ao tratamento, sendo a germinação totalmente suprimida após 12 horas de permanência na câmara. As espécies Roystonea oleracea e Phoenix reclinata apresentaram sementes mais resistentes que as outras espécies, mas redução gradativa do vigor, de acordo com o aumento do período de exposição às condições de envelhecimento; o período de 48 horas foi crítico para determinados parâmetros de vigor avaliados.

  16. Diagnóstico das condições higiênicas de serviços de alimentação de acordo com a NBR 15635:2008 Diagnosis of the hygienic conditions of food services in accordance with NBR 15635:2008

    Directory of Open Access Journals (Sweden)

    Laissa Benites Medeiros

    2012-05-01

    Full Text Available O objetivo deste estudo foi avaliar as condições higiênicas de serviços de alimentação de acordo com a Normativa Brasileira NBR 15635:2008. Foram avaliados 23 serviços de alimentação do município de Santa Maria-RS durante os meses de julho e agosto de 2011. Como critérios de inclusão da pesquisa, foram utilizados os serviços de alimentação comerciais do bairro Centro da cidade de Santa Maria-RS registrados na Vigilância Sanitária e que apresentaram os alvarás sanitários 2009 e 2010 atualizados. O instrumento de coleta de dados foi uma lista de verificação em boas práticas elaborada a partir da Normativa Brasileira para serviços de alimentação. Os resultados demonstraram que somente 4% (n = 1 dos serviços de alimentação avaliados foram classificados no grupo I (Bom, sendo que 70% (n = 16 foram classificados no grupo II (Regular e 26% (n = 6 foram classificados no grupo III (Deficiente. Pode-se concluir que a maioria dos estabelecimentos avaliados de acordo com a normativa utilizada encontra-se classificada nos grupos regular e ruim, não atendendo, assim, aos requisitos da Normativa.The objective of this study was to evaluate the hygienic conditions of food service in accordance to the Brazilian Normative NBR 15635:2008. We evaluated 23 food services in the city of Santa Maria (RS during the months of July and August in the year of 2011. As an inclusion criteria of the research, the food service business from the district of Santa Maria (RS registered in the Surveillance of health that have the license in 2009 and updated in 2010 were used. The data collection instrument was a checklist in the good practices drawn from the Brazilian Normative for foodservices. The results showed that only 4% (n = 1 from the food services were evaluated in group I (good, 70% (n = 16 were classified in Group II (Regular and 26% (n = 6 were classified in Group III (Bad. It can be concluded that the majority of the evaluated establishments

  17. Direito e Risco: do Consumo ao Ambiente

    OpenAIRE

    Marques, Carlos Alexandre Michaello

    2014-01-01

    A presente Dissertação tem como tema de investigação “Direito e Risco: do Consumo ao Ambiente”. Para tanto, essa temática foi delimitada através da investigação sobre a capacidade do Direito a partir de uma leitura Sociológica e Antropológica de compreender e promover aprendizagem nas questões que envolvem o Risco como elemento decorrente do Consumo e que externa suas consequências ao Ambiente. Neste sentido, se direcionou a responder ao problema de saber: em que medida é possível e necessári...

  18. Microbiota cérvico-vaginal de ovelhas mestiças e sua susceptibilidade aos antibióticos

    Directory of Open Access Journals (Sweden)

    Valdenice F. Silva

    2011-07-01

    Full Text Available A criação de ovinos tem se desenvolvido nas últimas décadas, entretanto ainda são escassas informações sobre a composição e potencial patogênico da microbiota cérvico-vaginal de ovelhas. O presente estudo teve como objetivo conhecer os microrganismos constituintes da microbiota cérvico-vaginal de ovelhas, bem como sua susceptibilidade aos antimicrobianos. Foram realizadas coletas em 60 animais sadios, pertencentes a rebanhos de Petrolina e região. Foi realizado o isolamento bacteriano em ágar sangue e ágar MacConkey, sendo os microrganismos identificados de acordo com características morfológicas, tintoriais e bioquímicas. As amostras foram submetidas ao teste de difusão em disco para determinar o perfil de sensibilidade aos antimicrobianos: sulfametazina, enrofloxacina, doxiciclina, tetraciclina, penicilina, amoxicilina, cefalotina e lincomicina. Foram obtidos 94 isolados, sendo constatada uma maior frequência de Staphylococcus spp. (32,97%, Escherichia coli e Micrococcus spp., sendo observado ainda, isolados de Acinetobacter spp., Shigella spp., Enterobacter spp., Klebsiella spp. e Streptococcus spp. Os isolados apresentaram alta sensibilidade aos antimicrobianos testados sendo observado o menor percentual de sensibilidade para lincomicina. A presença de microrganismos oportunistas de potencial patogênico, na microbiota, como Staphylococcus spp e Escherichia coli, remete a uma análise criteriosa em relação ao diagnóstico de infecções genitais. Os isolados bacterianos obtidos neste estudo são sensíveis à maioria dos grupos de drogas antimicrobianas testadas, demonstrando o potencial de utilização desses princípios ativos, além da disponibilidade de escolha, visto a ausência de multirresistência.

  19. Customer satisfaction and response to AOS

    Science.gov (United States)

    1999-01-01

    Passenger surveys were conducted in each of three successive springs in order to track passenger perception of changes in service quality during AOS implementation. In general, no improvement in passenger perceptions was observed relative to a high b...

  20. Standard Triaxial Ellipsoid Asteroids from AO Observations

    Science.gov (United States)

    Drummond, Jack D.; Merline, W. J.; Conrad, A.; Dumas, C.; Carry, B.

    2008-09-01

    As part of our study of resolved asteroids using adaptive optics (AO) on large telescopes (>8; m), we have identified several that can serve as Standard Triaxial Ellipsoid Asteroids (STEAs), suitable for radar and thermo-physical calibration. These objects are modeled well as triaxial ellipsoids, having: 1) small uncertainties on their three dimensions as determined with AO; 2) rotational poles well determined from both lightcurves and AO; and 3) good sidereal periods from lightcurves. Although AO allows the opportunity to find an asteroid's dimensions and rotational pole in one night, we have developed a method to combine AO observations from different oppositions to pool into a global solution. The apparent orientation and sizes of STEAs can be predicted to within a few degrees and a few km over decades. Currently, we consider 511 Davida, 52 Europa, 2 Pallas, and 15 Eunomia as STEAs. Asteroids that are not well modeled as ellipsoids, clearly showing departures from ellipsoid figures in AO images, include 129 Antigone and 41 Daphne. We will show movies of images and models of these asteroids.

  1. Avaliação da resistência ao cisalhamento de braquetes da técnica lingual colados sobre superfície cerâmica

    OpenAIRE

    Imakami,Michele Balestrin; Valle-Corotti,Karyna Martins; Carvalho,Paulo Eduardo Guedes; Scocate,Ana Carla Raphaelli Nahás

    2011-01-01

    OBJETIVO: avaliar a resistência ao cisalhamento de braquetes metálicos (American Orthodontics) utilizados na técnica lingual, colados em facetas de cerâmica. MÉTODOS: foram utilizados 40 corpos de prova divididos em quatro grupos de 10, de acordo com o material de colagem e do preparo da porcelana: Grupo I -resina Sondhi Rapid-Set e ácido fluorídrico; Grupo II -resina Sondhi Rapid-Set e óxido de alumínio; Grupo III -resina Transbond XT e ácido fluorídrico; e Grupo IV -resina Transbond XT e óx...

  2. Promoção de estratégias de estudo: contributos do Serviço de Apoio ao Estudante (SAPE) do Instituto Politécnico de Leiria (IPL)

    OpenAIRE

    Seco, Graça Maria dos Santos Batista; Pereira, Ana Patrícia; Santos, Irene Cristiana; Filipe, Luís Pereira; Alves, Sandra

    2008-01-01

    No âmbito do apoio psicopedagógico desenvolvido pelo Serviço de Apoio ao Estudante (SAPE) do IPL (implementado através do projecto "Trajectos com sucesso no IPL", financiado pelo POCI 2010), têm vindo a ser dinamizados alguns programas de formação destinados a todos os seus estudantes. Sendo que o ano lectivo 2007/2008 constitui um marco importante na transição das metodologias de ensino-aprendizagem, de acordo com o processo de Bolonha, considerámos da maior relevância e utilidade promover a...

  3. Resistência ao choque da madeira de Platanus x acerifolia em diferentes condições de umidade

    Directory of Open Access Journals (Sweden)

    Rafael Beltrame

    2013-08-01

    Full Text Available Este estudo teve como objetivo avaliar a resistência ao choque da madeira de plátano (Platanus x acerifolia (Airton Willd. ensaiada em condições de equilíbrio a 12% de umidade e ao PSF. Para tanto, foram utilizadas árvores procedentes de duas regiões fisiográficas do Estado do Rio Grande do Sul. Os corpos-de-prova foram submetidos ao choque utilizando pêndulo de CHARPY e avaliados quanto à resistência oferecida com a aplicação da carga nos planos tangencial e radial e posições de retirada (medula-casca nas toras, nas duas regiões fisiográficas e em cada condição de umidade, de acordo com a Norma NF B51-009 (AFN, 1942. Para auxiliar na interpretação dos dados, determinou-se a massa específica aparente a 12% e saturada, teor de umidade, trabalho absorvido, coeficiente de resiliência e cota dinâmica. Dessa maneira, pôde-se verificar, por meio dos resultados, que a madeira de plátano é mais resistente ao choque na condição de madeira saturada (PSF quando comparada com a condição a 12% de umidade. Todavia, os resultados do estudo indicaram que a madeira de plátano não é recomendada para usos que dependem de sua capacidade de absorver energia e dissipá-la.

  4. Delivery assistance in fetal macrosomia Assistência ao parto na macrossomia fetal

    Directory of Open Access Journals (Sweden)

    Renato Augusto Moreira de Sá

    2003-12-01

    Full Text Available OBJECTIVES: to evaluate delivery assistance in fetal macrosomia. METHODS: this was a hospital-based cohort study of consecutive births at a tertiary perinatal center from January 1, 1996 to October 31, 1999. A total of 5261 pregnancies met the inclusion criteria which were singleton pregnancies with minimal birth weight of 1000 g. Fetal macrosomia was defined as birth weight of 4000 g or more. We studied the mode of delivery, the newborn condition at birth, considered low when the Apgar scored below seven in the first or fifth minute, and the presence of abnormalities that could indicate a Caesarian section (disproportion, uterine dysfunction, prolonged second period of birth and fetal distress. RESULTS: 296 (5,6% of the babies were macrosomic. Macrosomia was a risk factor for Caesarian section (RR = 1,59, p OBJETIVOS: avaliar a assistência ao parto na macrossomia fetal. MÉTODOS: Estudo do tipo coorte realizado em centro perinatal terciário no período de 1 de janeiro de 1996 a 31 de outubro de 1999. Foram selecionadas 5261 gestações de acordo com os critérios de inclusão, que foram: gestação única e peso mínimo ao nascimento de 1000 g. A macrossomia fetal foi definida como peso ao nascimento acima de 4000 g. Estudamos a via de parto, as condições ao nascimento, Apgar baixo quando inferior a sete no primeiro e quinto minutos e as anormalidades que serviram de indicação para cesariana (desproporção, distocia uterina, segundo período prolongado e sofrimento fetal. RESULTADOS: 296 (5,6% dos conceptos eram macrossômicos. Macrossomia foi fator de risco para cesariana (RR = 1,59, p <0,001 e para parto operatório vaginal (RR = 1,12 p <0,001. As condições do recém-nascido não foram piores nos fetos macrossômicos. Houve correlação positiva entre macrossomia fetal e desproporção mas não para distocia uterina, prolongamento do segundo período ou sofrimento fetal. CONCLUSÕES: Houve maior número de indicações de cesariana

  5. Audiometria de resposta evocada de acordo com sexo e idade: achados e aplicabilidade Evoked response audiometry according to gender and age: findings and usefulness

    Directory of Open Access Journals (Sweden)

    Edmir Américo Lourenço

    2008-08-01

    Full Text Available A audiometria de respostas evocadas (ABR é um registro não-invasivo de potenciais elétricos auditivos nos primeiros 12 milissegundos, da orelha média ao córtex auditivo. ABR é importante na avaliação otoneurológica. OBJETIVO: Esclarecer as utilidades do exame, faixas etárias e sexo com maior incidência e topodiagnóstico segundo as latências absolutas e os intervalos interpicos. CASUÍSTICA E MÉTODO: Neste estudo retrospectivo foram analisados 403 prontuários de ABR realizados em clínica particular na cidade de Jundiaí/SP, Brasil, suspeitos de alteração auditiva e/ou doença do SNC, com os pacientes divididos por sexo e faixa etária. RESULTADOS E CONCLUSÕES: ABR é um importante exame para determinar a integridade da via auditiva, limiares eletrofisiológicos e topodiagnóstico, embora o teste não indique a etiologia das alterações. Foi demonstrado que ocorreu maior incidência de achados retrococleares na faixa etária de 12-20 anos e sexo masculino, contudo crianças menores de um ano com fatores de risco não apresentaram um aumento na incidência de alterações condutivas, cocleares e retrococleares em relação à população geral estudada. As latências absolutas das ondas I, III e V foram maiores no sexo masculino e as alterações dos intervalos interpicos foram similares em ambos os sexos, sendo que o intervalo I-III foi o mais freqüentemente alterado.Auditory evoked brainstem responses (ABR is a non-invasive electrical potential registration which evaluates the auditory tract from the middle ear to the auditory cortex in the first 12 milliseconds (ms. The ABR is an important otoneurological evaluation. AIM: confirm the test's usefulness, major incidence and topography according to are range gender considering the absolute latencies of the waves and interpeak intervals. MATERIALS AND METHOD: we retrospectively analyzed 403 tests from a private clinic in the city of Jundiaí-São Paulo State-Brazil, from

  6. Gorgonids from Curaçao Island

    NARCIS (Netherlands)

    Gordon, Isabella

    1925-01-01

    This report contains an account of a collection of Gorgonids made by Dr. C. J. VAN DER HORST at the island of Curaçao and also of a few specimens collected in the same locality by Ir. G. J. H. MOLENGRAAFF. The Majority of the specimens are taken from Caracas bay at a depth of not more than five

  7. Estados Unidos: do Iraque ao Brasil

    Directory of Open Access Journals (Sweden)

    Virgílio Caixeta Arraes

    2010-12-01

    Full Text Available O presente artigo busca analisar os recentes temas recorrentes na política externa norte-americana, caracterizada pela “guerra contra o terror”, e seus impactos para a agenda a ser discutida na vindoura visita do presidente dos Estados Unidos, Geoge W. Bush, ao Brasil.

  8. AoB PLANTS: origins and features.

    Science.gov (United States)

    Jackson, Michael B

    2009-01-01

    AoB PLANTS is a peer reviewed, Open Access (OA) journal owned and run by plant biologists and published by Oxford University Press. The journal publishes research papers, reviews and opinion papers on all aspects of land based plant biology. They are made available rapidly online and can be accessed without the need for subscriptions or payment. Several difficulties in conventional publishing of peer-reviewed manuscripts encouraged AoB PLANTS to adopt OA. Open Access helps sidestep library budgets which are struggling to purchase the increasing numbers of journals. Open Access makes research freely available both to the academic community and beyond while publishing online only eliminates the need to reject good manuscripts simply to control the size of the printed journal. Finally, the journal chose to go OA to ensure the widest possible international readership for the growing amount of high-quality plant science research being carried out worldwide in response to problems such as climate change and food shortages. Responses to a wide-ranging online questionnaire indicated strong international support for a journal such as AoB PLANTS. AoB PLANTS strives for fair and rapid peer review followed by fast publication of accepted papers. For an initial period, there will be no OA fees, and fees will remain modest once introduced. AoB PLANTS adopts double-blind peer review using published criteria for acceptability as a basis for decision-making. Accepted papers are published shortly after acceptance together with referees' analyses using Stanford University Libraries High Wire Press H2O platform. Authors retain ownership of the copyright in their papers.

  9. Avaliação do envelhecimento facial relacionado ao tabagismo

    Directory of Open Access Journals (Sweden)

    Suehara Letícia Yumi

    2006-01-01

    Full Text Available FUNDAMENTOS: O tabagismo é responsável por diversas doenças crônicas e pelo envelhecimento da pele. OBJETIVO: Comparar a pele facial de fumantes e não fumantes. MÉTODOS: Foram avaliados 77 pacientes, 43 não tabagistas e 34 tabagistas, entre 40 e 60 anos, excluídos aqueles com exposição solar excessiva, etilistas e submetidos a tratamento estético da face. As alterações faciais foram avaliadas com base em escore de características da pele da face descrita por Model (fácies de tabagismo. Os indivíduos tabagistas e não tabagistas foram avaliados de acordo com o tempo e a quantidade de cigarros fumados, o sexo, a cor da pele e a idade. RESULTADOS: A comparação quanto ao escore da fácies de tabagismo evidenciou que o grupo tabagista apresentou maior escore que o grupo não tabagista (p=0,021. Foram observadas diferenças significativas de escore na comparação entre as faixas etárias (p=0,004 e a cor (p <0,01. Em relação à quantidade de cigarros fumados e o tempo desse hábito de acordo com sexo não houve diferenças de escore. A análise multivariada das variáveis, evidenciou que o tabagismo, Odds Ratio (OR = 3,49, a cor da pele (OR=8,10 e a idade (OR=1,21 são fatores independentes para o envelhecimento facial. CONCLUSÃO: O tabagismo é fator de risco independente para o envelhecimento cutâneo. Esse achado confirma os efeitos cutâneos nocivos do cigarro, constituindo-se em mais um argumento na luta contra o tabagismo.

  10. Sensibilidade da rosa 'Osiana' ao etileno

    OpenAIRE

    Delaine Cristina Cordeiro; Fernando Luiz Finger; Joice Simone dos Santos; Juliane Karsten; José Geraldo Barbosa

    2011-01-01

    Os objetivos deste trabalho foram determinar a sensibilidade e as respostas da rosa cultivar Osiana (Rosa × hybrida) à presença de etileno ao longo da vida pós-colheita. Para determinar a sensibilidade da flor ao etileno, hastes foram cortadas e colocadas em câmaras herméticas e em seguida tratadas por 24 horas com diferentes concentrações de etileno variando de 0,0; 0,1; 1,0; 10; 100 e 1000 µL L-1do ar no interior da câmara. A rosa teve a vida pós-colheita reduzida pelo etileno, quando expos...

  11. Sensibilidade da rosa 'Osiana' ao etileno

    Directory of Open Access Journals (Sweden)

    Delaine Cristina Cordeiro

    2011-01-01

    Full Text Available Os objetivos deste trabalho foram determinar a sensibilidade e as respostas da rosa cultivar Osiana (Rosa × hybrida à presença de etileno ao longo da vida pós-colheita. Para determinar a sensibilidade da flor ao etileno, hastes foram cortadas e colocadas em câmaras herméticas e em seguida tratadas por 24 horas com diferentes concentrações de etileno variando de 0,0; 0,1; 1,0; 10; 100 e 1000 µL L-1do ar no interior da câmara. A rosa teve a vida pós-colheita reduzida pelo etileno, quando exposta a concentração igual ou superior a 10 µL L-1 de etileno. As flores tratadas com no mínimo de 10 µL L-1de etileno desenvolveram necrose, murcha e abscisão prematura das pétalas ainda túrgidas. As concentrações de 0,1 e 1,0 µL L-1de etileno estimularam a abertura do botão floral durante o período de 24 horas de exposição ao etileno, sem no entanto, reduzir a vida pós-colheita. A rosa 'Osiana' pode ser classificada como uma cultivar sensível ao etileno e a concentração influência os processos estimulados.

  12. ECOPERSONALISMO E DIREITO AO MEIO AMBIENTE

    Directory of Open Access Journals (Sweden)

    Jesús Ballesteros

    2008-04-01

    Full Text Available O objetivo do presente artigo consiste em refletir brevemente sobre as conseqüências, no âmbito do direito ao meio ambiente, das diferentes concepções sobre a relação entre o ser humano e a natureza, isto é, o modelo tecnocrático, o biologista e o ecológico-personalista

  13. Antropometria, maturação sexual e idade da menarca de acordo com o nível socioeconômico de meninas escolares de Cascavel (PR Antropometry, sexual maturation and menarcheal age according to socioeconomic status of schoolgirls from Cascavel (PR

    Directory of Open Access Journals (Sweden)

    Everton Paulo Roman

    2009-01-01

    Full Text Available OBJETIVO: Avaliar a idade da menarca e a antropometria de meninas escolares de diferentes níveis socioeconômicos em Cascavel (Estado do Paraná -Região Sul do Brasil. MÉTODOS: Estudo transversal realizado no ano de 2006 com 2.761 meninas em 27 escolas públicas e particulares. A idade da menarca foi obtida pelo método status quo. Para a avaliação da maturação sexual foi realizada a autoavaliação de acordo com os critérios descritos por Tanner. O nível socioeconômico foi obtido por meio do questionário da ABEP (2003. Avaliou-se o peso e a estatura, obtendo-se o índice de massa corporal (IMC. Foram utilizados a análise estatística descritiva e o teste de Mann-Whitney, com nível de significância de 5%. RESULTADOS: A idade da menarca geral foi 12,2±1,2 anos e 12,1±1,1; 12,3±1,2 e 12,4±1,2 anos para os tercis alto, médio e baixo de nível socioeconômico, respectivamente. Foram constatados valores superiores para as meninas pós-menarca no peso e na estatura dos 10 aos 17 anos de idade e no IMC dos 11 aos 14 anos de idade. CONCLUSÕES: As meninas de nível socioeconômico alto apresentaram idade da menarca em idade inferior aos demais níveis socioeconômicos. Embora estas diferenças tenham sido observadas em níveis socioeconômicos distintos, biologicamente foram consideradas pequenas.OBJECTIVE: To evaluate age of menarche and anthropometric data of schoolgirls of different socioeconomic levels in Cascavel, state of Parana, in Southern Brazil. METHODS: A cross-sectional study was carried out in 2006 with 2,761 girls evaluated in 27 private and public schools. Age at menarche was obtained by the status quo method. Sexual maturity was assessed by self evaluation, according to Tanner's criteria. Socioeconomic level was obtained through the ABEP (2003 questionnaire. Data of weight, stature and Body Mass Index (BMI were obtained. Data were analyzed by descriptive statistics and Mann-Whitney test at 5% significance. RESULTS: Age

  14. Estado nutricional materno, ganho de peso gestacional e peso ao nascer Maternal nutritional status, gestational weight gain and birth weight

    Directory of Open Access Journals (Sweden)

    Adriana Suely de Oliveira Melo

    2007-06-01

    Full Text Available INTRODUÇÃO: Tanto o estado nutricional materno como o ganho de peso gestacional vem sendo estudado em relação ao papel determinante que desempenham sobre o crescimento fetal e o peso ao nascer. O peso inadequado ao nascer é uma das grandes preocupações da saúde pública devido ao aumento da morbimortalidade no primeiro ano de vida e ao maior risco de desenvolver doenças na vida adulta, tais como a síndrome metabólica, nos casos de baixo peso, e diabetes e obesidade, nos casos de macrossomia. O objetivo deste trabalho foi descrever uma coorte de gestantes, classificando-as de acordo com o estado nutricional inicial, o ganho ponderal gestacional, a resistência nas artérias uterinas e o peso dos recém-nascidos. MÉTODOS: foi acompanhada, a cada quatro semanas gestacionais, uma coorte de 115 gestantes atendidas pelo Programa de Saúde da Família do município de Campina Grande, PB. O estado nutricional inicial foi determinado através do índice de massa corporal (kg/m² para a idade gestacional, e as gestantes classificadas de acordo com os critérios de Atalah. Na 20ª semana, foi estudada a resistência das artérias uterinas, através da dopplervelocimetria. RESULTADOS: o estado nutricional inicial mostrou uma alta prevalência de sobrepeso e obesidade (27%, e uma prevalência significante de desnutrição (23%. Um alto percentual de gestantes ganhou peso excessivo tanto no segundo (44% como no terceiro trimestre (45%. A distribuição do peso ao nascer, indicou uma incidência de 10% de baixo peso e de 9% de macrossomia. Observou-se ainda, uma alta prevalência de incisuras nas artérias uterinas.INTRODUCTION: Maternal nutritional status and gestational weight gain have been addressed because of their importance to fetal growth and birth weight. Inadequate birth weight is a major concern to public health given it has been associated with increasing morbidity-mortality during the first year of life and with increased risks of

  15. Prednisona e meloxicam no tratamento de ratos submetidos ao trauma agudo da medula espinhal

    Directory of Open Access Journals (Sweden)

    Graciane Aiello

    2015-01-01

    Full Text Available O objetivo deste estudo foi investigar o efeito da prednisona e do meloxicam na terapia de ratos submetidos ao modelo experimental de trauma agudo da medula espinhal, induzida pelo cateter de Fogarty 2Fr, mediante a avaliação dos parâmetros de estresse oxidativo, dos testes neurológicos e do exame histopatológico da medula espinhal. Foram utilizados 90 ratos Wistar, distribuídos em seis grupos, denominados controle salina ou GCS (n=15, controle prednisona ou GCP (n=15, controle meloxicam ou GCM (n=15, trauma mais salina ou GTS (n=15, trauma mais prednisona ou GTP (n=15 e trauma mais meloxicam GTM (n=15. Cada grupo foi redistribuído em três subgrupos de igual número, de acordo com o tempo de tratamento no pós-operatório de 24h, 72h e sete dias. Todos os grupos foram submetidos à laminectomia e, nos grupos GTS, GTM e GTP, após a exposição da medula espinhal, foi realizado o trauma medular compressivo, utilizando o cateter de Fogarty 2Fr. Os grupos GCS e GTS foram tratados com solução salina, os GSM e GTM receberam meloxicam e os GSP e GTP prednisona, sendo administrados pela via intraperitoneal. Em todos os ratos, foram avaliados os parâmetros de estresse oxidativo, testes neurológicos e exame histopatológico da medula espinhal. Os animais dos grupos GTS, GTM e GTP, nos diferentes tempos (24h, 72h e sete dias, tiveram pontuação zero na escala de Basso, Beattie e Bresnahan (BBB; no plano inclinado, permaneceram com pontuação três e perderam a percepção da dor profunda. Os grupos GTM e GTP apresentaram menor atividade da catalase e de níveis de TBARS, quando comparado ao grupo GTS. Foi constatada degeneração Walleriana e necrose da substância cinzenta de intensidades variáveis, não apresentando diferença entre os grupos submetidos ao trauma. O meloxicam e a prednisona apresentam possível efeito antioxidante, mas não impedem a necrose e a degeneração Walleriana da medula espinhal de ratos.

  16. Fatores associados à violência obstétrica na assistência ao parto vaginal em uma maternidade de alta complexidade em Recife, Pernambuco

    OpenAIRE

    Andrade,Priscyla de Oliveira Nascimento; Silva,Jéssica Queiroz Pereira da; Diniz,Cinthia Martins Menino; Caminha,Maria de Fátima Costa

    2016-01-01

    Resumo Objetivos: analisar os fatores associados à violência obstétrica de acordo com as práticas não recomendadas na assistência ao parto vaginal em uma maternidade escola e de referência da Cidade do Recife. Métodos: estudo transversal, prospectivo, com 603 puérperas, realizado entre agosto a dezembro de 2014. Os dados sociodemográficos, clínicos e de acesso à assistência foram obtidos através dos prontuários e de entrevistas com as pacientes. A prevalência da violência obstétrica foi bas...

  17. Peso ao nascer e obesidade em crianças e adolescentes: uma revisão sistemática

    OpenAIRE

    Rossi,Camila Elizandra; Vasconcelos,Francisco de Assis Guedes de

    2010-01-01

    OBJETIVO: Verificar o nível de evidência científica e epidemiológica da hipótese de associação entre peso ao nascer e sobrepeso/obesidade na infância e na adolescência, a partir de revisão sistemática da literatura. MÉTODO: Foi realizada revisão sistemática nas bases MedLine/Pubmed, Scielo-Brasil e Lilacs. Adaptou-se a escala de Downs & Black para avaliar a qualidade metodológica dos catorze artigos selecionados. Os artigos foram classificados em duas categorias de análise, de acordo com ...

  18. Produção de apitoxina por abelhas Apis mellifera L. e seu efeito na expressão de genes relacionados ao estresse

    OpenAIRE

    Modanesi, Melina Stoian [UNESP

    2012-01-01

    Os objetivos do presente trabalho foram verificar o efeito do período (manhã e tarde) e tempo de colheita (30 e 60 minutos) na produção de veneno por abelhas Apis mellifera africanizadas e a influência desse manejo na expressão de genes relacionados ao estresse. Foram utilizadas cinco colméias de abelhas Apis mellifera L. As colheitas de veneno e abelhas ocorreram três vezes por semana (manhã às 09h00 e tarde às 14h00), em dias intercalados, de acordo com os seguintes tratamentos: T1: manhã/3...

  19. Fisica atomica e quantistica introduzione ai fondamenti sperimentali e teorici

    CERN Document Server

    Haken, Hermann

    1990-01-01

    Per un laurea in Fisica, ma anche per la formazione moderna e aggiornata di un chimico o di un ingegnere, una conoscenza approfondita della fisica degli atomi e dei quanti è diventata ormai indispensabile....

  20. ROBO-AO M DWARF MULTIPLICITY SURVEY

    Science.gov (United States)

    Lamman, Claire; Berta-Thompson, Zachory; Baranec, Christoph; Law, Nicholas; Schonhut, Jessica

    2018-01-01

    We analyzed over 7,000 observations from Robo-AO’s field M dwarf survey taken on the 2.1m Kitt Peak telescope. Results will help determine the multiplicity fraction of M dwarfs as a function of primary mass, which is a crucial step towards understanding their evolution and formation mechanics. Through its robotic, laser-guided, and automated system, the Robo-AO instrument has yielded the largest adaptive-optics M dwarf survey to date. I developed a graphical user interface to quickly analyze this data. Initial data analysis included assessing data quality, checking the result from Robo-AO’s automatic reduction pipeline, and determining existence as well as the relative position of companions through a visual inspection. This program can be applied to other datasets and was successfully tested by re-analyzing observations from a separate Robo-AO survey. Following the preliminary results from this data analysis tool, further observations were done with the Keck II telescope by using its NIRC2 imager to follow up on ten select targets for the existence and physical association of companions. After a conservative initial cut for quality, 356 companions were found within 4” of a primary star out of 2,746 high quality Robo-AO M dwarf observations, including four triple systems. We will present a preliminary estimate for the multiplicity rate of wide M dwarf companions after accounting for observation limitations and the completeness of our search. Future research will yield insights into low-mass stellar formation and provide a database of nearby M dwarf multiples that will potentially assist ongoing and future surveys for planets around these stars, such as the NASA TESS mission.

  1. Deformable mirror designs for extreme AO (XAO)

    Science.gov (United States)

    Cavaco, Jeffrey; Wirth, Allan

    2014-08-01

    One of the science missions for the next generation of extremely large ground based telescopes (30-42m apertures) is the imaging and spectroscopy of exoplanets. To achieve that goal an Adaptive Optics (AO) subsystem with a very large number of corrected modes is required. To provide contrast ratios in the range of 10-9 or better for a 42m telescope an AO system with 25,000 to 60,000 channels will be needed. This is approximately an order of magnitude beyond the current state of the art. Adaptive Optics Associates Xinetics has developed the Photonex Module Deformable Mirror (DM) technology specifically to address the needs of extreme AO for high contrast applications. A Photonex Module is a monolithic block of electrostrictive ceramic in which a high density of individually addressable actuators are formed by screen printing of electrodes and partial wire saw cutting of the ceramic. The printed electrode structures also allow all electrical connections to be made at the back surface of the module via flex circuits. Actuator spacings of 1mm or less have been achieved using this approach. The individual modules can be edge butted and bonded to achieve high actuator count. The largest DMs fabricated to date have 4096 actuators in a 64X64mm array. In this paper the engineering challenges in extending this technology by a factor of ten or more in actuator count will be discussed. A conceptual design for a DM suitable for XAO will be presented. Approaches for a support structure that will maintain the low spatial frequency surface figure of this large (~0.6m) DM and for the electrical interface to the tens of thousands of actuators will be discussed. Finally, performance estimates will be presented.

  2. Epidemiologia da tricomoniose e sensibilidade ao metronidazol

    OpenAIRE

    Alves, Maria José Gonçalves

    2006-01-01

    A Trichomonas vaginalis é o agente etiológico da tricomoniose, a doença sexualmente transmissível (DST) não viral mais comum no mundo. Actualmente é sabido que promove a transmissão do vírus do HIV, é causa de baixo peso em bebés, bem como de nascimentos prematuros, predispõe mulheres a doença inflamatória pélvica atípica, neoplasia cervical e infertilidade. Acresce ao problema o facto de serem usadas metodologias de diagnóstico com baixa sensibilidade e ainda o aumento de c...

  3. Esta é minha carta ao mundo

    Directory of Open Access Journals (Sweden)

    Fernanda Mourão

    2009-01-01

    Full Text Available A partir da primeira carta de Emily Dickinson (1830-1886 a Thomas Higginson, que então seria seu “preceptor” e interlocutor para sempre, este texto propõe uma leitura da obra da escritora norte-americana a partir do biografema da carta e da ideia de sua obra como “carta ao mundo” – conforme um de seus mais famosos poemas –, com todas as implicações trazidas pelo termo, e à luz das teorias de Roland Barthes, Maurice Blanchot e Silvina Rodrigues Lopes, entre outros.

  4. Hepatotoxicidade associada ao uso de esteroides anabolizantes

    OpenAIRE

    Mónica Brinquinho; Ana Andresa Sousa; Janine Resende; João Valente

    2017-01-01

    O consumo de esteroides androgénicos anabolizantes tem vindo a aumentar no meio desportivo amador, sendo de fácil acesso apesar de se tratarem de substâncias proibidas. Estão descritos múltiplos efeitos laterais, sendo a hepatotoxicidade uma das mais reportadas. Apresentam-se dois casos clínicos representativos da lesão hepática associada ao consumo de esteroides anabolizantes. Ambos evidenciaram morbilidade significativa, embora nenhum deles tenha evoluído para falência hepática. Os autores ...

  5. O TEMA DA JUSTIFICAÇÃO NAS CARTAS AOS ROMANOS E AOS GÂLATAS

    Directory of Open Access Journals (Sweden)

    James N. F. Alisson

    1990-01-01

    Full Text Available Uma das dificuldades para entender a doutrina de Paulo sobre a justificação é o fato de esse tema constar em escritos que retomam a exposição anteriormente apresentada em forma oral à comunidade cristã da Galácia e de Roma. Ele escreve aos destinatários com a finalidade de esclarecer assunto anteriormente explicado. É o que se vê nas referências ao quérigma que recordam o primeiro anúncio da salvação em Cristo, já comunicado aos destinatários em outra ocasião. O uso freqüente da fórmula "acaso não sabeis?" é indício do conhecimento que os destinatários têm sobre o assunto.

  6. Fatores associados ao elevado ganho ponderal e ao excesso de peso de lactentes

    OpenAIRE

    Morais, Caroline Neves de

    2015-01-01

    O excesso de peso e o ganho ponderal estão associados a um conjunto complexo de fatores que atuam desde a vida fetal. O presente estudo teve como objetivo verificar os fatores associados ao elevado ganho ponderal e ao excesso de peso de lactentes. Trata-se de um estudo realizado com dados secundários de uma pesquisa de corte transversal que envolveu 967 mães e lactentes do estado de Pernambuco. Na caracterização do estado nutricional utilizou-se o índice de massa corporal para ...

  7. AO Observations of Three Powerful Radio Galaxies

    Energy Technology Data Exchange (ETDEWEB)

    de Vries, W; van Bruegel, W; Quirrenbach, A

    2002-08-01

    The host galaxies of powerful radio sources are ideal laboratories to study active galactic nuclei (AGN). The galaxies themselves are among the most massive systems in the universe, and are believed to harbor supermassive black holes (SMBH). If large galaxies are formed in a hierarchical way by multiple merger events, radio galaxies at low redshift represent the end-products of this process. However, it is not clear why some of these massive ellipticals have associated radio emission, while others do not. Both are thought to contain SMBHs, with masses proportional to the total luminous mass in the bulge. It either implies every SMBH has recurrent radio-loud phases, and the radio-quiet galaxies happen to be in the ''low'' state, or that the radio galaxy nuclei are physically different from radio-quiet ones, i.e. by having a more massive SMBH for a given bulge mass. Here we present the first results from our adaptive optics imaging and spectroscopy pilot program on three nearby powerful radio galaxies. Initiating a larger, more systematic AO survey of radio galaxies (preferentially with Laser Guide Star equipped AO systems) has the potential of furthering our understanding of the physical properties of radio sources, their triggering, and their subsequent evolution.

  8. Nefrocalcinose associada ao uso de esteroide anabolizante

    Directory of Open Access Journals (Sweden)

    Weverton Machado Luchi

    2015-03-01

    Full Text Available Os esteroides anabolizantes têm sido usados como arma terapêutica em diversas condições clínicas. Entretanto, o uso abusivo e indiscriminado, associado a outros suplementos nutricionais, tem gerado efeitos adversos graves. Relato do caso: Sexo masculino, 21 anos, admitido com náuseas, astenia, hiporexia, cefaleia e hipertensão arterial. Exames no sangue evidenciaram Cr: 3,9 mg/dl U:100 mg/dl e Cálcio total 14 mg/dl. Ultrassonografia e biópsia renal compatíveis com nefrocalcinose. Houve melhora gradativa da função renal e da calcemia após hidratação vigorosa e furosemida. Entretanto, após 1 ano, persistiram depósitos renais de cálcio e relação córticomedular reduzida ao ultrassom e creatinina estável em 1,4 mg/dl. Casos anteriores evidenciaram necrose tubular aguda e nefrite intersticial com poucos depósitos de cálcio no interstício renal. Nesse caso, encontramos nefrocalcinose acentuada associada à nefroesclerose. O objetivo deste estudo é relatar a ocorrência de injúria renal aguda com nefrocalcinose associada ao uso de esteroide anabolizante e oferecer uma revisão do assunto.

  9. Escala de valores relativos ao trabalho : EVT

    Directory of Open Access Journals (Sweden)

    Porto Juliana Barreiros

    2003-01-01

    Full Text Available Na literatura internacional são encontradas várias escalas para medir valores relativos ao trabalho, porém a maioria apresenta problemas com relação à definição do conceito ou a falta de integração com os modelos teóricos sobre valores pessoais. No Brasil foram encontrados dois instrumentos, um não foi validado para a população brasileira e o outro foi validado para uma população de baixa escolaridade. Foi objetivo do presente estudo desenvolver e validar uma Escala de Valores relativos ao Trabalho. Para o desenvolvimento da EVT foi realizado um levantamento de instrumentos anteriores e foram entrevistados trabalhadores. Após a análise de juízes e validação semântica, o instrumento foi respondido por 394 pessoas. A análise fatorial apontou para quatro fatores: Realização no trabalho, Relações sociais, Prestígio e Estabilidade. O instrumento após validação é composto por 45 itens. Os resultados corroboraram o modelo teórico previsto e conclui-se que a escala foi devidamente estabelecida e pode ser utilizada para pesquisa e diagnóstico.

  10. Escala de valores relativos ao trabalho: EVT

    Directory of Open Access Journals (Sweden)

    Juliana Barreiros Porto

    Full Text Available Na literatura internacional são encontradas várias escalas para medir valores relativos ao trabalho, porém a maioria apresenta problemas com relação à definição do conceito ou a falta de integração com os modelos teóricos sobre valores pessoais. No Brasil foram encontrados dois instrumentos, um não foi validado para a população brasileira e o outro foi validado para uma população de baixa escolaridade. Foi objetivo do presente estudo desenvolver e validar uma Escala de Valores relativos ao Trabalho. Para o desenvolvimento da EVT foi realizado um levantamento de instrumentos anteriores e foram entrevistados trabalhadores. Após a análise de juízes e validação semântica, o instrumento foi respondido por 394 pessoas. A análise fatorial apontou para quatro fatores: Realização no trabalho, Relações sociais, Prestígio e Estabilidade. O instrumento após validação é composto por 45 itens. Os resultados corroboraram o modelo teórico previsto e conclui-se que a escala foi devidamente estabelecida e pode ser utilizada para pesquisa e diagnóstico.

  11. Epidemiology of fluorosis and dental caries according to different types of water supplies Epidemiologia da fluorose e cáries dentárias de acordo com diferentes tipos de abastecimento de água

    Directory of Open Access Journals (Sweden)

    Solange de Oliveira Braga Franzolin

    2010-06-01

    Full Text Available The aim of this article is to investigate the relationship between fluorosis/dental caries in schools, according to the level of fluoride in public water supply. The sample comprised of twelve-year-old daytime students (360 of both genders, attending schools close to the region where they were born. The schools were classified into three groups according to the presence of fluoride in the water supply: 1 fluoridation in the Water Treatment Station-WTS; 2 Direct Fluoridation in Wells-DFW; and 3 Non Fluoridated Areas-NFA. The χ2 and Goodman tests (significance=5% were used to evaluate the association between the origin of water and degree of fluorosis; percentage of distribution and descriptive measures were used for investigation of the degree of fluorosis. The following outcomes were predominant: presence of dental caries in the entire sample (P0.05. Dental caries is still an important problem in this population, despite the establishment of preventive measured. The observation of fluorosis in students living in non-fluoridated areas confirms the presence of other sources of fluoride.O objetivo do presente artigo é investigar a relação fluorose/cáries em escolas, de acordo com o nível de fluoreto no abastecimento público de água. A amostra consistiu em 360 alunos de doze anos de idade, de ambos os sexos, que frequentam as escolas próximas da região em que nasceram. As escolas foram classificadas em três grupos de acordo com a presença de fluoreto no abastecimento de água: 1 fluoretação na Estação de Tratamento de Água (ETA; 2 fluoretação direta em poços; e 3 áreas não fluoretadas (ANF. Os testes deχe de Goodman (significância = 5% foram utilizados para avaliar a associação entre a origem da água e o grau de fluorose. Os resultados mais predominantes foram presença de cáries em toda a amostra (P0,05. As cáries ainda são uma importante questão nessa população, apesar do estabelecimento de medida preventiva. A

  12. Fatores relacionados ao surgimento e gradação da mucosite oral radioinduzida

    Directory of Open Access Journals (Sweden)

    Tatiana Stuart Vieira Holmes

    Full Text Available Introdução: a mucosite Oral é considerada uma das complicações mais comuns da terapia antineoplásica de cabeça e pescoço. Caracteriza-se pelo eritema e edema da mucosa seguidos, geralmente, pela ulceração e descamação. Objetivo: avaliar os fatores relacionados ao surgimento e gradação da mucosite em pacientes submetidos à radioterapia na região de cabeça e pescoço. Métodos: foi realizado um estudo transversal, com amostra composta por 22 pacientes com diagnóstico de câncer de cabeça e pescoço, submetido a tratamento de radioterapia. Os pacientes foram avaliados durante 4 semanas para se observar o surgimento e gradação da mucosite durante o tratamento antineoplásico os fatores como idade, consumo de álcool e tabaco, comorbidades como diabetes, hipertensão, cardiopatias, assim como níveis de higiene oral. Resultados: de acordo com os resultados do Coeficiente ñ de Sperman, U Mann-Whitney e Kruskal-Wallis a mucosite oral se desenvolveu em 95,45% dos pacientes submetidos à radioterapia de cabeça e pescoço, com maior gradação entre os fumantes quando comparados com os não fumantes, com diferença estatisticamente significativa (p = 0.034. Conclusão: estes resultados sugerem que não há associação entre idade, consumo de álcool, comorbidades como diabetes, hipertensão, cardiopatias e nível de higiene oral com o surgimento e gradação da mucosite. Já os pacientes tabagistas apresentam graus mais elevados de mucosite oral radioinduzida no momento do surgimento.

  13. Diferentes Metodologias Aplicadas ao Ensino de Astronomia

    Science.gov (United States)

    Albrecht, E.; Voelzke, M. R.

    2007-08-01

    Espera-se que o educando ao final da educação básica, adquira uma compreensão atualizada das hipóteses, modelos e formas de investigação sobre a origem e evolução do Universo em que vive. O presente trabalho tem como principal objetivo compreender dentre três práticas pedagógicas adotadas no Ensino de Astronomia, na terceira série do Ensino Médio, da Escola Estadual Colônia dos Pescadores, qual melhor cumpre o papel de formação e aprendizagem para vida. A pesquisa preliminar foi através de um questionário onde o intuito foi diagnosticar o conhecimento já existente acerca do tema em questão. O questionário é composto de vinte questões dissertativas e objetivas, onde os educandos das três turmas envolvidas o responderam. Este trabalho utiliza as seguintes metodologias: a tradicional, onde o professor é um repassador de informações, fazendo uso exclusivo de lousa e giz; a segunda também de forma tradicional, porém com auxílio de multimídia para desenvolvimento das aulas e aterceira sob forma de seminários, elaborados e apresentados pelos educandos, no qual o educador faz apenas as intervenções necessárias. Ao final do trabalho os alunos responderão novamente o questionário inicial para diagnosticar dentre as três metodologias utilizadas qual apresentou melhor resultado. Os resultados preliminares obtidos, já podem ser observados e, dos 119 alunos entrevistados, as respostas obtidas são as mais diversas e evidenciam que a grande maioria nunca teve em sua vida escolar o tema Astronomia. Ao serem questionados se já haviam estudado Astronomia as respostas foram: turma A: sim 43%; turma B: sim: 21%; turma C: sim: 24%. Porém quando questionados a respeito do significado de Astronomia observou-se que: turma A: 100% de acertos; turma B: 64% acertos; turma C: 84% de acertos, demonstrando claramente a aprendizagem em diferentes esferas, não dependendo unicamente da escola. Até o presente momento, verificou-se que há interesse em

  14. Os clássicos da “literatura” sociológica infantil: as crianças e a infância de acordo com Marx, Weber, Durkheim e Mauss

    Directory of Open Access Journals (Sweden)

    Lucas de Lima e Cunha

    2013-06-01

    Full Text Available O objetivo deste texto é mostrar que, apesar de ser um tema secundário e recente, é possível desenvolver uma Sociologia da Infância de acordo com aquilo que foi discutido pelos principais fundadores dessa ciência sobre as crianças. Para isso serão analisadas as considerações de Karl Marx, Max Weber, Émile Durkheim e Marcel Mauss sobre as crianças e as relações delas com as sociedades e com o pensamento sociológico tradicional. Pretende-se com isso afirmar que as crianças também são, assim como os adultos, sujeitos relevantes para as análises sociológicas. Ademais, acrescenta-se que é de fundamental importância compreender a constituição das sociedades por meio da infância e de suas personagens, as crianças.

  15. Hepatotoxicidade associada ao uso de esteroides anabolizantes

    Directory of Open Access Journals (Sweden)

    Mónica Brinquinho

    2017-06-01

    Full Text Available O consumo de esteroides androgénicos anabolizantes tem vindo a aumentar no meio desportivo amador, sendo de fácil acesso apesar de se tratarem de substâncias proibidas. Estão descritos múltiplos efeitos laterais, sendo a hepatotoxicidade uma das mais reportadas. Apresentam-se dois casos clínicos representativos da lesão hepática associada ao consumo de esteroides anabolizantes. Ambos evidenciaram morbilidade significativa, embora nenhum deles tenha evoluído para falência hepática. Os autores pretendem chamar a atenção para o consumo destes fármacos, particularmente frequente em indivíduos jovens, praticantes de desporto amador.

  16. Acesso ao aborto e liberdades laicas

    Directory of Open Access Journals (Sweden)

    Roberto Arriada Lorea

    2006-12-01

    Full Text Available Enfrentar o tema do aborto no Brasil requer uma perspectiva laica, na medida em que a liberdade de consciência assegurada na Constituição Federal impõe ao Estado contemplar não apenas as diferentes visões oriundas de distintas religiões, mas, principalmente, assegurar o direito à diversidade existente no seio de uma mesma religião, garantindo o direito de divergir da hierarquia de sua própria igreja. Assim, não havendo obstáculo jurídico à descriminalização do aborto no país, resta aos legisladores reformar a lei vigente, para descriminalizar o aborto, atendendo os compromissos assumidos pelo Brasil perante organismos internacionais de proteção dos direitos humanos e assegurando a eficácia das liberdades laicas.In Brazil, face an issue like abortion requires a lay perspective considering that the freedom of conscience assured by the Federal Constitution lays upon the State the need to look not only at different views from different religions but specially assure the right to the existing diversity within the same religion, as well as, the right to diverge from the hierarchy of his/her own religion. Therefore there is no legal barrier for the decriminalization of abortion in the country. It is up to the legislators to reform the present law to decriminalize abortion, assuming the commitments made by Brazil upon international organizations for the protection of the human rights assuring the efficacy of lay liberties.

  17. Perfil comportamental de crianças com dermatoses crônicas de acordo com a avaliação dos cuidadores = Behavioral profile of children with chronic skin disease according to caregivers’ assessment

    Directory of Open Access Journals (Sweden)

    Gon, Marcia Cristina Caserta

    2013-01-01

    Full Text Available Pesquisas indicam que crianças com doenças crônicas apresentam maior frequência de problemas de comportamento ou probabilidade de desenvolvê-los, com destaque para ansiedade, depressão e dificuldades de relacionamento. No entanto, observam-se poucos estudos empíricos sobre o tema com crianças com doenças crônicas de pele. O presente estudo investigou a avaliação dos cuidadores quanto ao perfil comportamental de crianças com dermatoses crônicas. Sessenta e sete cuidadores responderam ao CBCL (Child Behavior Check-List. Resultados quanto ao funcionamento global indicam frequências semelhantes de crianças avaliadas com perfil clínico e não clínico. Em relação aos gêneros, observa-se maior porcentagem de meninos avaliados com problemas de comportamento. Embora a maioria dos cuidadores tenha avaliado as crianças com alta competência social, a porcentagem daquelas avaliadas com baixa competência foi elevada. Sugere-se que a ocorrência de problemas de comportamento na amostra investigada pode estar relacionada à doença crônica pele

  18. Metodologia baseada nas funções de transferência para pré-processamento de imagens mamográficas digitais e sua aplicação em esquema computacional de auxílio ao diagnóstico

    OpenAIRE

    Marcelo Andrade da Costa Vieira

    2005-01-01

    Este trabalho tem por objetivo a investigação do comportamento de equipamentos de radiodiagnóstico em termos da qualidade da imagem produzida e a subseqüente aplicação desses resultados na otimização do desempenho de esquemas computacionais de auxílio ao diagnóstico, também conhecidos como esquemas CAD (do inglês, Computer-Aided Diagnosis). A principal meta consiste no desenvolvimento de técnicas de pré-processamento para imagens mamográficas digitalizadas que as realçasse de acordo com as ca...

  19. AVALIAÇÃO DOS BENEFÍCIOS SECUNDÁRIOS DE PROJETOS MDL: CONTRIBUIÇÃO AO CONTROLE DE POLUIÇÃO E AO DESENVOLVIMENTO LOCAL E REGIONAL

    Directory of Open Access Journals (Sweden)

    Pedro Camargo Amaral

    2011-05-01

    Full Text Available Considerando o aumento da importância de poluentes locais, regionais e globais nas atividades humanas, notados os acordos internacionais para controlar e reduzir as emissões de gases de efeito estufa destaca-se o Mecanismo de Desenvolvimento Limpo do Protocolo de Kyoto, como ferramenta para promover a redução de emissões de GEE e contribuir para o controle de poluição e desenvolvimento local e regional. Dentro do processo de aprovação de projetos de MDL no Brasil, existe a necessidade de se atender aos critérios relacionados à sustentabilidade local, definidos pelo governo brasileiro no documento denominado Anexo III. O presente estudo busca avaliar o processo que culminou com a definição dos critérios de sustentabilidade para projetos de MDL no Brasil e avaliar o impacto local e regional de projetos aprovados pelo governo brasileiro, no que concerne os poluentes ambientais CO, NOx, SOx, MP e hidrocarbonetos, assim como impactos diretos à fauna, flora e recursos hídricos. Para a avaliação dos projetos foi proposta uma metodologia, baseada em metodologias previamente sugeridas para avaliação de projetos de MDL. Concluí-se que os critérios estabelecidos para o Anexo III contemplam, em essência, os critérios sugeridos nos trabalhos que antecederam sua definição. Por outro lado, é notável a diminuição do peso de benefícios secundários no mecanismo, como critérios obrigatórios ou classificatórios, quando se comparam as idéias originais àquelas que de fato foram implementadas. Ao mesmo tempo, devem ser valorizados os impactos secundários positivos advindos dos projetos de MDL, notados àqueles apresentados neste trabalho. Ressalta-se que os impactos ambientais positivos são extremamente relacionados ao menor consumo de combustíveis fósseis (não desconsiderando também a menor necessidade de produção dos mesmos e aos impactos associados a estes combustíveis.

  20. Análise do nível de adesão ao disclosure do risco de mercado pelos bancos com ações negociadas na BM&FBOVESPA

    Directory of Open Access Journals (Sweden)

    Vinícius Costa da Silva Zonatto

    2015-05-01

    Full Text Available O objetivo deste estudo é analisar o nível de adesão ao disclosure do risco de mercado pelas instituições financeiras com ações negociadas na Bolsa de Valores, Mercadorias e Futuros (BM&F Bovespa, no tocante às recomendações do Acordo de Basileia II, em especial pelos bancos listados nos Níveis Diferenciados de Governança Corporativa da BM&F Bovespa. A metodologia utilizada na pesquisa consistiu num estudo descritivo, realizado por meio de uma pesquisa documental, com abordagem quantitativa dos dados. Os dados foram analisados por meio de consulta aos demonstrativos financeiros padronizados de 2010, disponibilizados por 24 bancos no sitio da BM&F Bovespa. Para tratar os dados foram utilizados o teste de Kolmogorov-Smirnov e o teste não-paramétrico de Mann-Whitney. A análise dos dados permitiu identificar os fatores que evidenciam o grau de transparência das informações relacionadas ao risco de mercado que se tornam necessárias para a tomada de decisão dos stakeholders dessas organizações. Os resultados encontrados indicam que instituições participantes de diferentes níveis de governança corporativa apresentam maior adesão às recomendações do Novo Acordo de Basileia para o disclosure do risco de mercado, do que as instituições participantes do mercado tradicional. No entanto, a partir da aplicação do teste não-paramétrico de Mann-Whitney, verificou-se que as práticas de disclosure das organizações em estudo não possuem diferenças estatisticamente significativas.

  1. Fatores associados ao consumo de dietas ricas em gordura em adultos de uma cidade no sul do Brasil

    Directory of Open Access Journals (Sweden)

    Airton José Rombaldi

    2014-05-01

    Full Text Available O objetivo deste estudo foi descrever a frequência de consumo de dieta rica em gordura por adultos de 20 a 69 anos de Pelotas, RS, e analisar fatores associados. Foi realizado um estudo transversal de base populacional, incluindo 972 adultos. A frequência do consumo de gordura alimentar no ano anterior à pesquisa foi avaliada pelo questionário de Block, composto por quinze itens alimentares, pontuados de acordo com a frequência de consumo de alimentos com elevados teores de gordura. Cerca de 1/3 da população adulta (32,7% consumia regularmente dieta rica em gordura. Para ambos os sexos, o consumo regular de gordura mostrou-se associado a idades mais jovens e consumo regular de refrigerantes e, somente para homens, aos níveis econômicos A/B. A frequência do consumo regular de alimentos ricos em gordura na população adulta residente no município de Pelotas encontra-se além das recomendações atuais do Ministério da Saúde. Políticas públicas que estimulem uma alimentação saudável são urgentemente necessárias.

  2. Políticas sociais de atendimento às crianças e aos adolescentes no Brasil Social policies for children and adolescents in Brazil

    Directory of Open Access Journals (Sweden)

    José Roberto Rus Perez

    2010-08-01

    Full Text Available Este artigo analisa a emergência e o desenvolvimento das políticas sociais de atendimento infanto-juvenil concomitante ao processo de desenvolvimento do sistema de proteção social nacional, focalizando algumas das principais representações atribuídas à infância, de acordo com o período histórico e político de cada época. Busca-se apresentar a noção de infância instituída sob a constituição do aparato do Estado de Bem-Estar brasileiro, de forma a situá-la em um contexto mais amplo de transformações históricas e políticas que envolveram a emergência e consolidação das políticas sociais destinadas ao atendimento à criança e ao adolescente no Brasil ao longo do século XX e início do século XXI.This article analyses the emergence and development of social policies for children and adolescents attendance that are in line with the development process of the Brazilian social protection system, focusing on some of the main representations attributed to childhood, according to the historical and political periods. It seeks to present the notion of childhood instituted under the constitution of the Brazilian welfare state, in such a way as to place it within the broader context of the historical and political transformations that involved the emergence and consolidation of the social policies directed towards children and adolescents in Brazil in the 20th century and the beginning of the 21st.

  3. Review of AO calibrations, or how to best educate your AO system

    Science.gov (United States)

    Kolb, Johann

    2016-07-01

    If the Real-Time Computer is the heart of an AO system, the Wavefront Sensor (WFS) its eyes, the Deformable Mirror (DM) its hands and the control strategy its nervous system, the sum of all those parts is made into a harmonious entity thanks to calibrations. This paper does not have the ambition to provide an overview of all the currently existing calibration strategies, but rather to focus on a few challenging problems and their recent evolution in the era of adaptive telescopes, mostly based on the experience of ESO's Adaptive Optics Instruments in general and the AO Facility in particular. Single most important calibration in post-focal AO system, the recording of the Interaction Matrix (IM) between WFS and DM has since long evolved to use fast modulation techniques, has shown to be feasible on-sky and is now almost free from measurements thanks to its pseudo-synthetic generation, quasi-mandatory solution in an adaptive telescope. Pseudo- because it requires an unprecedented knowledge of the components' characteristics, especially the WFS, DM and the optical registration between the two. Bigger telescopes and the use of Laser Guide Stars (LGS) also mean that the properties of the system will change in time and thus need to be constantly updated thanks to online diagnosis tools for spot size measurement, atmosphere monitoring, Wavefront Sensing and control optimization. New loops come into play like the one to minimize LGS Jitter and the one taking over the telescope active optics by means of offloading the DM low orders, and they all require calibration. More calibration means more time and one has to carefully balance the calibrations that require precious telescope night time, day time or for the best, no telescope time at all. Their importance sometimes underestimated, calibrations have repeatedly shown to be a vital part in the optimum functioning of present and future AO systems.

  4. O efeito do fim do Acordo sobre Têxteis e Vestuários para a indústria brasileira: uma análise a partir da fronteira de produção estocástica

    Directory of Open Access Journals (Sweden)

    Rogério Gomes

    2013-11-01

    Full Text Available This article investigates the productivity and production function of thirteen large Brazilian textile and clothing companies before and after the end of the Agreement on Textiles and Clothing (AVT that abolished import quotas in 2005. For this purpose, we estimate the stochastic production frontier in panel data between 1997 and 2008 and simultaneously an explanatory equation for the (inefficiency of firms, as proposed by Battese and Coelli (1995. The results indicated that more efficient firms are the oldest. The total factor productivity of firms tended to fall, even after the end of quotas, increasing productivity only from 2007. Overall, firms from Santa Catarina were more efficient than those of other states.Este artigo investiga a produtividade e a função de produção de 13 grandes empresas têxteis e de vestuário brasileiras antes e depois do fim do Acordo sobre Têxteis e Vestuário (AVT, que extinguiu as cotas de importação em 2005. Com esse propósito, estima-se a fronteira de produção estocástica entre 1997 e 2008 em painel e, simultaneamente, uma equação explicativa para a (ineficiência das firmas, como proposto por Battese e Coelli (1995. Os resultados indicaram que as empresas mais eficientes são as mais antigas. A produtividade total dos fatores das firmas apresentou tendência de queda, inclusive após o fim das cotas, aumentando a produtividade apenas a partir de 2007. De forma geral, no período as empresas de Santa Catarina foram mais eficientes do que as de outros Estados.

  5. Directly Imaging Planets with SCExAO: First Results

    Science.gov (United States)

    Currie, Thayne M.; Guyon, Olivier; Jovanovic, Nemanja; Lozi, Julien; Tamura, Motohide; Kudo, Tomoyuki; Uyama, Taichi; Garcia, Eugenio

    2017-01-01

    We present the first science results from the newly commissioned Subaru Coronagraphic Extreme Adaptive Optics project, an experimental system dedicated to image faint jovian planets around nearby stars. SCExAO is now achieving true extreme AO capability. We describe the typical performance of SCExAO, the first images of benchmark exoplanets and planet-forming disks, and SCExAO’s first science results. Finally, we briefly chart the path forward for SCExAO to achieve its full scientific capability, including imaging mature planets in reflected light.

  6. Photon counting arrays for AO wavefront sensors

    CERN Document Server

    Vallerga, J; McPhate, J; Mikulec, Bettina; Clark, Allan G; Siegmund, O; CERN. Geneva

    2005-01-01

    Future wavefront sensors for AO on large telescopes will require a large number of pixels and must operate at high frame rates. Unfortunately for CCDs, there is a readout noise penalty for operating faster, and this noise can add up rather quickly when considering the number of pixels required for the extended shape of a sodium laser guide star observed with a large telescope. Imaging photon counting detectors have zero readout noise and many pixels, but have suffered in the past with low QE at the longer wavelengths (>500 nm). Recent developments in GaAs photocathode technology, CMOS ASIC readouts and FPGA processing electronics have resulted in noiseless WFS detector designs that are competitive with silicon array detectors, though at ~40% the QE of CCDs. We review noiseless array detectors and compare their centroiding performance with CCDs using the best available characteristics of each. We show that for sub-aperture binning of 6x6 and greater that noiseless detectors have a smaller centroid error at flu...

  7. A VIA DEMOCRÁTICA AO AUTORITARISMO

    Directory of Open Access Journals (Sweden)

    Paulo César Nascimento

    2013-09-01

    Full Text Available Este artigo analisa as teorias de Aristóteles, Tocqueville e Hannah Arendt a respeito de como alguns aspectos da democracia como a busca do igualitarismo e o voto majoritário podem conduzir ao despotismo. Examinando os casos da democratização da Rússia pós-comunista e o sistema político da Venezuela durante a presidencia de Hugo Chavez, o texto procura demonstrar a importância das idéias daqueles pensadores para a compreensão de regimes autoritários legitimados pelo voto popular. --- The democratic route of autoritarism This article reviews the theories of Aristotle, Tocqueville and Hannah Arendt with respect to some elements of democracy such as the pursue of egalitarianism and the reliance on the will of the majority that can lead to despotism. On the basis of post-communist Russia’s transition to democracy and Venezuela’s political system under the presidency of Hugo Chavez, the article shows the importance of those thinker’s insights to understand current authoritarian regimes which rely on popular vote. keywords: democracy, autoritarian regimes, voting.

  8. Adesao ao guia alimentar para populacao brasileira

    Directory of Open Access Journals (Sweden)

    Eliseu Verly Junior

    2013-12-01

    Full Text Available OBJETIVO : Analisar a adesão ao Guia Alimentar para População Brasileira. MÉTODOS : Amostra composta por participantes do Inquérito de Saúde de São Paulo (n = 1.661 que preencheram dois recordatórios de 24 horas. Foi utilizado modelo bivariado de efeito misto para a razão entre o consumo de energia do grupo de alimentos e o consumo calórico total. A razão estimada foi utilizada para calcular o percentual de indivíduos com consumo abaixo ou acima da recomendação. RESULTADOS : Pelo menos 80,0% da população consome abaixo do recomendado para: leite e derivados; frutas e sucos de frutas; e cereais, tubérculos e raízes; aproximadamente 60,0% para legumes e verduras; 30,0% para feijões; e 8,0% para carnes e ovos. Adolescentes apresentaram a maior inadequação para legumes e verduras (90,0%, e o estrato de maior renda foi associado à menor inadequação para óleos, gorduras e sementes oleaginosas (57,0%. CONCLUSÕES : Foi observado consumo inadequado dos grupos de alimentos relacionados com aumento do risco de doenças crônicas.

  9. Toxicologia do tolueno: aspectos relacionados ao abuso

    Directory of Open Access Journals (Sweden)

    Letícia M.K. Forster

    1994-04-01

    Full Text Available O tolueno está presente em muitos produtos de uso doméstico e industrial e é o principal solvente envolvido no abuso de substâncias e na exposição ocupacional. O problema mais grave no estudo de patologias relacionadas ao tolueno é que este está geralmente associado, em suas preparações comerciais, a outras substâncias. O potencial tóxico do tolueno foi abordado nos seguintes aspectos: parâmetros farmacológicos; características físico-químicas; exposição; estudos clínicos; diagnóstico; pesquisa experimental; tolerância e dependência; efeitos agudos e crônicos; neurotoxicidade; teratogenicidade; doenças psiquiátricas; carcinogenicidade e tratamento. Conclui-se ser de grande importância e urgência que se realizem estudos clínicos com amostras maiores para definição mais precisa das conseqüências do uso crônico

  10. Toxicologia do tolueno: aspectos relacionados ao abuso

    Directory of Open Access Journals (Sweden)

    Forster Letícia M.K.

    1994-01-01

    Full Text Available O tolueno está presente em muitos produtos de uso doméstico e industrial e é o principal solvente envolvido no abuso de substâncias e na exposição ocupacional. O problema mais grave no estudo de patologias relacionadas ao tolueno é que este está geralmente associado, em suas preparações comerciais, a outras substâncias. O potencial tóxico do tolueno foi abordado nos seguintes aspectos: parâmetros farmacológicos; características físico-químicas; exposição; estudos clínicos; diagnóstico; pesquisa experimental; tolerância e dependência; efeitos agudos e crônicos; neurotoxicidade; teratogenicidade; doenças psiquiátricas; carcinogenicidade e tratamento. Conclui-se ser de grande importância e urgência que se realizem estudos clínicos com amostras maiores para definição mais precisa das conseqüências do uso crônico

  11. Uso da bandagem elástica associada ao tratamento fonoaudiológico no controle da sialorréia

    Directory of Open Access Journals (Sweden)

    Wanessa Furtado Caneschi

    2014-10-01

    Full Text Available OBJETIVO:verificar a efetividade do uso da bandagem elástica associada ao tratamento fonoaudiológico no controle da sialorréia.MÉTODOS:estudo longitudinal realizado com onze crianças com quadro de sialorréia crônica e alteração neurológica. Foi verificada a percepção do fonoaudiólogo e do responsável acerca da gravidade e o número de toalhas/paninhos de boca utilizados ao dia. Empregou-se também a sialometria. Cada participante recebeu a aplicação da bandagem elástica Kinesio Tape na região da musculatura supra-hióidea por 30 dias. As crianças foram avaliadas sem a bandagem (T0, imediatamente após a retirada da bandagem (T1 e três meses após (T2. O tratamento fonoaudiológico foi realizado pelo o mesmo profissional em duas sessões semanais. Os dados foram analisados estatisticamente.RESULTADOS:no questionário verificou-se redução da queixa de engasgos com saliva em T1 (p=0,024.A média de uso diário de toalhas/paninhos era de quatro (10,2% em T0, duas (5,1% em T1 e quatro (10,2% em T2.De acordo com a sialometria, verificou-se redução da sialorréia de T0 para T1 (p=0,018 e ausência de diferença entre T0 e T2 (p=0,215 e aumento de T1 para T2 (p=0,05.De acordo com a percepção do fonoaudiólogo houve redução da sialorréia 30 dias após o uso da bandagem, entretanto não se observou melhora ao se comparar os resultados 30 dias após o uso e três meses sem a bandagem.CONCLUSÃO:a bandagem elástica se mostrou eficaz no controle da sialorréia durante seu período de uso, não sendo observada permanência dos resultados após interrupção da aplicação.

  12. Sensibilidade de estirpes de Bradyrhizobium ao glyphosate

    Directory of Open Access Journals (Sweden)

    Rodrigo Josemar Seminoti Jacques

    2010-02-01

    Full Text Available A aplicação do glyphosate sobre a soja resistente a este herbicida pode causar prejuízos à simbiose com o rizóbio. O objetivo deste trabalho foi avaliar a sensibilidade ao herbicida glyphosate de três estirpes de Bradyrhizobium recomendadas para a produção de inoculantes de sementes de soja no Brasil. Avaliou-se o efeito das concentrações de 0,0; 5,4; 10,8; 21,6 e 43,2 µg L-1 do ingrediente ativo do glyphosate [N-(fosfonometil glicina] no meio YM líquido sobre o crescimento de B. japonicum (estirpe SEMIA 5079 e de B. elkanii (estirpe SEMIA 5019 e estirpe SEMIA 587, por meio de leituras das densidades óticas e geração de curvas de crescimento. As reduções de crescimento na presença da menor concentração do glyphosate foram de 18% para SEMIA 5079, 29% para SEMIA 5019 e de 35% para SEMIA 587, sendo, de modo geral, quanto maior a concentração do herbicida no meio de cultura maior a inibição do crescimen­to. As estirpes apresentaram sensibilidade diferencial somente às concentrações mais baixas do glyphosate; nesse caso, foi possível determinar a seguinte ordem de sensibilidade: SEMIA 587 > SEMIA 5019 > SEMIA 5079. Essa sensibilidade diferencial é dependente da concentração do herbicida, pois na presença de 43,2 µg L-1 todas as estirpes tiveram seu crescimento severamente reduzido, não havendo diferença entre elas.

  13. WIYN active optics: a platform for AO

    Science.gov (United States)

    Code, Arthur D.; Claver, Charles F.; Goble, Larry W.; Jacoby, George H.; Sawyer, David G.

    1998-09-01

    The WIYN 3.5 meter telescope is situated on the southwest ridge of Kitt Peak yielding excellent atmosphere seeing conditions. As such, the telescope and enclosure design was directed towards exploiting this feature. The primary mirror was spun cast and figured by the Steward Observatory Mirror Laboratory and the secondary mirror by Contraves. In both cases the performance exceeded the design specifications. The borosilicate primary is actively temperature controlled to within 0.2 C of the desired temperature, typically 0.5 degrees C below the ambient air. The telescope structure is also temperature controlled and the enclosure is opened to the outside ion all sides, which all heat sources are vented to ducts carrying air downwind of the facility. The primary mirror is actively controlled for low order aberrations by 66 axial actuators which are adjusted open loop via force matrix look-up tables and closed loop via real-time wavefront curvature sensing measurements. The active optics also included real-time collimation and focus control. The telescope drive and guider are capable of providing tracking to a few hundredths of a second of arc. By employing active telescope control at this level, it is possible to maintain telescope and local wavefront distortion to a level where atmospheric effects dominate the image quality. Since a significant fraction of the power in the atmospheric disturbances is contained in image motion the first step in adaptive optics control will be simple tip tilt. Studies of higher order AO system are being carried out, as well as additional test characterizing the telescope and site. It is intended to continue such studies in an attempt to establish long term variances.

  14. Beef cuts yield of steer carcasses graded according to conformation and weight Rendimento de cortes cárneos de carcaças de novilhos classificadas de acordo com a conformação e o peso de carcaça

    Directory of Open Access Journals (Sweden)

    Leonir Luiz Pascoal

    2010-06-01

    Full Text Available The experiment evaluated total and individual yield of commercial cuts, bones, and trimmings of carcasses from 38 Braford steers at 22 months of age finished in a feedlot. Carcasses were ranked according to three conformation classes (good minus = score 10; good = score 11; good plus = score 12, and three weight classes (heavy = 229.4 kg, intermediate = 205.0 kg, and light = 184.0 kg, ranging from 222.9 to 250.4, 201.5 to 209.0, and 170.0 to 190.3 kg, respectively. Carcass cold shrinkage was not affected by conformation, but it was significantly lower in heavy (1.83% than in intermediate (2.53% and in light carcasses (2.30%, which were not different among each other. Carcass flank percentage was not affected by conformation, but it was significantly higher in heavy (13.93% and intermediate carcasses (13.87% as compared to light carcasses (13.07%. Deboned beef cuts (78.08% of carcasses of steers, bone (16.57%, and trimmings (5.23% yields and losses due to deboning (0.12% were not significantly affected by carcass weight. However, when they were evaluated according to conformation classes, those with better conformation showed higher meat cut yield (78.75 vs 77.92 and 77.29%. Conformation affects meat cut yield of carcasses of young steers while carcass weight does not show this characteristic.Avaliaram-se os rendimentos cárneos total e individual de cortes comerciais, de osso e de retalho de carcaças de 38 novilhos Braford com 22 meses de idade terminados em confinamento. As carcaças foram classificadas de acordo com três classes de conformação (boa menos = 10 pontos; boa = 11 pontos; e boa mais = 12 pontos e três classes de peso (pesadas = 229,40 kg; medianas = 205,04 kg; e leves = 184,00 kg com variação, 222,9 a 250,4; 201,5 a 209,0; e 170,0 a 190,3 kg, respectivamente. A quebra no resfriamento não foi influenciada pela conformação, mas foi significativamente menor nas carcaças pesadas (1,83% em comparação às medianas (2,53% e

  15. Determinação dos valores normais do eletrorretinograma de campo total em cães da raça Poodle portadores de catarata de acordo com a faixa etária Determination of normal values of full-field electroretinogram in Poodle dogs with cataract according to age

    Directory of Open Access Journals (Sweden)

    Angélica de Mendonça Vaz Safatle

    2010-03-01

    Full Text Available Eletrorretinograma (ERG é um meio diagnóstico objetivo, não invasivo e capaz de avaliar a função retiniana, detectando precocemente, em diversas espécies, lesões nas camadas mais externas. Tem como uma das principais indicações a avaliação pré-cirúrgica em pacientes portadores de catarata. A determinação dos valores normais do ERG é indispensável quando se objetiva, pela mensuração dos valores, o auxílio no diagnóstico das degenerações retinianas, mesmo quando apresentam opacidade de meios (catarata. Este estudo teve como objetivo padronizar os valores das respostas do eletrorretinograma em cães da raça Poodle portadores de catarata madura ou hipermadura, submetidos ao mesmo protocolo de sedação, adaptação ao escuro e eletrodo, utilizando aparelho portátil BPM 200. Em todos os animais, o exame oftalmológico precedeu o ERG. Os animais foram separados em quatro grupos de acordo com a faixa etária: um a três anos (GI, quatro a sete anos (GII, oito a 11 anos (GIII e 12 anos ou mais (GIV. Foram mensuradas a amplitude pico a pico (pico da onda-a até o pico da onda-b e o tempo de culminação da onda-b na resposta de bastonetes, máxima resposta e resposta de cones. Cães com respostas atenuadas ou extintas foram excluídos deste trabalho. Observou-se diminuição das amplitudes das três respostas quando se comparou GI com os demais grupos. Houve aumento do tempo de culminação da onda-b na comparação da resposta de bastonetes de GI com os outros grupos. O tempo de culminação da onda-b na máxima resposta e resposta de cones manteve-se praticamente inalterado nos quatro grupos testados. Concluiu-se que houve alteração dependente de idade nos parâmetros eletrorretinográficos, com diminuição da amplitude na resposta de bastonetes, máxima resposta e resposta de cones, enquanto que, no tempo de culminação da onda-b, apenas a resposta de bastonetes foi estatisticamente significante nos animais submetidos ao

  16. Discrimination of brazilian red varietal wines according to their sensory descriptors Discriminação de vinhos tintos Brasileiros varietais de acordo com suas características sensoriais

    Directory of Open Access Journals (Sweden)

    Alberto Miele

    2011-12-01

    Full Text Available The purpose of this paper was to establish the sensory characteristics of wines made from old and newly introduced red grape varieties. To attain this objective, 16 Brazilian red varietal wines were evaluated by a sensory panel of enologists who assessed wines according to their aroma and flavor descriptors. A 90 mm unstructured scale was used to quantify the intensity of 26 descriptors, which were analyzed by means of the Principal Component Analysis (PCA. The PCA showed that three important components represented 74.11% of the total variation. PC 1 discriminated Tempranillo, Marselan and Ruby Cabernet wines, with Tempranillo being characterized by its equilibrium, quality, harmony, persistence and body, as well as by, fruity, spicy and oaky characters. The other two varietals were defined by vegetal, oaky and salty characteristics; PC 2 discriminated Pinot Noir, Sangiovese, Cabernet Sauvignon and Arinarnoa, where Pinot Noir was characterized by its floral flavor; PC 3 discriminated only Malbec, which had weak, floral and fruity characteristics. The other varietal wines did not show important discriminating effects.Conduziu-se este trabalho, com o objetivo de determinar as características sensoriais de vinhos tintos brasileiros elaborados com cultivares de uva introduzidos no país há algum tempo e outros, mais recentemente. Para tanto, as características de 16 vinhos tintos varietais brasileiros foram determinadas por um painel formado por enólogos que avaliaram os vinhos de acordo com suas características de aroma e sabor. Isso foi realizado utilizando-se uma escala não estruturada de 90 mm, a qual apresentava a intensidade de 26 descritores que foram analisados pela Análise de Componentes Principais (ACP. A ACP mostrou três importantes componentes, os quais representaram 74,11% da variação total. De fato, o CP 1 discriminou os vinhos Tempranillo, Marselan e Ruby Cabernet, o primeiro deles sendo caracterizado pelos descritores equil

  17. Aspectos epidemiológicos e distribuição geográfica da esquistossomose e geo-helmintos, no Estado de Sergipe, de acordo com os dados do Programa de Controle da Esquistossomose

    Directory of Open Access Journals (Sweden)

    Carla Virginia Vieira Rollemberg

    2011-02-01

    Full Text Available INTRODUÇÃO: A esquistossomose é endêmica no Brasil, com elevada prevalência no Estado de Sergipe, apesar da existência do Programa de Controle da Esquistossomose (PCE. MÉTODOS: Foi realizado levantamento de dados do PCE-Sergipe de 2005 a 2008. A partir da matriz bruta formulou-se planilha de dados no software Access e analisou-se frequência e distribuição geográfica das infecções por Schistosoma mansoni e outros enteroparasitos. Estes dados foram exportados para o software Spring 5.0.5 para georreferenciamento e confecção de mapas temáticos de distribuição espacial e temporal por ano de avaliação. RESULTADOS: Foram positivos para S. mansoni 13,6% (14471/106287 de exames nos anos de 2005, 11,2% (16196/145069 em 2006, 11,8% (10220/86824 em 2007 e 10,6% (8329/78859 em 2008. A análise de mapas mostrou elevada prevalência da doença em Sergipe, em particular nos municípios Ilha das Flores, Santa Rosa de Lima, Santa Luzia do Itanhi e São Cristóvão. Além disso, avaliamos a associação entre as frequências dessas doenças parasitárias com indicadores sociais e de desenvolvimento dos diferentes municípios, de acordo com os dados do Instituto Brasileiro de Geografia e Estatística (IBGE e da Superintendência de Recursos Hídricos (SRH. Observamos que os municípios com prevalência da esquistossomose maior do que 15% têm menor concentração de rede de esgotos (índice de higiene; p = 0,05. Adicionalmente, os municípios com prevalência de infecção por ancilostomídeos maior do que 10% apresentam um menor IDH educacional; p = 0,04. CONCLUSÕES: Ressalta-se a importância de maior controle dos fatores de risco ambientais e educacionais, na tentativa de reduzir prevalências dessas doenças parasitárias.

  18. Risco cardiovascular em pacientes submetidos ao transplante hepático Cardiovascular risk in patients submitted to liver transplantation

    Directory of Open Access Journals (Sweden)

    Hélem de Sena Ribeiro

    2012-06-01

    Full Text Available OBJETIVO: Determinar a prevalência de risco cardiovascular em pacientes submetidos ao transplante hepático de acordo com o escore de Framingham e avaliar possíveis associações com fatores de risco tradicionais e não tradicionais. MÉTODOS: Estudo transversal em que pacientes submetidos ao transplante hepático foram estratificados quanto ao risco cardiovascular pelo escore de Framingham. Variáveis demográficas, socioeconômicas, clínicas e antropométricas foram coletadas para verificar associação com risco cardiovascular utilizando-se análises estatísticas uni e multivariada. RESULTADOS: Foram avaliados 115 pacientes, dos quais 46,1% apresentaram médio ou alto risco para ocorrência de eventos cardiovasculares em 10 anos. O risco percentual médio dos pacientes avaliados foi de 9,5% ± 7,8%. Sexo masculino (OR: 4,97; IC 95% 1,92-12,85; p OBJECTIVE: To determine the prevalence of cardiovascular risk in patients undergoing liver transplantation according to the Framingham score, and to evaluate possible associations with traditional and non-traditional risk factors. METHODS: Cross-sectional study in which patients undergoing liver transplantation were stratified by cardiovascular risk according to the Framingham score. Demographic, socioeconomic, clinical, and anthropometric variables were collected to assess the association with cardiovascular risk factors using univariate and multivariate statistical analyses. RESULTS: A total of 115 patients were evaluated, of which 46.1% showed medium or high risk for the occurrence of cardiovascular events over ten years. The mean percentage risk of evaluated patients was of 9.5 ± 7.8%. Male gender (OR: 4.97; CI: 1.92-12.85; p < 0.01, older age (OR: 1,09; CI: 1.04-1.13; p < 0.01, and higher BMI at the moment of assessment (1.09; CI: 0.99-1.20; p = 0.03 were factors associated with medium and high cardiovascular risk. A higher percentage of cardiovascular risk was also associated with

  19. Conhecimentos e necessidades dos professores em relação aos transtornos do espectro autístico

    Directory of Open Access Journals (Sweden)

    Natalia Caroline Favoretto

    2014-03-01

    Full Text Available De acordo às normativas do Ministério da Educação, indivíduos com deficiência e necessidades educacionais especiais devem frequentar classes regulares visando à inclusão destes no sistema educacional. Portanto, é de extrema relevância que o professor seja sempre capacitado a atender as demandas de seus alunos no que tange aos processos de aprendizagem. Este estudo faz parte de um projeto maior com objetivo de utilizar recursos de teleducação como estratégia de ação para prover informações aos professores do ensino infantil visando à inclusão de crianças com Transtornos do Espectro Autístico (TEA na rede regular de ensino. Este trabalho constou da aplicação e análise de um questionário, realizado com 38 professores de ensino infantil da rede pública municipal de Bauru para investigar as experiências dos professores em relação aos TEA e necessidades de conteúdos sobre a temática. De posse a este conhecimento, foram organizados conteúdos programáticos para elaboração um curso de difusão de conhecimentos que será desenvolvido em uma próxima etapa. Os resultados evidenciaram que a inclusão escolar está em processo de crescimento, porém com professores carentes por informações. Com o estudo, foi possível obter uma maior integração entre a comunidade fonoaudiológica e pedagógica, favorecendo a elaboração do conteúdo de um curso de difusão para os professores que vise à inclusão dos alunos com TEA na rede regular de ensino.

  20. Respiração oral na criança: repercussões diferentes de acordo com o diagnóstico Mouth breathing in children: different repercussions according to the diagnosis

    Directory of Open Access Journals (Sweden)

    Renata C. Di Francesco

    2004-10-01

    Full Text Available A respiração oral é um sintoma freqüente na infância. A síndrome do respirador oral caracteriza-se por cansaço freqüente, sonolência diurna, adinamia, baixo apetite, enurese noturna e até déficit de aprendizado e atenção. Entretanto este sintoma apresenta diversas causas. Faz-se necessário, portanto, esclarecer detalhes sobre estes aspectos clínicos de acordo com suas causas. OBJETIVO: Comparar os achados de sonolência diurna, cefaléia, agitação noturna, enurese, problemas escolares e bruxismo em indivíduos com respiração oral; de acordo com os seguintes diagnósticos: rinite alérgica, hiperplasia adenoideana, hiperplasia adenoamigdaliana. FORMA DE ESTUDO: Estudo de coorte transversal. MATERIAL E MÉTODO: Estudo prospectivo com 142 pacientes de 2 a 16 anos, classificados em três grupos: rinite alérgica, hiperplasia adenoideana isolada e hiperplasia adenoamigdaliana. Os responsáveis dos pacientes responderam a questionário padronizado sobre os sintomas noturnos para caracterização da presença de apnéia do sono e sobre os aspectos estudados: cefaléia matinal, desempenho escolar e atenção, sonolência diurna, agitação noturna, enurese, bruxismo. RESULTADOS: A respiração oral é mais freqüente em meninos. Crianças com hiperplasia adenoamigdaliana são mais jovens. Este grupo apresenta maior freqüência de roncos e apnéia do sono, assim como mau desempenho escolar, bruxismo, enurese e agitação noturna, sendo estes sintomas relacionados com a apnéia, diferenciando-se do grupo com rinite alérgica. Não se observou sonolência diurna e cefaléia matinal significante nos grupos estudados. CONCLUSÃO: Bruxismo, enurese, agitação noturna e cefaléia estão relacionados com a apnéia do sono, sendo mais freqüente na hiperplasia adenoamigdaliana. Assim, a investigação de apnéia do sono na criança com respiração oral é fundamental e assim como a determinação da causa da respiração oral

  1. Contribuição ao estudo da estmativa do tempo decorrido de morte por meio da dosagem de ions "Mg++", "K+", Na+", "Ca", "P" e eletrolito "U" no humor vitreo de coelhos

    OpenAIRE

    Paulo Cesar Gaiotto

    2003-01-01

    Resumo: A determinação da cronologia da morte (cronotanatognose) é ainda hoje matéria controversa e intrigante, tendo-se em vista a inexistência de um único método que determine com precisão. Após a morte celular, dá-se início ao processo denominado de autólise, neste todas as células apresentam dissolução de sua integridade química física e morfológica, procedendo-se à difusão de íons de acordo com os seus gradientes de concentração nos diferentes tecidos corpóreos, fatores anatômicos locais...

  2. Desfechos clínicos aos 30 dias do registro brasileiro das síndromes coronárias agudas (ACCEPT

    Directory of Open Access Journals (Sweden)

    Luiz A lberto Piva e Mattos

    2013-01-01

    Full Text Available FUNDAMENTO: São escassos os registros documentando a prática clínica brasileira na vigência de uma síndrome coronária aguda. OBJETIVOS: Descrição da demografia, ocorrência de desfechos graves e análise comparativa dentre aqueles que efetivaram ou não uma estratégia invasiva (cinecoronariografia e revascularização miocárdica em um registro brasileiro multicêntrico de portadores de uma síndrome coronária aguda. MÉTODOS: O registro ACCEPT/SBC coletou prospectivamente, em 47 centros hospitalares brasileiros, pacientes na vigência de uma síndrome coronária aguda. Apresentamos a ocorrência de desfechos clínicos graves, de modo integral, e de acordo com a submissão ou não a um procedimento de revascularização do miocárdio ao final dos primeiros 30 dias de seguimento. RESULTADOS: De agosto de 2010 até dezembro de 2011, 2.485 pacientes foram incluídos neste registro. Destes, 31,6% eram portadores de angina instável e 34,9% e 33,4%, com síndrome sem e com supradesnível do segmento ST. Aos 30 dias, a submissão a procedimento de revascularização do miocárdio foi progressivamente maior de acordo com a gravidade da apresentação clínica (38,7% versus 53,6% versus 77,7%; p < 0,001. A ocorrência de mortalidade cardíaca, dentre aqueles submetidos ou não à revascularização miocárdica, foi de 1,0% versus 2,3% (p = 0,268, 1,9% versus 4,2% (p = 0,070 e 2,0% versus 8,1% (p < 0,001, angina instável, síndrome sem e com supradesnível do segmento ST, respectivamente. CONCLUSÕES: A prescrição de revascularização do miocárdio foi progressivamente mais frequente de acordo com a gravidade da apresentação clínica; naqueles atendidos na vigência de síndrome coronária sem e com supradesnível do segmento ST, promoveu tendência e redução significativa da mortalidade, aos 30 dias, respectivamente.

  3. SCExAO: First Results and On-Sky Performance

    Science.gov (United States)

    Currie, Thayne; Guyon, Olivier; Martinache, Frantz; Clergeon, Christophe; McElwain, Michael; Thalmann, Christian; Jovanovic, Nemanja; Singh, Garima; Kudo, Tomoyuki

    2013-01-01

    We present new on-sky results for the Subaru Coronagraphic Extreme Adaptive Optics imager (SCExAO) verifying and quantifying the contrast gain enabled by key components: the closed-loop coronagraphic low-order wavefront sensor (CLOWFS) and focal plane wavefront control ("speckle nulling"). SCExAO will soon be coupled with a high-order, Pyramid wavefront sensor which will yield greater than 90% Strehl ratio and enable 10(exp 6) -10(exp 7) contrast at small angular separations allowing us to image gas giant planets at solar system scales. Upcoming instruments like VAMPIRES, FIRST, and CHARIS will expand SCExAO's science capabilities.

  4. Acesso ao tratamento da diabetes na Bahia: por que se recorre ao judiciário?

    OpenAIRE

    Lisboa, Erick Soares

    2015-01-01

    A judicialização da saúde é um fenômeno importante, que tem motivado a realização de inúmeros estudos no país. A Constituição do país estabelece o direito de todos e o dever do Estado em prover acesso universal as ações e serviços de saúde. Ao longo dos 25 anos do SUS houve uma ampliação do acesso a medicamentos, e a cada ano, novos fármacos vem sendo lançados no Brasil pelas indústrias farmacêuticas. A judicialização do acesso a medicamentos tem causado impactos na estruturação, no financiam...

  5. LGS-AO Imaging of Every Kepler Planet Candidate: the Robo-AO KOI Survey

    Science.gov (United States)

    Law, Nicholas Michael; Baranec, Christoph; Morton, Timothy; Ziegler, Carl; Atkinson, Dani; Riddle, Reed

    2015-08-01

    The Robo-AO Kepler Planetary Candidate Survey is observing every Kepler planet candidate host star with laser adaptive optics imaging, to search for blended nearby stars which may be physically associated companions and/or responsible for transit false positives. We will present the results from searching for companions around over 3,000 Kepler planet hosts in 2012-2015. We will describe our first data release covering 715 planet candidate hosts, and give a preview of ongoing results including improved statistics on the likelihood of false positive planet detections in the Kepler dataset, many new planets in multiple star systems, and new exotic multiple star systems containing Kepler planets.We will also describe the automated Robo-AO survey data reduction methods, including a method of using the large ensemble of target observations as mutual point-spread-function references, along with a new automated companion-detection algorithm designed for extremely large adaptive optics surveys.Our first data release covered 715 objects, searching for companions from 0.15” to 2.5” separation with contrast up to 6 magnitudes. We measured the overall nearby-star-probability for Kepler planet candidates to be 7.4+/-1.0%, and we will detail the variations in this number with stellar host parameters. We will also discuss several KOIs of particular interest, including KOI-191 and KOI-1151, which are both multi-planet systems with detected stellar companions whose unusual planetary system architecture might be best explained if they are ``coincident multiple'' systems, with several transiting planets shared between the two stars. Finally, we will discuss and update the 98%-confidence evidence from our survey that third bodies in star/planet systems produce an excess of close-in giant planets.

  6. Passagem ao ato e acting-out: duas respostas subjetivas

    Directory of Open Access Journals (Sweden)

    Roberto Calazans

    2010-08-01

    Full Text Available O presente artigo delimita o conceito de passagem ao ato em relação ao acting-out e distingue as respostas subjetivas que envolvem. A partir das distinções propostas por Lacan entre eles com base no conceito de objeto a, busca-se situar o sujeito em ambas as modalidades de ato, com os objetivos de submeter à discussão clínica as passagens ao ato discretas e de interrogar o papel de suplência que supostamente desempenham. Para tal, são retomados dois fragmentos de casos de anorexia discutidos na literatura psicanalítica; no primeiro, o objeto ao qual o sujeito se identifica é circunscrito, enquanto no segundo, trata-se do objeto posto em cena pelo sujeito.

  7. Gender differences in predictors of health status in patients with COPD Preditores do estado de saúde em pacientes com DPOC de acordo com o gênero

    Directory of Open Access Journals (Sweden)

    Renata Ferrari

    2010-02-01

    Full Text Available OBJECTIVE: To evaluate the health status (HS of COPD patients and to identify the main predictors of HS in these patients according to gender. METHODS: The study included 90 COPD patients (60 males and 30 females; mean age = 64 ± 9 years with a wide range of airway obstruction disorders (mean FEV1 = 56 ± 19% of predicted. The men were individually matched to the women by % of predicted FEV1 (ratio: 2:1. The patients were assessed regarding body composition; six-minute walk distance; perception of dyspnea using the Modified Medical Research Council Dyspnea Scale; Saint George's Respiratory Questionnaire (SGRQ; Charlson comorbidity index; and the multidimensional Body mass index, airway Obstruction, Dyspnea, and Exercise capacity (BODE index. Multiple linear regression analysis was performed to identify the predictors of HS by gender. RESULTS: Impairment of HS was greater among the women than among the men for SGRQ total score and for all SGRQ domains (total: 51 ± 18% vs. 38 ± 19%; p = 0.002; symptoms: 61 ± 22% vs. 42 ± 21%; p OBJETIVO: Avaliar o estado de saúde (ES de pacientes com DPOC e identificar os principais preditores do ES nesses pacientes de acordo com o gênero. MÉTODOS: Participaram do estudo 90 pacientes com DPOC (60 homens e 30 mulheres; idade média = 64 ± 9 anos com ampla faixa de distúrbios obstrutivos (VEF1 = 56 ± 19% do predito. Os homens foram pareados individualmente às mulheres em função de VEF1 % do predito (razão 2:1. Os pacientes foram avaliados em relação à sua composição corporal, distância percorrida no teste de caminhada de seis minutos; percepção da dispneia através da Modified Medical Research Council Dyspnea Scale; Saint George's Respiratory Questionnaire (SGRQ; índice de comorbidade de Charlson; e índice Body mass index, airway Obstruction, Dyspnea, and Exercise capacity (BODE multidimensional. A análise de regressão linear múltipla foi feita para identificar os preditores do ES por g

  8. The AO Pediatric Comprehensive Classification of Long Bone Fractures (PCCF)

    OpenAIRE

    Audigé, L.; Slongo, T; Lutz, N.; Blumenthal, A.; Joeris, A

    2016-01-01

    Background and purpose - To achieve a common understanding when dealing with long bone fractures in children, the AO Pediatric Comprehensive Classification of Long Bone Fractures (AO PCCF) was introduced in 2007. As part of its final validation, we present the most relevant fracture patterns in the upper extremities of a representative population of children classified according to the PCCF. Patients and methods - We included children and adolescents (0-17 years old) diagnosed with 1 or more ...

  9. Análise de custo-efetividade de métodos preventivos para superfície oclusal de acordo com o risco de cárie: resultados de um ensaio clínico controlado

    Directory of Open Access Journals (Sweden)

    Elaine Pereira da Silva Tagliaferro

    2013-11-01

    Full Text Available Este estudo apresenta o resultado de uma avaliação de custo-efetividade conduzida ao longo de um ensaio clínico controlado para avaliar a efetividade do selamento com ionômero de vidro modificado por resina (Vitremer, 3M ESPE e da aplicação de verniz fluoretado (Duraphat, Col-gate em superfícies oclusais de primeiros molares permanentes, em crianças de 6 a 8 anos (N = 268, segundo o risco de cárie (alto risco; baixo risco. As crianças foram examinadas semestralmente, ao longo de 24 meses, pelo mesmo dentista calibrado, após alocação em seis grupos: controle alto risco e baixo risco (educação em saúde bucal trimestral; verniz alto risco e baixo risco (educação em saúde bucal trimestral + aplicação semestral de verniz; e selante alto risco e baixo risco (educação em saúde bucal trimestral + única aplicação do selante. A análise mostrou que o selamento de primeiros molares permanentes em crianças de alto risco apresentou razão de C/E de R$ 225,21(US$ 119,80 por superfície oclusal salva, e razão incremental de C/E de R$ 203,71(US$ 108,36 por superfície oclusal adicional salva. Conclui-se que uma única aplicação de selante, em escolares de alto risco, foi a intervenção mais custo-efetiva.

  10. Adolescência e as expectativas em relação aos efeitos do álcool

    Directory of Open Access Journals (Sweden)

    Araújo Lisiane B.

    1998-01-01

    Full Text Available Trata-se dois estudos interdependentes. No Estudo 1, 188 estudantes secundaristas de uma escola pública de Porto Alegre - RS responderam a um protocolo sobre tipos de bebida, locais de consumo, idades de experimentação, uso mais comuns e efeitos esperados em relação a informação de consumo de álcool no mês anterior. Os resultados permitiram a classificação dos adolescentes em três padrões de consumo (abstinência, moderado e elevado e mostraram que expectativas agradáveis dos efeitos do álcool estavam associadas ao consumo elevado. No Estudo 2, entrevistou nove sujeitos que haviam participado do Estudo 1, com o objetivo de conhecer os conteúdos das expectativas no contexto da história pessoal e familiar de consumo de álcool. A escolha dos sujeitos foi intencional, de acordo com idade (14 a 16 anos, freqüência do uso de álcool no último mês e tipos de expectativas, ou seja três representantes de cada perfil. As descrições das entrevistas foram classificadas em unidades de sentido e a seguir agrupados em categorias temáticas. As interpretações destacaram o uso do álcool como parte do desenvolvimento psicológico do adolescente em nossa sociedade e o impacto da orientação e modelo familiar nos hábitos de consumo e nas escolhas da bebida dos filhos adolescentes.

  11. PERFIL CLÍNICO DAS MULHERES SUBMETIDAS AO EXAME PAPANICOLAU NA USF – BREJINHO NO ANO DE 2011

    Directory of Open Access Journals (Sweden)

    Valquíria Borges da Silva

    2014-08-01

    Full Text Available O câncer de colo de útero é um importante problema de saúde pública, principalmente, em decorrência da crescente exposição a fatores de risco ambientais e da modificação de hábitos de vida da população. Com o objetivo de traçar o perfil clínico de mulheres submetidas ao exame Papanicolau, na USF-Brejinho, zona rural de um município do interior do Maranhão, no ano de 2011, foi realizado um estudo descritivo com resultados de exames papanicolau de 295 mulheres, por meio de um levantamento de dados, existentes em seus prontuários e livros de registro de enfermagem. De acordo com os resultados obtidos nesse trabalho, foram encontrados 2,1% de exames positivos para alterações celulares epiteliais escamosas e glandulares; destes, 0,6% referentes a atipias de significado indeterminado em células escamosas, 1,5% a atipias de significado indeterminado em células glandulares e, 1,25% com lesão intraepitelial cervical de baixo grau. Vale ressaltar que essas lesões, consideradas como precursoras do carcinoma de colo uterino, desempenham importante papel no processo de evolução para o câncer cervical. Isso demonstra a necessidade de um aporte às atividades de prevenção primária e de detecção precoce dessas lesões, na tentativa de minimizar as taxas de mortalidade atribuídas a essa patologia em nossa região.

  12. Fatores ambientais associados ao sobrepeso infantil Environmental factors associated with childhood overweight

    Directory of Open Access Journals (Sweden)

    Juliana Farias de Novaes

    2009-10-01

    Full Text Available OBJETIVO: Avaliar os fatores ambientais intra-uterinos, perinatais e familiares associados ao sobrepeso infantil, ainda controversos na literatura. MÉTODOS: Estudo transversal realizado com 627 crianças, de 6 a 10 anos, matriculadas em escolas urbanas públicas e privadas do município de Viçosa (MG. O estado nutricional das crianças foi classificado pelo índice de massa corporal, segundo a preconização do Centers for Disease Control and Prevention. Foram aferidas as medidas de peso, estatura, pregas cutâneas tricipital e subescapular, circunferências da cintura e do quadril e pressão arterial das crianças, sendo os fatores ambientais obtidos por meio de questionário, segundo informações maternas. Classificou-se o estado nutricional das mães segundo a recomendação do World Health Organization. RESULTADOS: Do total de crianças, 87,9% eram eutróficas e 12,1% apresentavam sobrepeso. De acordo com a análise de regressão logística múltipla, os fatores associados ao sobrepeso infantil foram apresentar mãe obesa (OR: 6,92; pOBJECTIVE: The objective of this study was to assess intrauterine, perinatal and family factors associated with childhood overweight, which are still controversial in the literature. METHODS: This cross-sectional study included a total of 627 children aged 6 to 10 years, who were enrolled in public and private schools in the city of Viçosa, Minas Gerais State. The nutritional status of the children was classified according to their body mass index, as recommended by the Centers for Disease Control and Prevention. The following data were collected: weight, height, tricipital and subscapular skinfold thicknesses, circumferences of the waist and hip, and blood pressure. The environmental factors were determined by means of a questionnaire, answered by the mother. The nutritional status of the mothers was classified according to the World Health Organization criteria. RESULTS: Out of 627 children, 551 were

  13. Classificação de 86 casos de linfoma em bovinos de acordo com a Working Formulation (WF of Non-Hodgkin's Lymphomas for Clinical Usage e a Revised European-American Classification of Lymphoid Neoplasms (REAL

    Directory of Open Access Journals (Sweden)

    Welden Panziera

    2016-04-01

    Full Text Available Resumo Por meio de um estudo retrospectivo, realizou-se avaliação fenotípica (histologia e imunofenotípica (imuno-histoquímica [IHQ] de 86 casos de linfoma bovino. Quanto ao padrão de distribuição, todos os linfomas foram incluídos como difusos. Em relação à dimensão dos linfócitos neoplásicos, 83,8% dos linfomas foram considerados como de grandes células e 11,6% como de pequenas células. Linfomas mistos, ou seja, constituídos por grandes e pequenas células, representaram apenas 4,6% dos casos. Quanto ao número de mitoses, 84,9% dos linfomas foram incluídos como de grau intermediário, 10,5% como de baixo grau e 4,6% como de alto grau. No que se refere à morfologia do núcleo, linfomas em que predominavam linfócitos não clivados (58,2% ou linfócitos clivados (37,2% foram mais frequentes do que aqueles em que havia uma mistura igualmente proporcional de linfócitos clivados e não clivados (4,6%. Com base nestes resultados, os 86 linfomas foram assim distribuídos utilizando-se a classificação proposta pela Working Formulation (WF of Non-Hodgkin's Lymphomas for Clinical Usage: difuso de grandes células não clivadas (46,5%, difuso de grandes células clivadas (33,7%, difuso de pequenas e grandes células (4,6%, difuso de pequenas células - tipo plasmocitoide (7%, imunoblástico (3,5%, difuso de pequenas células - tipo intermediário (2,3%, difuso de pequenas células não clivadas (1,2% e difuso de pequenas células não clivadas - tipo Burkitt (1,2%. Na imuno-histoquímica, 27 dos 86 (31,4% linfomas foram positivos para o anticorpo monoclonal CD79αcy, utilizado para detecção de linfócitos B, e nenhum caso foi positivo para o anticorpo policlonal CD3, utilizado para detecção de linfócitos T. Com base nestes resultados, os 27 linfomas B foram assim distribuídos utilizando-se a Revised European-American Classification of Lymphoid Neoplasms (REAL: linfoma difuso de grandes células B (81,5%, linfomas imunobl

  14. Characterizing and mitigating vibrations for SCExAO

    Science.gov (United States)

    Lozi, Julien; Guyon, Olivier; Jovanovic, Nemanja; Singh, Garima; Goebel, Sean; Norris, Barnaby; Okita, Hirofumi

    2016-07-01

    The Subaru Coronagraphic Extreme Adaptive Optics (SCExAO) instrument, under development for the Subaru Telescope, has currently the fastest on-sky wavefront control loop, with a pyramid wavefront sensor running at 3.5 kHz. But even at that speed, we are still limited by low-frequency vibrations. The current main limitation was found to be vibrations attributed mainly to the rotation of the telescope. Using the fast wavefront sensors, cameras and accelerometers, we managed to identify the origin of most of the vibrations degrading our performance. Low-frequency vibrations are coming from the telescope drive in azimuth and elevation, as well as the elevation encoders when the target is at transit. Other vibrations were found at higher frequency coming from the image rotator inside Subaru's adaptive optics facility AO188. Different approaches are being implemented to take care of these issues. The PID control of the image rotator has been tuned to reduce their high-frequency contribution. We are working with the telescope team to tune the motor drives and reduce the impact of the elevation encoder. A Linear Quadratic Gaussian controller (LQG, or Kalman filter) is also being implemented inside SCExAO to control these vibrations. These solutions will not only improve significantly SCExAOs performance, but will also help all the other instruments on the Subaru Telescope, especially the ones behind AO188. Ultimately, this study will also help the development of the TMT, as these two telescopes share very similar drives.

  15. Prevenção de acidentes: o reconhecimento das estratégias operatórias dos motociclistas profissionais como base para a negociação de acordo coletivo

    Directory of Open Access Journals (Sweden)

    Eugênio Paceli Hatem Diniz

    Full Text Available O objetivo deste artigo é apresentar como o estudo das estratégias operatórias contribui para elaborar medidas de prevenção dos acidentes sofridos pelos motociclistas profissionais, conhecidos popularmente como "motoboys". Os autores apresentam uma crítica à concepção do erro humano, hegemônica dentre os especialistas em segurança do trabalho. Os resultados apresentados foram obtidos de um estudo ergonômico iniciado por demanda do sindicato dos motociclistas profissionais de Minas Gerais. No total, 85 motociclistas profissionais foram observados e entrevistados. Os procedimentos adotados foram: registro da atividade por meio de filmagens nas ruas e avenidas da cidade; autoconfrontação das cenas do filme e das rotas elaboradas em mapas, e de certos aspectos das atividades de trabalho observadas na expedição das duas empresas selecionadas. Ao final, os autores discutem os limites das normas de segurança prescritas que não consideram o saber desenvolvido pelos próprios trabalhadores. As medidas de transformação das situações geradoras de acidentes elaboradas com apoio no estudo detalhado das estratégias implementadas pelos sujeitos estudados serviram para a elaboração da convenção coletiva de trabalho.

  16. A exposição ao risco das familias

    OpenAIRE

    dos Santos Amaro, Ana Raquel

    2014-01-01

    A presente Dissertação de Mestrado aborda a exposição ao risco financeiro das famílias. Ao longo do trabalho serão abordados temas como a heurística, as finanças comportamentais, a percepção do risco e a exposição ao risco. Estes são os conceitos que foram considerados como sendo fundamentais e os principais responsáveis pela tomada de decisões a nível financeiro das famílias. Este estudo é de natureza quantitativa e pretenderá tirar conclusões da população em geral tendo em consideraçã...

  17. Comportamento da beta-ciclodextrina adicionada ao leite de cabra submetido ao processo de desidratação por "spray-dryer" Beta-ciclodextrin's behavior added goat's milk submitted to the "spray-dryer" dehydration process

    Directory of Open Access Journals (Sweden)

    Adriana C. P. Diniz

    2005-06-01

    Full Text Available Este trabalho avaliou o comportamento do agente encapsulante beta -ciclodextrina ( beta-CD adicionado ao leite de cabra submetido ao processo de desidratação por "spray-dryer", através de análise termogravimétrica e de cromatografia gasosa. Após a desidratação, a amostra adicionada de beta-CD apresentou um rendimento real de 10,59% com taxa de perda de 0,04% (em relação ao valor teórico esperado 10,6% ; enquanto na amostra sem adição do agente encapsulante o rendimento real foi de 9,57%, com taxa de perda de 4,27% (valor teórico esperado 10% . Através da análise termogravimétrica (TGA, verificou-se que são volatilizados 44% e 21% dos ácidos comerciais C8 e C10 , respectivamente. Os resultados cromatográficos mostraram uma perda de aproximadamente 30% dos ácidos C8 e 20% dos ácidos C10 , nas amostras de leite de cabra sem beta -CD em relação às amostras com beta-CD. Tais porcentagens estão de acordo com os valores estimados para os ácidos comerciais. Com base nos parâmetros estudados, podemos inferir que há menor perda dos ácidos graxos C8 e C10 na amostra de leite de cabra com beta-CD, provavelmente devido ao efeito encapsulante, aumentando a estabilidade térmica dos ácidos.This work evaluated the effect of the encapsulant agent beta-cyclodextrin (beta-CD added the goat milk submitted to the "spray-dryer" dehydration process, through thermogravimetric analysis and gas cromatography. After dehydration, the sample added of beta-CD presented a real yield of 10,59%, with a loss rate of 0,04% (in relation to the expected theoretical value 10,6%; while in the sample without addition of the encapsulant agent the real yield was 9,57%, with a loss rate of 4,27% (expected theoretical value 10% . It was verified that the volatilization of 44% and 21% of the commercial acids C8 and C10 , respectively, through the thermogravimetric analysis (TGA. The cromatographic results showed losses of approximately 30% of the C8 acids and

  18. The resistance to fluconazole in patients with esophageal candidiasis Resistência ao fluconazol em pacientes com candidíase esofágica

    Directory of Open Access Journals (Sweden)

    Ana Botler Wilheim

    2009-03-01

    Full Text Available CONTEXT: Esophageal candidiasis is often observed in patients with risk factors for its development and fluconazole is the therapeutic choice for the treatment of this disease. OBJECTIVES: To determine its frequency, by performing upper digestive endoscopy; to determine Candida species involved in its pathogenesis and verify their distribution according with the predisposing factors and to determine susceptibility to fluconazole in the samples. METHODS: From March 2006 to April 2007, all patients submitted to esophagogastroduodenoscopy at the Digestive Endoscopy Unit in the Oswaldo Cruz University Hospital, Recife, PE, Brazil, were eligible for the study. Samples were collected from patients who presented lesions consistent with esophageal candidiasis in order to identify Candida species and verify their susceptibility to fluconazole. The predisposing factors for the occurrence of esophageal candidiasis were described. RESULTS: Of 2,672 patients referred to upper endoscopy at the Digestive Endoscopy Unit, 40 (1.5% had endoscopic findings compatible with esophageal candidiasis. The average age was 49.1 years. Twenty one patients (52.5% were less than 50 years old, of which 82.6% were infected with HIV. Most of them (52.5% were males and 65.0% were inpatients. Diseases were identified in 90% of the patients and 21 (52.5% were HIV positive. Concerning endoscopic findings, severe forms of esophagitis were found in 50% of the patients with CD4 count CONTEXTO: A candidíase esofágica é comumente observada em pacientes com fatores de risco para seu desenvolvimento. OBJETIVOS:Determinar a freqüência da candidíase esofágica, por meio da endoscopia digestiva alta; identificar as espécies de Candida envolvidas na patogênese da candidíase esofágica e sua distribuição de acordo com o fator predisponente; determinar a susceptibilidade ao fluconazol nas amostras coletadas. MÉTODOS: De março de 2006 a abril de 2007, os pacientes submetidos a

  19. Violência relacionada ao trabalho: uma proposta conceitual

    OpenAIRE

    Oliveira,Roberval Passos de; Nunes,Mônica de Oliveira

    2008-01-01

    p. 22-34 O aumento de situações de violência no âmbito do trabalho vem se constituindo um importante problema de Saúde Pública, que tem impacto na dignidade e na qualidade de vida dos trabalhadores. Nessa perspectiva, este artigo tem como objetivo propor, a partir da discussão do fenômeno da violência e de sua faceta concernente ao trabalho, o conceito de violência relacionada ao trabalho, como referência para futuros estudos no campo da Saúde do Trabalhador. Trata-se de um artigo conceitu...

  20. High-Performance CCSDS AOS Protocol Implementation in FPGA

    Science.gov (United States)

    Clare, Loren P.; Torgerson, Jordan L.; Pang, Jackson

    2010-01-01

    The Consultative Committee for Space Data Systems (CCSDS) Advanced Orbiting Systems (AOS) space data link protocol provides a framing layer between channel coding such as LDPC (low-density parity-check) and higher-layer link multiplexing protocols such as CCSDS Encapsulation Service, which is described in the following article. Recent advancement in RF modem technology has allowed multi-megabit transmission over space links. With this increase in data rate, the CCSDS AOS protocol implementation needs to be optimized to both reduce energy consumption and operate at a high rate.

  1. Do teatro grego ao teatro romano de Lisboa

    OpenAIRE

    Maciel, Manuel Justino

    2006-01-01

    A tipologia do teatro nasceu na Grécia e foi apropriada por Roma, com alterações significativas que constituem instrumento importante da investigação em História da Arte. Assim acontece com o teatro romano de Lisboa que, foi construído “ao modo grego”. Parece evidente que o Teatro foi adaptado para “espectáculos aquáticos”, embora o aprofundamento da reflexão exija a continuação de trabalhos arqueológicos, sob a Rua de São Mamede ao Caldas.

  2. Abuso sexual: um trajeto da fantasia ao real

    OpenAIRE

    Malgarim, Bibiana Godoi

    2015-01-01

    O presente trabalho visou apresentar a Dissertação de Mestrado realizada junto ao Programa de Pós-Graduação de Psicologia da Universidade do Vale do Rio dos Sinos, cujo título é Abuso Sexual: Um trajeto da fantasia ao real. O objetivo desta pesquisa foi compreender e interpretar a dinâmica das representações das relações objetais de duas pré-adolescentes encaminhadas por suspeita de abuso sexual, através de métodos projetivos, como o Rorschach e o HTP.

  3. PASSAGENS DO RURAL AO URBANO E PARTICIPAÇÃO SOCIAL: a sociologia política brasileira dos anos 60

    Directory of Open Access Journals (Sweden)

    Antonio Brasil Jr

    Full Text Available Colocando em diálogo as pesquisas empíricas de Maria Isaura Pereira de Queiroz, Maria Sylvia de Carvalho Franco e Florestan Fernandes, realizadas nas décadas de 1950 e 1960 na Universidade de São Paulo, discutimos como esses três sociólogos trataram, mesmo que às vezes indiretamente, a questão da participação social, com o intuito de divisar o seu potencial teórico. Analisando as modalidades de participação do “homem comum” nas instâncias da vida política – nos processos eleitorais, nas relações com a burocracia do Estado, nos movimentos sociais, etc. –, Queiroz, Franco e Fernandes, de diferentes maneiras, situaram suas possibilidades e limites de acordo com as especificidades do processo mais geral de passagem do rural ao urbano no Brasil. Entendemos que a perspectiva histórica desses três autores, que mostram os efeitos de longa duração das raízes agrárias na conformação do mundo urbano, é fundamental para uma melhor compreensão dos dilemas de participação na sociedade brasileira contemporânea.

  4. Adequação da contagem de células somáticas e da contagem bacteriana total em leite cru refrigerado aos parâmetros da legislação

    Directory of Open Access Journals (Sweden)

    G.A. Bozo

    2013-04-01

    Full Text Available O objetivo deste trabalho foi adequar a qualidade do leite cru refrigerado de cinco propriedades leiteiras aos parâmetros microbiológicos e de contagem de células somáticas (CCS estabelecidos pela legislação estadual do Paraná. As propriedades leiteiras estudadas foram monitoradas durante sete meses após a implantação de boas práticas de ordenha e de recomendações quanto ao tratamento de mastites e à manutenção e higienização de equipamentos de ordenha. Antes da adoção das recomendações, a contagem bacteriana total (CBT média era de 1,36 x 10(6UFC/mL e a CCS média, de 1,87 x 10(6/mL. Todas as propriedades atingiram os padrões estabelecidos para CBT, com redução média de 93,4%. A redução de CCS foi, em média, 74,3%. Apenas três propriedades atingiram os valores estabelecidos para CCS. As demais atingiram valores muito próximos ao limite. A adequação aos padrões de CBT e CCS gerou aumento na renda mensal, em razão do pagamento por qualidade do produto, entre R$120,00 e R$828,00, de acordo com a produção de cada propriedade.

  5. Exame Papanicolaou: sentimentos relatados por profissionais de enfermagem ao se submeterem a esse exame Pap smear screening: sensations reported by nursing professionals when submitted to this test

    Directory of Open Access Journals (Sweden)

    Roberta Jeane Bezerra Jorge

    2011-05-01

    Full Text Available Objetivou-se conhecer os sentimentos de auxiliares e técnicas de enfermagem ao se submeterem ao exame Papanicolaou. Trata-se de um estudo descritivo com abordagem qualitativa realizado nos meses de setembro a outubro de 2006, com 35 servidoras de uma instituição governamental referência em ginecologia na cidade de Fortaleza (CE. Os dados foram coletados através de entrevista semiestruturada, contendo uma questão norteadora gravada e analisada de acordo com referencial teórico metodológico da fenomenologia social. Os relatos foram agrupados em três temáticas: um exame que causa incômodo, medo e vergonha; um exame que gera ansiedade quanto aos resultados; e um exame que "me deixa calma e tranquila". Apesar de as entrevistadas pertencerem a uma instituição que cuida de mulheres na prevenção do câncer cérvico-uterino, elas não deixaram de emitir sentimentos negativos relacionados ao exame. Concluiu-se a importância de realizar projetos educativos, enfatizando a importância do empoderamento das usuárias a fim de minimizar essas questões.This work sought to record the impressions of nursing assistants and technicians after submitting to Pap smear screening. This is a descriptive study using a qualitative approach conducted in September and October of 2006 with 35 employees of a public institution, which is a benchmark in gynecology in Fortaleza in the State of Ceará (Brazil. The data was collected through semi-structured interviews containing a recorded leading question and analyzed according to the methodological-theoretical reference of social phenomenology. The testimonials were separated in three groups: an exam that causes discomfort, fear and shame; an exam that causes anxiety about the results; and an exam that "makes me calm and relaxed". Despite the interviewees being part of an institution that cares for the prevention of cervical-uterine cancer in women, negative feelings about the Pap smear test were nonetheless

  6. Economic analysis of agricultural enterprises in Turkey according to their level of success Análise econômica de empresas agrícolas na Turquia de acordo com seu nível de sucesso

    Directory of Open Access Journals (Sweden)

    Halil Kizilaslan

    2009-04-01

    uso mais efetivo. O ponto a ser alcançado pelo estudo é assistir as empresas agrícolas com um uso mais efetivo dos meios existentes, para ajudar a desenvolvê-las. Foram utilizados dados de 71 empresas selecionadas pelo método estratificado de Neyman, através de questionários. O "Criterion of Agricultural Income Per Interprise Land Decar" foi aplicado para a classificação em relação ao nível de sucesso. Quando a renda agrícola foi suficientemente examinada, as empresas de sucesso moderado e as sem sucesso não podem obter renda agrícola suficiente para atender ao custo do trabalho familiar. Seu nível agrícola está muito abaixo da soma dos salários familiares e do juro real do capital equivalente. Por isso, a renda agrícola das empresas examinadas é considerada insuficiente. A relação entre o produto líquido e o capital ativo é 3,45% nas empresas de sucesso, 0,57% nas de moderado sucesso e -2,22% nas sem sucesso. Nesta relação, o limite do juro normal é de 5% para empresas de sucesso. Assim, empresas de sucesso trabalham mais eficientemente em comparação a outros grupos empresarias.

  7. Características estruturais do pasto de capim-braquiária de acordo com a localização das fezes Structural characteristics of Brachiaria grass pasture according to the location of feces

    Directory of Open Access Journals (Sweden)

    Manoel Eduardo Rozalino Santos

    2010-10-01

    Full Text Available Objetivou-se avaliar o efeito da localização das fezes de bovinos sobre as características de perfilhos vegetativos e reprodutivos, a massa dos componentes da planta, a densidade volumétrica da forragem e a altura do pasto de Brachiaria decumbens, cv. Basilisk, manejado sob lotação contínua. O delineamento foi em blocos casualizados, com três repetições, em esquema de parcela subdivida, considerando parcelas os locais próximos e distantes das fezes e subparcelas as categorias de perfilhos vegetativos e reprodutivos. A massa de lâmina foliar viva (LFV por perfilho em locais próximos às fezes (0,14 g foi maior que nos locais distantes das fezes (0,08 g, contrariamente ao verificado para a composição de massa de lâmina foliar morta por perfilho. A massa de LFV nos perfilhos vegetativos (0,15 g foi maior que nos perfilhos reprodutivos (0,06 g. Por outro lado, a massa de colmo (0,38 g e de lâmina foliar morta (0,20 g foi maior nos perfilhos reprodutivos. O peso dos perfilhos das plantas próximas às fezes foi maior (0,58 g que daqueles distantes das fezes (0,17 g. Em locais próximos das fezes, o número de perfilhos vegetativos foi menor, enquanto o de perfilhos reprodutivos foi maior. Maiores massas de colmo verde, forragem verde e forragem total do pasto foram observados nos locais próximos das fezes, quando comparadas aos distantes. Mesmo resultado foi obtido para a altura do pasto. A estrutura do pasto de Brachiaria decumbens é modificada pela localização das fezes dos bovinos em pastejo. A deposição de fezes por bovinos constitui fator de heterogeneidade espacial da vegetação em pastagem.The objective of this study was to evaluate the effect of the cattle feces location on the characteristics of vegetative and reproductive tillers, dry mass content in plant components, forage volumetric density and Brachiaria decumbens cv. Basilisk pasture height managed under continuous stocking. It was used a randomized block design

  8. Resposta ao estresse: II. Resiliência e vulnerabilidade

    Directory of Open Access Journals (Sweden)

    Nicole Leite Galvão-Coelho

    2015-06-01

    Full Text Available ResumoA crescente exposição a estressores na vida cotidiana aumentou significativamente a investigação da resposta ao estresse nas duas últimas décadas. Embora associada a consequências negativas, pois muitas patologias físicas e mentais são desencadeadas por exposição crônica a estressores, esta resposta é indispensável para sobrevivencia do indivíduo e é extremamente adaptativa quando ativada de forma aguda. Na parte I desta revisão foram abordados os conceitos de homestase e alostase e os sistemas fisiológicos ativados durante a resposta ao estresse. Na parte II serão discutidos fatores que modulam a resposta ao estresse tais como sexo, temperamento, períodos críticos do desenvolvimento e a presença ou ausência de suporte social. A interação entre os fatores genéticos e ambientais gera os perfis da resposta psicofisiológica que caracterizam os fenótipos de susceptibilidade e resiliência frente aos estressores e sua relação com uma patologia mental cada vez mais presente na sociedade moderna, o transtorno de estresse pós-traumático.

  9. Reptiles and Amphibians of Curaçao

    NARCIS (Netherlands)

    Rooij, de Nelly

    1922-01-01

    The Zoological Museum of Amsterdam received some collections of reptiles from Curaçao made by Dr. J. BOEKE in 1905, by Dr. C. J. VAN DER HORST in 1920 and by Mr. G. J. H. MOLENGRAAFF „Engineer” in 1921. I had the opportunity of studying them and will here give an enumeration of all the reptiles

  10. Variability in olecranon AO fracture fixation: A radiological study ...

    African Journals Online (AJOL)

    Background: Tension Band Wire(TBW) fixation of olecranon fracture is a commonly used technique by orthopaedic surgeons. However surgeons do not strictly adhere to the AO standard. Objectives: To determine the use and variability of this technique by surgeons at the hospital. Design: A hospital based retrospective ...

  11. The Foraminifera of Piscadera Bay, Curaçao

    NARCIS (Netherlands)

    Hofker, J.

    1971-01-01

    Piscadera Bay is situated 4 km West of Willemstad, Curaçao, between two limestone hills which have a height of about 100 m. It is a drowned river system, the entrance of which is almost completely blocked by a bar of coral debris reaching to about 2 meters above sea level. The following parts may be

  12. On some Polychaetous Annelids from Curaçao

    NARCIS (Netherlands)

    Horst, R.

    1922-01-01

    Though we know already a rather large number of Polychaetous Annelids from the Caribbean Sea, hitherto, as far as I know, no Annelids have been described from the coast of the island Curaçao and I therefore was very glad, that my colleague Dr. VAN DER HORST kindly placed in my hands for

  13. Atitudes frente ao uso de álcool, maconha e outras drogas: verificando relações de predição e mediação Attitudes toward alcohol, marijuana and other drugs use: verifying relations of prediction and mediation

    Directory of Open Access Journals (Sweden)

    Carlos Eduardo Pimentel

    2009-01-01

    Full Text Available O objetivo desta pesquisa consistiu em verificar as relações entre atitudes frente ao uso de álcool, maconha e drogas. Contou-se com uma amostra não-probabilística de 276 universitários, com idade média de 21 anos (DP = 3,40, de diversos cursos de universidade pública (94,2% e particular (5,8% da cidade de João Pessoa - PB. Estes estudantes responderam às escalas de atitudes frente ao uso de álcool, maconha e drogas. De acordo com as principais análises, pode-se verificar que as atitudes frente ao uso de álcool predizem as atitudes frente ao uso de maconha e drogas, e as atitudes frente ao uso de maconha mediam e moderam a relação entre atitudes frente ao uso de álcool e drogas, independente do sexo e da idade.The goal of this research consisted in verifying the relations between attitudes towards the use of alcohol, marijuana and other drugs. The study counted with a non-probabilistic sample of 276 academic students, with average age of 21 years old (SD = 3.40, from different courses from public (94.2% and private (5.8% universities in the city of João Pessoa - PB. Those students answered attitude scales toward the use of alcohol, marijuana and drugs. According to the main analysis, it was verified that the attitudes toward drug use predict the attitudes related to marijuana and drug use, and that the attitudes toward marijuana use mediate and moderate the relations between the attitudes related to the use of alcohol and drugs, apart from gender and age.

  14. Glycemia in newborns of hypertensive mothers according to maternal treatment Glicemia no recém-nascido de mãe hipertensa de acordo com a terapêutica materna

    Directory of Open Access Journals (Sweden)

    Silvana Darcie

    2004-01-01

    Full Text Available PURPOSE: To evaluate the evolution of glycemic levels in newborns of hypertensive mothers according to maternal treatment. METHODS: Prospective randomized study, including 93 newborns of mothers treated with isradipine (n = 39, atenolol (n = 40, or low sodium diet (control group - n=14. Glycemia was determined at birth (mother and newborn by the oxidase glucose method and in the 1st, 3rd, 6th, 12th, and 24th hours after birth (newborn by a test strip method. The evolution of glycemia was analyzed in each group (Friedman test. The groups were compared regarding glycemia (Kruskall-Wallis test, and linear regression models were constructed for the analyses (independent variable = maternal glycemia; dependent variables = umbilical cord, 3rd, and 6th hour glycemia. RESULTS: There were no statistically significant differences among the mean blood glucose levels of the 3 groups in any of the assessments. There was a correlation between maternal and umbilical cord blood glucose in the isradipine (r = 0.61; P OBJETIVO: Avaliar o comportamento da glicemia em recém-nascidos (RN de mães hipertensas conforme o tratamento materno. MÉTODOS: Estudo prospectivo, randomizado, incluindo 93 RN de mães tratadas com isradipina(n=39, atenolol (n=40 ou dieta - controle (n=14. Determinou-se a glicemia ao nascimento (mãe e RN, pela glicose oxidase e na 1ª., 3ª., 6ª., 12ª. e 24ª. horas (RN, por fita reagente. A evolução da glicemia, em cada grupo, foi analisada (Teste de Friedman. Os grupos foram comparados, quanto às glicemias, em cada momento (Teste de Kruskall-Wallis e foram ajustados modelos de regressão linear para as glicemias (variável independente = glicemia materna; variáveis dependentes = glicemias de cordão, 3ª. e 6ª. horas. RESULTADOS: Não houve diferença estatisticamente significante entre as glicemias médias dos 3 grupos, em qualquer uma das coletas. Houve correlação entre as glicemias materna e de cordão umbilical nos grupos

  15. Falácia naturalista e naturalismo moral: do é ao deve mediante o quero

    Directory of Open Access Journals (Sweden)

    Adriano Naves de Brito

    2010-06-01

    Full Text Available O objetivo deste texto é discutir alguns argumentos contra a aceitação da falácia naturalista. Pretende-se mostrar aspectos que parecem corretos na argumentação dos que recusam aquela falácia, e, a despeito de seus acertos, demonstrar que estão fundamentalmente errados. O eixo para este desfecho é a reformulação da falácia em termos da recusa da implicação entre o ser e o querer. Espera-se, assim, tornar mais claras as relações - e a ausência delas - entre verdade e moral, bem como abrir espaço para a defesa de um naturalismo moral não comprometido com a existência de fatos morais. Este texto está dividido em cinco partes. Na primeira, apresenta-se a falácia naturalista de acordo com Moore; na segunda, distingue-se essa entre as formulações de Moore e de Hume; na terceira, apresentam-se objeções à interdição da passagem do "é" ao "deve" e se formulam respostas a essas objeções; na quarta, reapresenta-se o problema da interdição entre "é" e "deve" e se focaliza uma solução alternativa a ele mediante o querer; e, finalmente, na quinta parte, elaboram-se algumas conclusões acerca do naturalismo e do realismo na moral.This article aims to discuss some arguments against the acceptance of the naturalistic fallacy. It intends to demonstrate that some aspects, which seem to be correct in the argumentation of those who refuse that fallacy, are, despite their pertinence in some points, fundamentally imprecise. In order to reach this outcome, the fallacy is reformulated in terms of the refuse of the implication between "being" and "the will". Therefore, it pretends to clarify the relations - and their absence - between truth and morality as well as enable a defense of a moral naturalism disengaged from the existence of moral facts. This text is divided in five parts. In the first one, I show the naturalistic fallacy according to Moore; in the second part, a distinction between Moore's and Hume's formulations of the

  16. Prevenção ao crime e teoria social

    OpenAIRE

    Sento-Sé, João Trajano

    2011-01-01

    O artigo estabelece um diálogo entre a criminologia positivista e algumas correntes contemporâneas da prevenção ao crime inspiradas em teorias sociológicas. Através desse exercício, busca-se evidenciar que algumas das formulações focadas no campo da prevenção já aparecem, em estado embrionário, na agenda teórica positivista. Do mesmo modo, torna-se possível explicitar que alguns postulados empíricos e práticos do positivismo são menos estranhos às teorias contemporâneas de prevenção ao crime ...

  17. Cuidado ao idoso deprimido e institucionalizado à luz da Complexidade

    Directory of Open Access Journals (Sweden)

    Cenir Gonçalves Tier

    2008-06-01

    Full Text Available Instituições de Longa Permanência para Idosos (ILPI são estabelecimentos para atendimento integral, institucionalizando pessoas de 60 anos e mais, dependentes/ou não, que não dispõem de condições para permanecer com a família ou/em seu domicílio. A institucionalização pode desencadear doenças, dentre elas a depressão. Foi objetivo deste artigo de atualização fazer uma reflexão sobre a relação do cuidado ao idoso deprimido e residente em ILPI com três princípios da Complexidade segundo Edgar Morin. Primeiro, se reflete sobre a complexidade; depois, se relaciona o cuidado ao idoso deprimido e residente em ILPI, com os princípios dialógico, recursivo e hologramático. Percebeu-se que a Complexidade pode sustentar teoricamente, não só a compreensão do fenômeno depressão no idoso residente em uma ILPI, como também inspirar o modo de cuidar que direcione aos trabalhadores da saúde, que atuam junto à pessoa idosa, a abordarem o idoso de forma mais global. Para tanto deve ser utilizada a Avaliação Multidimensional do Idoso, que analisa as várias dimensões da pessoa idosa, contribuindo no desenvolvimento de um plano de cuidado/tratamento e acompanhamento multidisciplinar e interdisciplinar adequados. A Complexidade vem sendo utilizada, por enfermeiros, para entender melhor a enfermagem e prestar cuidado mais adequado ao ser humano.

  18. Da esclerodermia ao síndrome de poems

    Directory of Open Access Journals (Sweden)

    Ana Sofia Montez

    2015-12-01

    Full Text Available Homem, 84 anos, com antecedentes de hipotiroidismo e alterações cutâneas recentes compatíveis com esclerodermia, confirmadas em biópsia cutânea, mas com estudo auto-imune negativo. Foi internado por queixas constitucionais. Ao exame objetivo, apresentava-se emagrecido, com lesões de vitiligo nas mãos além das de esclerodermia (figura 1 e distensão abdominal com ascite

  19. High-Resolution Imaging of Asteroids/Satellites with AO

    Science.gov (United States)

    Merline, William

    2012-02-01

    We propose to make high-resolution observations of asteroids using AO, to measure size, shape, and pole position (spin vectors), and/or to search for satellites. We have demonstrated that AO imaging allows determination of the pole/dimensions in 1 or 2 nights on a single target, rather than the years of observations with lightcurve inversion techniques that only yield poles and axial ratios, not true dimensions. Our new technique (KOALA) combines AO imaging with lightcurve and occultation data for optimum size/shape determinations. We request that LGS be available for faint targets, but using NGS AO, we will measure several large and intermediate asteroids that are favorably placed in spring/summer of 2012 for size/shape/pole. Accurately determining the volume from the often-irregular shape allows us to derive densities to much greater precision in cases where the mass is known, e.g., from the presence of a satellite. We will search several d! ozen asteroids for the presence of satellites, particularly in under-studied populations, particularly NEOs (we have recently achieved the first-ever optical image of an NEO binary [Merline et al. 2008b, IAUC 8977]). Satellites provide a real-life lab for testing collisional models. We will search for satellites around special objects at the request of lightcurve observers, and we will make a search for debris in the vicinity of Pluto, in support of the New Horizons mission. Our shape/size work requires observations over most of a full rotation period (typically several hours).

  20. Atitudes dos profissionais de enfermagem relacionadas ao Processo de Enfermagem

    Directory of Open Access Journals (Sweden)

    Erika de Souza Guedes

    2012-10-01

    Full Text Available Os objetivos do estudo foram descrever a disposição sobre o Processo de Enfermagem (PE e a percepção de poder clínico dos profissionais de enfermagem; analisar associações entre atitudes relacionadas ao PE e variáveis selecionadas. Participaram 1.605 auxiliares de enfermagem e enfermeiros (86,9% mulheres, idade média 44,12 anos; DP=9,55. O escore médio no instrumento Posições sobre o Processo de Enfermagem (PPE foi 112,37 (DP=22,28 e no Power as Knowing Participation in Change Tool - versão brasileira (PKPCT foi 281,12 (DP= 38,72. Os escores nos instrumentos foram mais altos para enfermeiros quando comparados aos auxiliares. Houve correlação positiva moderada entre escores do PPE e PKPCT. Para os auxiliares houve associação entre os escores no PPE, sexo e pós-graduação; e entre percepção de poder e sexo. Para os enfermeiros houve associação entre PKPCT e cargo de chefia. Mais estudos devem ser desenvolvidos com vistas a identificar variáveis potencialmente associadas ao uso do Processo de Enfermagem na prática clínica.

  1. Resposta ao estresse: I. Homeostase e teoria da alostase

    Directory of Open Access Journals (Sweden)

    Maria Bernardete Cordeiro de Sousa

    2015-03-01

    Full Text Available ResumoOs seres vivos desenvolvem ao longo de sua história evolutiva mecanismos de enfrentamento às condições adversas originadas tanto no ambiente geofísico como no ambiente social. Esta resposta adaptativa é coordenada e envolve diferentes sistemas funcionais, particularmente, os sistemas nervoso, endócrino e imune, e é denominada de resposta ao estresse e deve atender a duas demandas principais da vida: sobrevivência e reprodução. Esta revisão tem o objetivo de discutir o emprego do conceito clássico de homeostase e um conceito alternativo, alostase, que inclui os mecanismos preditivos e reativos de regulação, assim como os diferentes níveis de impacto dos estressores crônicos, resultando em sobrecarga alostática que pode ou não se seguir de falha alostática. Os mecanismos neurais, hormonais, imunes, sistêmicos e moleculares, que compreendem os sistemas alóstaticos subjacentes à resposta ao estresse são também apresentados.

  2. Avaliação anatomopatológica de cicatrizes uterinas de acordo com o tipo de sutura cirúrgica (modelo experimental Anatomopathological evaluation of uterine scars according to the type of surgical suture (experimental model

    Directory of Open Access Journals (Sweden)

    Rogério Gomes dos Reis Guidoni

    2007-12-01

    Full Text Available OBJETIVO: comparar, macro e microscopicamente, cicatrizes uterinas pós-cesáreas, nas quais foram feitas suturas com pontos separados, contínuos e contínuos ancorados. MÉTODOS: utilizamos três coelhas prenhes, realizando parto cesáreo no 26º dia de prenhez, com três incisões em cada corno uterino. As histerorrafias foram realizadas com fio Vicryl® 00, com suturas distintas (pontos separados, sutura contínua e contínua ancorada. No 60º dia pós-parto, realizamos histerectomia total abdominal e anexectomia bilateral, para avaliação das cicatrizes cirúrgicas. Na macroscopia, avaliamos o grau de retração cicatricial (longitudinal e transversal, o depósito de fibrina, presença de aderências e integridade dos fios de sutura. Na microscopia, utilizamos coloração de hematoxilina-eosina, para contagem de vasos sangüíneos e fibroblastos, e a coloração do tricômio de Masson, para quantificação do colágeno. Para a análise comparativa das cicatrizes, utilizamos os testes de Friedman e exato de Fisher, adotando nível de significância de 5%. RESULTADOS: foram obtidas 18 cicatrizes, seis para cada tipo de sutura. Obtivemos as seguintes médias 0,5/0,4/0,5 (p=0,069 para os graus de retração longitudinal e 0,3/0,4/0,3 (p=0,143 para os graus de retração transversal, respectivamente para as suturas com pontos separados, contínuo e contínuo ancorado. Todas as suturas apresentaram depósito de fibrina regular, ausência de aderência e reabsorção integral dos fios. Na microscopia, apuramos a média de vasos sangüíneos (158,5/139,3/172,1; p=0,293, de fibroblastos (351,6/345,8/354,3; p=0,311 e da porcentagem de tecido colágeno (44,0/45,5/48,5; p=0,422, respectivamente para as suturas com pontos separados, contínuo e contínuo ancorado. CONCLUSÕES: a técnica de histerorrafia na cesárea de coelhas (pontos simples, sutura contínua e contínua ancorada não determinou diferenças estatísticas significantes em relação aos

  3. Pré-condicionamento in vitro de plantas de cana-de-açúcar (Saccharum spp. para tolerância ao estresse salino

    Directory of Open Access Journals (Sweden)

    Gemima M. de Melo

    Full Text Available RESUMO Avaliou-se a capacidade de adaptação à salinidade de mudas de cana-de-açúcar da variedade RB98710 após pré-condicionamento (priming in vitro com cloreto de sódio (NaCl. O experimento foi conduzido no período de maio a outubro de 2013. Plantas foram micropropagadas em biorreatores de imersão temporária, com tratamentos de priming caracterizados pela adição de 25 mM de NaCl, durante 0, 12, 24 e 36 horas. Concluídos os períodos de priming, as plantas foram cultivadas em meio de enraizamento sem NaCl, aclimatizadas e submetidas a tratamento salino gradativo: S0 = sem NaCl; S1 = regas com 20→40→60 mM de NaCl acrescido à solução nutritiva, durante 30 dias. Procedeu-se à supressão do NaCl e avaliaram-se as plantas 15 dias depois. As variáveis foram: matéria seca da parte aérea (MSPA e radicular (MSR, número de perfilhos, estimativa de clorofila (Chl, conteúdo hídrico relativo e dano de membrana. As plantas pré-condicionadas não reduziram a MSPA quando submetidas ao NaCl. O efeito do estresse salino sobre a MSR foi anulado nas plantas submetidas ao priming por 24 h. O priming favoreceu o perfilhamento das plantas dos tratamentos por 24 ou 36 h. A recuperação após o estresse, avaliado 15 dias após a supressão do NaCl, não diferiu entre plantas submetidas ou não ao priming. De acordo com os resultados, o priming utilizado na variedade RB98710, pode favorecer a tolerância à salinidade.

  4. Fatores associados a baixa adesao ao tratamento medicamentoso em idosos

    Directory of Open Access Journals (Sweden)

    Noemia Urruth Leao Tavares

    2013-12-01

    Full Text Available OBJETIVO : Analisar fatores associados à baixa adesão ao tratamento medicamentoso em idosos. MÉTODOS : Estudo transversal de base populacional, com amostra representativa de 1.593 indivíduos com 60 anos ou mais, residentes na região urbana de Bagé, RS, em 2008. A amostragem foi realizada em múltiplos estágios. Os dados foram coletados em entrevistas individuais nos domicílios. Analisou-se a associação entre a baixa adesão referida ao tratamento medicamentoso mensurado pelo Brief Medication Questionnaire (BMQ e fatores demográficos, socioeconômicos, comportamentais e de saúde, assistência e prescrição. Foi utilizado modelo de regressão de Poisson para estimar as razões de prevalência bruta e ajustada, os respectivos intervalos de confiança de 95% e p-valor (teste de Wald. RESULTADOS : Cerca de 78,0% dos indivíduos referiram ter usado algum medicamento nos sete dias precedentes à entrevista. Desses, cerca de 1 / 3 foram considerados com baixa adesão ao tratamento. Os fatores significativamente associados à baixa adesão foram: idade (65 a 74 anos, não ter plano de saúde, ter que comprar (totalmente ou em parte os seus medicamentos, ter três ou mais morbidades, possuir incapacidade instrumental para a vida diária e usar três ou mais medicamentos. CONCLUSÕES : A utilização elevada de medicamentos, decorrente da alta prevalência de doenças crônico-degenerativas em idosos, e o acesso ao tratamento devem ser considerados pelos profissionais de saúde para adoção de estratégias que visem diminuir a baixa adesão ao tratamento, aumentando a resolutividade terapêutica e a qualidade de vida desses pacientes.

  5. Intervenção com a pessoa em crise suicida aos três níveis de prevenção: prevenção primária, secundária e terciária

    OpenAIRE

    Madeira, Joana Domingues

    2015-01-01

    Relatório do Trabalho de Projeto de Mestrado em Enfermagem de Saúde Mental e Psiquiatria A crise suicida impôs-se como uma inquietação traduzida em necessidade de busca da melhoria dos cuidados de enfermagem em geral e das intervenções específicas do enfermeiro especialista em saúde mental em particular, a desenvolver com a pessoa em crise suicida, aos níveis da prevenção primária, secundária e terciária. De acordo com a Organização Mundial de Saúde a cada ano cerca de 1 mil...

  6. Suppression of Plant Immune Responses by the Pseudomonas savastanoi pv. savastanoi NCPPB 3335 Type III Effector Tyrosine Phosphatases HopAO1 and HopAO2

    Science.gov (United States)

    Castañeda-Ojeda, María Pilar; Moreno-Pérez, Alba; Ramos, Cayo; López-Solanilla, Emilia

    2017-01-01

    The effector repertoire of the olive pathogen P. savastanoi pv. savastanoi NCPPB 3335 includes two members of the HopAO effector family, one of the most diverse T3E families of the P. syringae complex. The study described here explores the phylogeny of these dissimilar members, HopAO1 and HopAO2, among the complex and reveals their activities as immune defense suppressors. Although HopAO1 is predominantly encoded by phylogroup 3 strains isolated from woody organs of woody hosts, both HopAO1 and HopAO2 are phylogenetically clustered according to the woody/herbaceous nature of their host of isolation, suggesting host specialization of the HopAO family across the P. syringae complex. HopAO1 and HopAO2 translocate into plant cells and show hrpL-dependent expression, which allows their classification as actively deployed type III effectors. Our data also show that HopAO1 and HopAO2 possess phosphatase activity, a hallmark of the members of this family. Both of them exert an inhibitory effect on early plant defense responses, such as ROS production and callose deposition, and are able to suppress ETI responses induced by the effectorless polymutant of P. syringae pv. tomato DC3000 (DC3000D28E) in Nicotiana. Moreover, we demonstrate that a ΔhopAO1 mutant of P. savastanoi NCPBB 3335 exhibits a reduced fitness and virulence in olive plants, which supports the relevance of this effector during the interaction of this strain with its host plants. This work contributes to the field with the first report regarding functional analysis of HopAO homologs encoded by P. syringae or P. savastanoi strains isolated from woody hosts. PMID:28529516

  7. Suporte relacionado ao cuidado em saúde ao doente com aids: o modelo de comboio e a enfermagem

    Directory of Open Access Journals (Sweden)

    Edilene Aparecida Araújo da Silveira

    2011-06-01

    Full Text Available O presente estudo teve como objetivo conhecer a relação e a troca de suporte entre o doente com AIDS e pessoas à sua volta. O estudo está baseado no modelo de comboio das relações sociais que tem como uma de suas características a representação da rede em três círculos concêntricos. Os participantes eram pessoas que estavam internadas e que falaram sobre o suporte relacionado ao cuidado em saúde proporcionado por pessoas próximas, ou seja, que pertenciam ao círculo interno do comboio. A maioria dos participantes descreveu o círculo como sendo composto por no máximo cinco integrantes, sendo que pessoas da família foram as mais citadas. Os profissionais de saúde precisam conhecer o paciente e seu comboio, reconhecendo-os no contexto psicossocial e cultural de forma a favorecer a aceitação da soropositividade, mudanças no estilo de vida, ajuda nos cuidados de saúde e adesão ao tratamento.

  8. Análise das cepas de Streptococcus pneumoniae causadores de pneumonia invasiva: sorotipos e sensibilidade aos antimicrobianos

    Directory of Open Access Journals (Sweden)

    Cristina R. M. Yoshioka

    2011-02-01

    Full Text Available OBJETIVOS: Identificar os sorotipos de pneumococo mais frequentemente isolados de crianças internadas com pneumonia invasiva, comparar os sorotipos com os incluídos em vacinas conjugadas e analisar sua sensibilidade aos antimicrobianos mais utilizados na faixa etária pediátrica. MÉTODOS: Estudo descritivo, retrospectivo das pneumonias pneumocócicas identificadas em crianças internadas no hospital universitário da Universidade de São Paulo, no período de janeiro de 2003 a outubro de 2008. Os critérios de inclusão foram: faixa etária de 29 dias até 15 anos incompletos com diagnóstico clínico e radiológico de pneumonia e com cultura de sangue e/ou líquido pleural com crescimento de Streptococcus pneumoniae. RESULTADOS: Foram incluídas no estudo 107 crianças. Os sorotipos mais frequentes foram: 14 (36,5%, 1 (16,7%, 5 (14,6%, 6B (6,3% e 3 (4,2%. A proporção de sorotipos contidos na vacina conjugada heptavalente seria de 53,1%, na vacina 10-valente de 86,5% e na 13-valente seria de 96,9%. De acordo com os padrões do Clinical and Laboratory Standards Institute 2008, 100 cepas (93,5% de pneumococos foram sensíveis à penicilina (concentração inibitória mínima, CIM 8 µg/mL. Verificamos alta taxa de sensibilidade para as cepas testadas para vancomicina, rifampicina, ceftriaxone, clindamicina, cloranfenicol e eritromicina. CONCLUSÕES: Nossos resultados confirmam um expressivo impacto potencial das vacinas conjugadas, principalmente pela 10-valente e 13-valente, sobre os casos de pneumonias invasivas. Os resultados de sensibilidade à penicilina evidenciam que a opção terapêutica de escolha para o tratamento das pneumonias invasivas continua sendo a penicilina.

  9. Data of evolutionary structure change: 1AO5B-3BSQC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AO5B-3BSQC 1AO5 3BSQ B C VVGGFNCEKNSQPWQVAVYYQKEHICGGVLLDRNWVLTA...AHCYVDQYEVWLGKNKLFQEEPSAQHRLVSKSFPHPGFNMSLLMLQTIPPGADFSDDLMLLRLSKPADITDVVKPIALPTKEPKPGSKCLASGWGSITPT-WQKPDDLQC...bChain>C 3BSQC TTTSPDVTFPS 3BSQ C 3BSQC DT

  10. Data of evolutionary structure change: 1AO5B-2AGEX [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AO5B-2AGEX 1AO5 2AGE B X VVGGFNCEKNSQPWQVAVYYQKEHICGGVLLDRNWVLTAAHCYVDQYEVWLGKNKL...KCLASGWGSITPT-WQKPDDLQCVFITLLPNENCAKVYLQKVTDVMLCAGEMGGGKDTCRDDSGGPLICDGILQGTTSYGPVPCGKPGVPAIYTNLIKFNSWIKDTMMKNA... 2AGE X 2AGEX 1 2AGE X 2AGEX 2 2AGE X 2AGEX

  11. Data of evolutionary structure change: 1AO5A-2AGEX [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AO5A-2AGEX 1AO5 2AGE A X VVGGFNCEKNSQPWQVAVYYQKEHICGGVLLDRNWVLTAAHCYVDQYEVWLGKNKL...KCLASGWGSITPT-WQKPDDLQCVFITLLPNENCAKVYLQKVTDVMLCAGEMGGGKDTCRDDSGGPLICDGILQGTTSYGPVPCGKPGVPAIYTNLIKFNSWIKDTMMKNA... 2AGE X 2AGEX 1 2AGE X 2AGEX 2 2AGE X 2AGEX

  12. Probing circumplanetary disks with MagAO and ALMA

    Science.gov (United States)

    Wu, Ya-Lin

    2018-01-01

    The dedication of the Magellan Adaptive Optics (MagAO) on the 6.5 m Clay Telescope has opened a new era in high-contrast imaging. Its unique diffraction-limited wavelengths of 0.6 to 1 micron helps to probe circumplanetary disks by measuring the amount of dust reddening as well as by searching for the strongest gas accretion indicator H-alpha (0.65 micron). Using MagAO, I found that two wide-orbit planetary-mass companions CT Cha B and 1RXS 1609 B have a significant dust extinction of Av ~ 3 to 5 mag likely from their disks. For GQ Lup B, I found that it is actively accreting material from its disk and emitting strong H-alpha emission. My research with MagAO demonstrates that circumplanetary disks could be ubiquitous among young giant planets. I later carried out a survey using ALMA to image accretion disks around several wide planet-mass companions at 1.3 mm continuum and CO (2-1). This is the first systematic study aiming to measure the size, mass, and structure of planetary disks. However, except for FW Tau C (which was shown to actually be a low-mass star from the dynamical mass measurement) no disks around the companions were found in my ALMA survey. This surprising null result implies that circumplanetary disks are much more compact and denser than expected, so they are faint and optically thick in the radio wavelengths. Therefore, mid- to far-infrared may be more favorable to characterize disk properties. The MIRI camera on the JWST can test this compact optically-thick disk hypothesis by probing disk thermal emission between 10 and 25 micron.

  13. Identification of system misregistrations during AO-corrected observations

    Science.gov (United States)

    Béchet, C.; Thiébaut, É.; .; Tallon, M.; Kolb, J.; Madec, P.-Y.

    2011-09-01

    The E-ELT will be equipped with a deformable mirror inside the telescope. The performance of reconstruction and control depends on the calibration of the interaction matrix- or a model of the interaction matrix- , which characterizes the system and the relationship between the commands sent to the deformable mirrors (DM) and the wavefront sensors (WFS) slopes. Such a calibration will be more complex than for the current systems at the VLT since it will have to be at least partly measured on sky and for a much larger number of degrees of freedom (more than 5000). In addition, gravity or temperature variations for instance are likely to introduce slow evolution of the matching between the M4 Deformable mirror and the WFS geometry. This can occur during observations and therefore degrade the adaptive optics (AO) correction. To relax the need of frequent painful calibrations and to prevent a loss of performance due to misregistrations, we investigate how to track the evolution of the interaction matrix errors in closed-loop without introducing any degradation in the observations. This is done thanks to identification methods and optimization theory. First, we formally describe the problem and the difficulties of such an identification in closed-loop configuration. Then, we present 2 solutions, based on the optimization of the error of estimates of the WFS slopes, at the output of the closed-loop AO. The performance of the methods and their limitations are discussed formally and thanks to numerical simulations of a high order AO system. We finally explore to which extent these methods currently studied for the Adaptive Optics Facility (AOF) at the VLT can be applied to the E-ELT.

  14. Anemia e peso ao nascer Anemia and birthweight

    Directory of Open Access Journals (Sweden)

    Taqueco T Uchimura

    2003-08-01

    Full Text Available OBJETIVO: Verificar a influência do baixo peso ao nascer (BPN na anemia e desnutrição da criança, ao longo do primeiro ano de vida. MÉTODOS: A população amostral foi constituída por todas as crianças menores de um ano de idade atendidas nas unidades de saúde do Município de Maringá, PR, em 1998, num total de 587. Considerou-se baixo peso ao nascer, todas as crianças com peso OBJECTIVE: To verify the influence of Low Birthweight (LBW on child anemia and malnutrition during the first year of life. METHODS: Sample population included all children under one year seen at Health Units of the municipality of Maringá, southern Brazil, in 1998. Total sample size was 587 children. LBW was defined as birthweight below 2 500 g. The analysis of growth for the weigh-for-age and height-for-age indicators was based on NationalCenter for HealthSstatiscs standards. For anemia diagnosis, a biochemical hemoglobin concentration dosage, using HemoCue direct colorimetric method was employed. Children with [Hb] <11,0 g/dL were considered as anemic. RESULTS: Fifty-eight percent of the studied population were anemic, and 37 children (6.3% presented LBW. Anemia was more prevalent during the second semester of life (p=0.0093. Undernutrition, as indicated by the height-for-age indicator, was high especially for children aged 0-3 months with LBW. CONCLUSIONS: Although LBW rates among the studied population were similar to those of developed countries, we suggest the implementation of specific antenatal care for high-risk women, aiming at reducing LBW, an event that affects the child, hampering its growth and increasing the risk of anemia and its countless deleterious consequences.

  15. Child abuse: a common problem in Curaçao?

    Science.gov (United States)

    Klein, K; Boersma, A A; Meyboom-de Jong, B; de Bruijn, J

    2013-02-01

    To assess the prevalence of child abuse among high school students in Curacao. A questionnaire survey among high school students up to 17 years of age was conducted. The questionnaire was based on existing literature and validated questionnaires. The questionnaire used was analysed and adapted to the situation in Curaçao by a panel of experts on child abuse. The primary objective was to gain insight into the incidence, prevalence and various forms of child abuse among students in Curaçao. Five forms of child abuse are distinguished in the literature: physical abuse, emotional abuse, sexual abuse, neglect and exploitation. Furthermore, the degree of confidence of the students in general practitioners (GPs) as care providers in the field of child abuse was explored. Questionnaires from 545 of the 628 respondents were included. In total, 43% of the respondents had ever-experienced an event which could be defined as (a form of) child abuse. More than one-third of the respondents reporting child abuse ever had an experience that could be interpreted as physical abuse. More than 15% of the respondents reporting child abuse had experienced sexual abuse. Girls experienced significantly more sexual abuse than boys. Emotional abuse in the last year was experienced by 3% of the respondents. One per cent of the respondents ever-experienced neglect. According to most respondents, GPs were not seen as care providers in cases of child abuse; they believed that GPs were mainly to be consulted for illnesses or physical symptoms and not for forms of child abuse. The prevalence of ever-having-experienced a form of child abuse is estimated at 431 per 1000 students. Child abuse, particularly physical abuse, is common in Curaçao, and is probably comparable to other surrounding countries. General practitioners were not seen as care providers in identifying and reporting cases of child abuse according to most respondents.

  16. Fatores maternos associados ao peso fetal estimado pela ultra-sonografia Maternal factors associated with fetal weight estimated by ultrasonography

    Directory of Open Access Journals (Sweden)

    Adriana Suely de Oliveira Melo

    2008-09-01

    Full Text Available OBJETIVO: avaliar o efeito de variáveis maternas, socioeconômicas e obstétricas, assim como a presença de incisuras na 20ª e na 24ª semana, sobre o peso fetal estimado no final da gravidez (36ª semana em gestantes atendidas pelo Programa Saúde da Família em uma cidade do interior do Nordeste do Brasil. MÉTODOS: estudo longitudinal incluindo 137 gestantes. As gestantes foram acompanhadas a cada quatro semanas para aferição das condições clínicas, socioeconômicas e obstétricas, incluindo o peso materno. As artérias uterinas foram avaliadas pelo Doppler na 20ª e 24ª semana, o peso fetal e o índice de líquido amniótico (ILA foram determinados na 36ª semana. O estado nutricional materno inicial foi determinado pelo índice de massa corpórea (IMC, classificando-se as gestantes como com baixo peso, eutróficas, com sobrepeso e obesas. O ganho ponderal durante a gestação foi avaliado de acordo com o estado nutricional inicial, sendo ao final do segundo e terceiro trimestre classificado em ganho ponderal insuficiente, adequado e excessivo. Foi realizada análise de variância para avaliar a associação do peso fetal estimado na 36ª semana com as variáveis preditoras, ajustada por regressão linear múltipla. RESULTADOS: observou-se associação entre peso fetal estimado na 36ª semana e idade da mãe (p=0,02, trabalho materno (p=0,02, estado nutricional inicial (p=0,04, ganho ponderal no segundo trimestre (p=0,01, presença de incisuras nas artérias uterinas (p=0,02 e ILA (p=0,007. Os principais fatores associados ao peso fetal estimado na 36ª semana, após a análise de regressão múltipla, foram: IMC no início da gravidez, ganho ponderal no segundo trimestre, ILA e tabagismo. CONCLUSÕES: o peso fetal no presente estudo associou-se positivamente ao estado nutricional materno inicial, ao ganho ponderal no segundo trimestre, ao volume do líquido amniótico e negativamente ao hábito de tabagismo.PURPOSE: to evaluate the

  17. Assistência de enfermagem humanizada ao paciente em UTI

    OpenAIRE

    Vieira, Claudir Aparecido; Maia, Luiz Faustino dos Santos

    2013-01-01

    Hoje em dia a humanização é ponto de pauta nos encontros nacionais e internacionais da área da saúde. Assim, cada vez mais enfermeiros nas unidades de terapia intensiva tem se preocupado com a sua prática. O presente estudo foi desenvolvido com o objetivo de compreender, reconhecer e entender como o comportamento humanizado reflete ao paciente e identificar a percepção da equipe de enfermagem sobre o processo de humanização. Trata-se de uma pesquisa de revisão bibliográfica descritiva com aná...

  18. Resistencia ao brometo de etidio em aspergillus nidulans

    OpenAIRE

    Maria Elizabeth Scarazzatti Frau

    1985-01-01

    Resumo: O presente trabalho teve por objetivo isolar e ana-lisar geneticamente mutantes de Aspergillus nidulans resistentes ao Brometo de Etídio (BE), bem como estudar os efeitos da riboflavina em relação a toxicidade do BE. Foram isolados mutantes espontâneos e induzidos. Dos mutantes isolados espontaneamente apenas 3 continuaram a apresentar resistência, sendo 1 da linhagem A e 2 da linhagem biAl methGl. Os outros mutantes (16) foram obtidos por indução com luz ultravioleta. Destes apenas 9...

  19. Stream-Field Interactions in the Magnetic Accretor AO Piscium

    Science.gov (United States)

    Hellier, Coel; van Zyl, Liza

    2005-06-01

    UV spectra of the magnetic accretor AO Psc show absorption features for half the binary orbit. The absorption is unlike the wind-formed features often seen in similar stars. Instead, we attribute it to a fraction of the stream that overflows the impact with the accretion disk. Rapid velocity variations can be explained by changes in the trajectory of the stream depending on the orientation of the white dwarf's magnetic field. Hence, we are directly observing the interaction of an accretion stream with a rotating field. We compare this behavior to that seen in other intermediate polars and in SW Sex stars.

  20. Aspect-Oriented Business Process Modeling with AO4BPMN

    Science.gov (United States)

    Charfi, Anis; Müller, Heiko; Mezini, Mira

    Many crosscutting concerns in business processes need to be addressed already at the business process modeling level such as compliance, auditing, billing, and separation of duties. However, existing business process modeling languages including OMG's Business Process Modeling Notation (BPMN) lack appropriate means for expressing such concerns in a modular way. In this paper, we motivate the need for aspect-oriented concepts in business process modeling languages and propose an aspect-oriented extension to BPMN called AO4BPMN. We also present a graphical editor supporting that extension.

  1. O papel do leite ao longo do ciclo de vida

    OpenAIRE

    Lima, Joana Catarina Dinis

    2012-01-01

    Resumo da tese: A presença do leite nos guias alimentares denota a sua importância na alimentação humana. Contudo, não é consensual que este alimento deva fazer parte da nossa alimentação ao longo de todo o ciclo de vida. Sabe-se que cada espécie produz um tipo de leite diferente, com diversas moléculas bioativas e nutrientes que modulam o seu crescimento e desenvolvimento corporal. Recentemente, uma parte da fração proteica do leite tem sido apontada como tendo um possível efeito estimulante...

  2. Apple fruit copper amine oxidase isoforms: peroxisomal MdAO1 prefers diamines as substrates, whereas extracellular MdAO2 exclusively utilizes monoamines.

    Science.gov (United States)

    Zarei, Adel; Trobacher, Christopher P; Cooke, Alison R; Meyers, Ashley J; Hall, J Christopher; Shelp, Barry J

    2015-01-01

    4-Aminobutyrate (GABA) accumulates in apple fruit during controlled atmosphere storage. A potential source of GABA is the polyamine putrescine, which can be oxidized via copper-containing amine oxidase (CuAO), resulting in the production 4-aminobutanal/Δ(1)-pyrroline, with the consumption of O2 and release of H2O2 and ammonia. Five putative CuAO genes (MdAO genes) were cloned from apple (Malus domestica Borkh. cv. Empire) fruit, and the deduced amino acid sequences found to contain the active sites typically conserved in CuAOs. Genes encoding two of these enzymes, MdAO1 and MdAO2, were highly expressed in apple fruit and selected for further analysis. Amino acid sequence analysis predicted the presence of a C-terminal peroxisomal targeting signal 1 tripeptide in MdAO1 and an N-terminal signal peptide and N-glycosylation site in MdAO2. Transient expression of green fluorescent fusion proteins in Arabidopsis protoplasts or onion epidermal cells revealed a peroxisomal localization for MdAO1 and an extracellular localization for MdAO2. The enzymatic activities of purified recombinant MdAO1 and MdAO2 were measured continuously as H2O2 production using a coupled reaction. MdAO1 did not use monoamines or polyamines and displayed high catalytic efficiency for 1,3-diaminopropane, putrescine and cadaverine, whereas MdAO2 exclusively utilized aliphatic and aromatic monoamines, including 2-phenylethylamine and tyramine. Together, these results indicate that MdAO1 may contribute to GABA production via putrescine oxidation in the peroxisome of apple fruit under controlled atmosphere conditions. MdAO2 seems to be involved in deamination of 2-phenylethylamine, which is a step in the biosynthesis of 2-phenylethanol, a contributor to fruit flavor and flower fragrance. © The Author 2014. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  3. Checklist of the birds of Aruba, Curaçao and Bonaire, South Caribbean

    NARCIS (Netherlands)

    Prins, T.G.; Reuter, J.H.; Debrot, A.O.; Wattel, J.; Nijman, V.

    2009-01-01

    We present an updated checklist of the birds of the islands of Aruba, Curaçao and Bonaire, and the islets of Klein Curaçao and Klein Bonaire, southern Caribbean, and compare this with earlier checklists (K.H. Voous, Stud. Fauna Curaçao Carib. Isl. 7: 1-260, 1957; Ardea 53: 205-234, 1965; Birds of

  4. Predictive factors for neuromotor abnormalities at the corrected age of 12 months in very low birth weight premature infants Fatores preditivos para anormalidades neuromotoras aos 12 meses de idade corrigida em prematuros de muito baixo peso

    Directory of Open Access Journals (Sweden)

    Rosane Reis de Mello

    2009-06-01

    Full Text Available BACKGROUND: The increase in survival of premature newborns has sparked growing interest in the prediction of their long-term neurodevelopment. OBJECTIVE: To estimate the incidence of neuromotor abnormalities at the corrected age of 12 months and to identify the predictive factors associated with altered neuromotor development in very low birth weight premature infants. METHOD: Cohort study. The sample included 100 premature infants. The outcome was neuromotor development at 12 months classified by Bayley Scale (PDI and neurological assessment (tonus, reflexes, posture. A multivariate logistic regression model was constructed. Neonatal variables and neuromotor abnormalities up to 6 months of corrected age were selected by bivariate analysis. RESULTS: Mean birth weight was 1126g (SD: 240. Abnormal neuromotor development was presented in 60 children at 12 months corrected age. CONCLUSION: According to the model, patients with a diagnosis including bronchopulmonary dysplasia, hypertonia of lower extremities, truncal hypotonia showed a 94.0% probability of neuromotor involvement at 12 months.INTRODUÇÃO: O aumento na sobrevida de recém-nascidos prematuros tem suscitado interesse crescente na predição do seu neurodesenvolvimento a longo prazo. OBJETIVO: Estimar a incidência de anormalidades neuromotoras aos 12 meses de idade corrigida e identificar os fatores associados ao desenvolvimento neuromotor alterado em prematuros de muito baixo peso. MÉTODO: Estudo de coorte. A amostra incluiu 100 crianças prematuras.O desfecho foi o desenvolvimento neuromotor aos 12 meses. Modelo de regressão logística multivariado foi construído. Variáveis neonatais e anormalidades neuromotoras até os 6 meses de idade corrigida foram selecionadas por análise bivariada. RESULTADOS: O peso de nascimento médio foi 1126g (DP:240. Aos 12 meses 60% das crianças apresentaram desenvolvimento neuromotor alterado. CONCLUSÃO: De acordo com o modelo, pacientes com diagn

  5. Titanium alloys (AoN) and their involvement in osseointegration.

    Science.gov (United States)

    Danza, Matteo; Zollino, Ilaria; Candotto, Valentina; Cura, Francesca; Carinci, Francesco

    2012-12-01

    Osseointegration is essential for a long-term successful and inflammation-free dental implant. Such a result depends on osteoblastic cells growth and differentiation at the tissue-implant interface. The aim of this study was to compare two different AoN titanium layers (GR4 and GR5) to investigate which one had a greater osteoconductive power using human osteoblasts (HOb) culture at two different time-points. The expression levels of some bone-related (ALPL, COL1A1, COL3A1, SPP1, RUNX2, and SPARC) were analyzed using real time reverse transcription-polymerase chain reaction (real time RT-PCR). Real-time RT-PCR data showed that after 3 days of treatment with TiA4GR, the genes up-regulated were COL3A1, ALPL, SPP1, and RUNX2. Moreover, no difference in gene expression was noticed 4 days later. On the other hand, the genes that overexpressed after 3 days of treatment with AoN5GR were ALPL, SPP1, and RUNX2. In both cases, the expression of COL1A1 and SPARC was negatively regulated. Our data showed that both titanium surfaces led to osteoblasts recruitment, maturation, and differentiation, thus promoting osseointegration at the tissue-implant interface.

  6. Atribuições de significados ao transplante renal

    Directory of Open Access Journals (Sweden)

    Quintana, Alberto M.

    2011-01-01

    Full Text Available Este trabalho teve foco na investigação das atribuições de significados ao transplante renal de pacientes com Insuficiência Renal Crônica (IRC de um Hospital Universitário da Região Sul. Foi utilizado um método qualitativo e participaram doze pessoas na pesquisa. Os instrumentos utilizados foram a entrevista semidirigida e a autofotografia. Para a análise dos dados foi empregada a técnica de análise de conteúdo, o que permitiu que fossem construídas quatro categorias temáticas: a ansiedade da espera, os conflitos ante o doador, as expectativas em relação ao devir e a vida antes e depois do transplante. Constatou-se que a possibilidade deste traz consigo uma série de repercussões psíquicas devido o fato de ser visto como algo que restitui a vida, proporciona bem-estar e sentimento de liberdade, mesmo levando em consideração que ainda persistem os cuidados com o corpo, com a alimentação e com os remédios

  7. New Results from the AO327 Drift Pulsar Survey

    Science.gov (United States)

    Deneva, Julia S.; Stovall, K.; McLaughlin, M.; Bates, S.; Freire, P.; Martinez, J.; Jenet, F.; Bagchi, M.

    2014-01-01

    The Arecibo 327 MHz drift pulsar survey (AO327) has operated since 2010 and aims to cover the entire Arecibo sky (declinations of -1 to 38 degrees). We present details on the progress of the survey and a new set of discoveries over the past year. Phase 1 of AO327 targets declinations of -1 to 28 degrees and is 55% complete; Phase 2 will target declinations of 28 to 38 degrees. The survey is expected to be completed in 2017. Out of a total of 28 new pulsars, 12 were found in 2013, including three millisecond pulsars. PSR J2234+06 has a rotation period of 3.58 ms and is in a 32-day orbit in a binary system with a white dwarf companion. This pulsar is bright and a very stable rotator, making it suitable for inclusion in Pulsar Timing Arrays. The orbit of J2234+06 has an eccentricity of 0.13, which cannot be accounted for by stellar evolution but may be explained by an origin in a subsequently disrupted hierarchical triple, or by an exchange interaction. PSR J0509+08 has a period of 4.06 ms and is in a 4.9-day binary system with a white dwarf companion. This pulsar is also a candidate for inclusion in PTAs.

  8. UMA PROPOSTA DE ABORDAGEM AO PROBLEMA DE FLÁVIO JOSEFO APLICADA AO ENSINO MÉDIO

    OpenAIRE

    Márcia Erondina Dias de Souza

    2013-01-01

    Neste trabalho, apresentamos uma sequência didática de atividades elaboradas para um grupo de alunos do ensino médio, na faixa etária de 15 a 18 anos, tendo como principal objetivo estudar o problema proposto pelo matemático Flávio Josefo, nos meados do ano 64. Conta a lenda que um grupo de rebeldes, dentre eles Flávio Josefo, foi encurralado numa caverna pelo exército inimigo. Preferindo o suicídio à captura, os rebeldes decidiram formar um círculo e, contando ao longo dest...

  9. OBSOLESCÊNCIA PROGRAMADA E TEORIA DO DECRESCIMENTO VERSUS DIREITO AO DESENVOLVIMENTO E AO CONSUMO (SUSTENTÁVEIS)

    OpenAIRE

    Oliveira da Silva, Maria Beatriz Beatriz; UNiversidade Federal de Santa Maria (UFSM)

    2012-01-01

    Inspirado em um documentário intitulado “Prêt à Jeter”, este texto tem como objetivo central colocar em apreciação algumas reflexões acerca da obsolescência programada como uma das estratégias do modelo de desenvolvimento capitalista e ensaiar uma reposta às seguintes questões: para combater a obsolescência programada se faz necessária a defesa de uma “teoria do decrescimento”? Sendo a obsolescência programada uma das estratégias da sociedade de consumo, é possível combatê-la e, ao mesmo temp...

  10. Competitividade de biótipos de capim-arroz resistente e suscetível ao quinclorac Competitiveness of echinochloa biotypes resistant and susceptible to quinclorac

    Directory of Open Access Journals (Sweden)

    G. Concenço

    2008-03-01

    Full Text Available Objetivou-se com este trabalho avaliar a competitividade de dois biótipos de capim-arroz, resistente e suscetível ao quinclorac, coletados em regiões orizícolas do Estado de Santa Catarina. O experimento foi instalado em ambiente protegido, e os tratamentos constaram de diferentes densidades de plantas dos biótipos de capim-arroz comprovadamente resistente (ITJ-13 e suscetível (ITJ-17 ao quinclorac, oriundos da região arrozeira de Itajaí/SC. No centro da unidade experimental, foram semeadas três sementes do biótipo de capim-arroz, considerado como o tratamento da unidade experimental. Na periferia foram semeadas dez sementes do biótipo oposto ao do tratamento (central. Dez dias após a germinação foi efetuado o desbaste, deixando-se apenas uma planta no centro da unidade experimental e um número variável de plantas do biótipo oposto, de acordo com o tratamento (0, 1, 2, 3, 4 ou 5 plantas por vaso. O delineamento experimental utilizado foi o completamente casualizado, em esquema fatorial 2 x 6, com quatro repetições. Aos 40 dias após a emergência, foram avaliados altura de plantas, número de afilhos e de folhas, área foliar, massa fresca e seca e conteúdo de água de colmos e folhas. Os dados foram analisados pelo teste F, sendo efetuado teste de Duncan para comparar o efeito de densidade de plantas e teste da Diferença Mínima Significativa (DMS para avaliar diferenças entre os biótipos resistente e suscetível, além de correlação linear simples entre as variáveis avaliadas. Nas análises, utilizou-se o nível de 5% de probabilidade. Os biótipos estudados de capim-arroz resistente e suscetível ao quinclorac são similares quando sob alta intensidade de competição, com vantagem em algumas variáveis para o biótipo suscetível sob baixa ou moderada intensidade competitiva.The objective of this research was to evaluate the competitive potential of two Echinochloa sp. biotypes, resistant and susceptible to

  11. Assessment of pelvic floor by three-dimensional-ultrasound in primiparous women according to delivery mode: initial experience from a single reference service in Brazil Avaliação do assoalho pélvico por meio da ultrassonografia tridimensional de mulheres primíparas de acordo com o tipo de parto: experiência inicial de um centro de referência do Brasil

    Directory of Open Access Journals (Sweden)

    Edward Araujo Júnior

    2013-03-01

    tipo de parto: cesariana eletiva (n=10, parto vaginal (n=16 e fórceps (n=9. A ultrassonografia tridimensional do assoalho pélvico foi realizada no segundo dia pós-parto com a paciente em repouso. Utilizou-se transdutor convexo volumétrico (RAB4-8L em contato com os grandes lábios vaginais, estando a paciente em posição ginecológica. Medidas biométricas do hiato urogenital foram tomadas no plano axial da imagem renderizada para avaliar a área, os diâmetros anteroposterior e transverso, a espessura média e a avulsão do músculo elevador do ânus. Diferenças entre os grupos foram avaliadas pela determinação da média das diferenças com seus respectivos intervalos de confiança de 95%. As proporções de avulsão do músculo elevador do ânus foram comparadas entre a cesárea eletiva e o parto vaginal pelo teste exato de Fisher. RESULTADOS: As áreas médias do hiato urogenital dos partos vaginais e fórceps foram 17,0 e 20,1 cm², respectivamente, contra 12,4 cm² do Grupo Controle (cesárea eletiva. Avulsão do músculo elevador do ânus foi observado em mulheres submetidas ao parto vaginal (3/25; no entanto, não houve diferença significativa entre os grupos cesárea e parto vaginal (p=0,5. CONCLUSÃO: A ultrassonografia tridimensional por via perineal foi útil na avaliação do assoalho pélvico de mulheres primíparas, diferenciando alterações pélvicas de acordo com o tipo de parto.

  12. Performance of the Sewage Treatment Plant of S˜ao Jo˜ao de Iracema (Brazil

    Directory of Open Access Journals (Sweden)

    Tsunao Matsumoto

    2016-05-01

    Full Text Available Context: Some of the most important parameters measured in the sewage treatment plant –STP- are: organic matter, solids and faecal organisms. The objective of this work was to diagnose the performance of S˜ao Jo˜ao de Iracema STP for those parameters removal. Method: A batimetric survey of the anaerobic and facultative lagoons; the STP influent and effluent monitoring in three different climate seasons of 3-month long each were conducted by dissolved oxygen, pH, temperature, BOD, filtered BOD, COD, solids and coliforms measuring. Results: Sludge accumulations of 1.3 and 6.5% in the anaerobic and facultative lagoons were registered; average BOD removal was of 73.6%, smaller than the 80% recommended by Brazilian legislation; the average faecal coliform number on final effluent was of 9.55*106/100mL, above the per-missible limit of 1000/100mL. Conclusions: The STP needs to set-up a post treatment system that guarantees additional organic matter removal and fecal coliforms in order to adjust the effluent quality to the environmental legislation standards.

  13. Forma musical como um processo: do isomorfismo ao heteromorfismo

    Directory of Open Access Journals (Sweden)

    Danilo Rossetti

    2016-05-01

    Full Text Available Este artigo se propõe a analisar a questão da forma musical a partir do momento em que temos, no início do século XX, uma ruptura com sua predeterminação, passando a se configurar como o resultado de diferentes operações ou processos de composição. Neste contexto, abordamos a noção de forma estatística, ligada ao isomorfismo e à continuidade entre as diferentes escalas temporais presentes numa obra musical (MEYER-EPPLER, 2009 [1954]; STOCKHAUSEN 1959; EIMERT, 1959 e ao princípio do grau de mudança (STOCKHAUSEN, 1989b [1958]; KOENIG, 1963, 1965, bem como a noção da forma como uma emergência, ligada ao heteromorfismo e à descontinuidade entre as diversas escalas temporais (VAGGIONE, 1994, 2010. Para tanto, trazemos como fundamentação teórica o método alagmático e o princípio da individuação das formas de Gilbert Simondon (2005, assim como as características morfológicas perceptivas de saliência (saillance e pregnância (prégnance de René Thom (1988, 1990a, além de sua teoria das catástrofes (THOM, 1985. No contexto proposto, a fusão de timbres é pensada como um processo alagmático gerador de novas formas, sendo analisada a partir de diferentes possibilidades tais como por jitter (DUBNOV; TISHBY; COHEN, 1997, síntese granular, permeabilidade (LIGETI, 2010a [1958], micropolifonia (LIGETI, 2010c [1980] e convolução (ERBE, 1997; JAFFE, 1987; ROADS, 1993; VAGGIONE, 1996. Concluímos a respeito dos processos de fusão analisados não apenas considerando-os isoladamente, mas como operações que propiciam o nascimento da forma musical, afirmando o pensamento da forma como um processo e não como algo definido a priori.

  14. Do dispositivo da sexualidade ao dispositivo da biotecnologia

    Directory of Open Access Journals (Sweden)

    Laura Belluzzo de Campos Silva

    2015-12-01

    Full Text Available Resumo No livro “A vontade de saber”, onde definiu o que chamou de dispositivo da sexualidade, Foucault deixou entrever que talvez outro dispositivo já estivesse em vias de se compor. Os avanços recentes no campo da biotecnologia molecular reabrem a discussão sobre as bases biológicas do comportamento, acenando com a possibilidade de novas formas de intervenção e com a de seu uso para fins comerciais. Partindo dessas idéias, este trabalho visa discutir que contribuições o conceito de biopoder pode trazer em relação aos recentes avanços da biotecnologia e cartografar algumas linhas que compõem esse novo dispositivo, que poderíamos chamar de biotecnológico.

  15. Lévi-Strauss nos 90 voltas ao passado

    Directory of Open Access Journals (Sweden)

    Lévi-Strauss Claude

    1998-01-01

    Full Text Available Este artigo responde às críticas formuladas por Christian Delacampagne e Bernard Traimond em "A Polêmica Sartre/Lévi-Strauss Revisitada. Nas Raízes das Ciências Sociais de Hoje", publicado em Les Temps Modernes 596 (novembro-dezembro de 1997. Para fazê-lo, recorda inicialmente o caráter relativo da oposição entre "sociedades frias" e "sociedades quentes". Em seguida, refuta a tese de que Maurice Merleau-Ponty, sob a capa de um elogio, teria dirigido críticas veladas ao autor. Finalmente, reconhecendo o afastamento da antropologia de hoje em face das posições do autor, admite, sem se pronunciar sobre o valor desse movimento, que temas de ar sartriano ressurgem nos antropólogos contemporâneos.

  16. Cuidado ao idoso deprimido e institucionalizado à luz da Complexidade

    OpenAIRE

    Cenir Gonçalves Tier; Valéria Lerch Lunardi; Silvana Sidney Costa Santos

    2008-01-01

    Instituições de Longa Permanência para Idosos (ILPI) são estabelecimentos para atendimento integral, institucionalizando pessoas de 60 anos e mais, dependentes/ou não, que não dispõem de condições para permanecer com a família ou/em seu domicílio. A institucionalização pode desencadear doenças, dentre elas a depressão. Foi objetivo deste artigo de atualização fazer uma reflexão sobre a relação do cuidado ao idoso deprimido e residente em ILPI com três princípios da Complexidade segundo Edgar ...

  17. Cuidado ao idoso deprimido e institucionalizado à luz da Complexidade

    OpenAIRE

    Tier, Cenir Gonçalves; Lunardi, Valéria Lerch; Santos, Silvana Sidney Costa

    2008-01-01

    Instituições de Longa Permanência para Idosos (ILPI) são estabelecimentos para atendimento integral, institucionalizando pessoas de 60 anos e mais, dependentes/ou não, que não dispõem de condições para permanecer com a família ou/em seu domicílio. A institucionalização pode desencadear doenças, dentre elas a depressão. Foi objetivo deste artigo de atualização fazer uma reflexão sobre a relação do cuidado ao idoso deprimido e residente em ILPI com três princípios da Complexidade segundo Edg...

  18. Empreendedorismo: do ensino básico ao ensino superior

    OpenAIRE

    Gonçalves, Vitor

    2009-01-01

    A Sociedade da Informação exige cada vez mais indivíduos com capacidade e espírito empreendedor. Embora seja visto como uma resposta ao problema do desemprego através da promoção do auto-emprego, o empreendedorismo deve assumir uma semântica mais abrangente. Não basta correr o risco e criar empresas, é necessário procurar fazê-lo com responsabilidade, competência e excelência. Mas, essa atitude empreendedora não é apenas apanágio dos gestores ou empresários, terá de ser também uma necessi...

  19. MODERNIDADE E LIBERTAÇÃO: DOIS DESAFIOS AO CRISTIANISMO

    Directory of Open Access Journals (Sweden)

    . Editorial

    1987-01-01

    Full Text Available A recente Assembléia Geral da Sociedade de Teologia e Ciências da Religião (SOTER, reunida em Belo Horizonte de 6 a 9 de julho passado, dedicou boa parte de seus trabalhos ao "debate em torno da Modernidade em relação com as preocupações da Teologia da Libertação no Brasil". Está mais uma vez relançada a sempre conflitiva questão da relação entre Cristianismo e Modernidade, só que agora percebida num Continente que não simplesmente goza de algumas luzes da Modernidade, como também sofre efeitos perversos deste processo histórico.

  20. Os ditongos do latim ao português

    Directory of Open Access Journals (Sweden)

    Quednau, Laura Rosane

    2005-01-01

    Full Text Available O presente trabalho trata da evolução dos ditongos já existentes e do surgimento de novos ditongos do latim ao português, analisando a motivação de sua redução quando esta ocorre. Para tanto, apresentamos cada ditongo separadamente, trazendo informações sobre a sua forma em latim clássico, latim vulgar e português. Além disso, tratamos de outros processos de formação de ditongos em português, uma vez que o português possui um número maior de ditongos do que o latim. Por fim, apresentamos um quadro-resumo, sintetizando as informações mais importantes do trbalho: quais ditongos permaneceram, quais foram reduzidos, quais surgiram por outros processos e quais são as causas da formação de ditongos em português

  1. Sophia, Mésseder e um Timor contado aos jovens

    OpenAIRE

    Albuquerque, Pedro; Azevedo, Fernando; Vergopolan, Roseli

    2015-01-01

    Devido a sucessivos e quase ininterruptos períodos bélicos e de ocupação, a fragilidades socioeconómicas e à ausência de um ensino sistematizado numa língua oficial, a produção literária timorense escrita revela-se bastante modesta. Apesar de a literatura timorense ter assistido ao despertar do género romanesco - sendo Luís Cardoso o mais proeminente escritor de Timor -, a invenção literária dedicada a um público mais jovem é praticamente inexistente. Ainda assim, os jovens timorenses, que tê...

  2. HST and Keck AO Images of Vortices on Jupiter

    Science.gov (United States)

    de Pater, Imke; Wong, M.; Luszcz-Cook, S.; Adamkovics, M.; Marcus, P.; Asay-Davis, X.; Conrad, A.; Go, C.

    2009-09-01

    Observations of Jupiter were conducted in April 2006 and May 2008 with both HST (250-890 nm) and the 10-m Keck telescope. On Keck we used the near-infrared camera NIRC2, coupled to the AO system, at 1.2 to 5 micrometers. At 5 um we are sensitive to Jupiter's thermal emission in cloud-free regions of the atmosphere, while at 1.2 um we see reflected sunlight from hazes and clouds in the troposphere-stratosphere. All small ovals (i.e., all except for Oval BA and the GRS) appear to be surrounded by bright rings at 5 mu, with typical brightness temperatures of 225-250 K, and hence probing depths to 2.5-4 bar. We argue that the small vortices are columnar structures, extending down into the water cloud. Air is rising along the center of these vortices, and descending around the outer periphery; the storm systems are likely fueled by the latent heat released from the water cloud. The descending part of the vertical circulation in the larger ovals is within the ovals, likely at the location of the red ring in Oval BA, which may indicate the maximum radial distance where such return flows can take place. On 19 July 2009, amateur observer Anthony Wesley (Australia) reported a dark spot/streak on Jupiter, near a southern latitude of 56 deg, which he attributed to an impact (analogous to the SL9 impact on Jupiter). We are scheduled to observe Jupiter with the Keck AO system on 24 July 2009 UT; if observations are successful, we will report preliminary results.

  3. Comportamento do gramado submetido aos herbicidas clethodim e sethoxydim.

    Directory of Open Access Journals (Sweden)

    Cleber D. de G. Maciel

    2007-06-01

    Full Text Available O principal fator do custo de manutenção de um gramado é o corte na altura adequada. O crescimento vegetativo e reprodutivo do gramado formado com grama-batatais (Paspalum notatum Flügge, submetido às doses de clethodim e sethoxydim foi avaliado em dois experimentos conduzidos no campus urbano da Escola Superior de Agronomia de Paraguaçu Paulista-ESAPP (SP, em gramado já estabelecido. Foi utilizado o delineamento experimental de blocos casualizados com seis tratamentos e quatro repetições, representados por clethodim nas subdoses de 0,0000; 0,0037; 0,0075; 0,0150; 0,0300 e 0,0600 kg i.a. ha-1, assim como pelo sethoxydim a 0,0000; 0,0156; 0,0312; 0,0625; 0,1250 e 0,2500 kg i.a. ha-1. O clethodim e sethoxydim, aos 7 DAA, intoxicaram as plantas a partir das doses de 0,0300 e 0,1250 kg ha-1, respectivamente. Os sintomas de intoxicação, aos 49 DAA, praticamente desapareceram para todos os tratamentos. O teor de clorofila nas folhas não apresentou diferenças significativas entre as subdoses de clethodim e sethoxydim em relação à testemunha, em nenhuma das épocas estudadas. Houve redução progressiva da altura média e no número de inflorescências do gramado em função do incremento das doses de clethodim e sethoxydim. Estes herbicidas apresentam viabilidade na redução vegetativa e reprodutiva da espécie P. notatum, sendo o sethoxydim mais seletivo em relação à preservação das características visuais do gramado

  4. Estilos de Aprendizagem versus Treinamento Vivencial ao Ar Livre

    Directory of Open Access Journals (Sweden)

    Luciano Munck

    2010-04-01

    Full Text Available O objetivo deste estudo foi analisar a relação entre estilos individuais de aprendizagem e o treinamento vivencial ao ar livre. Os treinamentos vivenciais tiveram como técnicas o arvorismo, dinâmicas de grupo e paintball. Para alimentar a análise, foram aplicados dois instrumentos de pesquisa a cento e cinco participantes dos treinamentos: o Learning Style Inventory (LSI e um questionário para identificação da satisfação. A coleta de dados foi realizada nos próprios locais de treinamento, sendo a identificação dos estilos de aprendizagem realizada antes, e a da satisfação, depois dos treinamentos. Os dados evidenciaram que o estilo de aprendizagem predominante entre os participantes da pesquisa foi o estilo acomodador(24,8%. A satisfação foi predominantemente alta, com 100% das respostas variando entre mais ou menos satisfeito e muito satisfeito (arvorismo P=0,006. Os dados da pesquisa demonstraram fraca influência dos estilos individuais de aprendizagem na maior ou menor satisfação para com os treinamentos recebidos. Em suma, concluiu-se que os treinamentos vivenciais ao ar livre possuem características que proporcionam alta satisfação para diferentes habilidades e estilos de aprendizagem. Informação essa que deveria ser levada em consideração por gestores e líderes no momento de planejar e estruturar programas de treinamento e desenvolvimento para seus colaboradores.

  5. The AO Pediatric Comprehensive Classification of Long Bone Fractures (PCCF).

    Science.gov (United States)

    Joeris, Alexander; Lutz, Nicolas; Blumenthal, Andrea; Slongo, Theddy; Audigé, Laurent

    2017-04-01

    Background and purpose - To achieve a common understanding when dealing with long bone fractures in children, the AO Pediatric Comprehensive Classification of Long Bone Fractures (AO PCCF) was introduced in 2007. As part of its final validation, we present the most relevant fracture patterns in the upper extremities of a representative population of children classified according to the PCCF. Patients and methods - We included children and adolescents (0-17 years old) diagnosed with 1 or more long bone fractures between January 2009 and December 2011 at the university hospitals in Bern and Lausanne (Switzerland). Patient charts were retrospectively reviewed and fractures were classified from standard radiographs. Results - Of 2,292 upper extremity fractures in 2,203 children and adolescents, 26% involved the humerus and 74% involved the forearm. In the humerus, 61%, and in the forearm, 80% of single distal fractures involved the metaphysis. In adolescents, single humerus fractures were more often epiphyseal and diaphyseal fractures, and among adolescents radius fractures were more often epiphyseal fractures than in other age groups. 47% of combined forearm fractures were distal metaphyseal fractures. Only 0.7% of fractures could not be classified within 1 of the child-specific fracture patterns. Of the single epiphyseal fractures, 49% were Salter-Harris type-II (SH II) fractures; of these, 94% occurred in schoolchildren and adolescents. Of the metaphyseal fractures, 58% showed an incomplete fracture pattern. 89% of incomplete fractures affected the distal radius. Of the diaphyseal fractures, 32% were greenstick fractures. 24 Monteggia fractures occurred in pre-school children and schoolchildren, and 2 occurred in adolescents. Interpretation - The pattern of pediatric fractures in the upper extremity can be comprehensively described according to the PCCF. Prospective clinical studies are needed to determine its clinical relevance for treatment decisions and

  6. The AO Pediatric Comprehensive Classification of Long Bone Fractures (PCCF).

    Science.gov (United States)

    Joeris, Alexander; Lutz, Nicolas; Blumenthal, Andrea; Slongo, Theddy; Audigé, Laurent

    2017-04-01

    Background and purpose - To achieve a common understanding when dealing with long bone fractures in children, the AO Pediatric Comprehensive Classification of Long Bone Fractures (AO PCCF) was introduced in 2007. As part of its final validation, we present the most relevant fracture patterns in the lower extremities of a representative population of children classified according to the PCCF. Patients and methods - We included patients up to the age of 17 who were diagnosed with 1 or more long bone fractures between January 2009 and December 2011 at either of 2 tertiary care university hospitals in Switzerland. Patient charts were retrospectively reviewed. Results - More lower extremity fractures occurred in boys (62%, n = 341). Of 548 fractured long bones in the lower extremity, 25% involved the femur and 75% the lower leg. The older the patients, the more combined fractures of the tibia and fibula were sustained (adolescents: 50%, 61 of 123). Salter-Harris (SH) fracture patterns represented 66% of single epiphyseal fractures (83 of 126). Overall, 74 of the 83 SH patterns occurred in the distal epiphysis. Of all the metaphyseal fractures, 74 of 79 were classified as incomplete or complete. Complete oblique spiral fractures accounted for 57% of diaphyseal fractures (120 of 211). Of all fractures, 7% (40 of 548) were classified in the category "other", including 29 fractures that were identified as toddler's fractures. 5 combined lower leg fractures were reported in the proximal metaphysis, 40 in the diaphysis, 26 in the distal metaphysis, and 8 in the distal epiphysis. Interpretation - The PCCF allows classification of lower extremity fracture patterns in the clinical setting. Re-introduction of a specific code for toddler's fractures in the PCCF should be considered.

  7. O teor de cálcio na casca é indicativo da suscetibilidade ao "bitter pit" em maçãs 'fuji'

    Directory of Open Access Journals (Sweden)

    Cassandro Vidal Talamini do Amarante

    2011-03-01

    Full Text Available Este trabalho objetivou identificar os atributos minerais na casca e na polpa, relacionados à severidade de "bitter pit" em maçãs 'Fuji'. Os frutos foram colhidos em pomar comercial do município de Lages-SC, e armazenados durante quatro meses em câmara fria convencional (0±0,4°C e 90-95% de umidade relativa. Posteriormente, foram separadas em quatro lotes, de acordo com a severidade de "bitter pit": nula (0 lesão/fruto, baixa (1-2 lesões/fruto, moderada (3-4 lesões/fruto e alta (5-16 lesões/fruto, com 15 frutos (repetições em cada nível de severidade. Os frutos de cada lote foram analisados individualmente quanto aos teores de Ca, Mg, K e N, na casca e na polpa. Na análise univariada dos teores minerais da polpa, observou-se aumento nos níveis de K e da relação K/Ca com o aumento na severidade de "bitter pit", apesar da ausência de diferenças quanto aos teores de Ca. Na casca, os teores de Ca e de N diminuíram, e as relações K/Ca, Mg/Ca e (K+Mg/Ca aumentaram com o incremento da severidade do distúrbio. Pela análise canônica discriminante (análise multivariada, observou-se que a melhor separação entre níveis de severidade de "bitter pit" foi obtida com os teores de Ca na casca. Assim, para maçãs 'Fuji', é mais seguro fazer previsão da ocorrência de "bitter pit" durante a armazenagem, com base nos teores de Ca na casca do que na polpa. Frutos com teor de Ca na casca < 240 mg kg-1 de matéria fresca são suscetíveis a esse distúrbio.

  8. A cor da dor: iniquidades raciais na atenção pré-natal e ao parto no Brasil

    Directory of Open Access Journals (Sweden)

    Maria do Carmo Leal

    Full Text Available Poucas pesquisas com foco nas influências da raça/cor no tocante à experiência de gestação e parto foram conduzidas no Brasil, sendo inédita a análise de abrangência nacional. Este estudo teve como objetivo avaliar as iniquidades na atenção pré-natal e parto de acordo com a raça/cor utilizando o método de pareamento baseado nos escores de propensão. Os dados são oriundos da pesquisa Nascer no Brasil: Pesquisa Nacional sobre Parto e Nascimento, um estudo de base populacional de abrangência nacional com entrevista e avaliação de prontuários de 23.894 mulheres em 2011/2012. Regressões logísticas simples foram utilizadas para estimar as razões de chance (OR e respectivos intervalos de 95% de confiança (IC95% da raça/cor associada aos desfechos analisados. Em comparação às brancas, puérperas de cor preta possuíram maior risco de terem um pré-natal inadequado (OR = 1,6; IC95%: 1,4-1,9, falta de vinculação à maternidade (OR = 1,2; IC95%: 1,1-1,4, ausência de acompanhante (OR = 1,7; IC95%: 1,4-2,0, peregrinação para o parto (OR = 1,3; IC95%: 1,2-1,5 e menos anestesia local para episiotomia (OR = 1,5 (IC95%: 1,1-2,1. Puérperas de cor parda também tiveram maior risco de terem um pré-natal inadequado (OR = 1,2; IC95%: 1,1-1,4 e ausência de acompanhante (OR = 1,4; IC95%: 1,3-1,6 quando comparadas às brancas. Foram identificadas disparidades raciais no processo de atenção à gestação e ao parto evidenciando um gradiente de pior para melhor cuidado entre mulheres pretas, pardas e brancas.

  9. Fontes de resistência ao bicho-mineiro, Perileucoptera coffeella, em Coffea spp. Sources of resistance to leaf miner, Perileucoptera coffeella, in Coffea spp.

    Directory of Open Access Journals (Sweden)

    Oliveiro Guerreiro Filho

    1991-01-01

    Full Text Available Procurou-se determinar, em nível de laboratório, por meio de infestações artificiais uniformes, fontes de resistência ao bicho-mineiro Perileucoptera coffeella (Guérin-Mèneville, 1842, entre as espécies Coffea stenophyila, C. salvatríx, C. racemosa, C. liberíca, C. eugenioides, C. kapakata, C. dewevrei, C. brevípes, C. congensis e C, canephora e os cultivares Catuaí Vermelho e Mundo Novo de C. arábica. Utilizaram-se testes de livre escolha e de confinamento, sendo avaliados os seguintes parâmetros: oviposição, número de discos lesionados por parcela, nota visual, área foliar danificada por parcela e área foliar danificada por lagarta. De acordo com os parâmetros analisados, pode-se, com relação ao número de pontos atribuídos na avaliação visual e quanto à porcentagem de discos lesionados, agrupar as espécies C. stenophyila, C. brevipes, C. liberíca e C. salvatrix, como altamente resistentes; C. racemosa, C. kapakata, C. dewevrei e C. eugenioides, como moderadamente resistentes, e C. congensis, C. canephora e C. arabica, como suscetíveis. Considerando os parâmetros área foliar danificada por parcela e área foliar danificada por lagarta, C. arabica pode ser classificada como altamente suscetível, mantendo-se C. congensis e C. canephora como suscetíveis.The species C. stenophyila, C. salvatrix, C. racemosa, C. liberíca, C. eugenioides, C. kapakata, C. dewevrei, C. brevipes, C. congensis and C. canephora and cvs Catuaí Vermelho and Mundo Novo of C. arabica were evaluated for resistance to leaf miner (Períleucoptera coffeeila (Guérin-Mèneville, 1842 under lab conditions with artificial infestations of leaf discs. There was no preference of P. coffeella for oviposition on any of the afore mentioned species. According to subjective visual ratings, number of discs with lesions, damaged foliar area and caterpillar consumption, C. stenophylla, C. salvatrix, C. Ilberica and C. brevipescan be considered as highly

  10. Drogas: famílias que protegem e que expõem adolescentes ao risco Drugs: families that protect and that expose teenagers to risk

    Directory of Open Access Journals (Sweden)

    Rogério Lessa Horta

    2006-01-01

    Full Text Available OBJETIVO: Este estudo tem por objetivo avaliar o consumo de substâncias psicoativas (bebidas alcoólicas, tabaco e drogas ilícitas por adolescentes do município de Pelotas (RS, de acordo com a presença de pai e/ou mãe no domicílio e o hábito de fumar ou não de ambos. MÉTODOS: Foi realizado, em 2002, um estudo transversal na área urbana de Pelotas. Empregou-se amostragem em múltiplos estágios para se obter uma amostra de adolescentes entre 15 e 18 anos de idade. As entrevistas foram realizadas com questionário auto-aplicado. RESULTADOS: A coabitação de pais ou mães e adolescentes parece reduzir significativamente as chances de os adolescentes consumirem tabaco, diminuir discretamente para drogas ilícitas e não tem influência em relação ao consumo de bebidas alcoólicas. CONCLUSÃO: O tabagismo de pais e mães parece aumentar as chances de os adolescentes fumarem. Não houve interação entre as duas variáveis em relação ao consumo de qualquer das substâncias estudadas.OBJECTIVE: This study was aimed to assess the relationship between substance use (alcoholic beverages, smoking and drug use among teenagers and cohabitation with parents, as well as the relationship between substance use and parental smoking. METHODS: In 2002, a cross-sectional survey was carried out in the urban area of Pelotas, southern Brazil. Multi-stage sampling was used to obtain a sample of adolescents aged between 15 and 18 years. Adolescents were interviewed using a self-applied confidential questionnaire. RESULTS: The cohabitation of parents and adolescents significantly reduced the odds ratio of tobacco smoking, but had a lower effect on reducing drugs use and was not related to alcohol intake. CONCLUSION: Parental smoking seems to be related only to adolescent smoking. No interaction was found between the two variables in relation to the consumption of any of studied substances.

  11. Resposta clínica e metabólica de potros neonatos em relação aos achados histopatológicos da placenta na égua

    Directory of Open Access Journals (Sweden)

    L.A. Lins

    2012-12-01

    Full Text Available Avaliaram-se as respostas clínica e metabólica de potros neonatos em relação aos achados histopatológicos da placenta na égua. Foram avaliados dois grupos de éguas da raça Puro Sangue Inglês - um grupo-problema (n=25 e um grupo-controle (n=25, de acordo com os achados da placenta. O exame dos potros constou de avaliação clínica geral, hematologia e bioquímica sérica. O exame histopatológico da placenta apresentou resultado compatível com a apresentação clínica do potro, sendo que a presença de lesões inflamatórias resultou na produção de potros debilitados. A presença de lesões degenerativas não comprometeu o estado clínico do neonato, mas pode ser responsável pela manifestação de distúrbios subclínicos, evidenciados pelo aumento das taxas de AST e GGT. A ureia pareceu ser um indicador de dano renal decorrente de insuficiência placentária em potros neonatos.

  12. O uso do TLS (Teste de Lideranca Situacional como instrumento de avaliaçao de gestores de restaurantes / Use of Situational Leadership Test (SLT as a tool for assessment of restaurant managers

    Directory of Open Access Journals (Sweden)

    Francisco Geová Feliciano da Silva

    2012-11-01

    Full Text Available Diversos modelos de liderança foram apresentados ao longo das décadas a fim de se descobrir a existência de um perfil ideal de um líder. A liderança contingencial é mais um modelo que tenta auxiliar neste desafio, considerando que não há um modelo único ideal de liderar, mas suas ações devem ser flexíveis de acordo com a situação. Esse trabalho teve como objetivo principal identificar se a liderança contingencial está presente nos processos de gestão de pessoas em empresa do segmento de restaurantes. Para isso foi aplicado o teste de liderança situacional (TLS desenvolvido por Agostinho Minicucci, em uma empresa de pequeno porte deste setor da cidade de São Paulo. Foi investigado um total de seis líderes, e os resultados apontaram a presença da liderança contingencial nos processos de gestão, no entanto não houve o predomínio. O setor alimentício nos últimos anos tem apresentado um crescimento considerável e pesquisas neste sentido se justificam em função da importância dos líderes neste contexto socioeconômico.

  13. Avaliação colorimétrica de aglomerados produzidos com partículas de madeira de Sequoia sempervirens e Pinus taeda submetidos ao intemperismo natural

    Directory of Open Access Journals (Sweden)

    Vinicius Gomes de Castro

    Full Text Available O objetivo do presente trabalho foi estabelecer o efeito do uso de misturas de diferentes proporções de partículas de Sequoia sempervirens e Pinus taeda nas propriedades colorimétricas de aglomerados, além de avaliar a alteração natural da cor após exposição ao intemperismo natural por seis meses. As análises colorimétricas foram realizadas através do sistema CIE-L*a*b* 1976. Os resultados indicaram uma relação direta das proporções de partículas de Sequoia sempervirens com os valores médios do pigmento vermelho (a* e uma relação indireta com os valores do pigmento amarelo (b*. Desta maneira, a cor do produto final pode ser prevista de acordo com o controle de proporções de partículas de diferentes espécies. Contudo, a exposição do material à luz natural por quatro meses é o suficiente para afetar negativamente os pigmentos a* e b*, e tende a eliminar a diferença de cores entre os painéis.

  14. O Bisfenol A: Sua Utilização e a Atual Polêmica em Relação aos Possíveis Danos à Saúde Humana

    Directory of Open Access Journals (Sweden)

    Marli Rocha Beserra

    2015-07-01

    Full Text Available O Bisfenol A (BPA é um produto químico industrial que, em sua forma monomérica é amplamente utilizado na produção de resinas epóxi e plásticos de policarbonato. É uma substância de excelentes características físicas e químicas utilizadas em diversas aplicações como, por exemplo: revestimento de embalagens metálicas, fabricação de mamadeiras etc. De acordo com relatos da literatura, baixas doses de Bisfenol A têm efeitos adversos sobre a fertilidade, o sistema nervoso, diabetes, câncer, obesidade, puberdade precoce, comportamento, doenças cardíacas. Diante do atual quadro, cabe aos fabricantes de produtos que utilizam Bisfenol A se prevenirem e buscarem alternativas através do desenvolvimento de tecnologia que venha a substituir o uso do citado composto. O presente trabalho tem como objetivo apresentar a temática do uso do Bisfenol A e o quadro atual das indústrias a cerca do assunto.

  15. RESISTÊNCIA AO CISALHAMENTO DAS JUNTAS ADESIVAS PRODUZIDAS COM TRÊS DIFERENTES ESPÉCIES DE MADEIRAS E ADESIVOS VINÍLICOS PARA APLICAÇÕES NÃO ESTRUTURAIS

    Directory of Open Access Journals (Sweden)

    Maurício Pinheiro Oliveira

    2015-04-01

    Full Text Available Os adesivos utilizados na colagem de madeiras para aplicações não estruturais normalmente contêm uma emulsão de poli(acetato de vinila (PVAc estabilizada com poli(álcool vinílico e alguns aditivos. A ligação adesiva formada com essa classe de adesivo é pobre quando exposta à umidade e à temperatura. Nesse contexto, a classificação prévia dos adesivos utilizados para aplicações não estruturais, com resistência à umidade e à temperatura, é muito importante para a qualidade e durabilidade das juntas adesivas. Neste trabalho, foi estudada a influência de três espécies de madeiras (Fagus sylvatica L., Mimosa scabrella Bentham e Micropholis cf. venulosa Mart. & Eichler na resistência ao cisalhamento das juntas adesivas preparadas com três adesivos vinílicos, sintetizados com diferentes concentrações do N-butoximetilacrilamida (NBMA. Os ensaios de resistência ao cisalhamento, na linha de colagem, foram realizados sob diferentes ciclos de acondicionamento das juntas adesivas. Os resultados indicaram que há diferenças significativas na resistência de colagem das juntas adesivas e na porcentagem de falha na madeira provocada, tanto pela espécie de madeira quanto pelo tipo de adesivo utilizado. Os adesivos produzidos foram classificados de acordo com a classe de durabilidade, após várias etapas de acondicionamento. Os valores mais altos de resistência ao cisalhamento foram observados nas juntas coladas com as madeiras de Micropholis cf. venulosa Mart. & Eichler e Fagus sylvatica L., com o adesivo AD-3. O menor valor de resistência ao cisalhamento foi observado nas juntas adesivas preparadas com a madeira da espécie Mimosa scabrella Bentham. A madeira Micropholis cf. venulosa Mart. & Eichler mostrou-se mais adequada para a substituição da madeira Fagus sylvatica L.

  16. Duas grandes transformações ao mesmo tempo: atitudes em relação à alimentação e ao corpo em gestantes adolescentes

    OpenAIRE

    Carolina Marques Oliboni

    2014-01-01

    Introdução - Adolescência e gestação são caracterizadas por intensas transformações relacionadas ao corpo, e ocorrendo concomitantemente podem potencializar riscos para o surgimento de problemas com a imagem corporal, atitudes alimentares disfuncionais e comportamentos de risco para transtornos alimentares. Objetivo - Avaliar as atitudes em relação à alimentação, ao peso e ao corpo de um grupo de adolescentes grávidas. Métodos - Uma amostra de adolescentes grávidas (n=67) foi avaliada por mei...

  17. A contabilidade gerencial como ferramenta de apoio ao planejamento e ao controle: um estudo sobre duas empresas de grande porte do setor automotivo

    OpenAIRE

    Quintairos, Paulo César Ribeiro; Andrade, Alequexandre Galvez de; Oliveira, Edson Aparecida de Araújo Querido

    2011-01-01

    A contabilidade gerencial é uma importante ferramenta para o planejamento e controle das organizações, pois integra medidas financeiras e não financeiras. O conjunto dessas informações forma um sistema integrado cuja finalidade é avaliar o alinhamento da produção de uma empresa aos seus objetivos estratégicos. Neste trabalho será apresentado um estudo sobre o uso da contabilidade gerencial como ferramenta de apoio ao planejamento e ao controle de duas empresas de grande porte do setor automob...

  18. Indicadores de depressão materna e a interação mãe-criança aos 18 meses de vida = Maternal depression indicators and mother-child interaction at 18 months

    Directory of Open Access Journals (Sweden)

    Alvarenga, Patrícia

    2013-01-01

    Full Text Available A depressão materna está associada a perturbações na interação mãe-criança e no desenvolvimento infantil. Este estudo comparou a interação mãe-criança aos 18 meses de vida, em díades com mães que apresentavam indicadores de depressão (grupo clínico e díades com mães que não apresentavam indicadores de depressão (grupo não clínico de acordo com duas avaliações, realizadas no primeiro e no décimo oitavo mês de vida da criança. Participaram 16 díades divididas nos dois grupos. Foram utilizados o Inventário Beck de Depressão (BDI e uma sessão de observação da interação mãe-criança. Os resultados revelaram uma única diferença entre os grupos, indicando que as mães do grupo clínico foram mais intrusivas ao interagir com seus filhos do que as mães do grupo não clínico. Discutem-se as implicações da intrusividade materna para a interação mãe-criança e a importância do estudo de comorbidades e da cronicidade da depressão materna em futuras investigações

  19. Decisões judiciais sobre acesso aos medicamentos em Pernambuco

    Directory of Open Access Journals (Sweden)

    Artur Stamford

    2012-10-01

    Full Text Available OBJETIVO: Analisar as decisões do sistema jurídico sobre acesso da população a medicamentos no Sistema Único de Saúde por via judicial quanto a critérios de decisão e eventuais pressões políticas e econômicas. MÉTODOS: Estudo documental descritivo e retrospectivo de abordagem qualitativa e quantitativa. A coleta de dados foi realizada na Superintendência Estadual de Assistência Farmacêutica de Pernambuco, utilizando-se como fontes de dados 105 ações judiciais e relatórios administrativos de janeiro a junho de 2009. Verificaram-se os medicamentos com pedido ou carta patente no banco de dados do Instituto Nacional de Propriedade Industrial para identificar a frequência das patentes nas ações judiciais. Os dados obtidos foram classificados conforme o Sistema Anatômico Terapêutico Químico. Para análise das decisões judiciais, foi utilizada a teoria dos sistemas sociais autopoiéticos. RESULTADOS: As ações judiciais somaram 134 medicamentos com valor estimado de R$ 4,5 milhões para atender aos tratamentos solicitados; 70,9% dos medicamentos estavam com carta patente ou pedido e se concentraram em três classes terapêuticas: antineoplásicos e moduladores imunológicos, aparelho digestório e metabolismo, órgãos dos sentidos. Foram identificadas seis ideias centrais com os critérios de decisão dos magistrados (Constituição Federal e prescrição médica e as pressões entre os sistemas do direito, da economia e da política quanto ao acesso a medicamentos. CONCLUSÕES: A análise das decisões judiciais fundamentadas na teoria dos sistemas sociais autopoiéticos permitiu identificar as estimulações mútuas (dependências entre o sistema do direito e demais sistemas sociais em relação à questão do acesso dos cidadãos aos medicamentos. Essas dependências foram representadas pela Constituição Federal e pela propriedade intelectual. A Constituição Federal e a prescrição médica foram identificadas como

  20. Resistência ao cisalhamento de braquetes metálicos utilizando sistema adesivo autocondicionante Shear bond strength evaluation of metallic brackets using self-etching system

    Directory of Open Access Journals (Sweden)

    Camilo Aquino Melgaço

    2011-08-01

    Full Text Available OBJETIVO: avaliar a resistência ao cisalhamento de braquetes metálicos colados com sistema autocondicionante utilizado imediatamente e após 2, 5 e 9 dias depois da ativação e armazenagem. MÉTODOS: utilizaram-se 64 dentes bovinos divididos igualmente em quatro grupos e devidamente preparados para receber a colagem dos braquetes. Em T1, realizou-se a ativação de 7 blisters de adesivos autocondicionantes (de acordo com as normas do fabricante e procedeu-se à colagem imediata apenas dos braquetes do grupo I. Os adesivos ativados foram, então, armazenados à temperatura de 4ºC e reutilizados em períodos de 2 dias (T2, 5 dias (T3 e 9 dias (T4 para a colagem dos braquetes dos grupos II, III e IV, respectivamente. RESULTADOS: não se observou diferença estatística quando comparados os valores médios de tensão para resistência ao cisalhamento entre os grupos I, II e III. Entretanto, diferença estatística foi encontrada quando esses valores foram comparados aos do grupo IV. CONCLUSÃO: o armazenamento do adesivo autocondicionante depois de ativado, à temperatura média de 4ºC, por até 5 dias, parece não afetar os resultados quanto às tensões de resistência ao cisalhamento; novos estudos são necessários para avaliação das demais características do material quando de sua utilização por período de tempo prolongado após sua ativação.OBJECTIVE: To evaluate the shear bond strength of metallic brackets using the self-etching system after its activation and storage for 2, 5 and 9 day periods. METHODS: A total of 64 bovine teeth were divided in four groups and prepared to receive the brackets. Initially, seven self-etching primer blisters were activated and used to bond the brackets of group I. The blisters were store at a constant temperature of 4ºC for 2, 5 and 9 days and used to bond the brackets of groups II, III and IV, respectively. RESULTS: No statistic difference was found in shear bond strength comparing groups I, II

  1. Robo-AO KP: A new era in robotic adaptive optics

    Science.gov (United States)

    Riddle, Reed L.; Baranec, Christoph; Law, Nicholas M.; Kulkarni, Shrinivas R.; Duev, Dmitry; Ziegler, Carl; Jensen-Clem, Rebecca M.; Atkinson, Dani Eleanor; Tanner, Angelle M.; Zhang, Celia; Ray, Amy

    2016-01-01

    Robo-AO is the first and only fully automated adaptive optics laser guide star AO instrument. It was developed as an instrument for 1-3m robotic telescopes, in order to take advantage of their availability to pursue large survey programs and target of opportunity observations that aren't possible with other AO systems. Robo-AO is currently the most efficient AO system in existence, and it can achieve an observation rate of 20+ science targets per hour. In more than three years of operations at Palomar Observatory, it has been quite successful, producing technology that is being adapted by other AO systems and robotic telescope projects, as well as several high impact scientific publications. Now, Robo-AO has been selected to take over operation of the Kitt Peak National Observatory 2.1m telescope. This will give Robo-AO KP the opportunity to pursue multiple science programs consisting of several thousand targets each during the three years it will be on the telescope. One-sixth of the observing time will be allocated to the US community through the NOAO TAC process. This presentation will discuss the process adapting Robo-AO to the KPNO 2.1m telescope, the plans for integration and initial operations, and the science operations and programs to be pursued.

  2. Adesão de pessoas com diabetes mellitus tipo 2 ao tratamento medicamentoso

    OpenAIRE

    BOAS, Lilian Cristiane Gomes-Villas; Foss-Freitas, Maria Cristina; Pace, Ana Emilia

    2014-01-01

    Estudo seccional de abordagem quantitativa que objetivou avaliar a adesão ao tratamento medicamentoso entre pessoas com diabetes mellitus, e sua relação com variáveis clínicas, de tratamento e controle metabólico. A amostra constituiu-se de 162 pessoas com diabetes mellitus tipo 2 em seguimento ambulatorial. Para a coleta dos dados, foram utilizadas a Medida de Adesão aos Tratamentos e a consulta aos prontuários dos participantes. Obteve-se elevada adesão ao tratamento medicamentoso. Para um ...

  3. COMO ENTENDER E ATENDER AOS DIREITOS DAS MINORIAS?

    Directory of Open Access Journals (Sweden)

    Maria Cristina Alves Delgado de Ávila

    2014-05-01

    Full Text Available No âmbito do Estado Democrático de Direito, um Governo representa a maioria. Conforme os ditames da Constituição Federal de 1988 – CRFB/88 -, a maioria pode organizar-se e decidir sobre os assuntos públicos de um determinado Estado. Dentro da idéia de maioria, tem-se o grupo que, em certo momento, encontra-se no poder com o direito de liderar os demais indivíduos ocupantes de um território. A minoria é o oposto. Para garantir a harmonia social, a maioria não tem o direito de oprimir a minoria e não deve retirar os direitos e as liberdades fundamentais de um grupo minoritário ou mesmo de um indivíduo. Ao contrário, a maioria deve garantir o pluralismo cultural de um povo dentro de um território. Partindo da hermenêutica dos direitos das minorias, pretende-se responder a pergunta como entender e atender a estes direitos.

  4. Subsunção do trabalho imaterial ao capital

    Directory of Open Access Journals (Sweden)

    Eleutério F. S. Prado

    Full Text Available O presente artigo examina a transformação do modo de produção capitalista que acompanha a expansão do trabalho imaterial como fonte de geração de riqueza efetiva. Essa avaliação é feita no interior da teoria do valor-trabalho e da crítica da economia política. Para tanto, interroga, primeiro, o verdadeiro impacto da informatização na natureza capitalista dos processos produtivos atualmente em andamento, principalmente nos países centrais. Compara, depois, as principais características da indústria taylorista com as características marcantes da indústria pós-taylorista. Ao final, conclui que uma transformação importante do sistema capitalista está em curso: a grande indústria, tal como foi caracterizada por Marx em O Capital, não predomina mais nos países do centro do sistema, pois o que aí prevalece agora é a pós-grande indústria.

  5. Touraine, Burawoy, Gramsci: do social ao político

    Directory of Open Access Journals (Sweden)

    Leonardo Mello e Silva

    Full Text Available O ensaio empreende uma discussão da proposta da sociologia pública de Michael Burawoy, nos anos 2000, a partir da confrontação com a intervenção sociológica de Alain Touraine, formulada nos anos 1970. Pontos de contato são detectados no que diz respeito à relação entre pesquisador e pesquisado, como atores sociais. Problemas e limitações, tanto da intervenção sociológica quanto da sociologia pública, são elencados, trazendo-se como apoio exemplos extraídos de trabalho de campo próprio. O texto vale-se também da inspiração de Antonio Gramsci e sua concepção da relação entre senso comum e intelectuais. Ao invés de um juízo conclusivo, propõe-se um diálogo entre os autores, todos preocupados, à sua maneira, com o destino público ou cívico do conhecimento obtido sobre o mundo social.

  6. ROTEIRO DE VIAGEM AO PAÍS DE LACAN

    Directory of Open Access Journals (Sweden)

    Laéria Fontenele

    2015-12-01

    Full Text Available Grande leitor e crítico da cultura de seu tempo e um dos nomes de maior destaque da psicanálise contemporânea, Slavoj Žižek desfaz a fábula segundo a qual ler Lacan é um trabalho árduo e difícil que seria apenas privilégio dos especialistas em psicanálise e, com isso, brinda o seu leitor com um envolvente passeio pelo país de Lacan. De origem eslovena, e quase eleito presidente de seu país, Slavoj Žižek é autor de diversos livros - dentre os quais os instigantes ensaios “Hegel, o mais sublime dos histéricos” e “Eles não sabem o que dizem” -, a maioria publicada em por volta de trinta idiomas. É ele reconhecido como sendo um profundo conhecedor de Hegel e Karl Marx; apaixonado leitor de Sigmund Freud e de Jacques Lacan; crítico contundente das ideologias totalitárias, espírito cultivado por sua filia às múltiplas artes – sendo, inclusive, especialista na cinematografia de Alfred Hitchcock. Os traços de sua erudição e sensibilidade para com as artes, se refletem e particularizam, também, o seu estilo de escrever, o qual se encontra muito bem representado no modo como urdiu esse seu novo livro. “Como ler Lacan” nos ensina a adotar um método especial para orientar em uma tal empreitada. Žižek advoga que, para lermos Lacan, devemos aplicar o mesmo método empregado pela psicanálise para ler e interpretar o texto que resulta do trabalho inconsciente. Mas há uma condição para esse emprego: abandonar o vício de querer entender, pois, assim como o inconsciente, Lacan não deve ser compreendido e sim lido, pois, conforme ele mesmo já nos advertira, o pior destino a que podemos ser conduzidos é o destino que nos leva à compreensão. Só assim será fácil ler Lacan, mais do que, amiúde, se imagina. Muitas introduções ao seu ensino foram publicadas, algumas delas marcadas por rigor conceitual, outras resultaram em versões grosseiras de sua letra. Sem desmerecer as boas introduções a Lacan

  7. INTRODUÇAO AOS MODELOS ODE PARTICIPAÇÃO DE MERCADO EM SERVIÇOS DE TRANSPORTES

    Directory of Open Access Journals (Sweden)

    Antonio Galvão Novaes

    2010-04-01

    Full Text Available

    Análises de participação de mercado ("market share" são comuns em estudos na área de "marketing", envolvendo produtos e respectivas marcas, de um lado, o perfil da demanda de outro, e o posicionamento das empresas produtoras que competem nesse mercado, num terceiro bloco. No setor de transportes a literatura registra aplicações em ligações aéreas e em serviços intermunicipais de ônibus. Os modelos de participação de mercado se aplicam normalmente a situações em que os operadores oferecem serviços de transportes similares num determinado mercado, com a competição sendo feita não com base em atributos modais intrínsecos, mas sim apoiada em características diferenciadoras intra-modais mais tênues, tais como conforto, atendimento, promoções tarifárias, "marketing" e propaganda, etc. Neste artigo é feita uma introdução aos modelos de "market share" em transportes, com a apresentação de um exemplo de aplicação ao transporte intermunicipal de passageiros em ônibus, sendo discutidos também aspectos ligados a calibração e tais modelos.

    ABSTRACT

    Market share analysis is common in marketing studies involving products and respective brands, on one hand, the demand profile on the other hand, and the competiting industries on a third set. In the transport sector the literature registers a number of applications to air transport problems and to intercity bus services. Market share models are normally applied to situations in which operators offer, in a specific market, transport services that are similar in nature, with competition based not on intrinsic modal attributes, but rather on more tenous intra-mode differentiating characteristics, such as comfort, attendance, tariff promotions, marketing and advertising efforts, etc (sub-modal configurations. It is presented in this paper an introduction to market share modelling in transport, with an example concerning an intercity bus service in

  8. Atomic-AES: A compact implementation of the AES encryption/decryption core

    DEFF Research Database (Denmark)

    Banik, Subhadeep; Bogdanov, Andrey; Regazzoni, Francesco

    2016-01-01

    report an 8-bit serialized AES circuit that provides the functionality of both encryption and decryption and occupies around 2645 GE with a latency of 226 cycles. This is a substantial improvement over the next smallest AES ENC/DEC circuit (Grain of Sand) by Feldhofer et al. which takes around 3400 gates...... but has a latency of over 1000 cycles for both the encryption and decryption cycles....

  9. Das portarias aos bloquinhos: arte e apoio institucional ao Projeto Mais Médicos para o Brasil

    Directory of Open Access Journals (Sweden)

    Heloísa Germany

    Full Text Available Este ensaio apresenta experiências vivenciadas por uma artista visual integrante da equipe de Apoio Institucional do Ministério da Educação para o Projeto Mais Médicos para o Brasil (PMMB, uma proposta interministerial que aproxima de forma significativa processos de trabalho e formação relacionados à saúde e à educação. Por meio do que Roland Barthes chama de obtuso e por meio de uma metodologia hifográfica, investe-se na leveza e reinvenção de ações no campo da Saúde Coletiva na interface das artes como processos educativos sensíveis experimentados ao longo de dois anos junto com o PMMB. Por meio de pequenos blocos de anotações produzidos individualmente e por um coletivo de apoiadores, delineia-se um processo singular e sensível, contribuindo na discussão sobre o fortalecimento das coletividades, das redes de Atenção Básica, da formação para o Sistema Único de Saúde e da composição de olhares poético-políticos acerca do PMMB.

  10. Um conceito reinterpretado ao longo do século: do intelectual individualista de Durkheim ao intelectual coletivo de Bourdieu

    Directory of Open Access Journals (Sweden)

    Ione Ribeiro Valle

    2017-10-01

    Full Text Available Para contribuir com o debate sobre os intelectuais recorremos a dois sociólogos, distanciados um do outro cerca de um século: Émile Durkheim (1858-1917 e Pierre Bourdieu (1930-2002. O primeiro preconiza a relação entre uma “moral individualista” e o papel do intelectual. Esta reflexão integra o conjunto de suas apostas na coesão social e na moral laica, indispensáveis à promoção do progresso e da ordem nas sociedades em processo crescente de diferenciação. A perspectiva de Bourdieu volta-se à necessidade de “reinventar uma espécie de intelectual coletivo segundo o modelo do que foram os enciclopedistas”. Segundo ele, um novo desafio se impõe ao intelectual coletivo: mobilizar a ciência, e a sociologia em particular, na luta contra os usos abusivos da própria ciência e da autoridade científica. As ideias destes pensadores oferecem chaves de leitura que inspiram o desenvolvimento de uma sociologia histórica voltada à educação no pensamento social brasileiro.

  11. Da Ruptura ao Acontecimento: Bachelard, Canguilhem e Foucault

    Directory of Open Access Journals (Sweden)

    Gabriela Menezes Jaquet

    2017-02-01

    Full Text Available Este artigo tem por objetivo propor uma problematização da concepção de acontecimento tal como é pensada, em seus contornos gerais, na filosofia francesa contemporânea e, mais especificamente, pela história da ciência. Nosso enfoque será a compreensão das abordagens de Gaston Bachelard, Georges Canguilhem e Michel Foucault principalmente no que tange às noções de ruptura epistemológica e de ideologia científica em sua articulação com as características do acontecimento pensado por Foucault, partimos, portanto, de concepções de história que, apesar das concordâncias, também acabam por se diferenciar: uma, a história descontinuísta das rupturas epistemológicas, outra, a história arqueológica dos acontecimentos. Para explicarmos a diferença deste nível acontecimental, será necessário compreendermos a visada singular de Foucault em relação à ciência, que é questionada (e criticada de forma a atentar para outro nível: o do saber que aqui exploraremos a partir do conceito de limiar. Igualmente quanto ao estatuto de científico, abordaremos o posicionamento crítico de Canguilhem em relação à Bachelard sobre os desdobramentos de uma razão pensada historicamente, através de sua história dos conceitos. Tendo em vista estas considerações poderemos compreender não só a especificidade do trabalho de cada um destes autores, mas visualizar o que a categoria de acontecimento pôde, via Foucault, trazer de novo para a história da ciência.

  12. As hérnias medem-se aos palmos?

    Directory of Open Access Journals (Sweden)

    Cátia Pereira

    2016-06-01

    Full Text Available Apresenta-se o caso de uma doente do sexo feminino com 74 anos, autónoma, com antecedentes patológicos de obesidade, diabetes mellitus tipo 2, hipertensão arterial e doença osteoarticular degenerativa, que recorreu à urgência por infeção respiratória inferior. Negava sintomas gastrointestinais ou antecedentes cirúrgicos. Ao exame objetivo, destacava-se a presença de uma hérnia umbilical volumosa não dolorosa à palpação, mas que condicionava a sua mobilidade, sendo impossível a redução do conteúdo herniário. Após insistência na anamnese, a doente referiu o seu aparecimento na infância, na altura com recusa em efetuar a sua correção cirúrgica, tendo sido perdido o seu seguimento posteriormente. A radiografia e a tomografia computorizada abdominais mostraram um colo herniário de seis centímetros de diâmetro e herniação de praticamente todo o intestino delgado e parte do cólon, sem evidência de encarceramento (Figuras 1 e 2. Apesar de décadas de evolução condicionarem um progressivo e forte impacto nas atividades da vida diária, a doente não procurou os cuidados de saúde por esse motivo, mantendo a sua decisão e sendo encaminhada para a consulta externa. As complicações herniárias abdominais incluem a obstrução intestinal e a temida emergência cirúrgica da hérnia encarcerada, não se desprezando a morbilidade inerente, bem evidente neste caso.1-2

  13. Suscetibilidade de Oligonychus yothersi (Acari: Tetranychidae ao fungo Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Oliveira Renato Cassol de

    2002-01-01

    Full Text Available A cultura da erva-mate (Ilex paraguariensis é uma importante atividade econômica no Sul do Brasil. Com o aumento de consumo nos anos oitenta, cresceram também as áreas de monocultura, gerando condições favoráveis para o aumento populacional de insetos e ácaros fitófagos, entre eles o ácaro vermelho Oligonychus yothersi. Este estudo avaliou a suscetibilidade do ácaro vermelho O. yothersi a vários isolados do fungo Beauveria bassiana. O experimento foi conduzido em Cascavel, PR. Discos foliares de erva-mate (2,2 cm² foram previamente infestados com 20 fêmeas adultas. Alíquotas de 1 mL de cada suspensão de conídios dos diferentes isolados de B. bassiana, ajustadas na concentração de 1,0x10(8 conídios mL-1 foram pulverizadas, separadamente, sobre um conjunto de 5 discos. Os discos foliares foram mantidos flutuando em água destilada, em caixas plásticas (3 cm de diâmetro, sob condições controladas. Diariamente, os ácaros mortos foram transferidos para câmara úmida, para confirmação de mortalidade causada pelo fungo. A mortalidade total variou entre 77 e 98% (6 dias após a aplicação, não permitindo diferenciar os isolados quanto à virulência (P>0,05. Já a mortalidade confirmada variou entre 19 e 75%, permitindo diferenciá-los (P<0,05. O ácaro vermelho O. yothersi foi suscetível, em diferentes níveis, aos isolados de B. bassiana testados.

  14. Patterns of Impairments in AOS and Mechanisms of Interaction between Phonological and Phonetic Encoding

    Science.gov (United States)

    Laganaro, Marina

    2012-01-01

    Purpose: One reason why the diagnosis of apraxia of speech (AOS) and its underlying impairment are often debated may lie in the fact that most patients do not display pure patterns of AOS. Mixed patterns are clearly acknowledged at other levels of impairment (e.g., lexical-semantic and lexical-phonological), and they have contributed to debate…

  15. SCExAO as a precursor to an ELT exoplanet direct imaging instrument

    Science.gov (United States)

    Jovanovic, Nemanja; Guyon, Olivier; Martinache, Frantz; Clergeon, Christophe; Singh, Garima; Vievard, Sebastien; Kudo, Tomoyuki; Garrel, Vincent; Norris, Barnaby; Tuthill, Peter; Stewart, Paul; Huby, Elsa; Perrin, Guy; Lacour, Sylvestre

    2013-12-01

    The Subaru Coronagraphic Extreme AO (SCExAO) instrument consists of a high performance Phase Induced Amplitude Apodisation (PIAA) coronagraph combined with an extreme Adaptive Optics (AO) system operating in the near-infrared (H band). The extreme AO system driven by the 2000 element deformable mirror will allow for Strehl ratios>90% to be achieved in the H-band when it goes closed loop. This makes the SCExAO instrument a powerful platform for high contrast imaging down to angular separations of the order of 1 lambda/D and an ideal testbed for exploring coronagraphic techniques for ELTs. In this paper we report on the recent progress in regards to the development of the instrument, which includes the addition of a visible bench that makes use of the light at shorter wavelengths not currently utilized by SCExAO and closing the loop on the tip/tilt wavefront sensor. We will also discuss several exciting guest instruments which will expand the capabilities of SCExAO over the next few years; namely CHARIS which is a integral field spectrograph as well as VAMPIRES, a visible aperture masking experiment based on polarimetric analysis of circumstellar disks. In addition we will elucidate the unique role extreme AO systems will play in enabling high precision radial velocity spectroscopy for the detection of small companions.

  16. The nature of ethnic identity among the people of Curaçao

    NARCIS (Netherlands)

    Dijs, N.M. van der

    2011-01-01

    This qualitative research explores the nature of ethnic identity among the people of Curaçao. The questions that are of fundamental interest to this study are: how do the people of Curaçao perceive themselves ethnically, how do they experience their sense of belonging to an ethnic group and what

  17. About the malacological subdivision of Curaçao; a review

    NARCIS (Netherlands)

    Wagenaar Hummelinck, P.

    1990-01-01

    Burrington Baker (1924) states that Curaçao can be divided into three distinct faunal areas. Stock (1977) mentions the occurrence of three subspecies of hadziid amphipods almost exclusively confined to different parts of Curaçao. The results of a study of the distribution on this island of various

  18. Use of AO PSF models for the Study of Resolved Stellar Populations

    NARCIS (Netherlands)

    Deep, A.; Fiorentino, G.; Jolissaint, L.; Tolstoy, E.; Clénet, Y.; Conan, J.-M.; Fusco, Th.; Rousset, G.

    2010-01-01

    The full scientific exploitation of AO images to study resolved stellar populations is still in a nascent stage. This requires pushing to the faint limits and carrying out deep and accurate crowded field photometry and astrometry. The main complexity of AO images is that the correction is never

  19. Data of evolutionary structure change: 1AO5B-1ELCA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AO5B-1ELCA 1AO5 1ELC B A VVGGFNCEKNSQPWQVAVYYQ----KEHICGGVLLDRNW...TPTWQKPDDLQCVFITLLPNENCAKV--YLQKVTDVMLCAGEMGGGKDTCRDDSGGPLICD----GILQGTTSYGPV-PCGKPGVPAIYTNLIKFNSWIKDTMMKNA TRP CA 491 1ELC A 1ELCA...hain> 1ELC A 1ELCA PLHCLVNGQYAVHG... PRO CA 225 1ELC A 1ELCA

  20. Knockdown resistance in pyrethroid-resistant horn fly (Diptera: Muscidae populations in Brazil Resistência Knockdown em populações de mosca-dos-chifres do Brasil resistentes aos piretróides

    Directory of Open Access Journals (Sweden)

    Gustavo A. Sabatini

    2009-09-01

    ,22% homozigotas resistentes. Em todas as populações verificou-se equilíbrio de acordo com a Lei de Hardy e Weinberg, exceto uma com excesso de heterozigotos. Entretanto, quando agrupamos diferentes populações numa metapopulação de acordo com a região geográfica, é possível observar um desvio nas populações Centro-Oeste, Sul e Sudeste, indicando isolamento populacional e que a ocorrência do kdr é provavelmente um efeito independente, talvez refletindo a estratégia de uso do inseticida de cada produtor. Apesar da resistência aos piretróides estar disseminada por todo o país, apenas 48% das populações resistentes apresentaram o kdr, e a frequência de indivíduos kdr nas populações resistentes se mostrou bastante baixa. À exceção da Região Nordeste, o mecanismo de resistência ligado ao kdr ocorre em todo o país.

  1. Modeling the effect of the age of dam at calving on the weaning weight of Charolais-Zebu crossbred calves Modelagem do efeito da idade da vaca ao parto sobre o peso à desmama de bezerros mestiços Charolês-Zebu

    Directory of Open Access Journals (Sweden)

    Fábio Luiz Buranelo Toral

    2009-07-01

    Full Text Available The objective of this study was to evaluate alternatives for modeling the age of dam at calving (AOD effect on the weaning weight of Charolais-Zebu crossbred calves. Data from 56,965 calves were analyzed, using statistical models considering the fixed effects of the contemporary groups, sire and dam genetic groups, and AOD. The AOD effect was fitted to models using annual age classes, and ordinary quadratic to quintic-ordered polynomials (OP or segmented polynomials (SP with two, three, four, six and twelve evenly spaced intervals. In the case of segmented polynomials, general linear and quadratic effects and only one quadratic additional term from each knot were considered. The AOD effects were nested within sex of calf in all cases. According to the fitting criteria, the F-test for the reduction of residual sum of squares, coefficient of determination, residual sum of squares and mean of squared residuals, the three interval segmented polynomial (two knots fitted to the data as well as the more complex polynomials.Este trabalho foi realizado com o objetivo de avaliar alternativas para a modelagem do efeito da idade da vaca ao parto sobre o peso à desmama de bezerros mestiços Charolês-Zebu. Os dados de 56.965 bezerros foram analisados por meio de modelos estatísticos, considerando os efeitos fixos de grupo de contemporâneos, grupos genéticos do touro e da vaca e da idade da vaca ao parto. O efeito da idade da vaca ao parto foi modelado utilizando-se classes anuais de idade, polinômios ordinários (PO de ordem quadrática até quíntica, ou polinômios segmentados com 2, 3, 4, 6 ou 12 intervalos do mesmo tamanho. No caso dos polinômios segmentados, consideraram-se os efeitos linear e quadrático gerais e apenas o quadrático a partir de cada nó. Os efeitos da idade da vaca ao parto foram considerados aninhados em sexo do bezerro em todos os casos. De acordo com os critérios de ajuste utilizados, ou seja, o teste F para diferenças de

  2. Propostas de mudanças ao basquete no sertão cearense: dando voz aos praticantes

    Directory of Open Access Journals (Sweden)

    Bérgson Nogueira de Oliveira

    2017-06-01

    Full Text Available Objetivo: o presente artigo tem como objetivo compreender as percepções de mudanças sociais atribuídas pelos praticantes de basquete em um município do sertão cearense, destacando neste contexto, as suas representações sociais acerca do papel social desta prática esportiva. Método: foram entrevistados cinco sujeitos do sexo masculino que praticam a modalidade há mais de dez anos no contexto do sertão cearense e que estudaram em escolas públicas. Para a construção das informações, utilizamos a entrevista semi-estruturada, seguida por um roteiro composto por temas, que foi adaptado de um estudo realizado por Santos (2004. As análises dos dados se deu a partir da Análise de Conteúdo do tipo Análise Temática, em que foram elaboradas categorias, a partir do material das entrevistas. Resultados: as representações de mudança dos sujeitos indicam o incentivo do basquete nas escolas; criação de projetos sociais; investimento na infraestrutura esportiva; bem como o fomento à criação de competições. Conclusão: conclui-se que a falta de apoio, de forma geral, dificulta a inserção de novos praticantes para essa modalidade. Nesse sentido, entende-se que são necessários mais incentivos ao esporte, pois se trata de um pilar na formação humana e possibilita o seu trabalho, não apenas no alto rendimento, mas também em dimensões de lazer, participação, educação, inclusão social entre outros aspectos.

  3. Sobre a domiciliaçao dos triatomineos

    Directory of Open Access Journals (Sweden)

    Mário B. Aragão

    1981-06-01

    Full Text Available Foram reunidos resultados de testes de precipitina feitos com o conteúdo do tubo digestivo de triatomineos. €ssas informações foram discutidas com base nas proporções de sangue de mamíferos e de ave, encontradas e em diversas observações relativas às espécies de vertebrados a que os triatomíneos estão associados na natureza. O estudo englobou as seguintes espécies: Belminus peruvianus, Panstrongylus geniculatus, Panstrongilus herreri, Panstrongylus megistus, Psammolestes tertius, Rhodnius neglectus, Rhodnius prolixus,Triatoma arthurneivai, Triatoma dimidiata,Triatoma infestans, Triatoma protracta, Triatoma rubrovaria e Triatoma sórdida. As seguintes conclusões puderam ser obtidas: 1 - As espécies que, nos biótopos artificiais, se alimentam principalmente de sangue humano, na natureza, são as mais ecléticas. Sugam mamífero, ave e animais de sangue-frio, mas apresentam marcada preferência por sangue de mamífero. 2 - As espécies que, nos biótopos artificiais, são encontradas com maior freqüência associadas a aves, na natureza ou preferem sangue de ave ou não tem predileção nítida por ave ou mamífero. 3 - As espécies associadas a animais de sangue frio ou restritas a um único grupo de mamíferos, podem colonizar nos domicílios desde que eles sejam previamente colonizados pelo hospedeiro. 4 - Não foram encontrados indícios de que alguma espécie esteja se adaptando aos domicílios. Todos os triatomineos ditos domiciliários já possuíam, na natureza, atributos que permitiam a vida em novos biótopos, habitados ou pelo homem ou por animais domésticos.

  4. Um sopro de Luz e Letra em meio ao caos

    Directory of Open Access Journals (Sweden)

    Marcelo Tomazi

    2009-06-01

    Full Text Available Enquanto compreende avanços científicos, o homem busca compreender a si mesmo. Partindo da citação de Carl Sagan, vemos que a Arte é um dos caminhos para a humanização, e os vínculos entre ciência (tecnologia e arte são cada vez mais estreitos. Um dos artistas que melhor trabalham dentro do nicho conhecido como “arte tecnológica” é Eduardo Kac. Sua trajetória inicial é apresentada aqui, dos “holopoemas” à “arte da telepresença”. Vemos o artista-teórico completo, profundo conhecedor da história da arte eletrônica. O livro Luz & letra: ensaios de arte, literatura e comunicação, sua obra de referência, é apresentado em essência, situando-se sua importância. É uma das poucas obras no Brasil a discutir, pela ótica de quem fez parte, eventos ligados ao advento da arte tecnológica nos anos 1980.In our quest to understand scientific advances, we seek to understand ourselves. Employing Carl Sagan's insight as a departure point, we see that art is one of the paths for humanization and that the links between science (technology and art are increasingly narrow. One of the artists who best works within the realm known as “art and technology” is Eduardo Kac. This essay explores Kac's early artworks, starting with “holopoems” and arriving at “telepresence art”, and especially his texts. We see a complete artist-theorist, with an unrivaled knowledge of electronic art and literature, in part because his theorizing emerges from having actively participated in the creation of the events he refers to. Of special interest is Kac's book Light & letter: essays in art, literature, and communication, which collects his writings of the 1980s. This is a fundamental work and mandatory reference for the study of the experimental art and literature of the period.

  5. Níveis de lisina digestível para leitões dos 6 aos 15 kg Digestible lysine level for piglets from 6 to 15 kg

    Directory of Open Access Journals (Sweden)

    Christiane Garcia Vilela Nunes

    2008-01-01

    Full Text Available Este estudo foi realizado para avaliar o efeito de diferentes níveis de lisina digestível na ração sobre o desempenho de leitões dos 6 aos 15 kg. Foram utilizados 120 leitões (80 machos castrados e 40 fêmeas, distribuídos em um delineamento experimental de blocos ao acaso, com cinco tratamentos (1,06; 1,16; 1,26; 1,36 e 1,46% de lisina digestível na ração, oito repetições e três animais por unidade experimental, mantidos em ambiente termoneutro. Os níveis de lisina digestível na ração não influenciaram o consumo diário de ração. Entretanto, o consumo de lisina digestível, o ganho de peso e a deposição de proteína corporal aumentaram de forma linear de acordo com os níveis de lisina digestível na ração. Os níveis de lisina digestível na ração influenciaram a conversão alimentar, que variou de forma quadrática, reduzindo até o nível estimado de 1,41% de lisina digestível. O nível estimado de no mínimo de 1,46% proporcionou melhores resultados de ganho de peso e deposição de proteína na carcaça de leitões dos 6 aos 15 kg mantidos em ambiente termoneutro.This study was conducted to evaluate the effect of different levels of digestible lysine in diets on the performance of piglets from 6 to 15 kg. One hundred and twenty piglets (80 castrated males and 40 females were used. The piglets were allotted to a completely randomized block design, with five treatments (1.06, 1.16, 1.26, 1.36, and 1.46% of digestible lysine, eight replicates and three animals per experimental unit, kept in thermoneutral environment. The dietary level of digestible lysine did not affect daily feed intake. However, the digestible lysine intake, weight gain and body protein deposition increased linearly according to the dietary lysine levels. The dietary digestible lysine levels affected feed:gain ratio that reduced in a quadratic way until the estimated dietary digestible lysine level of 1.41%. The estimated level at least of 1

  6. Aldehyde oxidase (AO) in the root nodules of Lupinus albus and Medicago truncatula: identification of AO in meristematic and infection zones.

    Science.gov (United States)

    Fedorova, Elena; Redondo, Francisco J; Koshiba, Tomokazu; Pueyo, José J; de Felipe, M Rosario; Lucas, M Mercedes

    2005-05-01

    Phytohormones are involved in the organogenesis of legume root nodules. The source of the auxin indole-3-acetic acid (IAA) in nodules has not been clearly determined. We studied the enzyme aldehyde oxidase (AO; EC 1.2.3.1), that catalyzes the last step of IAA biosynthesis in plants, in the nodules of Lupinus albus and Medicago truncatula. Primordia and young lupin nodules and mature M. truncatula nodules showed AO activity bands after native polyacrylamide gel electrophoresis. Gel activity analyses using indole-3-aldehyde as substrate indicated that the nodules of white lupin and M. truncatula have the capability to synthesize IAA via the indole-3-pyruvic acid pathway. Immunolocalization and in situ hybridization experiments revealed that AO is preferentially expressed in the meristematic and the invasion zones in Medicago nodules and in the lateral meristematic zone of Lupinus nodules. High IAA immunolabeling was also detected in the meristematic and invasion zones. Low expression levels and no AO activity were detected in lupin Fix- nodules that displayed restricted growth and early senescence. We propose that local synthesis of IAA in the root nodule meristem and modulation of AO expression and activity are involved in regulation of nodule development.

  7. O direito fundamental ao conteúdo do próprio trabalho: uma reconstrução normativa do direito ao trabalho

    Directory of Open Access Journals (Sweden)

    Leonardo Vieira Wandelli

    2016-12-01

    Full Text Available Resumo: Pretende-se enfrentar a inefetividade do direito humano e fundamental ao trabalho a partir de um esforço de reconstrução normativa da sua fundamentação, apoiada em um duplo pilar teórico, nas teorias das necessidades e nas teorias do reconhecimento. Com isso, não somente se recupera a importância do vínculo entre trabalho e dignidade humana, como se explicitam aspectos essenciais da centralidade do trabalho para os sujeitos. A partir disso, o direito ao trabalho se desvela não apenas como necessidade radical, tendente à transformação da institucionalidade vigente, mas também como direito positivado em um amplo leque de normas internacionais e nacionais, que contempla diversas dimensões normativas atualmente exigíveis. Propõe-se que, no centro desse direito, está um direito fundamental ao conteúdo do próprio trabalho, que determina juridicamente as condições da atividade e da organização do trabalho. Recente estudo adotado pelo Alto Comissariado em Direitos Humanos da Organização das Nações Unidas (ONU sobre o direito ao trabalho reforça essa compreensão. Palavras-chave: Direitos humanos. Direitos fundamentais. Direito ao trabalho. Psicodinâmica do trabalho. Direito do trabalho.

  8. Células-tronco mononucleares associadas ao plasma rico em plaquetas na consolidação de falha óssea no cão. Estudo piloto

    Directory of Open Access Journals (Sweden)

    A.L.T. Barbosa

    2014-12-01

    Full Text Available A padronização de técnicas e o teste da associação do Plasma Rico em Plaquetas (PRP e das Células-Tronco Mononucleares (CTMs na consolidação de falhas ósseas corticais, por meio de avaliação clínica, biomecânica, radiológica e histológica, é avaliada em um estudo piloto. Foram utilizados seis cães adultos, fêmeas, sem raça definida, pesando entre 5 e 10kg, separados por sorteio aleatório em seis tratamentos. Foi confeccionada uma falha elíptica de 1,0x0,4cm na cortical medial diafisária da tíbia direita de cada animal, sendo preenchida de acordo com o tratamento proposto. No cão I, a falha foi preenchida com solução fisiológica (SF; no II, com o PRP; no III, com a fração total das células mononucleares (FTCM; no IV, com a fração vascular estromal (FVE; no V, com o PRP associado à FTCM; no VI, com a associação PRP e FVE. Foram realizadas avaliações: clínicas, diariamente; dos graus de claudicação, semanalmente; radiológica e perimetria da coxa, antes, no pós-operatório imediato, aos 7, 14, 21 e 30 dias; biomecânica, antes do procedimento, aos 10, 20 e 30 dias; e biópsias, aos 15 e 30 dias. A FTCM obteve uma contagem e viabilidade média de 2,0x108cél. e 90%, respectivamente, enquanto a FVE obteve 3x106cél. e 50%. O PRP concentrou, em média, sete vezes o número inicial de plaquetas do sangue total, de 250.000 µl-1 plaquetas no sangue total para 1.750.000 µl-1 plaquetas no PRP. Obteve-se padronização adequada de técnicas, possibilitando o teste da associação entre as células-tronco mononucleares (CTMs e o plasma rico em plaquetas (PRP, assim como seu uso isolado, no reparo de falhas ósseas corticais, indicando a possibilidade de a associação FTCM e PRP ser o melhor tratamento.

  9. Avaliação da qualidade de vida e vulnerabilidade ao estresse no contexto hospitalar

    Directory of Open Access Journals (Sweden)

    Fernanda Ottati

    2013-05-01

    Full Text Available O conceito de Qualidade de Vida é usado para medir as condições de vida de um ser humano, já a palavra vulnerabilidade refere-se à chance das pessoas estarem expostas ao adoecer. Objetivou-se analisar possíveis relações entre percepção de qualidade de vida e a vulnerabilidade ao estresse no trabalho em enfermeiros, técnicos e auxiliares de enfermagem que atuam na UTI e no setor de emergência de um hospital público. Utilizou-se o instrumento de qualidade de vida da Organização Mundial da Saúde, WHOQOL-Bref e a Escala de Vulnerabilidade ao Estresse no Trabalho. Encontrou-se, em relação ao setor de trabalho, diferença significativa apenas para Qualidade de vida total. Portanto pode-se afirmar que os profissionais que atuam na UTI possuem maior percepção de qualidade de vida quando comparados aos do SUS. Na correlação entre os dois instrumentos, o domínio meio ambiente do WHOQOL-Bref correlacionou-se negativa e significativamente com todos os fatores da EVENT, indicando que a percepção da pessoa em relação aos diversos aspectos do meio em que vive tem relação com a vulnerabilidade ao estresse.

  10. Avaliação da sensibilidade ao contraste e da estereopsia em pacientes com lente intra-ocular multifocal Contrast sensitivity and stereopsis in pseudophakic patients with multifocal intraocular lens

    Directory of Open Access Journals (Sweden)

    Filipe de Oliveira

    2005-08-01

    Full Text Available OBJETIVO: Avaliar a sensibilidade ao contraste e a acuidade estereoscópica em pacientes pseudofácicos, que receberam implante bilateral de lente intra-ocular multifocal. MÉTODOS: Prospectivamente foram realizados testes de sensibilidade ao contraste com o uso da tabela Pelli-Robson e teste de acuidade estereoscópica com emprego do Titmus Stereo Test, em 20 pacientes com implante bilateral de lente intra-ocular multifocal Acrysof Restor®, no pós-operatório de 1 a 2 meses e sem uso de qualquer correção óptica. RESULTADOS:O teste de sensibilidade ao contraste binocular demonstrou que 6 pacientes (30% apresentaram 1,80 unid. log, 13 (65% 1,65 e 1 (5% 1,50. No teste monocular, ocorreram as seguintes respostas: 17 pacientes (85% 1,65 unid. log e 3 (15% 1,50 para o teste do olho direito. O teste do olho esquerdo mostrou que 16 pacientes (80% apresentaram 1,65 unid. log e 4 (20% 1,50. A média e o desvio-padrão da sensibilidade ao contraste testada binocularmente foi 1,69 (±0,08, ao passo que monocularmente foi 1,63 (±0,05 para OD e 1,62 (±0,06 para OE. O teste de acuidade estereoscópica revelou que 12 pacientes (60% obtiveram 40", 6 (30% 50" e 2 (10% 60", com média de 45" e desvio-padrão de ±6,88". CONCLUSÃO: A lente intra-ocular empregada no estudo, proporcionou resultados de sensibilidade ao contraste e acuidade estereoscópica compatíveis e de acordo com critérios de normalidade estabelecidos anteriormente por outros estudos em grupos de pacientes fácicos e pseudofácicos, e portanto, impacto positivo na funcionalidade visual.PURPOSE: To evaluate the contrast sensitivity and stereopsis tests in patients who underwent bilateral implantation of multifocal intraocular lens. METHODS: Tests of contrast sensitivity using the Pelli-Robson chart and stereopsis evaluation with the Titmus Stereo Test were performed in 20 patients 30-60 days after the bilateral implantation of Acrysof Restor® multifocal intraocular lens. RESULTS: The

  11. Potencialidades e espaços ao empreendedorismo

    Directory of Open Access Journals (Sweden)

    Adriano Lago

    2008-01-01

    Full Text Available A criação de negócios é apontada como uma das causas da prosperidade de um local, região, estado ou de um país. É neste sentido que o empreendedorismo tem recebido destaque nos últimos anos, como promotor de novos negócios. Captar, descrever e analisar o fenômeno do empreendedorismo é, portanto, necessário para o desenho de ações de promoção do desenvolvimento. Assim, o presente estudo aborda o empreendedorismo na piscicultura, tomando como base três casos analisados: uma propriedade com rizipiscicultura, uma com piscicultura de ciclo completo inclusive com frigorífico, e outra onde a piscicultura desenvolve-se através de um pesque-pague, com vistas a proporcionar o turismo rural. Para fins de pesquisa, entrevistaram-se os proprietários de cada estabelecimento na busca dos dados necessários para a construção de uma abordagem consistente da temática proposta, ou seja, identificar a presença do empreendedorismo e suas características particulares em cada propriedade analisada. Verificou-se que determinadas características empreendedoras são comuns aos três casos analisados: habilidade para identificar oportunidades; busca de conhecimento de sua área de atuação; senso de organização; disposição para tomar decisões; capacidade de liderança; talento para empreender; otimismo e tino empresarial; ser estrategista, além do dinamismo. Portanto, foi possível observar que o perfil empreendedor dos proprietários de cada negócio tornou possível a transformação de idéias e problemas em oportunidades reais de negócio.Abstract The business opening is indicated as one of the prosperity causes of a country, state, region or local. It’s in this context that the entrepreneurship has received attention along the last years as new business promoter. This way, to study and promote development actions it’s necessary, firstly, to get, to describe and to analyze the entrepreneurship phenomenon by itself. So, this study

  12. Contribuição ao estudo da Tripanosomiase Americana

    Directory of Open Access Journals (Sweden)

    Bichat de Almeida Rodrigues

    1942-01-01

    ano (época do estío. 6 Em plena mata, n’uma toca de tamanduá (T. tetradactylus foram encontradas larvas, ninfas e adultos de P. geniculatus. A casa situada mais próximo desse foco, foi a que apresentou maior infestação (22 exemplares e exclusiva para essa espécie. Em uma toca de macaco da noite (P. flavus, foi encontrada uma larva de Triatomídeo. Este foco também ficava próximo à casa acima referida. Em toca de P. flavus foi também achado um exemplar adulto de Panstrongylus refotuberculatus. 7 Amostras de S. cruzi isoladas de animais silvestres, mostraram fraco poder infectante. A amostra isolada do cão, embora infectando facilmente os animais de laboratório, pelos estudos biométricos feito por DIAS e FREITAS, afasta-se das amostras humanas típicas. 8 São discutidos os resultados acima referidos e, pelos hábitos dos transmissores, pela predominância de depositários silvestres do parasito, conclue-se pela natureza silvestre da Tripanosomiase Americana no local estudado. Se bem que não tenham sido verificadas infecções humanas, dado o encontro de um cão parasitado – infecção esta que se pode ter verificado pelo meio normal da transmissão da moléstia – admite-se a possibilidade do aparecimento de casos humanos nessa região. Ressalta-se a confirmação que tais resultados parecem trazer á hipótese de CARLOS CHAGAS, que pensava ser esta doença primitivamente silvestre, com posterior adaptação aos animais domésticos e ao homem.1 The epidemiology of Chagas’ disease was studied for the first time in a systematized work, in a district of the region of the Amazon estuary, whose ecological conditions differ from those encountered in other zones where similar researches have been made. 2 At the place chosen for the studies – Aurá – a locality about 10 kms from Belem (State of Pará, no human infection by S. cruzi has been found, either by blood examination or xenodiagnosis, both having been tried on all the inhabitants (117 people

  13. CLASSICAL AREAS OF PHENOMENOLOGY: Correcting dynamic residual aberrations of conformal optical systems using AO technology

    Science.gov (United States)

    Li, Yan; Li, Lin; Huang, Yi-Fan; Du, Bao-Lin

    2009-07-01

    This paper analyses the dynamic residual aberrations of a conformal optical system and introduces adaptive optics (AO) correction technology to this system. The image sharpening AO system is chosen as the correction scheme. Communication between MATLAB and Code V is established via ActiveX technique in computer simulation. The SPGD algorithm is operated at seven zoom positions to calculate the optimized surface shape of the deformable mirror. After comparison of performance of the corrected system with the baseline system, AO technology is proved to be a good way of correcting the dynamic residual aberration in conformal optical design.

  14. Lesão de mancha branca associada ao tratamento ortodôntico

    OpenAIRE

    Tambelli, Bianca

    2013-01-01

    Projeto de Pós-Graduação/Dissertação apresentado à Universidade Fernando Pessoa como parte dos requisitos para obtenção do grau de Mestre em Medicina Dentária O desenvolvimento de lesões de mancha branca em indivíduos submetidos ao tratamento ortodôntico com aparatologia fixa constitui um problema clínico importante. A inadequada higiene oral cria condições adicionais propícias ao aumento significativo da placa bacteriana ao redor dos suportes dos aparelhos fixos, fator este responsável pe...

  15. Modelo matemático aplicado ao processo de extrusão de argilas Mathematical model applied to the process of clay extrusion

    Directory of Open Access Journals (Sweden)

    F. A. Andrade

    2011-06-01

    Full Text Available As argilas, quando misturadas com água, adquirem a propriedade chamada plasticidade que tem papel fundamental durante o seu processamento. As técnicas empregadas na caracterização da plasticidade muitas vezes não revelam resultados quantitativos que permitam sua aplicação em modelos matemáticos do processo de conformação das argilas. Este trabalho teve por objetivo desenvolver um modelo matemático para cálculo da pressão média de extrusão, avaliando a plasticidade através de ensaios de compressão. Em seguida, os resultados teóricos da pressão de extrusão foram comparados aos resultados experimentais, sendo encontrado um bom acordo entre eles. Foi possível observar uma correlação entre tensão efetiva de compressão e pressão de extrusão. Para a equação que modela o processo de extrusão, a tensão efetiva obtida pelo ensaio de compressão foi um parâmetro significativo que revela o comportamento da argila durante o seu processamento.The clays when mixed with water acquire the property known as plasticity, which plays a key role during processing. The techniques used to characterize the plasticity often do not show quantitative results that allow its application in mathematical models of the forming process of clays. This study aimed to develop a mathematical model for calculating the average pressure of extrusion, evaluating the plasticity through compression tests. Then, the theoretical results of the extrusion pressure were compared to experimental results and a good agreement was found between them. It was possible to observe a correlation between effective stress of compression and extrusion pressure. For the extrusion process modeling equation, the effective stress obtained by compression test was a significant parameter that reveals the behavior of the clay during processing.

  16. Habilidades do Enfermeiro no Diagnóstico e Cuidado ao Portador de Depressão / Nursing Skills in Diagnosis and Care For Patients With Depression

    Directory of Open Access Journals (Sweden)

    Cristiane Rosa Guedes

    2015-12-01

    Full Text Available Objetivo: Identificar o significado para o enfermeiro em prestar cuidados para pacientes com Depressão. Materiais e métodos: Estudo exploratório e descritivo com abordagem qualitativa, a amostra foi de 12 enfermeiras, o cenário de estudo foram Unidades Básicas de Saúde e Estratégias de Saúde da Família, urbanas da cidade de Itajubá-MG. A coleta de dados foi por meio do roteiro de entrevista semiestruturada composta por questionário contendo uma pergunta inerente ao assunto. Resultados: Encontramos oito categorias como estigma da depressão, suicídio, dificuldade em lidar, tempo escasso, envolvimento familiar, aceitação da doença, acolhimento e dar medicamento, de acordo com os discursos dos sujeitos coletados na entrevista. Conclusão: Os enfermeiros não estão em contato direto com portadores de depressão no seu trabalho, não entendem que é sua tarefa identificar e encaminha-los para tratamento especializado. Sugerimos que outros estudos sejam desenvolvidos sobre essa temática. Objective: To identify the meaning for nurses when providing care for patients with depression. Materials and Methods: exploratory and descriptive study with qualitative approach, the sample consisted of 12 nurses, the study scenario was the urban Unidades Básicas de Saúde e Estrategia de Saúde da Família, in the city of Itajubá. Data collection was done through semi-structured interview guides consisting of a questionnaire containing a question related to the subject. Results and Discussion: we found eight categories as stigma of depression, suicide, coping difficulties, scarce time, family involvement, acceptance of the disease, host and give medicine, according to the speeches of the subjects collected in the interview. Conclusion: nurses are not in direct contact with individuals with depression in their work, do not understand that it is their job to identify and refer them to specialized treatment. We suggest that other studies be developed

  17. Os fatores intrínsecos ao ambiente de trabalho como contribuintes da síndrome de burnout em profissionais de enfermagem

    Directory of Open Access Journals (Sweden)

    Ana Paula da Cunha

    2012-04-01

    Full Text Available O burnout é uma síndrome identificada como um conjunto de manifestações físicas e emocionais característica de profissionais que se dedicam às necessidades de outras pessoas, sendo constituído pelas seguintes dimensões: exaustão emocional, despersonalização e baixa realização no trabalho. Vale destacar que os enfermeiros apresentam alto risco de desenvolver o burnout devido ao trabalho exercido diariamente. O estudo tem como objetivos identificar e analisar a produção científica sobre os fatores do ambiente de trabalho que favorecem o surgimento da síndrome de burnout em profissionais de enfermagem. Este estudo possui como abordagem metodológica a análise exploratória, fundamentada na revisão bibliográfica.  A pesquisa exploratória tem como intuito tornar algo mais explícito, tornando determinado tema mais familiar, onde se procura amadurecer um conceito. No que tange à revisão bibliográfica é a forma de analisar-se como determinado assunto está sendo evidenciado na comunidade científica. Resultados: Os fatores do ambiente de trabalho que influenciam no desenvolvimento da síndrome de burnout mais encontrados nos estudos analisados foram: sobrecarga de trabalho (24%, condições de trabalho inadequadas (22%, relação interpessoal conflituosa (19%, falta de expectativa profissional (13%, falta de autonomia e ambiguidade de funções (9% e insatisfação salarial (4%. Conclusão: Após a análise dos artigos, percebe-se que os fatores que influenciam no desenvolvimento da síndrome de burnout são a sobrecarga de trabalho, as condições de trabalho inadequadas, as relação interpessoal conflituosa, a falta de expectativa profissional, pouca autonomia profissional, a ambiguidade de funções e a insatisfação salarial. Desta forma, é necessário diversificar as rotinas, diminuir a carga horária, melhorar a relação interpessoal, melhorar as condições de trabalho, aperfeiçoar o profissional e delimitar as

  18. A escola atual e o atendimento aos portadores de altas habilidades

    Directory of Open Access Journals (Sweden)

    Cláudia Maria Ferreira Nicoloso

    2012-04-01

    Full Text Available Este artigo objetiva uma reflexão acerca dos Portadores de Altas Habilidades e os problemas que enfrentam na escola atual. Primeiramente, necessita-se compreender que a educação destas crianças não é elitista, mas sim necessária para que melhor se relacionem e não precisem esconder seus talentos. A falta de um consenso comum científico sobre o tema dificulta a definição. O que a bibliografia sugere é que se identifique de acordo com o tipo de programa que se quer oferecer. Palavras Chave: Portadores de Altas Habilidades; Superdotados; Talento.

  19. Percepção do consumidor frente aos riscos associados aos alimentos, sua segurança e rastreabilidade

    Directory of Open Access Journals (Sweden)

    Juliana Cunha de Andrade

    2013-09-01

    mostrou relevante nos três grupos, pois esta deve contribuir para o recolhimento mais eficiente de produtos, caso seja necessário. No entanto, sob a ótica do consumidor, a rastreabilidade leva ao aumento dos preços, embora aumente a confiança em relação à segurança dos alimentos. Muitas das preocupações dos consumidores refletem as informações publicadas em revistas e jornais, como o caso da crença de que hormônios são utilizados na cadeia da carne de frango. Indústria e varejistas devem incrementar a comunicação de informações científicas sobre a segurança dos alimentos, contribuindo, assim, na educação do consumidor.

  20. Reliability and Reproducibility of the OTA/AO Classification for Humeral Shaft Fractures

    NARCIS (Netherlands)

    K.C. Mahabier (Kiran); E.M.M. van Lieshout (Esther); B.C. van der Schaaf (Boyd); G.R. Roukema (Gert); B.J. Punt (Bas); M.H.J. Verhofstad (Michiel); D. den Hartog (Dennis); H.W. Bolhuis (Hugo); P.K. Bos (Koen); M.W.G.A. Bronkhorst (Maarten); M.M.M. Bruijninckx (Milko); P.Th. den Hoed (Pieter); B.J. Dwars (Boudewijn); J.C. Goslings (Carel); R. Haverlag (Robert); M.J. Heetveld (Martin); A.J.H. Kerver (Albert J.H.); K.A. Kolkman (Karel); K. Leenhouts (Kees); R. Onstenk (Ron); H. Poeze; R.W. Poolman (Rudolf); W.H. Roerdink (Herbert); J.B. Sintenie (Jan Bernard); N.M.R. Soesman (Nicolaj); F.H.W.M. van der Heijden (Frank); P. van der Zwaal (Peer); J.P. van Dijk (Johannes); H.P.W. van Jonbergen; E.J.M.M. Verleisdonk (Egbert); J.P.A.M. Vroemen (Jos); M. Waleboer (Marco); W.P. Zuidema (Wietse)

    2017-01-01

    textabstractObjectives: This study aimed to determine interobserver reliability and intraobserver reproducibility of the OTA/AO classification for humeral shaft fractures, and to evaluate differences between fracture types, fracture groups, and surgical specializations. Methods: Thirty observers (25

  1. Additions to the marine algal flora of Curaçao, Netherlands Antilles

    NARCIS (Netherlands)

    Stegenga, H.; Vroman, M.

    1988-01-01

    Nine species of benthic marine algae are reported from the Caribbean island of Curaçao for the first time: Chlorophyta: Derbesia marina and Trichosolen longipedicellata; Phaeophyta: Ectocarpus rhodochortonoides, Feldmannia elachistaeformis, Hecatonema floridanum, Herponema tortugense and Sphacelaria

  2. Tense, But in the Mood: Diachronic Perspectives on the Representation of Time in Ao

    National Research Council Canada - National Science Library

    Coupe, Alexander R

    2013-01-01

    印度東北部的Ao 語呈現一些從類型學的角度來說很有意思的特徵,我們從這些特徵可以看到Ao 語時標誌歷史發展的一些線索。作者認為Ao 語原來有二元的語氣系統:實然 (realis) 和非實然 (irrealis),前者無標誌,後者有標誌。Ao 語把其中兩個名物化標誌的作用延伸到標記時的不同範疇,而原來的無標誌的實然範疇卻...

  3. Ciberespaço cubano: uma forma de resistência ao poder e à censura

    Directory of Open Access Journals (Sweden)

    Lia Hecker Luz

    2011-01-01

    Full Text Available A entrada do corpo e da vida nos cálculos do poder corresponde ao que Foucault chamou de biopolítica. Entretanto, o próprio Foucault intuiu que aquilo mesmo que o poder investia – a vida – era o que doravante ancoraria a resistência a ele. Assim, ao poder sobre a vida deveria responder a potência da vida, capaz de operar uma resistência possível ao sequestro da vida pelo poder. Apoiando-nos no pensamento de Lévy, levantamos a hipótese, a partir da análise do blog Generación Y, de que a blogosfera cubana é uma expressão micropolítica de resistência ao poder, de biopotência da multidão.

  4. Bicolumnar 90–90 plating of AO 13C type fractures

    National Research Council Canada - National Science Library

    Cemal Kural; Ersin Ercin; Mehmet Erkilinc; Evren Karaali; Mustafa Gokhan Bilgili; Suleyman Altun

    2017-01-01

    Objective: The aim of this study was to evaluate functional results and complication rate of patients who underwent medial-dorsolateral plating for intra-articular distal humeral fracture (Müller AO type 13C). Methods...

  5. Desempenho de vacas Charolês e Nelore desterneiradas aos três ou sete meses

    Directory of Open Access Journals (Sweden)

    Restle João

    2001-01-01

    Full Text Available Foi avaliado o desempenho de vacas Charolês (C e Nelore (N, agrupadas em três classes de idade, jovens (3 e 4 anos, adultas (5 a 7 anos e velhas (8 ou mais anos, desmamadas aos três (precoce ou sete meses no outono (tradicional. O peso no outono das vacas desterneiradas aos três meses (T3 foi 45 kg superior ao das vacas com remoção do bezerro aos sete meses (T7. O estado corporal aos sete meses também foi melhor nas vacas do T3 (3,3 contra 2,1 pontos. Vacas do T3 apresentaram maior ganho de peso do parto ao final do período reprodutivo e apresentaram maiores porcentagem de cio (81 contra 51% e prenhez (67,2 contra 37,3% e menor intervalo do parto ao primeiro cio pós-parto (102 contra 114 dias que vacas do T7. Vacas adultas apresentaram melhor estado corporal aos sete meses e tiveram melhor desempenho reprodutivo do que vacas velhas e jovens. A diferença na porcentagem de prenhez entre o T3 e T7 foi mais evidente nas vacas jovens (42,11 contra 12,5% e velhas (51,72 contra 35,71% que nas adultas (62,50 contra 53,33%. Vacas C foram mais pesadas que as N, ao parto, aos três e sete meses pós-parto e apresentaram melhor estado corporal aos sete meses. O efeito do desmame precoce no desempenho reprodutivo foi mais evidente nas vacas C. A porcentagem de fêmeas prenhes nas C foi de 80,60% para o T3 e 41,90% para o T7, já nas N as porcentagens foram de 45,50 e 30,00%, respectivamente, para o T3 e T7. Nas vacas C, a produção de leite e a amamentação apresentaram efeito inibidor, sobre a reprodução, mais marcante que nas vacas N.

  6. Attitude toward contraception and abortion among Curaçao women. Ineffective contraception due to limited sexual education?

    NARCIS (Netherlands)

    Brink, M.J.; Boersma, A.A.; Meyboom-deJong, B; Bruijn, de J.G.M.

    2011-01-01

    Background In Curaçao is a high incidence of unintended pregnancies and induced abortions. Most of the induced abortions in Curaçao are on request of the woman and performed by general practitioners. In Curaçao, induced abortion is strictly prohibited, but since 1999 there has been a policy of

  7. Te Ao Kori as Expressive Movement in Aotearoa New Zealand Physical Education Teacher Education (PETE): A Narrative Account

    Science.gov (United States)

    Legge, Maureen

    2011-01-01

    A unique aspect of Aotearoa/New Zealand physical education is the inclusion of Maori culture in the form of te ao kori. Te ao kori translates to mean the world of movement and is represented by the interpretation of indigenous movement, games and pastimes. Participation in te ao kori means the sports-based normative frame of reference for physical…

  8. Safety evaluation of pectin-derived acidic oligosaccharides (pAOS): Genotoxicity and sub-chronic studies

    NARCIS (Netherlands)

    Garthoff, J.A.; Heemskerk, S.; Hempenius, R.A.; Lina, B.A.R.; Krul, C.A.M.; Koeman, J.H.; Speijers, G.J.A.

    2010-01-01

    Pectin-derived acidic oligosaccharides (pAOS) are non-digestible carbohydrates to be used in infant formulae and medical nutrition. To support its safety, the genotoxic potential of pAOS was evaluated. pAOS was not mutagenic in the Ames test. Positive results were obtained in the chromosome

  9. Safety evaluation of pectin-derived acidic oligosaccharides (pAOS): genotoxicity and sub-chronic studies.

    NARCIS (Netherlands)

    Garthoff, J.A.; Heemskerk, S.; Hempenius, R.A.; Lina, B.A.; Krul, C.A.; Koeman, J.H.; Speijers, G.J.

    2010-01-01

    Pectin-derived acidic oligosaccharides (pAOS) are non-digestible carbohydrates to be used in infant formulae and medical nutrition. To support its safety, the genotoxic potential of pAOS was evaluated. pAOS was not mutagenic in the Ames test. Positive results were obtained in the chromosome

  10. Fatores associados ao baixo peso ao nascimento entre adolescentes no Sudeste do Brasil Factors associated with low birth weight among adolescents in the Brazil Southeast region

    Directory of Open Access Journals (Sweden)

    Fernanda Garanhani Castro Surita

    2011-10-01

    Full Text Available OBJETIVOS: Conhecer a prevalência e alguns fatores associados ao baixo peso ao nascer entre gestantes adolescentes. MÉTODOS: Estudo de corte transversal, realizado entre outubro de 1994 a dezembro de 2009, com os partos ocorridos em uma maternidade de Campinas, utilizando informações coletadas em uma Ficha Obstétrica Informatizada. Foram selecionados os casos de partos entre adolescentes e, posteriormente, separados em dois grupos com e sem baixo peso ao nascer. Foram calculados o risco relativo e o intervalo de confiança (IC de 95% para as variáveis independentes (fatores de risco, e calculou-se o teste do Χ2 para comparação dos resultados perinatais. Assumiu-se nível de significância de 5%. RESULTADOS: No período ocorreram 24.000 partos no Centro de Atenção à Saúde da Mulher (CAISM, com 2.404 em 2.357 adolescentes (10,02%, sendo a frequência de baixo peso ao nascer de 15,1%. A gestação neste grupo foi recorrente em 294 (8,2%. A idade menor que 15 anos, anemia, tabagismo e hipertensão não se associaram ao baixo peso ao nascer. O antecedente de aborto e a associação com lúpus eritematoso sistêmico elevaram o risco de baixo peso ao nascer. A necessidade de cesariana e o Apgar menor que sete também foram mais prevalentes entre as adolescentes com baixo peso ao nascer, e 85% das adolescentes realizaram menos de seis consultas durante o pré-natal. CONCLUSÕES: A prevalência de baixo peso ao nascer é maior entre as adolescentes do que na população geral. Também chamou a atenção o grande número de adolescentes com menos de seis consultas durante o pré-natal. O antecedente de aborto e a presença de lúpus eritematoso sistêmico foram fatores de risco para ocorrência de baixo peso ao nascer em gestantes adolescentes.PURPOSES: To determine the rate of low birth weight and some of the risk factors associated with this event among adolescents. METHODS: A cross-sectional study conducted between October 1994 and

  11. Functional analysis of AoAtg11 in selective autophagy in the filamentous fungus Aspergillus oryzae.

    Science.gov (United States)

    Tadokoro, Takayuki; Kikuma, Takashi; Kitamoto, Katsuhiko

    2015-07-01

    Autophagy is a highly conserved cellular degradation process in eukaryotes and consists of both non-selective and selective types. Selective autophagic processes include pexophagy, mitophagy, and the cytoplasm-to-vacuole targeting (Cvt) pathway of yeast, in which particular vacuolar proteins, such as aminopeptidase I (Ape1), are selectively transported to vacuoles. Although selective autophagy has been mainly studied in the yeasts Saccharomyces cerevisiae and Pichia pastoris, there is evidence for selective autophagy in filamentous fungi; however, the details are poorly understood. In S. cerevisiae, Atg11 is a selective autophagy-specific protein that recognizes and transports substrates to the pre-autophagosomal structure (PAS). Here, we first identified an ATG11 homologue in the filamentous fungus Aspergillus oryzae and analyzed the localization of the corresponding protein, designated AoAtg11, fused to enhanced green fluorescent protein (EGFP). Imaging analysis revealed that AoAtg11-EGFP was localized to PAS-like structures. We next constructed an Aoatg11 disruptant of A. oryzae and showed that AoAtg11 is involved in pexophagy and mitophagy. In addition, AoAtg11 was found to be dispensable for non-selective autophagy and for transporting AoApe1 to vacuoles. Taken together, these results suggest that AoAtg11 is a selective autophagy-specific protein in A. oryzae, and has distinct molecular functions from that of S. cerevisiae Atg11. Copyright © 2015 The British Mycological Society. Published by Elsevier Ltd. All rights reserved.

  12. History of the AO and its global effect on operative fracture treatment.

    Science.gov (United States)

    Matter, P

    1998-02-01

    In 1958 a group of Swiss general and orthopaedic surgeons established the AO (Arbeitsgemeinschaft für Osteosynthesefragen) or the Association of the Study of Internal Fixation (ASIF) to strive to transform the contemporary treatment of fractures in Switzerland. This association was revolutionary in development of instruments and implants for operative fracture treatment. The first instructional course for teaching the use of these instruments and implants occurred in Davos, Switzerland, in the newly founded Laboratory of Experimental Surgery in 1960. Through a process of internal quality control (AO documentation) the clinical success of these new techniques and implants became evident. Operative fracture treatment gained acceptance throughout Europe and finally worldwide. AO/International (AOI) was founded in 1972 to expand education and the teaching programs for surgeons and operating personnel on an international basis. In 1984, the AO/ASIF Foundation was created with an AO Board of Trustees comprising 90 leading trauma surgeons from throughout the world. Continuous research, implant and instrument development, clinical documentation, and multifaceted educational opportunities are coordinated by the AO/ASIF Foundation to maintain its position as the international authority in the treatment of trauma. The medical community recognizes today the enormous positive global effect that this respected and ever changing organization has had by continually improving operative fracture treatment.

  13. Building a reliable, scalable and affordable RTC for AO instruments on ELTs

    Science.gov (United States)

    Gratadour, Damien; Sevin, Arnaud; Perret, Denis; Brule, Julien

    2013-12-01

    Addressing the unprecedented amount of computing power needed by the ELTs AO instruments real-time controllers (RTC) is one of the key technological developments required for the design of the next generation AO systems. Throughput oriented architectures such as GPUs, providing orders of magnitude greater computational performance than high-end CPUs, have recently appeared as attractive and economically viable candidates since the fast emergence of devices capable of general purpose computing. However, using for real-time applications a I/0 device which cannot be scheduled nor controlled internally by the operating system but is sent commands through a closed source driver comes with a number of challenges. Building on the experience of almost real-time end-to-end simulations using GPUs, and relying on the development of the COMPASS platform, a unified and optimized framework for AO simulations and real-time control, our team has engaged into the development of a scalable, heterogeneous GPU-based prototype for an AO RTC. In this paper, we review the main challenges arising when utilizing GPUs in real-time systems for AO and rank them in terms of impact significance and available solutions. We present our strategy, to mitigate these issues including the general architecture of our prototype, the real-time core and additional dedicated components for data acquisition and distribution. Finally, we discuss the expected performance in terms of latency and jitter on the basis of realistic benchmarks and focusing on the dimensioning of the MICADO AO module RTC.

  14. Candidemia in a Brazilian tertiary care hospital: species distribution and antifungal susceptibility patterns Candidemia em hospital terciário brasileiro: distribuição das espécies e padrões de susceptibilidade aos antifúngicos

    Directory of Open Access Journals (Sweden)

    Ana Graciela Ventura Antunes

    2004-10-01

    Full Text Available Recent studies have shown differences in the epidemiology of invasive infections caused by Candida species worldwide. In the period comprising August 2002 to August 2003, we performed a study in Santa Casa Complexo Hospitalar, Brazil, to determine Candida species distribution associated with candidemia and their antifungal susceptibility profiles to amphotericin B, fluconazole and itraconazole. Antifungal susceptibility was tested according to the broth microdilution method described in the NCCLS (M27A-2 method. Only one sample from each patient was analyzed (the first isolate. Most of the episodes had been caused by species other than C. albicans (51.6%, including C. parapsilosis (25.8%, C. tropicalis (13.3%, C. glabrata (3.3%, C. krusei (1.7%, and others (7.5%. Dose-dependent susceptibility to itraconazole was observed in 14.2% of strains, and dose-dependent susceptibility to fluconazole was found in 1.6%. Antifungal resistance was not found, probably related to low use of fluconazole. Further epidemiological surveillance is needed.Estudos realizados em diferentes países têm mostrado diferença na epidemiologia das infecções invasivas por Candida spp. No período de agosto de 2002 a agosto de 2003, foi conduzido estudo na Santa Casa Complexo Hospitalar, Porto Alegre, Brasil, para determinar a distribuição das espécies de Candida associadas a candidemia e o perfil de susceptibilidade das mesmas aos antifúngicos anfotericina B, fluconazol e itraconazol. Os testes de susceptibilidade foram realizados de acordo com a metodologia M27-A2 padronizada pelo NCCLS. Foi incluído no estudo o primeiro isolado de hemocultivo de cada paciente. A maioria dos episódios (51,6% ocorreu por espécies outras que C. albicans, incluindo C. parapsilosis (25,8%, C. tropicalis (13,3%, C. glabrata (3,3%, C. krusei (1,7% e outras espécies (7,5%. Não foi encontrada resistência aos antifúngicos testados, possivelmente devido ao baixo consumo de fluconazol na

  15. Resposta in vitro de fungos agentes de micoses cutâneas frente aos antifúngicos sistêmicos mais utilizados na dermatologia In vitro response of cutaneous mycosis fungal agents to the most widely used systemic antifungals in dermatology

    Directory of Open Access Journals (Sweden)

    Lívia Maria Martins de Almeida

    2009-07-01

    Full Text Available FUNDAMENTOS - A alta frequência das micoses cutâneas justifica a necessidade de avaliar a possível contribuição da determinação do perfil de susceptibilidade aos antifúngicos in vitro. OBJETIVO - Avaliar se existe variabilidade nos isolados fúngicos quanto à susceptibilidade in vitro de fungos filamentosos, previamente isolados de micoses cutâneas, frente aos antifúngicos fluconazol, cetoconazol, itraconazol e terbinafina. MÉTODOS - Os fungos foram isolados e identificados por meio da metodologia clássica e o teste de susceptibilidade aos antifúngicos foi realizado segundo o método de microdiluição em caldo, de acordo com protocolo preconizado pelo Clinical Laboratory Standards Institute (CLSI, documento M38-A. RESULTADOS - Das 80 amostras de fungos filamentosos identificadas, o gênero Trichophyton representou 81%. As quatro drogas analisadas apresentaram grande variação nos gêneros Trichophyton e Microsporum. O gênero Fusarium foi resistente a todas as drogas testadas. A terbinafina foi o antimicótico mais eficaz contra a maioria dos isolados fúngicos. CONCLUSÃO - Houve uma grande variabilidade nos perfis de resposta aos antifúngicos testados. O estabelecimento de um método-teste de referência permitirá ao clínico maior objetividade na escolha de uma terapia adequada.BACKGROUND - The high frequency of cutaneous mycosis justify the need to evaluate the possible contribution of in vitro profile of susceptibility to antifungal agents. OBJECTIVE - To evaluate whether there is variability in in vitro susceptibility by filamentous fungi, previously isolated from cutaneous mycosis, to fluconazole, ketoconazole, itraconazole and terbinafine. METHODS - Fungi were isolated and identified by classical methods and the antifungal susceptibility test was performed using the method of broth microdilution, according to a protocol recommended by the Clinical Laboratory Standards Institute (CLSI, through M38-A document. RESULTS

  16. The influence of gestational age and birth weight in the clinical assesment of the muscle tone of healthy term and preterm newborns A influência da idade gestacional e do peso ao nascimento na avaliação clínica do tono muscular de recém nascidos a termo e prematuros hígidos

    Directory of Open Access Journals (Sweden)

    Edla S. da Silva

    2005-12-01

    Full Text Available OBJECTIVE: To evaluate the influence of gestational age (GA and birth weight (BW in the clinical assessment of the muscle tone of healthy term and preterm newborns. METHOD: Cross sectional study. The muscle tone of healthy 42 preterm and 47 term newborns was quantified and measured with a goniometer (an instrument for measuring angles respectively between 7th-14th day of life and 24-48 hours of life. Newborns were grouped according to GA and BW and evaluated at fixed time intervals by one examiner. Preterm newborns were matched to term at 40 weeks postconceptional age (PCA. RESULTS: The evolution of muscle tone in the preterm occurred gradually, following PCA, independent of birth weight. Preterm newborns had lower scores in all muscle tone indicators when compared to term at the first assessment. Differences were observed among preterm small for GA and adequate to GA for the indicator heel to ear (pOBJETIVO: Verificar a influência da idade gestacional (IG e do peso ao nascimento (PN na avaliação do tono muscular de recém nascidos (RN a termo e prematuros hígidos. MÉTODO: Estudo transversal. O tono muscular de 42 RN prematuros e 47 termo foi quantificado e mensurado com goniômetro (instrumento para medir ângulos, respectivamente entre 7-14 dias de vida e 24-48 horas de vida. Os RN foram agrupados de acordo com IG e PN, sendo avaliados em intervalos fixos. RN prematuros foram comparados aos a termo na 40ª semana de idade concepcional (IC. RESULTADOS: A evolução do tono muscular nos RN prematuros ocorreu de forma gradual de acordo com IC e independente do PN. RN prematuros, na primeira avaliação apresentaram escores de tono muscular inferiores aos de RN a termo em todos os indicadores. Foram observadas diferenças entre RN prematuros pequenos e adequados para a IG em relação ao indicador calcanhar-orelha (p<0,001. O pareamento dos grupos na 40ª semana de IC mostra, exceto pela postura, diferença significativa entre os grupos (p< 0

  17. Desfechos clínicos aos 30 dias do registro brasileiro das síndromes coronárias agudas (ACCEPT Clinical outcomes at 30 days in the brazilian registry of acute coronary syndromes (ACCEPT

    Directory of Open Access Journals (Sweden)

    Luiz A lberto Piva e Mattos

    2013-01-01

    Full Text Available FUNDAMENTO: São escassos os registros documentando a prática clínica brasileira na vigência de uma síndrome coronária aguda. OBJETIVOS: Descrição da demografia, ocorrência de desfechos graves e análise comparativa dentre aqueles que efetivaram ou não uma estratégia invasiva (cinecoronariografia e revascularização miocárdica em um registro brasileiro multicêntrico de portadores de uma síndrome coronária aguda. MÉTODOS: O registro ACCEPT/SBC coletou prospectivamente, em 47 centros hospitalares brasileiros, pacientes na vigência de uma síndrome coronária aguda. Apresentamos a ocorrência de desfechos clínicos graves, de modo integral, e de acordo com a submissão ou não a um procedimento de revascularização do miocárdio ao final dos primeiros 30 dias de seguimento. RESULTADOS: De agosto de 2010 até dezembro de 2011, 2.485 pacientes foram incluídos neste registro. Destes, 31,6% eram portadores de angina instável e 34,9% e 33,4%, com síndrome sem e com supradesnível do segmento ST. Aos 30 dias, a submissão a procedimento de revascularização do miocárdio foi progressivamente maior de acordo com a gravidade da apresentação clínica (38,7% versus 53,6% versus 77,7%; p BACKGROUND: There are few registries documenting clinical practice in Brazilian patients with acute coronary syndrome. OBJECTIVES: Demography description, occurrence of major clinical adverse events and comparative analysis in patients submitted or not to an invasive strategy (coronary angiography and myocardial revascularization in a Brazilian multicenter registry of acute coronary syndrome. METHODS: The ACCEPT/SBC registry prospectively collected data on acute coronary syndrome patients from 47 Brazilian hospitals. The current analysis reports the occurrence of major clinical outcomes and according to the performance or not of a procedure for myocardial revascularization at the end of 30 day follow-up. RESULTS: Between August 2010 and December 2011

  18. Instrumento mensurador de adesao para hipertensos: contribuicao da Teoria da Resposta ao Item

    Directory of Open Access Journals (Sweden)

    Malvina Thais Pacheco Rodrigues

    2013-06-01

    Full Text Available OBJETIVO: Analisar instrumento de medição da adesão ao tratamento da hipertensão por meio da "Teoria da Resposta ao Item". MÉTODOS: Estudo analítico com 406 hipertensos com complicações associadas, atendidos na atenção básica em Fortaleza, CE, 2011, pela "Teoria da Resposta ao Item". As etapas de execução foram: teste de dimensionalidade, calibração dos itens; tratamento dos dados e construção da escala, analisadas com base no modelo de resposta gradual. Estudo da dimensionalidade do instrumento foi feito pela análise da matriz de correlação policórica e análise fatorial de informação completa. Utilizou-se o software Multilog para calibração dos itens e estimação dos escores. RESULTADOS: Os itens referentes ao tratamento medicamentoso foram os mais diretamente relacionados à adesão, enquanto aqueles referentes ao tratamento não medicamentoso precisam ser reformulados, pois possuíram menor quantidade de informação psicométrica e baixa discriminação. A independência dos itens, o reduzido número de níveis da escala e as baixas variâncias explicadas no ajuste dos modelos mostraram as principais fragilidades do instrumento analisado. A "Teoria da Resposta ao Item" mostrou-se relevante para análise, pois avaliou o respondente quanto à adesão ao tratamento da hipertensão, ao nível de dificuldade dos itens e à sua capacidade de discriminação entre indivíduos com diferentes níveis de adesão, o que gerou maior quantidade de informação. CONCLUSÕES: O instrumento analisado é limitado para medir a adesão ao tratamento da hipertensão, mediante análise pela "Teoria da Resposta ao Item", e necessita de ajustes. A adequada formulação dos itens é importante para medir precisamente o traço latente desejado.

  19. Desafios da adesão ao tratamento de pessoas vivendo com HIV/Aids no Brasil Challenges of treatment adherence by people living with HIV/AIDS in Brazil

    Directory of Open Access Journals (Sweden)

    Regina Melchior

    2007-12-01

    Full Text Available OBJETIVO: Analisar as dificuldades referentes à adesão ao tratamento de pacientes vivendo com HIV/Aids em terapia anti-retroviral altamente ativa. MÉTODOS: Pesquisa qualitativa baseada em 34 entrevistas com pacientes em tratamento de diversos serviços ambulatoriais do estado de São Paulo em 1998-1999. O grupo compreendeu pessoas de diferentes níveis socioeconômicos, sexo, tempo no tratamento e diferentes graus de adesão de acordo com a percepção da equipe de saúde. As entrevistas foram focalizadas na narrativa do paciente sobre sua doença. A análise de conteúdo classificou as dificuldades relacionadas a fatores sociais e do estilo de vida, incluindo o estigma; a crenças acerca do uso da medicação; e diretamente ao uso da medicação. RESULTADOS: Todos os entrevistados relataram dificuldades relacionadas ao estigma de viver com HIV/Aids. As dificuldades relacionadas ao uso da medicação predominaram entre pacientes com melhor adesão. Pacientes com aderência média apresentaram os três tipos de dificuldade. CONCLUSÕES: Os fatores sociais e culturais são mais difíceis de serem superados para adesão ao tratamento do que aqueles relacionados a tomar a medicação, o que torna importante o papel desempenhado pelo setor saúde, apoiado por políticas públicas sociais claras. Essas dimensões devem ser enfrentadas não somente no setor saúde, mas também nos âmbitos político e social.OBJECTIVE: To analyze the difficulties related to treatment adherence by patients living with HIV/AIDS in highly active antiretroviral therapy. METHODS: Qualitative research based on 34 interviews with patients under treatment in several outpatient services in the state of São Paulo, in 1998-1999. The group was comprised of people from different socioeconomic levels, gender, length of treatment and varied adherence levels, according to healthcare staff perception. The interviews focused on the patient's narrative about his/her disease. The

  20. COLPOCITOLOGY AND SERUM CONCENTRATIONS OF PROGESTERONE IN NULIPAROUS GOATS SUBMMITED TO ARTIFICIAL PHOTOPERIODS COLPOCITOLOGIA E CONCENTRAÇÕES SÉRICAS DE PROGESTERONA EM CABRAS NULÍPARAS SUBMETIDAS AO FOTOPERÍODO ARTIFICIAL

    Directory of Open Access Journals (Sweden)

    Caroline Rocha de Oliveira Lima

    2008-10-01

    artificial, por 24 horas durante 35 dias ininterruptos. Realizou-se colheita de conteúdo cérvico-vaginal para preparo de esfregaços, que foram corados pelo método Papanicolau. A concentração sérica de progesterona foi mensurada por enzimaimunoensaio. Verificou-se predomínio de células parabasais, seguido de células intermediárias, principalmente no final do metaestro e diestro. Células superficiais queratinizadas foram relacionadas às fases de proestro e estro. O perfil celular acompanhou as oscilações das concentrações séricas de progesterona, as quais sofreram modificações de acordo com a fase do ciclo estral nos animais-controle, mas com um período confuso no início da exposição à luz artificial, nos animais tratados. O estudo das modificações celulares do epitélio cérvico-vaginal pode ser valioso como um bioensaio hormonal do ciclo estral em cabras submetidas ao fotoperíodo artificial, apenas após o período de adaptação ao tratamento.

     

    PALAVRAS-CHAVES: Caprino, citologia vaginal, hormônio, luz artificial.

     

  1. Mielopatia associada ao HTLV-I / paraparesia espástica tropical: relato dos primeiros casos em Sergipe HTLV-I associated myelopathy, tropical spastic paraparesis: report of the first cases in Sergipe-Brazil

    Directory of Open Access Journals (Sweden)

    HÉLIO ARAUJO OLIVEIRA

    1998-03-01

    Full Text Available Mielopatia associada ao HTLV-I / paraparesia espástica tropical (MAH/PET, tem sido descrita em quase todas as regiões do Brasil.Os autores apresentam oito casos clinicamente definidos como MAH/PET, os primeiros relatados no Estado de Sergipe .Todos foram positivos para HTLV-I, através do método ELISA, realizado duas vezes; em apenas dois casos foi possível a confirmação por Western Blot. De acordo com protocolo de investigação clínico-laboratorial, todos os pacientes apresentaram acometimento do tracto piramidal, com mínimo comprometimeto da sensibilidade e alterações esfincterianas. Os autores chamam a atenção para a endemicidade do HTLV-I no Estado, cuja prevalência entre doadores de sangue é significativa (0,43%.HTLV-I associated myelopathy/ tropical spastic paraparesis (HAM/TSP has been decribed in practically all regions of Brazil. The authors present eight clinically defined cases of HAM/TSP, as being the first reported in Sergipe (Northeastern Brazil. All of them were confirmed through ELISA in two examinations, although only two were confirmed by Western Blot. According to clinical/laboratorial investigation protocol, all patients presented involvement of the pyramidal tract with minimal sensory loss and sphincter alteration. The authors call the attention for the endemicity of HTLV-I in the region, whose prevalence amongst blood donors is significant (0.43%.

  2. Avaliação clínica de reabsorção radicular externa em dentes desvitalizados submetidos ao clareamento Clinical evaluation of external radicular resorption in non-vital teeth submitted to bleaching

    Directory of Open Access Journals (Sweden)

    Alessandro Dourado Loguercio

    2002-06-01

    Full Text Available O propósito deste estudo foi avaliar a presença de reabsorção cervical externa em pacientes submetidos ao clareamento de dentes desvitalizados. Os pacientes avaliados tiveram pelo menos um dente desvitalizado clareado entre os anos de 1986 a 1996. Os pacientes foram submetidos à técnica de clareamento com perborato de sódio e peróxido de hidrogênio, de acordo com a técnica descrita por Busato et al.5,6.Dos 193 pacientes chamados para que os dentes clareados fossem examinados clínica e radiograficamente, apenas 43 pacientes compareceram (54 dentes com uma média de tempo após o clareamento de 3,5 anos. Os resultados permitiram concluir que em nenhum dos dentes examinados foi possível observar indícios de reabsorção cervical externa.The purpose of this study was to evaluate the presence of external resorption in non-vital teeth submitted to bleaching. The evaluated patients had at least one non-vital tooth, which had been bleached between 1986 and 1996. All teeth were submitted to bleaching with hydrogen peroxide and sodium perborate, as described by Busato et al.5,6. From 193 patients recalled for clinical and radiographic evaluation of bleached teeth, only 43 attended (54 teeth. The average time elapsed after bleaching was 3.5 years. The results revealed that none of the examined teeth had any degree of external cervical resorption.

  3. Influência da adição de carga inorgânica aos sistemas adesivos na resistência adesiva à dentina = Influence of filler addition to bonding agents on dentin bond strength

    Directory of Open Access Journals (Sweden)

    Cesar, Patricia Desiderio

    2005-01-01

    Full Text Available O objetivo desse estudo foi avaliar o papel da presença ou não de partículas de carga nos sistemas adesivos sobre a resistência adesiva à dentina. Foram utilizados 70 dentes bovinos, divididos em 7 grupos, que foram embutidos em resina acrílica e desgastados até a exposição de uma área plana de dentina. Todos os espécimes receberam o condicionamento ácido e aplicação dos sistemas adesivos, contendo ou não as partículas de carga, de acordo com as instruções do fabricante: Prime & Bond 2. 1 (sem carga – SC, Prime & Bond NT (com carga – CC, Prime & Bond 2. 1 + 10% de SiO² (CC, One Step (SC, One Step Plus (CC, Sigle Bond (SC e Single Bond +10% de SiO² (CC. Cilindros de resina composta TPH Spectrum foram realizados sobre a área de adesão. Os espécimes foram armazenados por 24 a 37C°, e então submetidos ao teste de cisalhamento. Os dados obtidos foram submetidos à análise estatística, empregando- se o teste de análise de variância paramétrica, seguida pelo teste de Tukey a um nível de significância de 5%. Concluiu-se que, para todos os sistemas adesivos testados, a adição de partículas de carga não resultou em diferenças significativas na força de adesão. Porém, entre as marcas comerciais, observamos diferenças significativas, o que demonstra a influência dos demais componentes na eficiência adesiva

  4. Só em direção ao só: considerações sobre a mística de Plotino

    Directory of Open Access Journals (Sweden)

    Bernardo Guadalupe dos Santos Lins Brandão

    2009-05-01

    Full Text Available Resumo Plotino é um pensador estranho para o filósofo contemporâneo: nas suas Enéadas, ele discute experiência mística e prática filosófica como se fosse uma mesma coisa. De fato, no pensamento plotiniano, o ápice da vida filosófica é a contemplação mística: não pensamento irracional, mas uma forma supra-racional de consciência que é alcançada pela prática ascética e pelo procedimento dialético. Este artigo tenta entender o que é a experiência mística em Plotino. Na verdade, uma leitura atenta dos textos das Enéadas que tratam do assunto mostram que não existe apenas um, mas dois tipos de contemplação mística supra-racional: a experiência da alma humana unida ao Intelecto divino e a experiência da alma humana unida ao Um, o princípio supremo da realidade de acordo com a filosofia plotiniana. Ambos são tipos de intuição intelectual interior, mas, se a experiência mística do Intelecto é a contemplação da totalidade do mundo inteligível, a contemplação do Um é a intuição da identidade pura, além de toda a diferença. Palavras-chave: Plotino; Neoplatonismo; Mística. Abstract Plotinus is a strange scholar to the contemporary philosopher: in his Enneads, he discusses mystical experience and philosophical practice as if they were the same thing. Indeed, according to his thoughts, the summit of philosophical life is mystical contemplation: not irrational thinking, but a supra-rational form of consciousness achieved through ascetic practice and dialectical procedure. This paper attempts to understand the mystical experience in Plotinus. In fact, a close reading of the texts of the Enneads on the subject demonstrates that there are not only one, but two kinds of supra-rational mystical contemplation: the experience of the human soul united to the divine Intellect and the experience of the human soul united to the One, the supreme principle of reality according to Plotinus's philosophy. Both are kinds of

  5. Farinha integral de trigo germinado: 3. Características nutricionais e estabilidade ao armazenamento Whole flour of germinated wheat: 3. Nutritional characteristics and storage stability

    Directory of Open Access Journals (Sweden)

    Martha Zavariz de Miranda

    2002-12-01

    Full Text Available O trigo (Triticum aestivum L. é usado principalmente para alimentação humana, na forma de farinhas. A germinação pode ser útil para melhorar a qualidade protéica, bem como a de outros nutrientes do trigo, e a estabilidade das farinhas produzidas de trigo germinado é desconhecida. Assim, este trabalho investigou, em laboratório, o efeito da germinação sobre algumas características nutricionais e sobre a estabilidade ao armazenamento de farinhas integrais de trigo germinado por 48 (FITG48, 72 (FITG72 e 96 horas (FITG96. O perfil de aminoácidos das FITGs foi considerado bom, quando comparado com o da farinha controle e com o do padrão teórico da FAO para pré-escolares (2-5 anos. Somente a lisina (primeiro aminoácido limitante e a treonina das FITGs mostraram valores mais baixos que o do citado padrão. O escore químico (em torno de 56-57 e o escore de aminoácidos corrigido pela digestibilidade protéica (em torno de 54-58 foram mais altos nas FITGs que na farinha integral controle (48 e 42, respectivamente. Com base nesses resultados, as características nutricionais das FITGs foram melhoradas pela germinação de trigo. Com relação à estabilidade ao armazenamento, o pH diminuiu e a acidez álcool-solúvel aumentou de acordo com o tempo de germinação de trigo. As FITGs foram estáveis até 4 meses de armazenamento, com exceção da FITG96, que apresentou alto nível de acidez álcool-solúvel, provavelmente devido à rancidez hidrolítica. O hexanal, uma medida da deterioração oxidativa, foi encontrado somente na farinha controle; nas FITGs não foi detectado, indicando boa estabilidade oxidativa durante 6 meses de armazenamento.Wheat (Triticum aestivum L. is used mainly as human food in the form of flour. Germination may be useful to improve the quality of protein, and possibly other nutrients in wheat. Since the stability of flours produced from germinated grains is little known, this work investigated the effect of

  6. Review of adaptive optics OCT (AO-OCT): principles and applications for retinal imaging [Invited].

    Science.gov (United States)

    Pircher, Michael; Zawadzki, Robert J

    2017-05-01

    In vivo imaging of the human retina with a resolution that allows visualization of cellular structures has proven to be essential to broaden our knowledge about the physiology of this precious and very complex neural tissue that enables the first steps in vision. Many pathologic changes originate from functional and structural alterations on a cellular scale, long before any degradation in vision can be noted. Therefore, it is important to investigate these tissues with a sufficient level of detail in order to better understand associated disease development or the effects of therapeutic intervention. Optical retinal imaging modalities rely on the optical elements of the eye itself (mainly the cornea and lens) to produce retinal images and are therefore affected by the specific arrangement of these elements and possible imperfections in curvature. Thus, aberrations are introduced to the imaging light and image quality is degraded. To compensate for these aberrations, adaptive optics (AO), a technology initially developed in astronomy, has been utilized. However, the axial sectioning provided by retinal AO-based fundus cameras and scanning laser ophthalmoscope instruments is limited to tens of micrometers because of the rather small available numerical aperture of the eye. To overcome this limitation and thus achieve much higher axial sectioning in the order of 2-5µm, AO has been combined with optical coherence tomography (OCT) into AO-OCT. This enabled for the first time in vivo volumetric retinal imaging with high isotropic resolution. This article summarizes the technical aspects of AO-OCT and provides an overview on its various implementations and some of its clinical applications. In addition, latest developments in the field, such as computational AO-OCT and wavefront sensor less AO-OCT, are covered.

  7. Review of adaptive optics OCT (AO-OCT): principles and applications for retinal imaging [Invited

    Science.gov (United States)

    Pircher, Michael; Zawadzki, Robert J

    2017-01-01

    In vivo imaging of the human retina with a resolution that allows visualization of cellular structures has proven to be essential to broaden our knowledge about the physiology of this precious and very complex neural tissue that enables the first steps in vision. Many pathologic changes originate from functional and structural alterations on a cellular scale, long before any degradation in vision can be noted. Therefore, it is important to investigate these tissues with a sufficient level of detail in order to better understand associated disease development or the effects of therapeutic intervention. Optical retinal imaging modalities rely on the optical elements of the eye itself (mainly the cornea and lens) to produce retinal images and are therefore affected by the specific arrangement of these elements and possible imperfections in curvature. Thus, aberrations are introduced to the imaging light and image quality is degraded. To compensate for these aberrations, adaptive optics (AO), a technology initially developed in astronomy, has been utilized. However, the axial sectioning provided by retinal AO-based fundus cameras and scanning laser ophthalmoscope instruments is limited to tens of micrometers because of the rather small available numerical aperture of the eye. To overcome this limitation and thus achieve much higher axial sectioning in the order of 2-5µm, AO has been combined with optical coherence tomography (OCT) into AO-OCT. This enabled for the first time in vivo volumetric retinal imaging with high isotropic resolution. This article summarizes the technical aspects of AO-OCT and provides an overview on its various implementations and some of its clinical applications. In addition, latest developments in the field, such as computational AO-OCT and wavefront sensor less AO-OCT, are covered. PMID:28663890

  8. Por que as pessoas recorrem ao Judiciário para obter o acesso aos medicamentos? O caso das insulinas análogas na Bahia

    OpenAIRE

    Lisboa, Erick Soares; Souza, Luis Eugenio Portela Fernandes de

    2017-01-01

    Resumo As insulinas análogas são alvo de controvérsias quanto à sua superioridade terapêutica em relação às humanas. Talvez, em parte, devido a isso, são objetos frequentes de ações judicias. A judicialização da saúde tem sido muito estudada, mas pouco se sabe sobre os motivos que levam as pessoas a recorrerem ao Judiciário para obter acesso a medicamentos no SUS. Sendo assim, o presente estudo tem por objetivo analisar os motivos que levaram as pessoas a recorrerem ao Judiciário para obter o...

  9. Dynamic SPECT of the brain using a lipophilic technetium-99m complex, PnAO

    DEFF Research Database (Denmark)

    Holm, S; Andersen, A R; Vorstrup, S

    1985-01-01

    The lipophilic 99mTc-labeled oxime propylene amine oxime (PnAO) should, according to recent reports behave like 133Xe in the human brain. This study compares SPECT images of the two tracers in six subjects: four stroke cases, one transitory ischemic attack case and one normal subject. Technetium-......AO has a high yet incomplete brain extraction yielding a flow dominated initial distribution with limitations mentioned.......The lipophilic 99mTc-labeled oxime propylene amine oxime (PnAO) should, according to recent reports behave like 133Xe in the human brain. This study compares SPECT images of the two tracers in six subjects: four stroke cases, one transitory ischemic attack case and one normal subject. Technetium-99......m PnAO was injected i.v. as a bolus of 15 to 25 mCi. The distribution was followed over 10-sec intervals using a highly sensitive, rapidly rotating SPECT (Tomomatic 64) and compared to 133Xe flow maps. Upon arrival of the PnAO bolus to the brain, a high uptake was found in brain tissue with high...

  10. Production of Alginate Oligosaccharides (AOS as Prebiotic Ingredients through by Alginate lyase enzyme

    Directory of Open Access Journals (Sweden)

    Fahriza Sri Afni

    2017-04-01

    Full Text Available Prebiotics is indigestible foods that can not be digested but can stimulate the growth and activity of bacteria in the digestive tract effecting human health. Alginate oligosaccharides (AOS can be used as a source of prebiotic. That compounds can be produced enzymatically by cutting long chain alginates using alginate lyase. The aim of this study was to produce alginate lyase enzyme then producing Alginate oligosaccharides (AOS as a prebiotic ingredients. The alginate lyase enzyme can be produced from Bacillus megaterium bacteria using a discontinuous fermentor. The enzyme was  optimum temperature of 45°C and an optimum pH of 7.0. Alginate oligosaccharides production was performed with the addition of different enzyme concentrations 25, 50, 75, and 100 U. The result of the addition of enzyme (25, 50,75 U showed that the value of polymerization degrees (DP were between 4-5. However, the addition of enzyme (100 U was in the range of  DP 3-4. Bacterial probiotic growth test results of Bifidobacteria and Lactobacillus showed that 1% added AOS media were able to increase the growth of probiotic bacteria compared to themedia without addition of AOS. The addition Alginate lyase activity of 50 U in AOS production is the best treatment of both probiotic bacteria.

  11. Morfologia e Crescimento dos 6 aos 10 anos de idade em Viana do Castelo, Portugal

    Directory of Open Access Journals (Sweden)

    Luis Paulo Rodrigues

    2008-09-01

    Full Text Available Ao longo de quatro anos, o Estudo Morfofuncional da Criança Vianense observou 1911 crianças entre os 6e os 10 anos de idade, resultando em 4064 observações individuais(2054 de raparigas, 2006 de rapazes.Os resultados encontrados nos indicadores morfológicos simples(altura, peso, pregas adiposas, diâmetros ósseos e perímetros muscularese no somatótipo, são descritos normativamente (valores percentílicose comparados com outros estudos nacionais e internacionais. As crianças vianenses demonstraram possuir uma estatura média ligeiramente superior às reportadas nos estudos portugueses e um ritmo de crescimento diferente das norte-americanas; peso semelhante ao das congéneres nacionais mas inferior ao das EUA; valores de pregas adiposas geralmente inferiores aos encontrados em Portugal e EUA; perímetros musculares e diâmetros ósseos semelhantes aos seus pares portugueses; e uma tendência para o aumento, com a idade, do ectomorfismo nos rapazes e do endomorfismo em ambos os sexos. Este panorama parece indicar que as crianças vianenses apresentam características de aptidão morfologia que estão longe de espelhar as preocupações internacionais nesta matéria.

  12. Relationship between winter AO/NAO and temperature in China: intraseasonal and interdecadal variations

    Science.gov (United States)

    Ren, Hong-Li; Zuo, Jinqing; Li, Weijing

    2017-04-01

    In this study, we focus on the intraseasonal and interdecadal variations in the relationship between winter AO/NAO (Arctic Oscillation / North Atlantic Oscillation) and surface air temperature (SAT) in China. On one hand, our results show that there is an intraseasonal contrast in impacts of AO/NAO on SAT in the central-southern China between early and mid-late winter. The linkage between AO and central-southern China SAT strongly depends on the AO-associated changes in Middle-East Jet Stream (MEJS) and the AO-MEJS relationship is significantly different between early and mid-late winter. On the other hand, our results also clearly show that inter-decadal changes have occurred in the relationship between the winter NAO and southern China surface air temperature anomalies in the past decades. A weak in-phase relationship occurred before the early 1970s, but a significant out-of-phase relationship dominated during 1979-1998, though it has been clearly weaker from the late 1990s onwards. Observational evidence shows that such interdecadal variations are mainly related to variations in the spatial pattern and amplitude of the NAO. The eastward shift and amplitude intensification of the NAO favored a north-south Asian dipole structure of circulation anomalies, which tended to produce cold SAT anomalies in central-southern China in the positive NAO phase and warm in the negative NAO phase.

  13. Toward an experimental validation of new AO concepts for future E-ELT instrumentation

    Science.gov (United States)

    El Hadi, K.; Fusco, T.; Le Roux, B.

    2012-07-01

    For the last few years, LAM has been carrying out several R&D activities in Adaptive Optics (AO) instrumentation for Extremely Large Telescopes (ELTs). In the European ELT framework, a multi-purpose AO bench is developed to allow the experimental validation of new instrumental concepts dedicated to the next generation of ELTs. It is based on the use of a Shack-Hartmann wave-front sensor in front of a 140 actuators micro-deformable mirror (Boston Micromachines), dedicated to “low orders” modes, while a Pyramid wave-front sensor (PWFS) will be combined to a Liquid Crystal Spatial Light Modulator for “high orders” correction. Both systems could be merged in a two stages AO concept allowing to study the coupling of a telescope pre-correction using a dedicated large M4 deformable mirror and a post focal high order AO system. Analysis and optimisation of the spatial and temporal splits of the AO correction between the two systems is therefore essential. Finally, we will use the world’s fastest and most sensitive camera system OCAM (developed at LAM) coupled with the pyramid , to demonstrate the concept of a fast and hyper-sensitive PWFS (up to 100x100 sub-pupils) dedicated to the first generation instruments for ELTs.

  14. Cantaria em louvação ao dia do Barroco Mineiro e homenagem ao poeta e ensaísta Affonso Ávila

    Directory of Open Access Journals (Sweden)

    Cristina Ávila

    2013-12-01

    Full Text Available É com profunda comoção que, em nome de minha família, agradeço a prestigiosa homenagem concedida pela Pontifícia Universidade Católica de Minas Gerais – PUCMinas e pela Assembleia Legislativa do Estado de Minas Gerais ao reconhecido e saudoso poeta e ensaísta do Barroco Mineiro, Affonso Ávila. O convite para a participação neste debate acadêmico, feito ao próprio homenageado pela Prof. Dra. Melânia da Silva Aguiar, foi recebido por ele com enorme entusiasmo, mas quis o destino que ele se fosse antes da data prevista. Como historiadora da arte e cultura estou presente apenas para contemplar alguns aspectos de sua obra, especialmente no que se refere aos estudos de Barroco, mas não posso substituir o depoimento do ensaísta que seria, com certeza, bem mais interessante.

  15. Práticas educativas maternas e paternas aos 24 e aos 72 meses de vida da criança

    Directory of Open Access Journals (Sweden)

    Angela Helena Marin

    Full Text Available Este estudo investigou as práticas educativas indutivas, coercitivas e de não interferência maternas e paternas aos 24 e 72 meses de vida da criança. Participaram 24 mães e pais de um único filho/a, que responderam uma entrevista para avaliação dessas práticas. Análises estatísticas revelaram que as mães foram significativamente mais indutivas que os pais aos 24 meses, mas aos 72 meses não houve diferenças. Enfatiza-se que as mães tendem a conversar mais com seus filhos/as, expressar sentimentos, opiniões, estabelecer limites e elogiar comportamentos adequados. As mães também apresentaram médias mais elevadas no total de práticas relatadas, o que pode ser explicado pelo papel predominante que ainda exercem na socialização infantil, embora os pais venham participando mais da educação dos filhos/as.

  16. As bases e a eficiência da teoria de paz democrática do Direito dos Povos e sua resposta ao Realismo Político nas relações internacionais

    Directory of Open Access Journals (Sweden)

    Fernando Nunes Oliveira

    2017-02-01

    Full Text Available O modelo do realismo político nas relações internacionais concebe as relações entre os Estados como dadas em um espaço em que reina a anarquia. Dada a estrutura anárquica internacional, os Estados apresentam uma especial preocupação com sua segurança e a verdadeira confiança entre eles é improvável. A teoria da paz democrática é uma das mais conhecidas oposições à necessidade anárquica do sistema internacional. Os teóricos da paz democrática argumentam que as democracias não fazem guerras umas com as outras. Entretanto, elas ainda se portam agressivamente com relação às não-democracias, deixando de observar normas e tratados internacionais sem critérios específicos para seu descumprimento e, consequentemente, gerando instabilidade internacional e ressentimento. Com sua teoria de paz democrática, apresentada em O Direito dos Povos, Rawls pretende dar uma resposta ao realismo político nas relações internacionais. A paz de Rawls é uma paz de povos, que se diferenciam de Estados por apresentarem características morais e limites nos seus poderes de soberania. Povos podem conceder a outros povos condições razoáveis para cooperação (e sabe-se que estão dispostos a agirem de acordo com elas. Com o tempo, povos que vivem sob a égide de tal paz passam a vê-la como um valor e também desenvolvem confiança recíproca. Tal paz é ainda estendida aos povos não-liberais mas decentes, incluindo portanto certos povos que dificilmente seriam considerados democráticos, mas que possuem instituições que merecem ser respeitadas. Argumentamos que tal inclusão torna a paz democrática de Rawls especialmente eficiente, pois uma quantidade maior de povos pode fazer parte dela, diminuindo a instabilidade gerada pelo ressentimento.

  17. Reação de clones de bananeira(Musa spp. ao nematóide Meloidogyne incognita (Kofoid & White, 1919 Chitwood, 1949, Raça 2

    Directory of Open Access Journals (Sweden)

    Vilas Boas Lenisa Cezar

    2002-01-01

    Full Text Available O trabalho teve por objetivo estudar em condições de casa de vegetação a reação de clones de bananeira, em relação a Meloidogyne incognita raça 2. Mudas micropropagadas foram inoculadas, utilizando-se da suspensão de M. incognita, formada de ovos e de juvenis do segundo estádio, totalizando 20.000 / muda. A inoculação foi feita após cinco dias do transplante das mudas para sacos de plástico preto de cinco litros de capacidade, contendo solo, areia e esterco, na proporção 3:1:1, esterilizado em caldeira a 100ºC, por duas horas. O delineamento experimental foi o inteiramente casualizado, com quatro repetições. Após 120 dias, os clones foram avaliados. Determinou-se o número de ovos e juvenis contido no sistema radicular, sendo utilizado o clone CPA-34, a cultivar Grande Naine, como padrão de suscetibilidade. Amostras de 200 cm³ de solo foram coletadas para a determinação do número de nematóides no solo. De acordo com os fatores de reprodução (Pf/Pi, verificou-se que o clone CPA-34 apresentou-se suscetível ao nematóide, como era esperado, com o maior fator de reprodução, seguido do clone CPA-49, da cultivar Maçã, com índice superior a um. Os demais clones testados apresentaram fator de reprodução menor que um, indicando certa resistência ao nematóide M. incognita raça 2. Entretanto, nas análises estatísticas, foram verificadas diferenças significativas entre o clone-padrão CPA-34, quando comparado com os clones CPA-58 e CPA-54. Para os resultados de peso de raízes e peso da parte aérea, a diferença foi significativa (1% para todos os clones testados, apresentando os maiores valores para os clones não inoculados.

  18. Os 600 transplantes renais do Hospital das Clínicas da Faculdade de Medicina de Botucatu (HC da FMB - UNESP: Mudanças ao longo do tempo

    Directory of Open Access Journals (Sweden)

    Luis Gustavo Modelli de Andrade

    2014-04-01

    Full Text Available Introdução: Os resultados alcançados pelos transplantes renais nas últimas décadas têm melhorado progressivamente. Objetivo: A fim de determinar a extensão desse progresso, conduzimos uma análise dos resultados obtidos em nosso programa de transplantes através de três períodos diferentes. Métodos: Avaliamos os 600 transplantes renais realizados no HC FMB-UNESP até dezembro de 2011, subdividindo-os em três eras, de acordo com a imunossupressão vigente. Era 1: de 1987 a 2000 (n = 180; associação de ciclosporina e azatioprina. Era 2: de 2001 a 2006 (n = 120; associação de ciclosporina e micofenolato e Era 3: de 2007 a 2011 (n = 300; associação de tacrolimus e micofenolato. Resultados: Os resultados mostram aumento da idade média do receptor, da prevalência de diabetes e do número de transplantes com doador falecido (60% na terceira era. O uso de terapia de indução foi de 75% era atual contra 46,6% (Era 2 e 3,9% (Era 1, p < 0,0001. Os dados de sobrevida geral por tipo de doador mostram dados semelhantes à literatura. Houve progressivo aumento da sobrevida do enxerto com doadores falecidos em 5 anos, saindo de 13,7% (Era 1 para 81,9% (Era 3. Conclusão: Houve significativas diferenças ao longo do tempo, culminando com aumento do volume de transplantes na atual era (média de 14 transplantes/ano na Era 1 para 75 transplantes/ano na Era 3. Inverteu-se o perfil de transplantes na era atual com predomínio de doador falecido. A melhor sobrevida com doador falecido da atual era foi atribuída a maior experiência do centro e aos esquemas de imunossupressão baseados na combinação de tacrolimus com micofenolato associados a esquema de indução.

  19. Effects of clove oil on the stress response of matrinxã (Brycon cephalus subjected to transport Efeito do óleo de cravo na resposta de estresse do matrinxã (Brycon cephalus submetido ao transporte

    Directory of Open Access Journals (Sweden)

    Luís Antônio Kioshi Aoki Inoue

    2005-06-01

    Full Text Available Fish transport is one of the most stressful procedures in aquaculture facilities. The present work evaluated the stress response of matrinxã to transportation procedures, and the use of clove oil as an alternative to reduce the stress response to transport in matrinxã (Brycon cephalus. Clove oil solutions were tested in concentrations of 0, 1, 5 and 10 mg/L during matrinxã transportation in plastic bags, supplied with water and oxygen as the usual field procedures in Brazil. Clove oil reduced some of the physiological stress responses (plasma cortisol, glucose and ions that we measured. The high energetic cost to matrinxã cope with the transport stress was clear by the decrease of liver glycogen after transport. Our results suggest that clove oil (5 mg/l can mitigate the stress response in matrinxã subjected to transport.O transporte de peixes vivos é certamente um dos principais estímulos adversos à homeostase dos peixes nas condições de criação em cativeiro. O presente trabalho mensurou o estresse do matrinxã (Brycon cephalus, quando submetido ao transporte em sacos plásticos, bem como avaliou os efeitos do uso do anestésico óleo de cravo nessa etapa do manejo. Foram testadas as concentrações de 0, 1, 5 e 10 mg/L de óleo de cravo em bolsas plásticas preenchidas com água e oxigênio, de acordo com as práticas comumente utilizadas no Brasil. O óleo de cravo reduziu algumas das principais respostas ao estresse (cortisol, glicose plasmática e íons mensuradas. O alto gasto de energia para o matrinxã tolerar o transporte foi evidenciado pela diminuição dos valores de glicogênio hepático. Os resultados sugerem que o óleo de cravo em concentração de 5 mg/L pode atenuar as principais respostas de estresse do matrinxã durante o transporte.

  20. Up-Regulated Expression of AOS-LOXa and Increased Eicosanoid Synthesis in Response to Coral Wounding

    Science.gov (United States)

    Lõhelaid, Helike; Teder, Tarvi; Tõldsepp, Kadri; Ekins, Merrick; Samel, Nigulas

    2014-01-01

    In octocorals, a catalase–like allene oxide synthase (AOS) and an 8R-lipoxygenase (LOX) gene are fused together encoding for a single AOS-LOX fusion protein. Although the AOS-LOX pathway is central to the arachidonate metabolism in corals, its biological function in coral homeostasis is unclear. Using an acute incision wound model in the soft coral Capnella imbricata, we here test whether LOX pathway, similar to its role in plants, can contribute to the coral damage response and regeneration. Analysis of metabolites formed from exogenous arachidonate before and after fixed time intervals following wounding indicated a significant increase in AOS-LOX activity in response to mechanical injury. Two AOS-LOX isoforms, AOS-LOXa and AOS-LOXb, were cloned and expressed in bacterial expression system as active fusion proteins. Transcription levels of corresponding genes were measured in normal and stressed coral by qPCR. After wounding, AOS-LOXa was markedly up-regulated in both, the tissue adjacent to the incision and distal parts of a coral colony (with the maximum reached at 1 h and 6 h post wounding, respectively), while AOS-LOXb was stable. According to mRNA expression analysis, combined with detection of eicosanoid product formation for the first time, the AOS-LOX was identified as an early stress response gene which is induced by mechanical injury in coral. PMID:24551239

  1. Physical properties of the Algol-type eclipsing binary AO Ser

    Science.gov (United States)

    Chehlaeh, N.; Lampens, P.; Mkrtichian, D.; Van Cauteren, P.; Vermeylen, L.; Komonjinda, S.

    2017-09-01

    We present the results of a combined analysis of photometric time series and spectroscopic observations for the semi-detached eclipsing binary AO Ser aimed to study physical parameters of the system. New CCD photometric light curves in the B and V bands and radial velocities of AO Ser are presented. The Wilson-Devinney technique was used to simultaneously analyze the light and radial velocity curves for determining a new set of the system’s parameters. The solution shows that AO Ser is a semi-detached eclipsing binary system with a mass ratio of 0.183 ± 0.003, an inclination of 89.42 ± 0.04 degrees and a secondary star’s temperature of 4900 K.

  2. A Arqueologia do cuidado: da prática ao discurso

    Directory of Open Access Journals (Sweden)

    Sidi Askofare

    2006-06-01

    Full Text Available A noção de cuidado, assimilada há muito tempo ao tratamento e, então, ao conceito de terapêutica, retorna, logo depois, nos estudos, pesquisas e reflexões nas ciências humanas. Mas, daí em diante, está emancipado de suas aderências e conotações médicas por serem demasiadamente redutoras. O presente artigo propõe uma arqueologia (no sentido foucaultiano do cuidado &– de suas origens animais às suas formas culturalmente e historicamente definidas &– e põe em evidência a subversão que produz no campo do cuidado &– das práticas aos discursos &– a emergência e a dominação do discurso da ciência.

  3. O Ocaso da Utopia Telecomunicacional: regular para quem no tocante ao Direito Fundamental à Privacidade?

    Directory of Open Access Journals (Sweden)

    Conselho Editorial

    2014-05-01

    Full Text Available O presente estudo figura como introdução à Revista de Direito, Estado e Telecomunicações do Grupo de Estudos em Direito das Telecomunicações da Universidade de Brasília, abordando sinteticamente a estrutura, conteúdo e política editorial da revista. Em acréscimo, o texto analisa os principais acontecimentos do setor no Brasil, bem como normas e julgados relativos ao ano de 2013, para registro das principais discussões político-jurídicas do setor de telecomunicações brasileiro referentes ao ano anterior ao da publicação.

  4. Sensibilidade de laranjeiras-doces ao deficit hídrico

    OpenAIRE

    Ramos, Yuri Caires; Mourão Filho, Francisco de Assis Alves; Stuchi, Eduardo Sanches; Sentelhas, Paulo Cesar; Fadel, André Luiz

    2016-01-01

    Resumo: O objetivo deste trabalho foi avaliar a sensibilidade ao deficit hídrico de 17 seleções de laranja-doce enxertadas sobre tangerineira 'Sunki', ao longo de cinco safras. Empregou-se um modelo agrometeorológico de penalização da produtividade pelo deficit hídrico, tendo-se avaliado a relação entre os valores estimados e observados. As seleções podem ser classificadas como de alta, média e baixa sensibilidade ao deficit hídrico, classificação que é inédita para as condições brasileiras. ...

  5. ESTUDO DE PROBLEMAS DE ENFERMAGEM REFERENTES AO CABELO E COURO CABELUDO EM PACIENTES HOSPITALIZADOS

    Directory of Open Access Journals (Sweden)

    Maria Romana Friedlander

    Full Text Available A autora procurou identificar os tipos e os problemas de enfermagem referentes ao cabelo e couro cabeludo, apresentados por pacientes internados em clínicas médicas e cirúrgicas gerais de um hospital governamental de ensino. Identificou 4 classes de problemas: estado de limpeza, lesões, infestações e penteação. Cada classe foi subdividida em graus os quais foram denominados tipos de problemas. A proporção de problemas por paciente encontrada foi 0,80 e a proporção de pacientes com problemas foi 58%. Foram também estudadas algumas condições que podem intervir no cuidado ao cabelo e ao couro cabeludo e foram obtidas informações sobre hábitos e costumes apresentados pelos pacientes.

  6. A Exposição ao Risco das Famílias

    OpenAIRE

    Amaro, Ana Raquel

    2014-01-01

    A presente Dissertação de Mestrado aborda a exposição ao risco financeiro das famílias. Ao longo do trabalho serão abordados temas como a heurística, as finanças comportamentais, a percepção do risco e a exposição ao risco. Estes são os conceitos que foram considerados como sendo fundamentais e os principais responsáveis pela tomada de decisões a nível financeiro das famílias. Este estudo é de natureza quantitativa e pretenderá tirar conclusões da população em geral tendo em consideraçã...

  7. Obtenção de plantas de feijão-caupi resistentes ao Cowpea severe mosaic virus e ao Cowpea aphid-borne mosaic virus

    Directory of Open Access Journals (Sweden)

    Gislanne Brito Barros

    2013-06-01

    Full Text Available Dentre os vírus que infectam o feijão-caupi (Vigna unguiculata L. Walp. destacam-se, respectivamente, pela severidade e ampla ocorrência o Cowpea severe mosaic virus (CPSMV e o Cowpea aphid-borne mosaic virus (CABMV. Portanto, objetivaram-se, no presente trabalho, obter e avaliar plantas de feijão-caupi com resistência ao CPSMV e ao CABMV, visando ao desenvolvimento de cultivares essencialmente derivadas e novas cultivares. Realizaram-se oito cruzamentos seguidos de retrocruzamentos, utilizando a linhagem TE 97-309G-9 e a cultivar Patativa como genitores resistentes, e as cultivares BR3-Tracuateua, BRS-Urubuquara, BRS-Novaera, BRS-Guariba e Pretinho como genitores suscetíveis. As gerações F2 e F2RC1 foram desafiadas quanto à resistência por meio de inoculação mecânica com isolados do CPSMV e do CABMV. Nas gerações F2RC1, além da resistência foram avaliados os caracteres: número de dias para o início da floração, comprimento das vagens, número de grãos. vagem-1, peso de cem grãos e produção de grãos.planta-1. Todos os indivíduos F2 e F2RC1 foram analisados pelo teste χ² e se ajustaram à frequência esperada de 15 plantas suscetíveis 1 planta resistente a ambos os vírus. As médias das plantas F2RC1 resistentes, de cada retrocruzamento, foram comparadas com a média do seu respectivo genitor recorrente pelo teste 't' e as médias dos retrocruzamentos foram comparadas pelo teste de Scott-Knott. Foi detectada variabilidade genética entre os retrocruzamentos para todos os caracteres. Todos os retrocruzamentos foram considerados promissores para produção de cultivares essencialmente derivadas resistentes ao CPSMV e ao CABMV e as plantas selecionadas possuem características que possibilitam a seleção de linhagens com grãos de bom padrão comercial e altamente produtivas.

  8. Fatores associados ao tempo de espera e ao acesso ao transplante renal em Belo Horizonte, Minas Gerais, Brasil Factors associated with waiting time and access to kidney transplants in Belo Horizonte, Minas Gerais State, Brazil'

    Directory of Open Access Journals (Sweden)

    Elaine Leandro Machado

    2012-12-01

    Full Text Available O objetivo deste artigo foi analisar os fatores associados ao acesso ao transplante renal com doador vivo e cadáver em Belo Horizonte, Minas Gerais, Brasil. Foi realizado um estudo de coorte não concorrente com pacientes inscritos na lista de espera por transplante renal, entre 2000 e 2004, os quais foram acompanhados até o transplante, óbito, exclusão ou permanência na fila de espera ao fim do estudo em 31 de dezembro de 2005. Utilizou-se o modelo de Cox para riscos competitivos. Dos 835 pacientes, 22,7% foram transplantados. Apresentaram menor risco de transplante por doador cadáver e vivo os pacientes com maior tempo em diálise e tipo sanguíneo O. Observou-se menor risco de transplante intervivos para residentes em uma área de alto risco à saúde e portadores de diabetes. A maior disparidade de acesso foi para transplante renal intervivos, uma vez que não houve diferenças sociodemográficas significativas para transplante por doador cadáver. Pode-se inferir que o sistema de alocação de órgãos contribuiu para amenizar desigualdades sociodemográficas, sendo as questões clínicas mais relevantes no acesso ao transplante com doador cadáver.The objective of this study was to analyze factors associated with access to kidney transplants from living and cadaver donors in Belo Horizonte, Minas Gerais State, Brazil. The authors conducted a non-concurrent cohort study of patients on the waiting list for kidney transplants from 2000 to 2004 and followed until transplantation, death, exclusion, or continued presence on the line at the end of the study on December 31, 2005. The Cox model was used for competing risks. Of the 835 patients, 22.7% were transplanted. Lower risk of transplantation from living donors and cadavers was observed in patients with more time on dialysis and blood type O. Lower risk of transplantation from living donors was observed in residents in a high health risk area and in recipients with diabetes. The

  9. Facilitadores e barreiras de retorno ao trabalho de trabalhadores acometidos por LER/DORT

    Directory of Open Access Journals (Sweden)

    Jorge Henrique Santos Saldanha

    Full Text Available INTRODUÇÃO: As Lesões por Esforços Repetitivos/Distúrbios Osteomusculares Relacionados ao Trabalho (LER/DORT causam afastamento do trabalho de uma grande parcela de trabalhadores. OBJETIVO: Entender e sistematizar de que forma os fatores relacionados ao retorno ao trabalho (RT de trabalhadores acometidos por LER/DORT são descritos na literatura como facilitadores ou barreiras. MÉTODOS: Revisão crítica de literatura do período de janeiro de 2005 a outubro de 2010 disponível nas bases Lilacs, MedLine e SciELO. As informações foram sistematizadas em três categorias de fatores que influenciam o RT e como facilitadores ou barreiras - de ordem pessoal, de ordem organizacional e relacionadas às características dos serviços, sistemas e políticas. RESULTADOS: Dos 633 artigos inicialmente levantados, 21 atenderam aos critérios de inclusão. Fatores identificados como mais relevantes: de ordem pessoal - dor, fatores psicossociais, afastamento do trabalho; organizacionais - modificações nos postos de trabalho, demanda psicológica do trabalho, apoio organizacional, apoio de colegas e da chefia; relacionados aos serviços, sistemas e políticas - programa de retorno ao trabalho, tempo de afastamento e serviços de apoio. CONCLUSÃO: O estudo evidenciou que o RT é um processo complexo, que demanda políticas intersetoriais, cooperação técnica e pactuação de metas entre os atores envolvidos no processo.

  10. Novel algorithm implementations in DARC: the Durham AO real-time controller

    Science.gov (United States)

    Basden, Alastair; Bitenc, Urban; Jenkins, David

    2016-07-01

    The Durham AO Real-time Controller has been used on-sky with the CANARY AO demonstrator instrument since 2010, and is also used to provide control for several AO test-benches, including DRAGON. Over this period, many new real-time algorithms have been developed, implemented and demonstrated, leading to performance improvements for CANARY. Additionally, the computational performance of this real-time system has continued to improve. Here, we provide details about recent updates and changes made to DARC, and the relevance of these updates, including new algorithms, to forthcoming AO systems. We present the computational performance of DARC when used on different hardware platforms, including hardware accelerators, and determine the relevance and potential for ELT scale systems. Recent updates to DARC have included algorithms to handle elongated laser guide star images, including correlation wavefront sensing, with options to automatically update references during AO loop operation. Additionally, sub-aperture masking options have been developed to increase signal to noise ratio when operating with non-symmetrical wavefront sensor images. The development of end-user tools has progressed with new options for configuration and control of the system. New wavefront sensor camera models and DM models have been integrated with the system, increasing the number of possible hardware configurations available, and a fully open-source AO system is now a reality, including drivers necessary for commercial cameras and DMs. The computational performance of DARC makes it suitable for ELT scale systems when implemented on suitable hardware. We present tests made on different hardware platforms, along with the strategies taken to optimise DARC for these systems.

  11. Deep-water sponges (Porifera) from Bonaire and Klein Curaçao, Southern Caribbean.

    Science.gov (United States)

    Van Soest, Rob W M; Meesters, Erik H W G; Becking, Leontine E

    2014-10-29

    Four submersible dives off the coast of Bonaire (Caribbean Netherlands) and Klein Curaçao (Curaçao) to depths of 99.5-242 m, covering lower mesophotic and upper dysphotic zones, yielded 52 sponge specimens belonging to 31 species. Among these we identified 13 species as new to science. These are Plakinastrella stinapa n. sp., Pachastrella pacoi n. sp., Characella pachastrelloides n. sp., Geodia curacaoensis n. sp., Caminus carmabi n. sp., Discodermia adhaerens n. sp., Clathria (Microciona) acarnoides n. sp., Antho (Acarnia) pellita n. sp., Parahigginsia strongylifera n. sp., Calyx magnoculata n. sp., Neopetrosia dutchi n. sp., Neopetrosia ovata n. sp. and Neopetrosia eurystomata n. sp. We also report an euretid hexactinellid, which belongs to the rare genus Verrucocoeloidea, recently described (2014) as V. liberatorii Reiswig & Dohrmann. The remaining 18 already known species are all illustrated by photos of the habit, either in situ or 'on deck', but only briefly characterized in an annotated table to confirm their occurrence in the Southern Caribbean. The habitat investigated-steep limestone rocks, likely representing Pleistocene fossil reefs--is similar to deep-water fossil reefs at Barbados of which the sponges were sampled and studied by Van Soest and Stentoft (1988). A comparison is made between the two localities, showing a high degree of similarity in sponge composition: 53% of the present Bonaire-Klein Curaçao species were also retrieved at Barbados. At the level of higher taxa (genera, families) Bonaire-Klein Curaçao shared approximately 80% of its lower mesophotic and upper dysphotic sponge fauna with Barbados, despite a distance between them of 1000 km, indicating high faunal homogeneity. We also preliminarily compared the shallow-water (euphotic) sponge fauna of Curaçao with the combined data available for the Barbados, Bonaire and Klein Curaçao mesophotic and upper dysphotic sponges, which resulted in the conclusion that the two faunas show only

  12. Adesão ao Tratamento em Gestação de Alto Risco

    Directory of Open Access Journals (Sweden)

    Fabíola Langaro

    Full Text Available No Brasil, aproximadamente 15% das gestações são de alto risco, sendo os diagnósticos de diabetes gestacional e hipertensão as causas mais frequentes dessa condição. Para a efetividade dos tratamentos indicados nesses casos, bem como alcance de desfechos favoráveis, é essencial a adesão da paciente às recomendações fornecidas pelas equipes de saúde, o que torna fundamental a avaliação desse indicador. A pesquisa apresentada avaliou a adesão de participantes de um programa de atendimento interdisciplinar a gestantes de alto risco desenvolvido em um hospital geral privado por meio de três instrumentos: Questionário Morisky-Green de adesão ao uso de medicação, Questionário de Adesão ao Tratamento e Pergunta descritiva de avaliação qualitativa. Durante oito meses, 83 gestantes responderam aos questionários, que possibilitaram identificar níveis de adesão ao longo do tempo de participação no programa, situações de não adesão mais frequentes, bem como variáveis que interferem nas medidas de adesão ao uso de medicação e ao tratamento global. Considera-se que os índices levantados são passíveis de uso como indicadores clínicos e gerenciais, possibilitando a comprovação da efetividade e melhoria constante das rotinas de saúde. Tais mecanismos são úteis para definição de protocolos, discussão de casos clínicos e mesmo para feedbackàs próprias pacientes.

  13. Ressalto no canto posteromedial do joelho relacionado ao músculo sartório

    Directory of Open Access Journals (Sweden)

    Marcello Henrique Nogueira-Barbosa

    2011-06-01

    Full Text Available As causas da síndrome de ressalto no joelho relatadas com maior frequência são relacionadas a anormalidades meniscais, ao tendão do músculo bíceps femoral e aos tendões grácil e semitendíneo. Neste trabalho é descrito um caso de ressalto no canto posteromedial relacionado à junção miotendínea do músculo sartório em um paciente do sexo masculino, de 58 anos de idade, com hiperextensão do joelho.

  14. O panorama das Drogas no México: da margem da sociedade ao centro da cultura

    OpenAIRE

    Diana Palaversich

    2013-01-01

    O artigo destaca o percurso das manifestações culturais ligadas ao tráfico de drogas no México, de um lugar marginal, de subcultura, na sociedade mexicana das décadas de 1970 e 1980, expressas principalmente através dos narcocorridos e do narcocine, para um lugar no mainstream cultural mexicano, desde o início do século 21, com destaque especial para a narcoliteratura. O aumento da violência, provocado pela guerra ao narcotráfico, produz uma proliferação da temática nos meios de comunicação e...

  15. The Ashkenazi Jews of Curaçao, a trading minority

    Directory of Open Access Journals (Sweden)

    Eva Abraham-Van der Mark

    2000-07-01

    Full Text Available First describes the early Sephardi presence in Curaçao, the arrival of the Ashkenazi in the 20th c., and the relations between these 2 groups. Author goes on to discuss the Ashkenazis' economic success and the exodus of the 1980s. She asks whether the success and the exodus can be attributed to the characteristics of the group itself or whether conditions and developments in Curaçao account for economic fortune and the departure of the Ashkenazi.

  16. A MEMÕRIA DE JESUS E A MANVFESTAÇAO DO PAI NO QUARTO EVANGELHO

    Directory of Open Access Journals (Sweden)

    Johan Konings

    1988-01-01

    Full Text Available Não somos os primeiros a constatar que as cristologias narrativas pouco se inspiram no Quarto Evangelho (QE, tanto na atual teologia latino-americana como na europeia, de E. Schillebeeckx, por exemplo. Entretanto, as cristologias especulativas usam amplamente pelo menos o prólogo de João como ponto de partida para suas especulações. Será que este tratamento faz jus ao QE, ou repousa num preconceito espiritualista com relação ao evangelho que Clemente de Alexandria chamou de "espiritual"?

  17. [Study on Provenance of Kraak Porcelains from "Nan'ao I" Shipwreck].

    Science.gov (United States)

    Du, Jing-nan; Chen, Yue; Li, Nai-sheng; Ming, Chao-fang; Zhu, Jian; Luo, Wu-gan

    2015-06-01

    The "Kraak Porcelain" was a kind of Blue and White Porcelain which exported from China to Europe in Ming and Qing period. The study of Kraak Porcelain is a focus issue in international field of porcelain research. In 2007, the discovery of "Nan'ao I" Shipwreck of Ming Dynasty and the porcelains loaded in it, provided precious materials for the research on Kraak Porcelain. In this paper, we explored the provenance of 10 Kraak Porcelain samples from Nan'ao I, using both traditional visual method and WDXRF.

  18. Resistência ao Consumo em um Circuito Urbano de Parkour

    Directory of Open Access Journals (Sweden)

    Tatiana Maria Bernardo da Silva

    2011-08-01

    Full Text Available A partir de uma pesquisa alinhada ao método etnográfico, o presente trabalho tem por objetivo investigar os valores e as práticas de resistência ao consumo adotadas pelos membros de um circuito urbano de parkour no Rio de Janeiro. Confiando em uma abordagem indutiva e interpretativa amparada por um estudo empírico de base qualitativa, foram exploradas quatro categorias de análise: (1 a resistência como valor essencial; (2 um percurso de doação; (3 o consumo aprisiona; e (4 mobilização social e resistência.

  19. COMPORTAMENTO ÉTICO E CRÍTICA AO PRECONCEITO BURGUÊS

    OpenAIRE

    Carli, Ranieri

    2014-01-01

    Este artigo procura delinear os componentes mais elementares de uma ética marxista, para então focar na lacuna que há entre o preconceito, que se atém àquilo que existe de particular e imediato no homem, e o comportamento de natureza essencialmente ética, que se eleva à generalidade. A intenção é demonstrar como o preconceito limita-se ao chão raso do cotidiano, ao passo que, no polo oposto, a ética supera-o, purificando o homem singular rumo à universalidade genérica. Enfim, tomaremos alguns...

  20. Posicionamentos skinnerianos quanto ao uso do controle aversivo pelas agências de controle

    OpenAIRE

    Bruna Del Giudice Machado Godinho

    2011-01-01

    O campo de estudo, denominado controle aversivo, é constituído pelas contingências de reforçamento negativo e de punição positiva e negativa. O uso do controle aversivo tem sido alvo de muitas críticas dentro da comunidade científica. As críticas às contingências aversivas, normalmente, são dirigidas aos subprodutos emocionais que se mostram prejudiciais às pessoas controladas e ao poder positivamente reforçador que essas contingências exercem sobre os controladores. Por isso, Skinner normalm...

  1. Perfil das atitudes de formandos em enfermagem frente aos transtornos mentais no Brasil, Chile e Peru

    OpenAIRE

    Luiz Jorge Pedrão; Sueli Aparecida Frari Galera; Maria Concepcion Pezo Silva; Angelica Cazenave Gonzalez; Moacyr Lobo da Costa Júnior; Souza,Maria Conceição Bernardo de Mello e; Gricelda Uceda Senmache

    2005-01-01

    Este estudo teve por objetivo traçar um perfil de atitudes de formandos em enfermagem frente aos transtornos mentais em três culturas diferentes: Brasil, Chile e Peru. Para isso foi utilizada a escala de opiniões sobre a doença mental. Os resultados mostraram diferenças estatisticamente significantes no nível de 5% nos fatores autoritarismo, ideologia de higiene mental, restrição serial e visão minoritária, favoráveis aos estudantes brasileiros. No fator etiologia interpessoal, os resultados ...

  2. Imunidade celular em caninos neonatos - do nascimento ao 45° dia de idade

    Directory of Open Access Journals (Sweden)

    R.P. Klein

    2014-06-01

    Full Text Available O objetivo do presente trabalho foi acompanhar o desenvolvimento imunológico dos neonatos caninos, a fim de avaliar a imunidade celular pela análise dos leucócitos e linfócitos totais e das subpopulações de linfócitos T (CD4+ e CD8+ pela técnica de citometria de fluxo. Foram utilizados 30 cães neonatos de ambos os sexos, sem raça definida, aos três, 10, 17, 24, 31, 38 e 45 dias de idade. A contagem de leucócitos totais aos 45 dias (11.639±3.574 foi significativamente maior que no terceiro dia de idade (8.740±1.812 (P<0,05; não houve diferença entre a contagem total de linfócitos aos 45 dias em relação ao terceiro dia de idade. Quanto às subpopulações de LT CD4+ e LT CD8+, os percentuais de LT CD4+, aos três dias de idade (24,9±16,8%, foram inferiores quando comparados à média entre o 10°, o 24° e o 31°dia (35,5%, e os de CD8+, ao terceiro dia, menores em relação às médias do 10° e do 31° dia de idade. Pode-se concluir que as subpopulações de LT CD4+ e CD8+ sofrem oscilações durante o desenvolvimento pós-natal, sendo estas crescentes em relação aos níveis obtidos aos três dias de idade. A relação CD4+:CD8+ mostrou superioridade para o primeiro tipo celular, sendo que a maior relação entre CD4+ e CD8+ ocorreu no terceiro dia de idade. Com base nos resultados obtidos neste estudo, notaram-se as diferenças semanais nas populações linfocitárias, o que demonstra a dinâmica dessas células durante o período neonatal.

  3. Características individuais e contextuais associadas ao bullying entre escolares no Brasil

    OpenAIRE

    Catarina Machado Azeredo

    2015-01-01

    O bullying escolar é um importante problema de saúde pública que vem sendo extensivamente estudado em países de alta renda. Nos países de baixa e média renda, características individuais e contextuais associadas ao bullying são pouco conhecidas. A presente tese é composta por três estudos. O estudo 1 objetivou realizar revisão sistemática sobre fatores contextuais associados ao bullying escolar. A busca utilizou as bases de dados MEDLINE, PsychInfo, Web of Knowledge e SciELO. Trinta e um estu...

  4. Adesão ao tratamento clínico no transtorno de personalidade borderline

    OpenAIRE

    Tanesi,Patrícia Helena Vaz; Yazigi,Latife; Fiore,Maria Luiza de Mattos; Pitta,José Cássio do Nascimento

    2007-01-01

    Adesão é um comportamento complexo, envolve desde pequenas recusas ao tratamento até o uso inadequado dos serviços de saúde e abandono do tratamento. O presente trabalho é um estudo qualitativo com seis pacientes com transtorno de personalidade borderline sobre adesão ao tratamento, utilizando análise qualitativa em entrevista aberta, questionário psicossocial, classificação diagnóstica pela SCID I e II e acompanhamento clínico. Os resultados mostraram que impulsividade, manipulação, dissocia...

  5. Comunicações uma contribuição ao aprimoramento da informação contábil, no tocante à mensuração do resultado contábil da produtora cinematográfica

    Directory of Open Access Journals (Sweden)

    Ricardo Lopes Cardoso

    2003-08-01

    Full Text Available Este artigo apresenta uma proposta de aprimoramento dos critérios de mensuração do resultado contábil de uma produtora cinematográfica que realiza suas atividades no mercado brasileiro. O interesse pelo assunto é motivado pela admiração ao cinema, em especial, o nacional. A necessidade de aprimoramento da informação foi constatada pela falta de normas de procedimentos contábeis a serem observados pelas produtoras nacionais. Neste trabalho foi desenvolvido um modelo contábil próprio considerando a produção de um filme como um contrato de longo prazo, sendo o resultado apurado de acordo com a geração efetiva de receitas.This article presents a proposal to improve the criteria for measuring the accounting income of a movie producer active in the Brazilian market. Our interest in this subject is motivated by our admiration for cinema, and particularly for national productions. The need to improve information was observed as a result of the lack of standards for accounting procedures to be observed by the national producers. In this study, we develop a particular accounting model considering the production of a movie as a long-term contract, while income is determined in accordance with the actual creation of revenues.

  6. Therapeutic usage of omeprazole and corticoid in a dog with hydrocephalus unresponsive to conventional therapyUso terapêutico da associação do omeprazol com corticóide em um cão com hidrocefalia não-responsiva ao tratamento convencional

    Directory of Open Access Journals (Sweden)

    Alexandre Mendes Amude

    2013-05-01

    Full Text Available Medical therapy for hydrocephalus includes the administration of medications to limit the production of the cerebrospinal fluid (CSF resulting in reduced intracranial pressure (ICP. This report describes the clinical findings in one dog with congenital hydrocephalus that was unresponsive to conventional medical treatment with steroids, but demonstrated good response to omeprazole when this drug was added to the steroid. Omeprazole might decrease the CSF production by about 26% according to experimental studies with healthy dogs, but the usage of the omeprazole in clinical trials with affected dogs such as hydrocephalic animals is lacking. The results of this report might suggest that omeprazole can be used added to steroids to ameliorate the neurological status in dogs with increased ICP by hydrocephalus.O tratamento médico para a hidrocefalia inclui a administração de medicamentos para limitar a produção do fluido cerebroespinhal (FCE, resultando em redução da pressão intracraniana (PIC. Este trabalho descreve os achados clínicos em um cão com hidrocefalia congênita não responsiva ao tratamento médico convencional com esteróides mas que apresentou boa resposta à associação omeprazolesteróides. O omeprazol pode diminuir a produção de FCE em cerca de 26% de acordo com estudos experimentais realizados com cães saudáveis. Porém, o uso do omeprazol em ensaios clínicos com cães enfermos, como os animais hidrocefálicos, não é descrito. Os resultados deste trabalho sugerem que o omeprazol pode ser empregado em associação ao corticóide para melhorar o estado neurológico em cães com aumento da PIC devido à hidrocefalia.

  7. Programa de atenção particularizada ao idoso em unidades básicas de saúde

    OpenAIRE

    Ferreira,Aleksandro Belo; Minann,Carlos André; Paganini,Camila Bianca Lecciolle; Falce,Thiago Souza La; Todeschini,Alexandre Bossi; Eras,Aline Estefanes; Chekin,Giovana; Motta,Bruno Ribeiro; Carneiro Junior,Nivaldo

    2009-01-01

    INTRODUÇÃO: Envelhecer é um processo de mudanças irreversíveis na estrutura e no funcionamento de um organismo, que ocorre como resultado da passagem do tempo. Segundo a OMS, programas voltados à saúde dos idosos devem promover, estimular e potencializar situações que os levem a organizar sua rotina de acordo com o próprio planejamento e metas pessoais. No Brasil, a população de idosos aumenta significativamente; estima-se que representará 12,5% em 2020. Nesse contexto, justifica-se a criação...

  8. Validity of the CAGE questionnaire for screening alcohol-dependent inpatients on hospital wards Validade do questionário CAGE para rastrear pacientes com dependência ao álcool internados em enfermarias clínicas

    Directory of Open Access Journals (Sweden)

    Maria Alicia Castells

    2005-03-01

    questionário CAGE e uma entrevista semi-estruturada - Mini International Neuropsychiatric Interview (MINI, utilizada como padrão-ouro para diagnóstico de dependência ao álcool (de acordo com os critérios do DSM-IV. Foram obtidas medidas de validade (sensibilidade e especificidade do CAGE para os diferentes pontos de corte possíveis. Para análise do melhor ponto de corte, foi utilizada a curva ROC. RESULTADOS: A amostra foi composta de 747 pacientes, a maioria homens (66%, brancos (85%, com média de idade ± Desvio Padrão (DP = 50 ± 17 anos, estado civil casado/amasiado (61%, com escolaridade média ± DP = 6 ± 4 anos. Através do MINI, foram diagnosticados 48 pacientes (6,6% com dependência ao álcool. O CAGE apresentou a melhor sensibilidade (93,8% com ponto de corte igual a um (CAGE positivo para uma ou mais respostas afirmativas. Com este ponto de corte, a especificidade foi de 85,5%. CONCLUSÃO: Aplicado em pacientes clínicos internados em hospital geral, o questionário CAGE mostrou bons índices de sensibilidade (93,8% e especificidade (85,5%, utilizando como ponto de corte 0/1. Por ser de fácil e rápida aplicação e ter baixos custos, poderia ser utilizado para rastreamento de casos de dependência ao álcool neste contexto.

  9. Sexual dysfunction, depression, and anxiety in young women according to relationship status: an online survey Disfunção sexual, depressão e ansiedade em mulheres jovens de acordo com o status de relacionamento: uma pesquisa on-line

    Directory of Open Access Journals (Sweden)

    Valeska Martinho Pereira

    2013-01-01

    Full Text Available BACKGROUND: Sexual dysfunction is a common, still poorly understood problem among women. Being or not in a relationship seems to be a risk factor for sexual dysfunction. OBJECTIVES: To evaluate the presence of sexual problems, anxiety, and depression in young women and to correlate findings with current relationship status (single, in a committed relationship, or married. METHODS: Data were collected trough an online survey from a total of 155 women aged between 20 and 29 years. Sociodemographic data were collected, and both the Hospital Anxiety and Depression scale and the Female Sexual Function Index were applied. Data were statistically analyzed using the chi-square and Kruskal-Wallis tests, and groups were compared in 2 x 2 matrices using the Mann-Whitney test. RESULTS: Single women showed a significantly higher prevalence of problems in the lubrication (45.3%, orgasm (53.1%, satisfaction (67.2%, and pain (50% domains and also in total Female Sexual Function Index scores (60.9% in comparison with the other groups. Additionally, significantly higher depression scores were found among single women (5.89±3.3 in comparison to those in a committed relationship (4.05±2.83. Anxiety scores were similar in all groups. CONCLUSION: Our findings suggest that single women have a poorer sexual function and are more likely to have mood disorders in comparison to their peers involved in stable relationships.CONTEXTO: Disfunção sexual é um problema comum e ainda pouco compreendido entre mulheres. Estar ou não em um relacionamento parece ser um fator de risco para disfunção sexual. OBJETIVO: Avaliar a presença de problemas sexuais, ansiedade e depressão em jovens mulheres e correlacionar os achados ao estado de relacionamento atual (solteiras, em relacionamento sério ou casadas. MÉTODOS: Dados foram coletados através de pesquisa on-line de um total de 155 mulheres com idade entre 20 e 29 anos. Foram coletados dados sociodemográficos, e a Escala

  10. POTENCIAL SOCIAL DO MUNICÍPIO DE SILVEIRA MARTINS, RS: CONTRIBUIÇÃO AO ZEE

    Directory of Open Access Journals (Sweden)

    Franciele Francisca Marmentini Rovani

    2016-06-01

    Full Text Available Esta pesquisa consistiu em identificar e diagnosticar as potencialidades sociais do município de Silveira Martins/RS, segundo a metodologia proposta por Becker e Egler (1996 para o Zoneamento Ecológico-Econômico (ZEE. Deste modo, utilizou-se como base cartográfica os setores censitários do município e dados referentes à economia, educação, política e saneamento básico. Com base nas informações elaborou-se um banco de dados e por meio da álgebra de mapas ponderou-se os indicadores em valores de alto, médio e baixo potencial de acordo com o potencial natural, humano, produtivo e institucional, derivando o mapa de potencial social. No município de Silveira Martins predomina o potencial mediano na maioria dos indicadores analisados, isto significa que não foi evidenciado potencial alto ou baixo. Verificou-se que o município apresenta equilíbrio entre as restrições territoriais e o potencial de expansão produtivo. Isso pode ser considerado como um aspecto positivo e com políticas públicas o desenvolvimento sustentável poderá ser intensificado.

  11. Doença periodontal materna como fator associado ao baixo peso ao nascer Maternal periodontal disease as a factor associated with low birth weight

    Directory of Open Access Journals (Sweden)

    Simone Seixas da Cruz

    2005-10-01

    Full Text Available OBJETIVO: Estudos recentes têm apresentado evidências de que a doença periodontal em gestantes pode ser um dos determinantes do baixo peso ao nascer. Realizou-se estudo para verificar a existência de associação entre doença periodontal materna e baixo peso ao nascer. MÉTODOS: Estudo do tipo caso-controle com 302 mulheres, sendo 102 mães de nascidos vivos de baixo peso (grupo caso e 200 mães de nascidos vivos com peso normal (grupo controle. A existência de associação entre doença periodontal e baixo peso ao nascer foi avaliada mediante modelo multivariado de regressão logística, considerando outros fatores de risco para o baixo peso. RESULTADOS: Ambos os grupos de mães eram comparáveis no que se refere a idade, altura, peso pré-gestacional, tabagismo, alcoolismo, doenças prévias, estado civil, situação socioeconômica, número de escovações e uso de fio dental, número de refeições diárias, e visitas ao dentista. A doença periodontal foi diagnosticada em 57,8% das mães do grupo caso e 39,0% do grupo controle. A análise de regressão logística indicou associação positiva entre doença periodontal e baixo peso ao nascer (ORbruto=2,15; IC 95%: 1,32-3,48, especialmente entre as mães com escolaridade menor ou igual a quatro anos (ORajustada=3,98; IC 95%: 1,58-10,10. CONCLUSÕES: A doença periodontal é um possível fator de risco para o baixo peso ao nascer.OBJECTIVE: Recent studies have presented evidence that periodontal disease in pregnant women may be a determining factor for low birth weight. The present investigation was carried out to verify whether or not there is an association between maternal periodontal disease and low birth weight. METHODS: This was a case-control study on 302 women, of whom 102 were the mothers of live newborns of low weight (case group and 200 were the mothers of live newborns of normal birth weight (control group. The existence of an association between periodontal disease and low

  12. Perfil de clientes colostomizados inscritos em programa de atenção aos estomizados

    National Research Council Canada - National Science Library

    Mara Rúbia Violin; Thais Aidar de Freitas Mathias; Taqueco Teruya Uchimura

    2008-01-01

    ..., exploratório, de natureza quantitativa, foi o de identificar o perfil do paciente colostomizado, inscrito no Programa de Atenção ao Estomizado – PAE, da 15ª Regional de Saúde do Paraná...

  13. Rituais aos Mortos da Tradi��o do Batuque e do Candombl�

    OpenAIRE

    de Oliveira, Ricardo Moreira

    2013-01-01

    Resumo: este artigo se prop�e apresentar os rituais dedicados aos mortos na tradi��o do Batuque afro-riograndense, do Candombl� e os raros templos Egungun do Brasil, bem como os procedimentos de desenlace de iniciados nos cultos de matriz africana referidos. Palavras-chave: Egun. Antepassados. Axex�. Aressum. Morte.

  14. Eu gosto da escola: um estudo sobre o apego ao ambiente escolar

    Directory of Open Access Journals (Sweden)

    Pollyana Verissimo de Araújo

    Full Text Available Resumo O presente artigo teve como objetivo analisar o nível de apego dos alunos ao ambiente escolar. Para tanto, adotou-se a perspectiva da relação pessoa-ambiente que busca contribuir para a vertente institucional da psicopedagogia. Participaram do estudo 200 alunos do ensino médio, com idade média de 15,15 (DP=0,98, igualmente distribuídos entre escolas públicas e privadas de uma capital nordestina. Estes responderam à Escala Apego ao Lugar, além de questões sociodemográficas. As análises indicaram que o nível de apego à escola foi considerável em relação ao esperado, evidenciando uma diferença significativa do nível de apego ao lugar em função do tipo de sistema de ensino (t(191 = -2,205; p≤0,03, com destaque para a escola privada (M= 3,36; DP= 0,603. Com base nesses resultados, foi possível discutir a necessidade de desenvolver estratégias voltadas para promoção de identidade com a escola, percepção da escola como comunidade e atitudes positivas frente à escola.

  15. General cognitive distortions and body satisfaction : Findings from the Netherlands and Curaçao

    NARCIS (Netherlands)

    Dijkstra, Pieternel; Barelds, Dick; Van Brummen-Girigori, Odette

    2017-01-01

    The present study examined ten cognitive distortions, as assessed by the Cognitive Distortions Scale (CDS), and their relations to body satisfaction among young women living in The Netherlands (n = 152) and Curaçao (a former colony of the Netherlands; n = 160). Findings showed that, in general,

  16. High prevalence of dermal parasites among coral reef fishes of Curaçao

    NARCIS (Netherlands)

    Bernal, M.A.; Floeter, S.R.; Gaither, M.R.; Longo, G.O.; Morais, R.; Ferreira, C.E.L.; Vermeij, M.J.A.; Rocha, L.A.

    2016-01-01

    During expeditions to Curaçao in August and October of 2013, a large number of fish infected with dermal parasites was observed. Infected individuals presented black spots and white blemishes on their skin and fins that were easily observed by divers, and which have been associated with infections

  17. On the radulae and spines of some Polyplacophora and Archaeogastropoda from Curaçao

    NARCIS (Netherlands)

    Righi, Gilberto

    1968-01-01

    During her stay at Curaçao from December 1965 to March 1966 Prof. Dr. DIVA DINIZ CORRÊA collected several groups of marine invertebrates. I should like to thank her for having entrusted me with the Polyplacophora and Archaeogastropoda for further study of radulae and spines.

  18. Aluminium hydro(oxide)–based (AO) adsorbent for defluoridation of ...

    African Journals Online (AJOL)

    2014-12-17

    Dec 17, 2014 ... In this study, the performance of different aluminium hydroxide–based adsorbents was compared in terms of fluoride adsorption capacity, potential for repetitive regeneration, surface acidity and surface site concentrations. The adsorbents were aluminium hydro(oxide) (AO), activated alumina (AA), and ...

  19. Molecular Evidence for Dissemination of Unique Campylobacter jejuni Clones in Curaçao, Netherlands Antilles

    NARCIS (Netherlands)

    Duim, B.; Godschalk, P.C.R.; Braak, N. van den; Dingle, K.E.; Dijkstra, J.R.; Leyde, E.; Plas, J. van der; Colles, F.M.; Endtz, H.P.; Wagenaar, J.A.; Maiden, M.C.J.; Belkum, A. van

    2003-01-01

    Campylobacter jejuni isolates (n = 234) associated with gastroenteritis and the Guillain-Barré syndrome (GBS) in the island of Curaçao, Netherlands Antilles, and collected from March 1999 to March 2000 were investigated by a range of molecular typing techniques. Data obtained by pulsed-field gel

  20. A new species of the Rodent Baiomys from Aruba and Curaçao

    NARCIS (Netherlands)

    Husson, A.M.

    1960-01-01

    In his paper on the mammals of the islands of Aruba, Curaçao, and Bonaire (situated off the north coast of Venezuela), WAGENAAR HUMMELINCK (1940 a, p. 69) mentioned a juvenile specimen of a cricetine rodent which was identified by Mr. M. A. C. HINTON and Mr. R. W. HAYMAN as probably belonging to the

  1. Exposição ao vivo no tratamento de agorafobia: relato de caso

    Directory of Open Access Journals (Sweden)

    Gustavo J. Fonseca D'El Rey

    Full Text Available Relato de caso, em que a Exposição ao Vivo foi utilizada no tratamento de paciente com diagnóstico de agorafobia. O tratamento foi realizado em doze sessões, apresentando êxito no uso dessa técnica comportamental.

  2. Aluminium hydro(oxide)–based (AO) adsorbent for defluoridation of ...

    African Journals Online (AJOL)

    In this study, the performance of different aluminium hydroxide.based adsorbents was compared in terms of fluoride adsorption capacity, potential for repetitive regeneration, surface acidity and surface site concentrations. The adsorbents were aluminium hydro(oxide) (AO), activated alumina (AA), and pseudoboehmite (PB).

  3. Long-term functional outcome of mandibular reconstruction with stainless steel AO reconstruction plates

    NARCIS (Netherlands)

    van Minnen, B; Nauta, JM; Vermey, A; Bos, RRM; Roodenburg, JLN

    Mandibular continuity defects are usually reconstructed with bone grafts. However, factors associated with the tumour and the patient can still be reasons to choose reconstruction plates. The aim of this study was to find out the results of mandibular reconstructions with stainless steel AO

  4. The groundwater quality of Aruba, Bonaire and Curaçao: a hydrogeochemical study

    NARCIS (Netherlands)

    Sambeek, M.H.G. van; Eggenkamp, H.G.M.; Vissers, M.J.M.

    2000-01-01

    Groundwater resources on the Caribbean Islands of Aruba, Bonaire and Curaçao are limited and of poor quality. The groundwater of the islands is brackish, due to both seawater mixing and the semi-arid climate of the islands.Two hundred and thirty water samples were collected to relate chemical

  5. Social behavior of the Paguridae and Diogenidae of Curaçao

    NARCIS (Netherlands)

    Hazlett, Brian A.

    1966-01-01

    1. The social behavior patterns of twelve species of hermit crabs found in the waters around Curaçao, N.A. are described. All species showed marked similarity in their aggressive displays, the most common of which are movements of the appendages, called here the ambulatory raise and cheliped

  6. Do afro-americanismo ao caucasianismo: um convertido discute o cristianismo ocidental

    Directory of Open Access Journals (Sweden)

    Edison Minami

    2015-04-01

    Foi a partir dessas ideias de fundo que iniciei a leitura do livro de Alex e Donna Jones, Não tem preço. O livro – na verdade são dois textos, um do marido e outro da esposa – relatos da conversão de dois afro-americanos pentecostais ao catolicismo.

  7. Eutrophication threatens Caribbean seagrasses – An example from Curaçao and Bonaire

    NARCIS (Netherlands)

    Govers, L.L.; Lamers, L.P.M.; Bouma, T.J.; de Brouwer, J.H.F.; van Katwijk, M.M.

    2014-01-01

    Seagrass beds are globally declining due to human activities in coastal areas. We here aimed to identify threats from eutrophication to the valuable seagrass beds of Curaçao and Bonaire in the Caribbean, which function as nursery habitats for commercial fish species. We documented surface- and

  8. Síndrome metabólica em crianças obesas e fatores de risco para doenças cardiovasculares de acordo com a resistência à insulina (HOMA-IR Metabolic syndrome and risk factors for cardiovascular disease in obese children: the relationship with insulin resistance (HOMA-IR

    Directory of Open Access Journals (Sweden)

    Aparecido Pimentel Ferreira

    2007-02-01

    Full Text Available OBJETIVO: Verificar a prevalência da síndrome metabólica e identificar fatores de risco para desenvolvimento de doenças cardiovasculares de acordo com a resistência à insulina. MÉTODOS: Realizou-se um estudo transversal em 52 crianças obesas. A amostra foi randomizada após avaliação do índice de massa corporal [peso (kg/estatura (m²] de 1.550 escolares. A obesidade foi definida quando esse índice se encontrava acima do percentil 95 da classificação do Centers for Disease Control and Prevention. O sangue de jejum foi utilizado para mensurar a glicemia, lipoproteínas de alta densidade, triglicerídeos e insulina. A gordura corporal foi avaliada pela absortometria de raio X de dupla energia. A pressão arterial e a resistência à insulina foram mensuradas. A síndrome metabólica foi definida segundo o critério do National Cholesterol Education Program, com pontos de corte ajustados para a idade da amostra. RESULTADOS: A síndrome metabólica esteve presente em 17,3% das crianças avaliadas. A resistência à insulina diferiu significativamente entre o sexo feminino (3,8±2,2; IC95% 2,9-4,8 e o sexo masculino (2,6±1,3; IC95% 2,1-3,1; p = 0,016. Cerca de 44,2% da amostra apresentou pelo menos dois fatores de risco, e 15% apresentou hipertensão arterial. A hipertrigliceridemia foi encontrada em 50 e 70,8% dos meninos e meninas, respectivamente. Os níveis de lipoproteínas de alta densidade abaixo do desejável foram encontrados somente nas meninas. CONCLUSÕES: Crianças obesas apresentaram alta prevalência de síndrome metabólica. Apresentaram mais fatores de risco aquelas que obtiveram maiores níveis de resistência à insulina. Desta forma, são necessárias medidas intervencionistas com intuito de barrar o ganho de peso durante a infância.OBJECTIVE: To identify the prevalence of metabolic syndrome and risk factors for the development of cardiovascular diseases and to investigate their relationship with insulin resistance

  9. The complexity of national identity Construction in Curaçao, Dutch Caribbean

    Directory of Open Access Journals (Sweden)

    Rose Mary Allen

    2010-10-01

    Full Text Available Curaçao, one of the five islands of the Dutch Caribbean federation called the Netherlands Antilles, currently stands at a crossroad of constitutional reform. In the context of these changes at the political level, it is logical that national identities are being redefined and repositioned. The developments in the fashioning of national identities in Curaçao deserve attention locally but also regionally. How do people in Curaçao construct national identities in daily life? How is a national collective constructed on the one hand, and how are differences with other collectivities constructed on the other hand? The historical context of constitutional changes that have occurred over the years is considered as well as an examination of the present discourse on constitutional reform. These identity issues are then placed within a wider Caribbean context.  Resumen: La complejidad de la construcción de la identidad nacional en Curaçao,en el Caribe holandés Curaçao, una de las cinco islas de la federación caribeña neerlandesa llamada Antillas Holandesas, se encuentra hoy en día en una encrucijada de reformas constitucionales. En el contexto de estos cambios a nivel político, es lógico que las identidades nacionales sean redefinidas y reposicionadas. Los desarrollos en la formulación de identidades nacionales en Curaçao merecen atención local, y también regional. ¿Cómo construye la gente en Curaçao identidades nacionales en la vida cotidiana? ¿Cómo, por un lado, se construye el colectivo nacional y, por otro, cómo se construyen las diferencias con otras colectividades? En este análisis se estudia el contexto histórico de los cambios constitucionales que han ocurrido en el curso del tiempo y se realiza igualmente una revisión del actual discurso sobre la reforma constitucional. Estos problemas de identidad son analizados entonces en un contexto caribeño más amplio.

  10. Improved tilt sensing in an LGS-based tomographic AO system based on instantaneous PSF estimation

    Science.gov (United States)

    Veran, Jean-Pierre

    2013-12-01

    Laser guide star (LGS)-based tomographic AO systems, such as Multi-Conjugate AO (MCAO), Multi-Object AO (MOAO) and Laser Tomography AO (LTAO), require natural guide stars (NGSs) to sense tip-tilt (TT) and possibly other low order modes, to get rid of the LGS-tilt indetermination problem. For example, NFIRAOS, the first-light facility MCAO system for the Thirty Meter Telescope requires three NGSs, in addition to six LGSs: two to measure TT and one to measure TT and defocus. In order to improve sky coverage, these NGSs are selected in a so-called technical field (2 arcmin in diameter for NFIRAOS), which is much larger than the on-axis science field (17x17 arcsec for NFIRAOS), on which the AO correction is optimized. Most times, the NGSs are far off-axis and thus poorly corrected by the high-order AO loop, resulting in spots with low contrast and high speckle noise. Accurately finding the position of such spots is difficult, even with advanced methods such as matched-filtering or correlation, because these methods rely on the knowledge of an average spot image, which is quite different from the instantaneous spot image, especially in case of poor correction. This results in poor tilt estimation, which, ultimately, impacts sky coverage. We propose to improve the estimation of the position of the NGS spots by using, for each frame, a current estimate of the instantaneous spot profile instead of an average profile. This estimate can be readily obtained by tracing wavefront errors in the direction of the NGS through the turbulence volume. The latter is already computed by the tomographic process from the LGS measurements as part of the high order AO loop. Computing such a wavefront estimate has actually already been proposed for the purpose of driving a deformable mirror (DM) in each NGS WFS, to optically correct the NGS spot, which does lead to improved centroiding accuracy. Our approach, however, is much simpler, because it does not require the complication of extra DMs

  11. Resistência ao clopidogrel: prevalência e variáveis associadas

    Directory of Open Access Journals (Sweden)

    Fabrício Braga da Silva

    Full Text Available FUNDAMENTO: A dupla terapia antiagregante plaquetária com ácido acetilsalicílico e clopidogrel é pedra angular do tratamento de pacientes submetidos a angioplastia com implante de stents coronarianos. Todavia, parte desses pacientes, a despeito do uso de aspirina e clopidogrel, não se encontram eficazmente antiagregados, fenômeno conhecido como resistência aos antiagregantes plaquetários. A sua prevalência, assim como as condições a ela relacionadas são desconhecidas em nosso meio. OBJETIVO: Determinar a prevalência de resistência ao clopidogrel, assim como as variáveis a ela relacionadas. MÉTODOS: Pacientes admitidos para angioplastia eletiva em uso crônico de aspirina e clopidogrel entre janeiro de 2007 e janeiro de 2010. Uma hora após o procedimento, foi medida a agregação plaquetária utilizando a agregometria óptica com difosfato de adenosina 5 µmoles/l como agonista. Nesse momento, em um coorte transversal, determinou-se a prevalência de resistência ao clopidogrel, definida com um valor de agregação plaquetária > 43% e um modelo de regressão logística às variáveis a ela relacionadas. RESULTADOS: Foram analisados 205 pacientes (66,4 ± 11anos, 61,5% masculino. A prevalência de resistência ao clopidogrel foi 38,5% (IC95% 31,9 - 45,2%. O valor da glicemia (OR = 1,014 IC95% 1,004 - 1,023, infarto do miocárdio prévio (OR = 2,320 IC95% 1,1103 - 4,892 e a resposta terapêutica à aspirina (OR = 1,057 IC95% 1,017 - 1,099 foram as variavéis de associação independente à resistência ao clopidogrel. CONCLUSÃO: A prevalência de resistência ao clopidogrel foi alta. Glicemia, infarto agudo do miocárdio prévio e a resposta ao ácido acetilsalicílico foram variáveis a ela relacionadas. A melhor compreensão desse fenômeno se faz necessária frente às novas propostas de antiagregantes plaquetários.

  12. CONTRIBUIÇÃO AO ENTENDIMENTO DA SENSIBILIDADE AMBIENTAL AO DERRAMAMENTO DE ÓLEO NO LITORAL DE MARICÁ NO ESTADO DO RIO DE JANEIRO

    Directory of Open Access Journals (Sweden)

    Érika Cardoso da Silva Baptista

    2016-01-01

    Full Text Available Desastres associados ao transporte marinho e terrestre de hidrocarbonetos causam sérios impactos aos ambientes costeiros, afetando a fauna e a flora marinha, além de prejudicar diversas atividades econômicas, inclusive àquelas tradicionais, como é o caso da pesca artesanal. Assim, faz-se necessário conhecer a geologia e a geomorfologia da costa, em especial as praias devido à elevada dinâmica e vulnerabilidade desses ambientes. A construção de megaempreendimentos na zona costeira e o tráfego de navios petroleiros e pequenas embarcações, ou mesmo a implantação de dutos, localizados junto à linha de costa, representam uma ameaça ao equilíbrio dos ecossistemas. Para tal, foram analisados diversos aspectos da geomorfologia costeira de Maricá, para posterior identificação do grau de sensibilidade deste litoral a eventos de derramamento de óleo, a partir do Índice de Sensibilidade Ambiental (ISA proposto pelo Ministério do Meio Ambiente. O litoral de Maricá, ao longo de 34 km de extensão entre Itaipuaçú (no extremo oeste e Ponta Negra (a leste, apresenta quatro áreas distintas quanto à sensibilidade à poluição decorrente de derramamento de óleo, sendo: ISA1, para as áreas de costões rochosos localizados nas extremidades leste e oeste deste litoral; ISA4, para a quase totalidade das praias, formadas por areias quartzosas grossa e média, exceto o extremo-oeste de Itaipuaçú, que possui areia muito grossa e cascalhos sendo, portanto, representada pelo ISA5; e ISA10, para as lagoas costeiras e canais na retaguarda das barreiras arenosas, sujeitas à contaminação por meio dos canais e por transposição por grandes ondas de tempestades. Os índices compreendem os extremos dessa classificação, devido à grande variedade de elementos na paisagem costeira de Maricá e mostra a elevada sensibilidade deste litoral, frente à ameaça de desastres causados por derramamento de óleo.

  13. Controle dos recursos locals através da contabilidade pública: a transformalçao do processo do antigo ao novo regime

    OpenAIRE

    Campos Luceno, María Soledad

    2012-01-01

    Durante muito  tempo, a precariedade firlanceira do Eslado colidia com a prosperidade dos recursos locais. Isto se viu agravado no ultimo périodo do Antigo Regime com a perda das colonias, principal fonte de ingressos do Estado, assim como pelos conflitos bélicos nos que o pais esteve imerso, que aumentaram os gastos. Esta situaçao levou a que os distintos governos que se sueederam na Espallha desde a metade do seculo XVII ate o final do XIX. tivessem um objetivo comun, o comtrole dos recurso...

  14. Resolução CONAMA 357/2005: análise espacial e temporal de não conformidades em rios e reservatórios do estado de São Paulo de acordo com seus enquadramentos (2005-2009

    Directory of Open Access Journals (Sweden)

    Davi Gasparini Fernandes Cunha

    2013-06-01

    Full Text Available A Resolução CONAMA 357/2005 estabeleceu condições de qualidade para o enquadramento dos sistemas aquáticos no Brasil. Essa pesquisa avaliou os níveis de não conformidade entre a qualidade de rios e reservatórios do estado de São Paulo e o seu enquadramento para algumas variáveis. Foram analisados dados (n=43.897 de fósforo total, oxigênio dissolvido, nitrato, turbidez e Demanda Bioquímica de Oxigênio de 360 pontos amostrais nas 22 UGRHIs (Unidades de Gerenciamento de Recursos Hídricos de SP. A situação se apresentou mais crítica para o fósforo total e o oxigênio dissolvido, sobretudo nas UGRHIs industriais. Entre 2005 e 2009, não houve melhoria significativa em relação aos resultados desconformes para algumas variáveis. Há necessidade de investimentos no tratamento de esgotos em nível terciário e de medidas para atenuar a geração de cargas difusas.

  15. Resistência de Eleusine indica aos inibidores de ACCase Eleusine indica resistance to ACCase inhibitors

    Directory of Open Access Journals (Sweden)

    R.A. Vidal

    2006-01-01

    Full Text Available Dentre as causas da ineficácia no controle de plantas daninhas destaca-se a resistência delas aos herbicidas. Os objetivos deste trabalho foram avaliar a suspeita de resistência de Eleusine indica a inibidores de acetil-CoA carboxilase (ACCase e investigar a ocorrência de resistência cruzada entre os inibidores de ACCase. Biótipo de Eleusine indica originado do Mato Grosso com suspeita de resistência aos herbicidas inibidores de ACCase foi avaliado em casa de vegetação na sua suscetibilidade para diversos produtos do grupo dos ariloxifenoxipropionatos e cicloexanodionas. Estudos de resposta à dose confirmaram que o biótipo era 18 vezes mais insensível ao sethoxydim do que biótipo suscetível nunca aspergido com herbicidas. Também se constatou resistência cruzada ao fenoxaprop, cyhalofop, propaquizafop e butroxydim. Não se observou resistência cruzada aos produtos fluazifop, haloxyfop, quizalofop e clethodim.Among the causes for weed control inefficacy, the worst one is resistance to herbicides. The objectives of this work were to evaluate an Eleusine indica biotype suspected of resistance to ACCase inhibitors and to investigate the occurrence of cross- resistance to several ACCase inhibitors. One biotype of Eleusine indica originated from Mato Grosso with suspected resistance to ACCase inhibitors was evaluated in a greenhouse in relation to its susceptibility to several products of the ariloxyphenoxypropionate and cyclohexanedione groups. Studies on dose response confirmed that the suspected biotype was 18 times more insensitive to sethoxydim than the susceptible biotype that had never been treated with herbicides. Cross-resistance was confirmed for fenoxaprop, cyhalofop, propaquizafop and butroxydim. No cross-resistance was observed with fluazifop, haloxyfop, quizalofop, and clethodim.

  16. Evolução do perfil neuromotor e capacidade funcional de mulheres fisicamente ativas de acordo com a idade cronológica Evolución del perfil neuromotor y la capacidad funcional de mujeres fisicamente activas de acuerdo con la edad cronológica Evolution of neuromotor profile and functional capacity of physically active women according to chronological age

    Directory of Open Access Journals (Sweden)

    Sandra Mahecha Matsudo

    2003-11-01

    Full Text Available FUNDAMENTOS E OBJETIVO: Poucos estudos longitudinais têm sido feitos em mulheres fisicamente ativas para determinar o impacto do envelhecimento na aptidão física e capacidade funcional. O objetivo deste estudo foi comparar a evolução do perfil neuromotor e capacidade funcional de mulheres ativas no período de um ano, de acordo com a idade cronológica. MÉTODOS: A amostra foi composta por 117 mulheres de 50 a 79 anos de idade (: 65 ± 6,6 anos participantes de um programa de exercícios aeróbicos, duas vezes por semana, 50 minutos por sessão durante 5,4 ± 3,0 anos e divididas pela idade em: 50-59 (n: 23; 60-69 (n: 60; 70-79 (n: 34. Os testes neuromotores e de mobilidade incluíram: força muscular dos membros inferiores e superiores, agilidade, flexibilidade do tronco, velocidade de levantar-se da cadeira, equilíbrio estático, velocidade normal de andar e velocidade máxima de andar. Os resultados iniciais e nas duas avaliações seguintes, feitas a intervalos de seis meses, foram comparados usando ANOVA two way, com post-hoc Bonferroni. RESULTADOS: Em um ano não houve nenhuma alteração no desempenho neuromotor; já a velocidade de levantar da cadeira e a velocidade de andar evidenciaram diferenças significativas nos grupos de 50-59 e 60-69 anos, apresentando resultados 10-20% melhores; quanto à velocidade máxima de andar, houve melhora (8% nos grupos de 60 a 79 anos. CONCLUSÃO: A evolução da aptidão física e capacidade funcional teve comportamento similar, em mulheres fisicamente ativas, independentemente da idade cronológica. Essa evolução fortalece a hipótese de um efeito favorável da atividade física regular na promoção da saúde, estratégia fundamental do envelhecimento saudável.FUNDAMENTOS Y OBJETIVO: Pocos estudios longitudinales han sido realizados en mujeres físicamente activas para determinar el impacto del envejecimiento de la aptitud física y la capacidad funcional. El objetivo de este estudio fu

  17. Discrimination of Brazilian red wines according to the viticultural region, varietal, and winery origin Discriminação de vinhos tintos brasileiros de acordo com a região vitícola, varietal e vinícola

    Directory of Open Access Journals (Sweden)

    Alberto Miele

    2010-03-01

    Full Text Available This work evaluated the physicochemical composition of 171 red Brazilian wines from the 2006 vintage, which were represented by 21 varietals. These wines were produced by 58 Brazilian wineries in different regions of the country, with latitudes varying from 9º to 31º South. Physicochemical wine analysis was performed in the same year and discrimination in the viticultural regions, varietal wines, and wineries was performed by means of the principal component analysis (PCA. The main results show that wines from São Joaquim had higher values of A420, A520, A620, color intensity, total phenolic compounds, anthocyanins, and dry extracts, while those from Toledo had lower values of these variables; those from Vale do São Francisco had higher values of potassium, pH, density, and volatile acidity; from Serra do Nordeste A, they had higher titratable acidity; and from Planalto Superior B, higher hue. Regarding the varietal wines, PCA mainly discriminated the wines produced from the varieties Ancellotta, Teroldego, Egiodola, Refosco, Marselan, Cabernet Sauvignon, Pinotage, Pinot Noir, Malbec, Arinarnoa, Barbera, and Alfrocheiro. In relation to wineries, twenty two of them were discriminated by their higher values of some variables, i.e., three were characterized by color intensity; three by hue; eight by alcohol content; six by potassium, dry extract, density, and pH; and two by titratablel acidity.O trabalho avaliou a composição físico-química de 171 vinhos tintos brasileiros elaborados na safra de 2006, representados por 21 varietais. Os vinhos foram elaborados por 58 vinícolas localizadas em sete regiões vitícolas do País com latitudes variando de 9º a 31º Sul. A análise físico-química foi feita em 2006 e a discriminação entre as regiões vitícolas, os vinhos varietais e as vinícolas foi realizada através da análise de componentes principais (ACP. Os principais resultados mostram que ao se considerar as regiões vitícolas, os

  18. Local knowledge of medicinal plants in three artisanal fishing communities (Itapoá, Southern Brazil, according to gender, age, and urbanization Conhecimento local sobre plantas medicinais em três comunidades de pescadores artesanais (Itapoá, sul do Brasil, de acordo com gênero, idade e urbanização

    Directory of Open Access Journals (Sweden)

    Adriana Heindrickson Cunha Merétika

    2010-06-01

    obtidas principalmente por cultivo. Cordia curassavica (Jacq. Roem. & Schult. (Boraginaceae é a espécie mais citada nas entrevistas, localmente chamada de "erva-baleeira" ou "erva-de-baleia". Os idosos têm um maior conhecimento sobre as espécies, mas não houve diferenças em relação ao sexo dos entrevistados. Um menor conhecimento sobre as plantas foi observado na área mais urbanizada, quando comparada com as áreas menos urbanizadas. As plantas mais utilizadas não estão relacionadas com as doenças mais freqüentes. As plantas medicinais são um recurso importante para a saúde dessas comunidades de pescadores, mas este conhecimento pode estar se deteriorando devido principalmente à falta de interesse dos membros mais jovens e à melhoria do acesso aos serviços públicos de saúde.

  19. Identification and characterization of filamentous fungi isolated from the sunflower (Helianthus annus L. rhizosphere according to their capacity to hydrolyse inulin Identificação e caracterização de fungos filamentosos isolados de rizosfera de girassol (Helianthus annus L. de acordo com a capacidade de hidrolisar inulina

    Directory of Open Access Journals (Sweden)

    Cristina Maria de Souza-Motta

    2003-07-01

    diversidade destes fungos ao longo do ciclo de vida da planta. O fungos foram também caracterizados quanto a capacidade de hidrolisar inulina. Das quarenta e nove espécies de fungos filamentosos isoladas, Penicillium e Aspergillus foram os gêneros que apresentaram maior número de espécies, nove e sete, respectivamente. No final do ciclo de vida do girassol, cultivado tanto em campo quanto em casa de vegetação, foi isolado um menor número de espécies. Cento e cinquenta e nove amostras de fungos filamentosos, isoladas do solo e da rizosfera de girassol e destas 79 (49,7% foram capazes de hidrolisar inulina. Não houve diferença significativa quanto a proporção de espécies capazes ou não de hidrolisar esse polissacarídeo, ao longo do ciclo de vida do girassol, cultivado tanto em campo quanto em casa de vegetação. Embora a rizosfera de girassol seja uma fonte de fungos filamentosos capazes de hidrolisar inulina, que podem ser utilizados em processos biotecnológicos, ela não atua de modo a concentrar fungos com esta característica. Espécies de Aspergillus, Chaetomium, Cunninghamella, Emericela, Eupenicillium, Fusarium, Myrothecium, Neosartorya, Neocosmospora, Penicillium and Thielavia estão sendo relatados pela primeira vez como produtores de inulinase.

  20. Eluição de Magnésio, Cálcio e Potássio de acordo com o tempo de difusão em colunas com agregados de um Latossolo Vermelho distrófico típico

    Directory of Open Access Journals (Sweden)

    Araújo C. A. S.

    2003-01-01

    Full Text Available O transporte de nutrientes até às raízes é essencialmente efetuado por fluxo de massa e difusão. À medida que os nutrientes presentes na solução móvel ou de interagregados vão-se exaurindo, eles se movimentam por difusão do interior para a superfície dos agregados. Com o objetivo de determinar a quantidade de Mg, Ca e K no efluente de colunas com agregados de um Latossolo Vermelho distrófico típico, em resposta ao tempo de difusão, realizou-se um experimento utilizando água destilada como eluente. Os tratamentos corresponderam a um arranjo fatorial 4 x 5, sendo quatro classes de agregados (2,0-1,0; 1,0-0,5; 0,5-0,25; e 0,25-0,105 mm e cinco tempos de difusão (0, 1, 2, 4 e 6 dias. As colunas receberam um volume de água destilada igual a 10 vezes o seu volume de poros, recolhendo-se cinco frações de dois volumes de poros de efluente nos intervalos indicados para cada tempo de difusão. Os agregados menores liberaram mais Mg, Ca e K para a solução nos espaços interagregados que os maiores. A quantidade de Mg, Ca e K eluída aumentou com o tempo de difusão, a partir da segunda fração analisada.

  1. A consciência da definição e utilização de estratégias de desenvolvimento sustentável de acordo com os gestores de organizações públicas no Brasil

    Directory of Open Access Journals (Sweden)

    Danilo de Oliveira Sampaio

    2016-10-01

    Full Text Available Esta pesquisa teve como objetivo verificar o conhecimento dos gestores e dirigentes de empresas públicas brasileiras sobre o significado de desenvolvimento sustentável. O estudo foi realizado entre abril e outubro de 2014 na cidade de Juiz de Fora, no estado de Minas Gerais, Brasil. A pesquisa foi do tipo descritiva e exploratória com viés qualitativo. A coleta de dados respeitou as cinco variáveis teóricas (meio ambiente natural, sociedade, economia, consumo sustentável e variável institucional propostas por Elkington (1987; 1999, García (2010 e Dresner (2002, sendo entrevistados sete gestores públicos, utilizando-se um roteiro semiestruturado. Foram analisados os discursos e falas dos gestores por meio de estatística descritiva e análise de conteúdo. Verificou-se que o conhecimento sobre o desenvolvimento sustentável dos gestores das organizações públicas brasileiras entrevistadas é parcialmente compreendido e pouco incentivado aos funcionários e sociedade. Notou-se a necessidade de instruir e capacitar os gestores sobre o significado de desenvolvimento sustentável e como implementar planos de ação respeitando as demandas dos cidadãos. Acredita-se que as estratégias para apoiar as aspirações sociais, econômicas e ambientais devem estar presentes com maior ênfase na gestão das organizações públicas brasileiras pesquisadas. Assim, atender as demandas da sociedade e proporcionar uma melhor qualidade vida são metas que o setor público brasileiro deve priorizar.

  2. Medo, ansiedade e controle relacionados ao tratamento odontológico

    Directory of Open Access Journals (Sweden)

    SINGH Kira Anayansi

    2000-01-01

    Full Text Available Nosso objetivo foi avaliar medo, ansiedade e controle relacionados ao tratamento odontológico. Os sujeitos foram 364 crianças da faixa etária de 7 a 13 anos. Três questionários com questões de múltipla escolha foram aplicados em grupos de 10 crianças. O primeiro questionário destinou-se à avaliação do medo ao tratamento odontológico e outras situações. Foi traduzido e adaptado do "Child's Fear Survey Schedule"9 e contém 15 itens. O segundo questionário contém 20 itens relacionados as situações potencialmente produtoras de ansiedade. Foi traduzido e adaptado do "State Trait Anxiety Inventory for Children"16. O terceiro questionário contém 40 itens sendo 20 relacionados ao controle percebido e 20 ao controle desejado e foi traduzido e adaptado do "Child Dental Control Assessment"19. Em relação ao medo e ansiedade, a média dos escores foi mais elevada para o sexo feminino do que para o sexo masculino (P < 0,05. Em relação a idade, as crianças da faixa de 11 a 13 anos revelaram-se em média mais temerosas que as de 7 a 9 anos. Quanto ao controle percebido as crianças mais novas percebem mais controle do que as mais velhas. Em geral os dados indicam que valores mais altos de medo relacionam-se com valores mais baixos de controle percebido. As crianças que tinham realizado tratamento odontológico com anestesia mostraram-se mais temerosas do que aquelas que não foram submetidas a anestesia, o que permite inferir que a etiologia de medo pode relacionar-se a esse procedimento que pode envolver a percepção de incontrolabilidade.

  3. Fatores associados aos tratamentos inadequados em grupo de portadores de tuberculose multirresistente

    Directory of Open Access Journals (Sweden)

    Barroso Elizabeth Clara

    2003-01-01

    Full Text Available INTRODUÇÃO: A tuberculose multirresistente é uma ameaça ao controle da tuberculose em todo o mundo. Tratamento inadequado é freqüentemente apontado como fator de risco para tuberculose multirresistente. OBJETIVO: Identificar fatores associados ao tratamento inadequado em portadores de tuberculose multirresistente. MÉTODO: Foram levantados e identificados os testes de sensibilidade para tuberculose, realizados no Laboratório Central do Estado do Ceará de 1990 a 1999. Foi realizado um estudo retrospectivo e prospectivo, em grupo de portadores de tuberculose multirresistente, comparando as características dos pacientes com tratamento adequado com as dos com tratamentos inadequados. Foi considerado multirresistente o bacilo resistente a pelo menos rifampicina + isoniazida e utilizado o método das proporções. RESULTADOS: Dos 1.500 testes de sensibilidade realizados, 266 eram multirresistentes. Destes, identificaram-se apenas 153 pacientes, dos quais 19 foram excluídos, restando, no estudo, 134 pacientes. Pela análise univariada os fatores associados significativamente ao tratamento inadequado foram: não-adesão ao tratamento, pobreza extrema, intolerância medicamentosa, falha no atendimento, falta de medicação, dois ou mais tratamentos anteriores, lesões radiológicas bilaterais e grandes cavidades pulmonares. Foi encontrada ainda associação (p < 0,001 de alcoolismo e/ou tabagismo com a não-adesão. Na análise multivariada, permaneceram associados ao tratamento inadequado: dois ou mais tratamentos anteriores (p < 0,0001, OR = 5,9; IC 95%: 2,5-13,7, grandes cavidades pulmonares (p < 0,0217, OR = 2,7; IC 95%: 1,2-6,1 e lesões radiológicas bilaterais (p < 0,0226, OR = 3,2; IC 95%: 1,4-7,4. CONCLUSÃO: Neste estudo, observou-se que os fatores associados aos tratamentos inadequados são de grande abrangência. Deve existir uma tentativa para controlar melhor a doença, principalmente nos pacientes em retratamento e nos portadores

  4. The Effectiveness of a Mixed-Mode Survey on Domestic Violence in Curaçao: Response and Data Quality

    Science.gov (United States)

    van Wijk, Nikil; de Leeuw, Edith; de Bruijn, Jeanne

    2015-01-01

    To collect reliable statistical data on domestic violence in Curaçao, we conducted a large-scale quantitative study (n = 816). To meet with the special needs of the population and topic, we designed a tailored mixed-mode survey to assess the prevalence of domestic violence in Curaçao and its health consequences. Great care was taken to reduce…

  5. A new species of Hemicyclops (Crustacea, Copepoda, Poecilostomatoida, Clausidiidae) associated with hermit crabs in Curaçao

    NARCIS (Netherlands)

    Stock, Jan H.

    1992-01-01

    STOCK, J. H. 1992. A new species of Hemicyclops (Crustacea, Copepoda, Poecilostomatoida, Clausidiidae) associated with hermit crabs in Curaçao. Stud. Nat. Hist. Caribbean Region 71, Amsterdam 1992: 69-78. Hemicyclops geminatus n. sp. is described from the upper infralittoral zone of Curaçao

  6. Regional differences associated with drinking and driving in Brazil Diferenças regionais entre os fatores associados ao beber e dirigir no Brasil

    Directory of Open Access Journals (Sweden)

    Raquel De Boni

    2012-10-01

    Full Text Available OBJECTIVE: To evaluate regional differences and similarities associated with drinking and driving (DUI in the five Brazilian macro-regions. METHOD: A roadside survey was conducted in the 27 Brazilian state capitals. A total of 3,398 drivers were randomly selected and given a structured interview and a breathalyzer test. To determine the predictors of positive blood alcohol concentration (BAC in each region, a MANOVA was performed, and 3 groups were used as follows: 1 North and Northeast, 2 South and Midwest, and 3 Southeast. A Poisson robust regression model was performed to assess the variables associated with positive BAC in each group. RESULTS: Of all surveyed drivers, 2,410 had consumed alcohol in the previous 12 months. Most were male, with a median age of 36. Leisure as the reason for travel was associated with positive BAC in all 3 groups. Low schooling, being older than 30, driving cars or motorcycles and having been given a breathalyzer test at least once in their lives predicted DUI in at least two different groups. CONCLUSIONS: Factors , especially low schooling and leisure as a reason for travel, associated with drinking and driving were similar among regions, although certain region-specific features were observed. This information is important for aiming to reduce DUI in the country.OBJETIVO: Avaliar diferenças e similaridades em relação a beber e dirigir (DUI nas cinco macroregiões brasileiras. MÉTODO: Um roadside survey foi realizado nas 27 capitais brasileiras. Foram selecionados aleatoriamente 3.398 condutores que responderam a uma entrevista estruturada e foram testados com uso de etilômetro. Para a construção de modelos preditivos de alcoolemia positiva (BAC, as regiões foram agrupadas de acordo com sua similaridade, obtida por MANOVA, em: 1 Norte e Nordeste; 2 Sul e Centro-Oeste; 3 Sudeste. Em cada grupo foi realizado um modelo de regressão robusta para estimar as variáveis associadas a BAC. RESULTADOS: Dentre os

  7. Água de Coco comercializadas no Sertão do Ceará e Paraíba: Imprópria ao consumo

    Directory of Open Access Journals (Sweden)

    Suziane Alves Josino Lima

    2014-10-01

    Full Text Available A água de coco é considerada um isotônico natural, rica em nutrientes e altamente atrativa devido a seu valor nutricional e sabor, com a busca por alimentos saudáveis nos tempos atuais seu consumo tem aumentado consideravelmente principalmente na forma industrializada no Nordeste do Brasil onde se concentram os maiores plantios do coqueiro anão verde, tornando assim indispensável a avaliação da qualidade da água de coco comercializada nesta região. Neste sentido, este trabalho objetivou avaliar a qualidade microbiológica de amostras de água de coco, industrializada e comercializada por duas empresas no sertão paraibano e cearense. Como parâmetros da qualidade microbiológica foram realizadas as seguintes análises: Coliformes Termotolerantes,Salmonella spp/25g, Bolores e Leveduras e contagem de Microrganismos Aeróbios Psicrotróficos nas amostras. A água de coco anão verde comercializada pela indústria A, apresentou resultados de coliformes totais variando de 7 NMP/mL a 1,5 x 102 NMP/mL e < 3 NMP/mL a 7 NMP/mL para coliformes termotolerantes, estes valores oscilaram durante os trintas dias de armazenamento tempo este de validade do produto industrializado. Também foram detectados nas amostras analisadas uma alta contagem de bactérias, nas amostras da água de coco da indústria A armazenada sob-refrigeração, indicando assim possivelmente o uso de matéria prima contaminada, falhas no processamento distribuição e ou armazenamento, estas diretamente relacionadas ao binômio tempo/temperatura insatisfatórios. Os valores encontrados para Bolores e Leveduras variaram de 5,05x102 UFC/mL a 7,6x105 UFC/mL, valores estes considerados elevados, caracterizando a água de coco como imprópria para o consumo quando comparadas á legislação vigente. De acordo com os resultados sugere-se que esta contaminação tenha ocorrido durante a manipulação e ou processamento, uma vez que esta apresenta-se estéril dentro do seu próprio inv

  8. Marketing de alimentos industrializados destinados ao público infantil na perspectiva da rotulagem | Evalution of processed foods for children from the perspective of nutrition labeling and marketing

    Directory of Open Access Journals (Sweden)

    Jéssica Soares Geraldo Ferreira

    2015-05-01

    Full Text Available Compreendendo a importância das informações contidas nos rótulos dos alimentos, foi objetivo do presente estudo avaliar a qualidade de alimentos industrializados destinados ao público infantil, comercializados na cidade do Rio de Janeiro, sob a ótica da rotulagem nutricional e do marketing. Foram avaliados alimentos e bebidas industrializadas das categorias mais consumidas pelo público infantil. Os rótulos selecionados foram avaliados de acordo com os parâmetros estabelecidos em regulamentações vigentes, assim como, os recursos de marketing empregados nas embalagens e sua composição nutricional para 100 g ou 100 mL. Foram avaliados os rótulos de 93 embalagens de alimentos industrializados de 33 fabricantes diferentes. Cada amostra foi avaliada em 32 quesitos, totalizando 2.976 análises. Houve conformidade em 80% dos itens avaliados, 19% não eram aplicáveis e 1% apresentou não conformidade à legislação. A análise de marketing identificou o uso de 20 diferentes estratégias. A análise da composição nutricional declarada no rótulo permitiu concluir que os alimentos classificados com quantidades elevadas de açúcar, gordura saturada, gordura trans e/ou sódio corresponderam a 66%. Torna-se fundamental um modelo eficiente de regulação e fiscalização da rotulagem e marketing de modo a garantir informações claras e fidedignas. --------------------------------------------------------------------------------------------- The aim of this study was to evaluate the quality of processed foods for children marketed in the city of Rio de Janeiro from the perspective of nutrition labeling and marketing in terms of the prevailing regulations. Industrialized foods and beverages consumed by were evaluated in the categories most commonly consumed by children were assessed. The product labels selected for the study were evaluated according to the parameters established in the current regulations, the marketing resources employed in

  9. Efeito do sulfato de magnésio sobre o índice de pulsatilidade das artérias uterinas, umbilical e cerebral média fetal de acordo com a persistência da incisura protodiastólica da artéria uterina na pré-eclâmpsia grave Effect of magnesium sulfate on pulsatility index of uterine, umbilical and fetal middle cerebral arteries according to the persistence of bilateral diastolic notch of uterine arteries in patients with severe preeclampsia

    Directory of Open Access Journals (Sweden)

    Alex Sandro Rolland Souza

    2009-02-01

    Full Text Available OBJETIVO: avaliar o efeito do sulfato de magnésio sobre o índice de pulsatilidade (IP das artérias uterinas, umbilicais e cerebral média fetal, de acordo com a persistência ou não da incisura protodiastólica bilateral das artérias uterinas na pré-eclâmpsia grave. MÉTODOS: foi desenvolvido um estudo do tipo coorte, incluindo 40 gestantes com pré-eclâmpsia grave, das quais 23 apresentavam incisura protodiastólica bilateral e 17, incisura ausente/unilateral. As pacientes foram submetidas a doplervelocimetria antes e depois de 20 minutos da administração intravenosa de 6 g do sulfato de magnésio. O exame foi realizado com a paciente em posição semi-Fowler, obtendo-se os sonogramas durante a inatividade fetal, em períodos de apneia e ausência de contrações uterinas. Todos os exames foram realizados por dois pesquisadores, considerando a média como resultado final. A comparação dos IP antes e depois do sulfato de magnésio em cada grupo foi realizada pelo teste de Wilcoxon. A diferença das duas medidas (antes e depois do sulfato de magnésio foi comparada entre os grupos (incisura bilateral e incisura ausente/unilateral utilizando-se o teste de Mann-Whitney. RESULTADOS: houve um aumento significativo da frequência cardíaca materna e uma diminuição da pressão arterial materna e da mediana dos IP das duas artérias uterinas e da artéria cerebral média fetal depois da utilização do sulfato de magnésio em ambos os grupos. Houve redução significativa do IP da artéria uterina esquerda e da artéria umbilical apenas no grupo com incisura protodiastólica unilateral/ausente. No entanto, não foram encontradas diferenças significativas em relação ao IP da artéria uterina direita e relação umbilical/cerebral antes e depois do sulfato de magnésio em cada grupo. Não se encontrou diferença entre os grupos, antes e depois do sulfato de magnésio, para nenhum dos desfechos estudados. CONCLUSÕES: após a administra

  10. Truncus arteriosus operado aos 28 anos: importância do diagnóstico diferencial

    Directory of Open Access Journals (Sweden)

    Lilian Maria Lopes

    2011-08-01

    Full Text Available Descrevemos um caso de adulto de 28 anos com suspeita de cardiopatia congênita desde o nascimento, não tratada na infância por opção da família. Aos 27 anos, foi feito diagnóstico de atresia pulmonar com comunicação interventricular e colaterais sistêmico-pulmonares, sendo contraindicada a cirurgia. Uma nova reavaliação em nosso serviço demonstrou tratar-se de um truncus arteriosus atípico. O fato de um tronco arterial comum com shunt esquerda-direita ter sido visualizado ao ecocardiograma foi um dado crucial para a indicação de novo cateterismo, abrindo perspectiva de correção cirúrgica. No momento, o paciente encontra-se bem, com 7 anos de evolução pós-operatória.

  11. As resistências ao poder em Michel Foucault The resistance to power in Michel Foucault

    OpenAIRE

    Guilherme Castelo Branco

    2001-01-01

    Ainda pouco estudada, a última fase do pensamento de Michel Foucault traz contribuições inegáveis ao debate ético e político de nossa época, sobretudo por enfatizar o papel do indivíduo e das coletividades nas lutas de transformação das estruturas de poder ora vigentes. Os modos de ser das lutas de resistência, sua importância no quadro referencial do último Foucault, revelam uma dimensão política antes insuspeitada em sua obra. Essa dimensão, para além da analítica do poder, concede aos pequ...

  12. Escala multidimensional aplicada aos estudos de apreciação musical

    Directory of Open Access Journals (Sweden)

    Raquel Cocenas da Silva

    2009-08-01

    Full Text Available A escala multidimensional (MDS provém de uma família de técnicas de análise de proximidade de dados, obtida por meio do julgamento do participante que compara vários estímulos em vários traços, concomitantemente. A análise dos julgamentos de proximidade produz um espaço em que pontos representam a relação entre os estímulos em um espaço euclidiano. O ordenamento dos estímulos ao longo das dimensões neste espaço permite que inferências possam ser feitas sobre o universo perceptual subjacente ao grupo de pesquisa. A literatura mostra que a MDS vem ampliando o estudo da música e a mensuração de suas propriedades estruturais.

  13. A amizade para Foucault: resistências criativas face ao biopoder

    Directory of Open Access Journals (Sweden)

    Hélio Rebello Cardoso Jr.

    2009-04-01

    Full Text Available O artigo trabalha a noção de amizade em Foucault como um modo de vida que se opõe ao processo de normalização empreendido pelo biopoder. Inicia com uma caracterização acerca do Estado Moderno. Logo após, aborda a historicidade dos processos de subjetivação e de como a atitude frente a estes implica estados de maior autonomia ou sujeição. Em seguida, aborda a amizade como resistência à normalização, situando-a em relação ao prazer e à sexualidade. Por fim, discute o papel da filosofia no processo de constituição da amizade, particularmente quanto à possibilidade de pensá-la por meio de uma teoria das relações.

  14. Evolução da temperatura ambiente em construções sujeitas ao fogo

    OpenAIRE

    Inácio, Pedro Jorge Rita Ledo

    2011-01-01

    Dissertação para a obtenção do Grau de Mestre em Engenharia Civil A perda de bens materiais e de vidas humanas em situações de incêndio tem sido ao longo dos tempos uma preocupação crescente, promovendo assim o conceito de segurança contra incêndio e de diversos mecanismos associados à sua prevenção ou limitação dos danos causados. Um incêndio é algo difícil de prever, assim como a sua consequência nos elementos de construção. Dessa forma, ao longo das ultimas décadas, os elementos d...

  15. Do mundano ao sagrado: o papel da efervescência na teoria moral durkheimiana

    Directory of Open Access Journals (Sweden)

    Raquel Andrade Weiss

    2013-12-01

    Full Text Available Meu objetivo neste artigo é discutir o significado do conceito de efervescência na obra durkheimiana e apontar o papel que esse processo desempenha em relação à sua teoria moral. De modo geral, a argumentação versa em torno da articulação de três pressupostos estruturais da teoria moral durkheimiana, quais sejam, 1 a vinculação entre sagrado e ideal moral, 2 a concepção acerca da natureza humana como sendo essencialmente dual e 3 a proposta normativa de Durkheim de institucionalização de uma moralidade laica. Ao final, proponho ao leitor uma reflexão sobre a pertinência de sua defesa de um "sagrado laico" a partir dos desafios morais que caracterizam o mundo contemporâneo.

  16. Associação entre indicadores de risco ao desenvolvimento infantil e estado emocional materno

    OpenAIRE

    Flores,Mariana Rodrigues; Souza,Ana Paula Ramos de; Moraes,Anaelena Bragança de; Beltrami,Luciane

    2013-01-01

    OBJETIVO: analisar a associação entre os estados emocionais maternos depressivo e ansioso, combinados ou de modo isolado, em relação à presença de risco ao desenvolvimento infantil na faixa etária de 0 a 4 meses. MÉTODO: trata-se de estudo observacional, analítico e de coorte. Para a obtenção dos dados foram utilizados os Inventários de Beck de Depressão e de Ansiedade e analisada a interação mãe-bebê a partir do protocolo de índices de risco ao desenvolvimento infantil em uma amostra de 182 ...

  17. Resistência ao cisalhamento de lajes nervuradas unidirecionais de concreto armado

    Directory of Open Access Journals (Sweden)

    W. M. Souza

    Full Text Available A resistência ao cisalhamento de lajes nervuradas unidirecionais de concreto armado sem estribos nas nervuras ainda gera controvérsias quando sua estimativa não considera a contribuição da capa monolítica. Visando contribuir para o melhor entendimento do comportamento destas lajes, foram confeccionados em laboratório 8 painéis de lajes nervuradas unidirecionais de concreto armado onde as principais variáveis foram a distância entre as nervuras e a espessura da capa. Foram avaliadas as recomendações normativas da NBR 6118, ACI 318 e EUROCODE 2 para as resistências últimas destas lajes. Os resultados experimentais mostraram que houve acréscimo de resistência ao cisalhamento com o aumento da espessura da capa, resultando também em maiores deformações nas armaduras e em flechas mais elevadas.

  18. O exercício do estudar nos cursinhos destinados aos concursos públicos

    Directory of Open Access Journals (Sweden)

    Leonardo Del Puppo Luz

    2008-06-01

    Full Text Available O artigo discute o processo de produção da subjetividade contemporânea elaborado sobre o Estudar em alunos de cursinhos destinados aos concursos públicos. Procura-se discutir as tecnologias de poder, sobretudo na relação saber-poder, engendradas nestes "ambientes educacionais", já que tais construções sobre o Estudar produzem e perpetuam a manifestação de conceitos absolutos e verdadeiros de se pensar o estudo por meio de técnicas e procedimentos de funcionamentos ideais e idealizados. Busca-se problematizar este modelo homogêneo baseado no tecnicismo do estudar e nas falas sobre o verdadeiro visando colocar em análise o estereótipo do "fracasso" atrelado aos alunos vinculados a estes locais.

  19. Analyses of Alternatives (AoAs): Toward a More Rigorous Determination of Scope

    Science.gov (United States)

    2014-03-11

    Inappropriate Treatment of Time Constraints ..................................................... 7  Inappropriate Focus on Existing C/CSS and/or...several reasons why AoAs may be improperly scoped. Inappropriate Treatment of Time Constraints In the first section, we noted the recent trend...Type Memorandum DTM 10-017). Washington, DC: Author. Retrieved from http://www.hsdl.org/?view&did=728880 United States Air Force Office of

  20. Subordinate but proud: Curaçao's free blacks and mulattoes in the eighteenth century

    Directory of Open Access Journals (Sweden)

    Wim Klooster

    1994-07-01

    Full Text Available Focuses on the socio-economic position of free non-whites in 18th-c. Curaçao. The manumission rate was relatively high and consequently a large group of free non-whites was created. Blacks and mulattoes enjoyed religious freedom as well as considerable economic freedom. Their growing numbers and social and economic assertiveness alarmed the whites, who gradually admitted the most successful mulattoes in their circles.

  1. Caminhoneiros de rota curta e sua vulnerabilidade ao HIV, Santos, SP

    Directory of Open Access Journals (Sweden)

    Villarinho Luciana

    2002-01-01

    Full Text Available OBJETIVO: Descrever a vulnerabilidade, de caminhoneiros de rota curta, à transmissão sexual do HIV e da Aids. MÉTODOS: Foram entrevistados 279 caminhoneiros com vínculo de trabalho na cidade de Santos, SP, em locais de concentração na área portuária e suas proximidades, sindicatos e associações, recrutados pela amostragem do tipo "bola-de-neve". Foram realizadas entrevistas utilizando perguntas abertas e fechadas sobre questões sociodemográficas, práticas sexuais, uso de drogas, conhecimento sobre o HIV e a Aids, contato prévio com programas de prevenção à Aids em Santos, percepção de sua vulnerabilidade ao HIV e à Aids. Foi realizada análise descritiva da amostra, e apresentados relatos para ilustrar algumas situações de vulnerabilidade. RESULTADOS: Do total de 279 caminhoneiros entrevistados, 93% declararam ter parceira fixa, 40% referiram manter relações sexuais com parceiras casuais, e 19% referiram manter relações sexuais com parceiras freqüentes. A principal situação de vulnerabilidade ao HIV ocorre devido ao uso inconsistente do preservativo, interligado ao vínculo estabelecido com cada parceira. O tempo fora de casa parece não ser o principal fator para situações de vulnerabilidade, conforme demonstram estudos com caminhoneiros de rota longa. CONCLUSÕES: A cultura "machista" e os papéis tradicionais masculinos são emblemáticos entre os caminhoneiros de rota curta. Certamente é necessário investir mais na prevenção nessa categoria profissional. A prevenção em locais de trabalho parece promissora, pois permite entender melhor seu universo, propiciando intervenções educativas adequadas a essa categoria profissional.

  2. Do corpo histérico ao "corpus" teórico

    Directory of Open Access Journals (Sweden)

    Francisco Ramos de Farias

    1992-09-01

    Full Text Available Este estudo aborda a maneira pela qual Freud, de forma original, efetuou uma leitura no corpo-sintoma da histérica e construiu uma clínica inédita destinada ao tratamento das neuroses. Esta clínica, fundada na transferência, é suportada pelo edifício teórico que tem o inconsciente e a sexualidade como paradigmas.

  3. Diversity and spatial heterogeneity of mangrove associated sponges of Curaçao and Aruba

    OpenAIRE

    Hunting, E.R.; van Soest, R.W.M.; Van der Geest, H. G.; Vos, A; Debrot, A.O.

    2008-01-01

    Sponges are major epibionts of mangrove roots in the Caribbean. Mangrove sponge communities in the Caribbean mainly consist of species that are typical to this habitat and community compositions often differ from those found on coral reefs nearby. Heterogeneity in species distributions between locations and within locations between roots is often reported. This study quantifi es the diversity and abundance of mangrove associated sponges in the inner bays of Curaçao and Aruba and correlates va...

  4. Análise de fatores associados ao significado do trabalho

    Directory of Open Access Journals (Sweden)

    Sergio Hideo Kubo

    2012-12-01

    Full Text Available O trabalho tem sido visto não somente como forma de obter a renda, mas também como atividade que proporciona realização pessoal, status social e possibilidade de estabelecer e manter contatos interpessoais, entre outros. Nesta pesquisa, teve-se como objetivo investigar os fatores que influenciam e conferem sentido ao trabalho, como centralidade do trabalho, normas da sociedade e objetivos e resultados valorizados. Na centralidade do trabalho, procurou-se investigar o grau de importância do trabalho dentro do contexto das diversas áreas da vida das pessoas, como família, lazer, religião e vida comunitária. Em normas da sociedade, foram analisados os pontos mais significativos no tocante ao que a sociedade deveria proporcionar ao indivíduo, assim como o que o indivíduo deveria fazer em prol da sociedade. Nos objetivos e resultados valorizados, foi pesquisado o que as pessoas buscam com o trabalho. A partir da pesquisa na literatura, foi elaborado um modelo inicial que, não se mostrando satisfatório segundo critérios estatísticos, foi substituído por outro que apresentou significância estatística e boa aderência aos dados. O modelo escolhido foi o que melhor goodness-of-fit apresentou, quando se utilizou modelagem de equações estruturais pelo método partial least square. O estudo revelou que o significado do trabalho se reflete, na ordem, na centralidade do trabalho, nos objetivos e resultados valorizados e, por último, nas normas sociais.

  5. Perícia contábil: uma ferramenta de combate ao crime organizado

    Directory of Open Access Journals (Sweden)

    IDALBERTO JOSÉ DAS NEVES JÚNIOR

    2011-11-01

    Full Text Available No Brasil e no mundo, devido principalmente à ausência do Estado no cumprimento do seu papel de garantidor da lei e da ordem, as organizações criminosas cresceram significativamente, e as suas ações passaram a ocorrer de formas planejadas e estratégicas. Para combatê-las e reprimi-las, a Perícia Contábil, materializada nos laudos periciais elaborados pelos peritos criminalistas, surge como importante ferramenta de Inteligência. Nesse contexto, o objetivo desta pesquisa foi identificar a relevância da Perícia Contábil como meio de prova para a solução de controvérsias relativas ao crime organizado. Para tanto, houve a realização de pesquisa de campo por meio de questionário aplicado aos Delegados, Escrivães e Agentes de Polícia das divisões da Diretoria de Combate ao Crime organizado – DCOR do Departamento de Polícia Federal. Também, houve a utilização de técnicas de estatística multivariada de análise de cluster para o estudo dos registros (K-Means clusters do software SPSS, que resultou na formação de dois agrupamentos. Considerando a pesquisa de campo e o referencial teórico, verificou-se que a Perícia Contábil, no limite de suas atribuições, é um relevante meio de prova para a solução de controvérsias relativas ao crime organizado.

  6. Avaliação da sensibilidade da goiabeira 'Pedro Sato' ao ozônio

    Directory of Open Access Journals (Sweden)

    Regina Maria de Moraes

    2011-09-01

    Full Text Available O objetivo deste trabalho foi avaliar a sensibilidade da goiabeira 'Pedro Sato' ao ozônio (O3, em comparação à cultivar Paluma, descrita como sensível. Oito plantas de cada cultivar foram submetidas separadamente a ar filtrado e a ar filtrado + O3, cinco horas por dia, durante quatro dias. Foram avaliadas fotossíntese (Asat, injúrias foliares visíveis e concentração de antocianinas e taninos. Plantas das duas cultivares também foram expostas, durante três meses, a condições ambientais em local contaminado por O3, tendo-se avaliado fotossíntese, injúrias foliares e crescimento. Plantas fumigadas com O3 apresentaram redução de Asat e da atividade fotoquímica, além de manifestação de injúrias foliares. 'Paluma' apresentou maior redução de Asat, injúrias foliares mais severas e redução de taninos. Quando exposta ao ambiente contaminado, 'Paluma' apresentou trocas gasosas mais altas, mas apresentou redução de Asat 30 dias antes que 'Pedro Sato'. O crescimento não foi afetado em 'Pedro Sato', cujas injúrias foliares tiveram menor incidência, severidade e precocidade do que em 'Paluma'. A menor taxa de crescimento de 'Paluma' indica maior sensibilidade ao O3. Apesar de responder com menor intensidade ao estresse induzido pelo O3, a cultivar Pedro Sato não pode ser considerada tolerante, pois apresenta danos fotoquímicos, injúrias foliares e alterações nos conteúdos de metabólitos secundários quando exposta a esse poluente.

  7. Potencial de fertilizantes e corretivos no aporte de micronutrientes ao solo

    OpenAIRE

    Vinícius Gedeão Bezerra de Carvalho; Clístenes Williams Araújo do Nascimento; Caroline Miranda Biondi

    2012-01-01

    Fertilizantes e corretivos, ao serem aplicados nos solos, fornecem micronutrientes como impurezas residuais da sua fabricação, os quais podem ser importantes fontes para as culturas. Em decorrência disso, o objetivo deste trabalho foi quantificar os teores dos micronutrientes Zn, Cu, Fe, Mn e Ni em fertilizantes e corretivos comercializados no Nordeste brasileiro, visando avaliar o potencial desses insumos no fornecimento indireto de micronutrientes às culturas agrícolas. Os insumos analisado...

  8. Do valor intrínseco e de sua aplicabilidade ao meio ambiente

    Directory of Open Access Journals (Sweden)

    Tânia Ap. Kuhnen

    2004-01-01

    Full Text Available O tema deste estudo é a teoria do valor sagrado da vida e sua aplicabilidade às questões de ética prática, mais especificamente ao meio ambiente. O objetivo geral consiste em apontar os limites da concepção de Dworkin sobre a teoria do sagrado, quando aplicada ao meio ambiente, e a solução que Singer oferece para a atribuição de valor ao mesmo. Justifica-se esse trabalho em decorrência da importância de se discutir, a partir da análise dessas teorias filosóficas, questões vinculadas ao estabelecimento de um princípio ético que, além de englobar, no campo da ação moral, todos os seres sencientes, envolva também o meio ambiente como um todo. Além disso, o tema que aqui se desenvolve é uma contribuição do raciocínio filosófico-teórico para a discussão de problemas relevantes no campo da ética prática. Esse estudo ainda se justifica por abordar a questão da linha moral divisória entre os seres que são ou não incluídos na comunidade moral, o que representa outro problema que concerne à ética. As diferentes formas de classificação não foram capazes de incluir todos os seres vivos no âmbito da comunidade moral. Há sempre exclusões, as quais tendem a diminuir com o surgimento de teorias éticas inovadoras, dentre elas as que serão abordadas a seguir.

  9. Clinical use of AO three-dimensionally preformed titanium mesh plates for orbital fractures

    Directory of Open Access Journals (Sweden)

    Ming Chen

    2015-01-01

    Full Text Available AIM:To evaluate the accuracy and practicability of three-dimensionally preformed Arbeitsgemeinschaft Osteosynthese AO titanium mesh plates for orbital fractures.METHODS:Forty-seven patients with isolated blow-out orbital fractures were included in this study. Fracture locations were as follows: floor/medial wall(n=26, 55%, medial wall(n=12, 26%, and floor(n=9, 19%. The floor fractures were exposed by a standard transconjunctival approach, whereas a combined transcaruncular transconjunctival approach was used in patients with medial wall fractures with temporary dissection of inferior oblique muscle. A three-dimensionally preformed AO titanium mesh plate was selected according to the size of the defect previously measured on the preoperative computed tomographic scan examination and fixed at the inferior orbital rim with 2 screws. The accuracy of plate positioning of the reconstructed orbit was assessed on the postoperative computed tomography(CTscan. The practicability of clinical use of AO three-dimensionally preformed titanium mesh plates was assessed on the preoperative and postoperative clinical data.RESULTS: Postoperative orbital CT scan showed an anatomic three-dimensional placement of the orbital mesh plates in all of the patients. All patients had a successful treatment outcome without clinical complications. 40 patients(87%had a successful enophthalmos correction. 25 patients(86%had a successful recovery from diplopia.CONCLUSION: Three-dimensionally preformed AO titanium mesh plates for orbital fracture reconstruction results in an accurate anatomic restoration of the bony orbital contour with a high rate of success to correctenophthalmos and diplopia.

  10. Software interativo: ecocardiografia na avaliaçao da hipertensao arterial

    Directory of Open Access Journals (Sweden)

    Fábio Abdalla Segamarchi

    Full Text Available A hipertensao arterial é uma doença muito prevalente, evoluindo com lesoes em órgaos-alvo, alta morbidade e mortalidade. A avaliaçao das repercussoes cardíacas pela ecocardiografia tem papel importante na conduçao clínica dos indivíduos hipertensos, e suas imagens podem ser utilizadas como ferramenta para o ensino. OBJETIVOS: Desenvolver e avaliar um software, construído com base em imagens ecocardiográficas, abordando de forma ilustrativa e interativa a estrutura e funçao cardíacas normais,bem como as alteraçoes induzidas pela hipertensao arterial. MÉTODOS: Foram selecionadas imagens ecocardiográficas de indivíduos normais e com comprometimento cardíaco determinado pela hipertensao (hipertrofia ventricular esquerda, miocardiopatia dilatada e infarto do miocárdio. Com estas imagens foi construído um software no programa multimídia Flash, que foi avaliado por estudantes de Medicina (n=38 e Enfermagem (n=18, também submetidos a pré- e pós-teste. RESULTADOS: Os alunos consideraram o software útil, atraente e adequado as atuais metodologias educacionais proativas,promovendo ganho de conhecimento na compreensao do comprometimento cardíaco na hipertensao arterial. Conclusao: O software foi bem avaliado e considerado útil na aquisiçao de conhecimento numa área específica mais prevalente do comprometimento da saúde do adulto.

  11. Fatores associados ao sedentarismo no lazer em idosos, Campinas, São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Maria Paula do Amaral Zaitune

    2007-06-01

    Full Text Available O objetivo deste estudo foi conhecer a prevalência de sedentários no lazer (que referem não praticar nenhum exercício físico no lazer ao menos uma vez por semana em idosos de Campinas, São Paulo, Brasil, segundo fatores demográficos e sócio-econômicos, outros comportamentos relacionados à saúde e à presença de morbidades. Trata-se de um estudo transversal, de base populacional, com amostragem em múltiplos estágios. A análise dos dados levou em conta o desenho amostral. A prevalência de sedentários foi 70,9%, sendo que as razões de prevalências foram significativamente maiores que um para os idosos de menor renda (1,31: 1,11-1,55, tabagistas (1,39: 1,23-1,57, com transtorno mental comum (1,20: 1,04-1,39 e do sexo feminino (1,16: 1,00-1,35. A prevalência de caminhada foi 23,5%, seguida por ginástica ou musculação (3,8% e por natação ou hidroginástica (3,6%. Os resultados apontam para a necessidade do desenvolvimento de ações globais com respeito aos comportamentos relacionados à saúde. Atenção especial deve ser dada aos idosos do sexo feminino, àqueles com transtorno mental comum e aos de menor nível sócio-econômico a fim de garantir eqüidade em relação às práticas de promoção da saúde.

  12. Factors associated with bullying at nurses' workplaces Factores asociados al acoso moral en el ambiente laboral del enfermero Fatores associados ao assédio moral no ambiente laboral do enfermeiro

    Directory of Open Access Journals (Sweden)

    Kátia Biagio Fontes

    2013-06-01

    embargo, la investigación con base en muestras de enfermeros brasileños representa solamente el primer paso para evaluar otros factores condicionantes relacionados al contexto organizacional. OBJETIVO: identificar enfermeiros vítimas de assédio moral no trabalho e fatores associados. MÉTODO: estudo descritivo-exploratório, de abordagem quantitativa. A amostra foi composta por 199 enfermeiros, pertencentes ao setor público e privado (n=388. Para a coleta de dados utilizaram-se um questionário socioprofissiográfico e o Leymann Inventory Psychological Terrorization, ambos em formato impresso ou eletrônico (maio/setembro de 2010. RESULTADOS: de acordo com os dados obtidos, 11,56% dos sujeitos estudados foram vítimas de assédio moral. Análise multivariada apontou que possuir filhos, atuar nas unidades de saúde pública, trabalhar na instituição por período de 1 a 3 anos, enfrentar atualmente condutas de assédio moral e sentir-se assediado moralmente são fatores de risco para o assédio moral. CONCLUSÃO: o estudo possibilitou melhor compreensão dos fatores associados ao assédio moral, contudo, a investigação com base em amostras de enfermeiros brasileiros é apenas o primeiro passo na avaliação de outros fatores condicionantes, relacionados ao contexto organizacional.

  13. Economic burden of expected epidemiological changes in diseases related to tobacco, Mexico Impacto econômico das mudanças epidemiológicas esperadas nas doenças associadas ao tabaco, México

    Directory of Open Access Journals (Sweden)

    Armando Arredondo

    2007-08-01

    Full Text Available OBJECTIVE: To determine health care costs and economic burden of epidemiological changes in diseases related to tobacco consumption. METHODS: A time-series analysis in Mexico (1994-2005 was carried out on seven health interventions: chronic obstructive pulmonary diseases, lung cancer with and without surgical intervention, asthma in smokers and non-smokers, full treatment course with nicotine gum, and full treatment course with nicotine patch. According with Box-Jenkins methodology, probabilistic models were developed to forecast the expected changes in the epidemiologic profile and the expected changes in health care services required for selected interventions. Health care costs were estimated following the instrumentation methods and validated with consensus technique. RESULTS: A comparison of the economic impact in 2006 vs. 2008 showed 20-90% increase in expected cases depending on the disease (pOBJETIVO: Avaliar os custos da atenção médica a doenças associadas ao tabagismo e o impacto econômico das mudanças epidemiológicas. MÉTODOS: Análise de série temporal no México (1994-2005 de sete intervenções médicas em relação a: doença pulmonar obstrutiva crônica, câncer de pulmão com e sem intervenção cirúrgica, asma bronquial em fumantes e não-fumantes, tratamento com adesivos para deixar de fumar, tratamento com goma de mascar. As mudanças epidemiológicas esperadas e as necessidades financeiras para atender a demanda de serviços foram avaliadas pelos modelos probabilísticos de Box-Jenkins. Os custos foram determinados de acordo com método de instrumentação e a técnica de consenso. RESULTADOS: A comparação do impacto das mudanças epidemiológicas previstas para 2006 e 2008 mostrou incremento de 20% a 90%, dependendo do tipo de intervenção. O incremento nos custos da atenção médica foi de 25% a 93%. Há indícios que a demanda de serviços de saúde para as intervenções investigadas continuarão aumentando

  14. Estudo das indicações de partos cesáreas entre hospitais de atendimento ao Sistema Único de Saúde: baixo e alto riscos

    Directory of Open Access Journals (Sweden)

    Caroline Rosa Pellicciari

    2015-10-01

    Full Text Available A alta incidência de partos cesáreas  sem indicações precisas é motivo de preocupação mundial.  As cesáreas sem indicações médicas estão associadas a maiores riscos maternos e fetais. De acordo com a Organização Mundial da Saúde (OMS não há justificativa, para qualquer região do mundo possuir  taxas de partos cesáreas maiores do que 10-15%.  Este projeto investigou  os fatores indicativos para a  realização de partos cesáreas  entre hospitais da rede SUS em Sorocaba-SP: Hospital Santa Lucinda – HSL (baixo risco e Conjunto Hospitalar de Sorocaba – CHS (alto risco. Durante o período de 03/2014 a 03/2015 foi realizada análise retrospectiva de 300 prontuários das pacientes internadas nestes hospitais. Analisou-se parâmetros maternos sócio-epidemiológicos, reprodutivos, clínicos e  indicações dos partos cesáreas.  No CHS prevaleceu o tipo de parto cesárea (56,3%, enquanto no HSL a porcentagem do parto cesárea foi 32,4% (p<0,001.  Em relação ao tipo de parto anterior, o número de pacientes com cesárea anterior prevalece no HSL: 77% (n=83 em comparação com o CHS: 56,4% (n=62, (p=0,0009.   Em relação às indicações de cesárea, as mais prevalentes no HSL foram: sofrimento fetal agudo: 24% (n=36, falha na indução ao parto: 22% (n=33 e desproporção céfalo-pélvica: 18,7% (n=28. No CHS  as maiores proporções foram: sofrimento fetal agudo: 35,3% (n=53  e iteratividade: 25,3% (n=38 (p<0,0001.  A observação dos resultados demonstra a realização de partos cesáreas em porcentagens superiores àquelas preconizadas pela OMS. Sua redução poderá ser conseguida preparando-se e conscientizando-se melhor a mulher perante a futura parturição, com procedimentos precisos de indução ao parto, utilizando a aplicação de procedimentos analgésicos, e, ainda com a devida prática da extração baixa pelo fórcipe de alívio às parturientes.

  15. Optimal control strategy to reduce the temporal wavefront error in AO systems

    Science.gov (United States)

    Doelman, Niek J.; Hinnen, Karel J. G.; Stoffelen, Freek J. G.; Verhaegen, Michel H.

    2004-10-01

    An Adaptive Optics (AO) system for astronomy is analysed from a control point of view. The focus is put on the temporal error. The AO controller is identified as a feedback regulator system, operating in closed-loop with the aim of rejecting wavefront disturbances. Limitations on the performance of feedback regulator systems are discussed. The concept of optimal control is proposed to minimise the temporal error. The issue of closed-loop feedback controller design is made transparent by using the principle of Internal Model Control. The central issue in reducing the temporal wavefront is the design of a feedforward prediction filter. In three separate tests - a numerical simulation example, measured data from an AO test bench and open-loop telescope data - the advantage of optimal control over the common approach of integral control is demonstrated. Optimal control of the temporal error yields a smaller temporal error, enables a longer integration time in the wavefront sensor, or the use of fainter natural guide stars.

  16. Do modernismo ao alívio pós-moderno

    Directory of Open Access Journals (Sweden)

    Simone Regina Dias

    2003-06-01

    Full Text Available Ao traçar um mapeamento dos elementos fundantes da grande crise mundial que se instaurou desde 1789, no livro Crítica e crise, Reinhart Koselleck sustenta: Pertence à natureza da crise que uma decisão esteja pendente mas ainda não tenha sido tomada. Também reside em sua natureza que a decisão a ser tomada permaneça em aberto. Portanto, a insegurança geral de uma situação crítica é atravessada pela certeza de que, sem que se saiba ao certo quando ou como, o fim do estado crítico se aproxima. A solução possível permanece incerta, mas o próprio fim, a transformação das circunstâncias vigentes — ameaçadora, temida ou desejada —, é certo. A crise invoca a pergunta ao futuro histórico. As constatações de Koselleck apontam para o reconhecimento de um estado de crise permanente do mundo. Isto é, um olhar focado em determinado momento da história poderia extrair, em tempos diversos, um quadro em que se detecta a crise, um estado de incertezas.

  17. Reconhecimento dos aspectos tacêsicos para o cuidado afetivo e de qualidade ao idoso hospitalizado

    Directory of Open Access Journals (Sweden)

    Teresa Cristina Gioia Schimidt

    2013-04-01

    Full Text Available Verificar os aspectos tacêsicos importantes para serem observados ao tocar o idoso. Estudo de campo, qualitativo e exploratório desenvolvido com 117 graduandos e profissionais de saúde participantes da capacitação em comunicação não verbal em gerontologia. Os resultados revelam que a maioria conseguiu identificar, pelo menos, um fator de atenção que precisa ser respeitado ao tocar o idoso. Os discursos permitiram a construção de nove categorias apontando condições necessárias ao cuidado afetivo e de qualidade prestado no âmbito da tacêsica; quais sejam: autorização para que o toque ocorra; localização do toque; intensidade do toque; condição do idoso; intencionalidade e tipo de toque; duração do toque; sexo e idade de quem toca e quem é tocado; frequência do toque e características das mãos que tocam. O tocar faz parte do cotidiano dos profissionais da saúde e expressa zelo e sentimentos consequentemente, revela a qualidade da assistência prestada.

  18. Dificuldades vividas por pessoas trans no acesso ao Sistema Único de Saúde

    Directory of Open Access Journals (Sweden)

    Pablo Cardozo Rocon

    Full Text Available Resumo Objetivou-se discutir as dificuldades de pessoas trans moradoras da região metropolitana da Grande Vitória/ES em acessarem os serviços de saúde no SUS. Utilizou-se uma abordagem qualitativa por meio de entrevistas semiestruturadas com 15 pessoas trans. Os resultados apontaram o desrespeito ao nome social, a discriminação e o diagnóstico no processo transexualizador como principais limitações no acesso ao sistema de saúde. Afirma-se que o diagnóstico contribui para ocultar a responsabilidade da heteronormatividade e do binarismo de gênero pela marginalização social das pessoas trans. Conclui-se que é necessário modificar o diagnóstico em sua função, já que a existência de uma patologia prévia não é requisito para acessar o SUS. Aponta-se, também, a importância de elaborar programas de educação e campanhas permanentes sobre o direito de acesso ao sistema de saúde livre de discriminação e com uso do nome social.

  19. Simulated Guide Stars: Adapting the Robo-AO Telescope Simulator to UH 88”

    Science.gov (United States)

    Ashcraft, Jaren; Baranec, Christoph

    2018-01-01

    Robo-AO is an autonomous adaptive optics system that is in development for the UH 88” Telescope on the Mauna Kea Observatory. This system is capable of achieving near diffraction limited imaging for astronomical telescopes, and has seen successful deployment and use at the Palomar and Kitt Peak Observatories previously. A key component of this system, the telescope simulator, will be adapted from the Palomar Observatory design to fit the UH 88” Telescope. The telescope simulator will simulate the exit pupil of the UH 88” telescope so that the greater Robo-AO system can be calibrated before observing runs. The system was designed in Code V, and then further improved upon in Zemax for later development. Alternate design forms were explored for the potential of adapting the telescope simulator to the NASA Infrared Telescope Facility, where simulating the exit pupil of the telescope proved to be more problematic. A proposed design composed of solely catalog optics was successfully produced for both telescopes, and they await assembly as time comes to construct the new Robo-AO system.

  20. Currículo universitário: do México ao Brasil neoliberais

    Directory of Open Access Journals (Sweden)

    Dostoiewski Mariatt de Oliveira Champangnatte

    2016-03-01

    Full Text Available Resumo O objetivo deste estudo foi discutir e comparar percepções e ações curriculares de professores universitários mexicanos e brasileiros. Contextualizando as realidades socioeconômicas dos dois países e, principalmente, as políticas governamentais voltadas ao ensino superior, observa-se, nas várias falas dos professores, uma abordagem simplista de currículo, significando-o apenas como preocupações de conteúdos administrados em disciplinas e planos de ensino. Aspectos da realidade social, política e econômica são desatrelados do pensamento e prática curriculares, onde o maior objetivo se tornou a adequação ao mercado de trabalho. Nota-se, direta e indiretamente, influências do pensamento e práticas neoliberais no posicionamento desses professores tanto quanto ao currículo como com a própria funcionalidade do ensino superior, refletindo e reproduzindo, em seus discursos e práticas, as políticas governamentais neoliberais vigentes.

  1. Improvement of small incision transscleral sulcus fixation of Akreos Adapt AO foldable intraocular lens

    Directory of Open Access Journals (Sweden)

    Tao He

    2015-12-01

    Full Text Available AIM:to observe the effect of modified surgery of small incision transscleral sulcus fixation of Akreos Adapt AO foldable intraocular lens.METHODS:The study included 37 patients(37 eyeswho could not be performed the regular implantation of posterior chamber intraocular lens for the rupture of posterior capsule or for the zonular dialysis caused by trauma, congenital or surgery. Bausch & lomb Akreos Adapt AO fordable intraocular lens, VE22000 implantation device were applied in this study. Regular 2.4mm transparent cornea incision and pocket-like sclera incision were made. The intraocular lens were transscleral sulcus fixed by 10/0 prolene suture and the suture was buried within the scleral incision.RESULTS:The intraocular lenses were all well posited and the postoperative visual acuity(VAwas improved in all patients. Three eyes(8%were≥0.8 while 18 eyes(49%>0.4~≤0.6 and the remaining 16(43%were ≤ 0.4 at 3mo after surgery.Cornea astigmatism was 1.73D±1.22D and 1.62±1.34D before and after surgery, no statistic significance was observed(PCONCLUSION:The modified surgery of 2.4mm small incision transscleral sulcus fixation of Akreos Adapt AO foldable intraocular lens has the following advantages such as:good visual results, less postoperative astigmatism, small surgery incision, steady intraocular lens, less manipulation, less complication and more effective.

  2. Atendimento domiciliar ao idoso: problema ou solução?

    Directory of Open Access Journals (Sweden)

    Ciro Augusto Floriani

    Full Text Available O atendimento domiciliar ao idoso tem se tornado um importante instrumento de assistência nos últimos anos, tanto nos países desenvolvidos quanto nos países em desenvolvimento. Vários aspectos éticos, sociais e operacionais têm sido negligenciados e a literatura nacional é escassa em relação a esta temática. A partir de revisão bibliográfica em atendimento domiciliar, este artigo enfoca, do ponto de vista bioético, os potenciais problemas advindos com a implantação dessa crescente e importante modalidade de atendimento. Conclui ser necessário um maior direcionamento ético na implantação do atendimento domiciliar, com políticas de proteção ao paciente, à família e ao cuidador, visando a aperfeiçoar a qualidade dos programas oferecidos.

  3. Escala de atitudes face ao lazer em adolescentes e jovens adultos

    Directory of Open Access Journals (Sweden)

    Teresa Freire

    2007-04-01

    Full Text Available Atualmente, o lazer e as atitudes face ao lazer têm sido alvo de interesse na investigação psicológica, concretamente no domínio da Psicologia Social. O objetivo do presente estudo foi adaptar a escala Leisure Attitude Scale de Raghb e Beard, construída para avaliar as atitudes face ao lazer em função das três componentes de atitude (cognitiva, afetiva e comportamental para a população de estudantes, adolescentes e jovens adultos portugueses. Participaram no estudo 462 sujeitos (57,8% do sexo feminino e 42,2% do sexo masculino, com uma média de idades de 19,97 (desvio padrão de 4,85. Os resultados obtidos confirmam a estrutura e as características psicométricas da versão original, refletindo valores largamente aceitáveis de fidelidade (consistência interna e validade (validade de conteúdo quer para a escala total quer para as várias sub-escalas (cognitiva, afetiva e comportamental. Conclui-se pela adequação da escala na medida das atitudes face ao lazer, no contexto português.

  4. Physical Growth and Nutritional Status among Ao Naga Children of Nagaland, Northeast India

    Directory of Open Access Journals (Sweden)

    Temsumongla Longkumer

    2013-01-01

    Full Text Available The present study was carried out on 571 Ao Naga children including 289 boys and 282 girls aged 8 to 15 years from Mokokchung town, Nagaland. This study tried to find out the physical growth according to the height and weight and nutritional status according to the body mass index (BMI following the classification by Cole et al. Our study revealed that the girls were taller than boys till 13 years and the boys became taller thereafter. As for weight, the girls were heavier during 10 to 14 years. The mean height and weight increased as the age advanced in both boys and girls. The prevalence of underweight was 30.12% and the prevalence of overweight was 2.28% among the Ao Naga children, and the girls were found to have a higher prevalence of overweight and the boys had a higher prevalence of underweight. This revealed that both underweight and overweight coexisted among the Ao Naga children from Mokokchung town, although the prevalence of overweight was not high.

  5. Desempenho escolar da criança vitimizada encaminhada ao fórum judicial

    Directory of Open Access Journals (Sweden)

    Paulo Celso Pereira

    Full Text Available O objetivo do estudo foi caracterizar o desempenho escolar da criança vítima de violência doméstica atendida no Fórum Judicial. Participaram do estudo 20 crianças vitimizadas comparadas com seus pares da mesma sala de aula, mesmo sexo e mesma faixa etária, mas sem histórico de violência doméstica, suas respectivas mães e professoras. As crianças responderam ao Teste de Desempenho Escolar, Inventário de Estilos Parentais e ao Teste de Raven (Escala Especial e apresentaram o caderno escolar. As mães responderam a uma entrevista e a Escala de Táticas de Conflitos Revisada (CTS-2. As professoras apresentaram sua opinião sobre o desempenho acadêmico dos participantes. Os dados obtidos mostraram que a criança vitimizada tem desempenho escolar inferior ao grupo controle. Os resultados da CTS-2 indicaram que a maioria das crianças vitimizadas estava exposta à violência conjugal. O estudo mostrou que, além da violência doméstica direta e indireta, tais crianças estavam expostas a outros fatores de risco, tais como, pobreza, baixa escolaridade materna e uso de álcool e/ou droga por familiares.

  6. Reconhecimento dos aspectos tacêsicos para o cuidado afetivo e de qualidade ao idoso hospitalizado

    Directory of Open Access Journals (Sweden)

    Teresa Cristina Gioia Schimidt

    Full Text Available Verificar os aspectos tacêsicos importantes para serem observados ao tocar o idoso. Estudo de campo, qualitativo e exploratório desenvolvido com 117 graduandos e profissionais de saúde participantes da capacitação em comunicação não verbal em gerontologia. Os resultados revelam que a maioria conseguiu identificar, pelo menos, um fator de atenção que precisa ser respeitado ao tocar o idoso. Os discursos permitiram a construção de nove categorias apontando condições necessárias ao cuidado afetivo e de qualidade prestado no âmbito da tacêsica; quais sejam: autorização para que o toque ocorra; localização do toque; intensidade do toque; condição do idoso; intencionalidade e tipo de toque; duração do toque; sexo e idade de quem toca e quem é tocado; frequência do toque e características das mãos que tocam. O tocar faz parte do cotidiano dos profissionais da saúde e expressa zelo e sentimentos consequentemente, revela a qualidade da assistência prestada.

  7. O ser-coronariopata: entree o viver autêntico e as amarras ao cotidiano

    Directory of Open Access Journals (Sweden)

    Lucia de Fatima da Silva

    Full Text Available Estudo fenomenológico, cujo objeto é o sentido atribuído pelos coronariopatas às suas experiências vivenciadas. Das entrevistas foram extraídas as significações: temer a morte e o retorno dos sintomas agudos; perceber a transformação na vida social, profissional e sexual; sentir-se vigiado; conformar-se com a nova condição e sentir tristeza e inconformação. Estas significações subsidiaram a análise compreensiva a qual, respaldada na obra Ser e tempo de Martin Heidegger, permitiu captar o sentido nelas velado. Os coronariopatas desvelaram-se existentes inautênticos ao temerem "algo", prenderem-se à tagarelice e ao vigor de ter sido. Ainda, transcendem ao existir autêntico quando angustiam-se, assumindo a coronariopatia como possibilidade de ser-no-mundo; embora fracassem nesta tarefa e voltem às amarras do cotidiano. O estudo reflete a necessidade de privilegiar a dimensão existencial na assistência à saúde e na formação dos profissionais, além da compreensão do outro como esteio para o cuidar.

  8. Profilaxia das úlceras associadas ao estresse Prophylaxis of ulcers associated with stress

    Directory of Open Access Journals (Sweden)

    Carlos Eduardo Pompilio

    2010-06-01

    Full Text Available INTRODUÇÃO: As úlceras da mucosa gastroduodenal que aparecem após graves insultos têm sido chamadas de úlceras associadas ao estresse ou, mais genericamente, de "doença mucosa associada ao estresse" (DMAE. São conhecidas desde a Antiguidade e apesar de relacionarem-se com altos índices de morbidade e mortalidade, esquemas de profilaxia no intuito de minimizar seus riscos, só foram introduzidos recentemente. Os inibidores da bomba de prótons têm desempenhado papel importante nesse cenário. MÉTODOS: O presente artigo é uma breve revisão sobre seu uso dentro do contexto clínico da profilaxia do sangramento gastrointestinal relacionado ao estresse.INTRODUCTION: Gastroduodenal mucosal ulcers that appear after severe insults have been called ulcers associated with stress or, more generally, "mucosal disease associated with stress" (DMAE. Are known since antiquity and although linked with high morbidity and mortality, prevention schemes in order to minimize their risk, were introduced only recently. The proton pump inhibitors have played an important role in this scenario. METHODS: This article is a brief review of its use within the clinical context of prophylaxis of gastrointestinal bleeding due to stress.

  9. Ausência de expectativa de suporte para o cuidado aos idosos da comunidade

    Directory of Open Access Journals (Sweden)

    Déborah Cristina de Oliveira

    2016-06-01

    Full Text Available RESUMO Objetivo: identificar fatores associados à ausência de expectativa de suporte para o cuidado aos idosos da comunidade. Método: foram utilizados parte dos dados do estudo multicêntrico "Fragilidade em Idosos Brasileiros", pesquisa quantitativa, epidemiológica e transversal desenvolvida no período de 2008 a 2009. Foram realizadas análises de comparação e regressão dos dados de 671 idosos. Resultados: a avaliação da expectativa de suporte para o cuidado aos idosos mostrou-se um bom indicador de risco para ausência de expectativa de suporte em mulheres, idosos que residiam sozinhos e com percepção ruim da própria saúde. Conclusão: conclui-se que é preciso refletir sobre o sistema de suporte oferecido aos idosos no Brasil, visto que o perfil destes que estão em risco é cada vez maior na população. Ressalta-se também a importância da inserção de métodos subjetivos para avaliação da percepção dos idosos sobre suporte para o cuidado.

  10. O DUALISMO DO SER ÓRFICO NA EPÍSTOLA DE PAULO AOS ROMANOS

    Directory of Open Access Journals (Sweden)

    Roger Ribeiro da Silva

    2010-01-01

    Full Text Available Este trabalho consiste na comparação de fragmentos de textos encontrados na obra de Platão e na Epístola aos Romanos atribuída à Paulo. Retirados de inúmeros textos atribuídos a Platão, estes fragmentos tiveram confirmados indícios da teologia órfica pelo professor Alberto Bernabé Pajares. E ao aplicar a Metodologia de Analise do Discurso Teológico, desenvolvido especificamente para este trabalho, e comparado os resultados individuais, encontramos pontos de encontro entre as duas teologias, a Órfica e a Paulina, acentuando o que tange a crença no Dualismo do Ser. A problemática levantada neste trabalho se refere a como a representação1 da alma unida ao corpo, encontrada em escritos paulinistas, apresenta indícios de contatos com fundamentos órficos no berço do cristianismo.

  11. O enfermeiro frente ao desmame precoce na consulta de enfermagem à criança

    Directory of Open Access Journals (Sweden)

    Caroline Aparecida Coutinho Monteschio

    2015-10-01

    Full Text Available RESUMOObjetivo:analisar a atuação do enfermeiro frente ao desmame precoce em crianças menores de 6 meses de idade.Método:estudo descritivo de abordagem qualitativa. Participaram do estudo enfermeiros que realizavam consulta de enfermagem à criança de maneira programática em unidades de saúde da família em Cuiabá-MT. Os dados foram coletados nos meses de janeiro e fevereiro de 2012, por meio da observação participante da consulta de enfermagem. Para análise dos dados foi utilizada a análise de conteúdo.Resultados:os enfermeiros, na maioria das vezes, utilizaram estratégias apropriadas para o manejo dos problemas mais comuns na amamentação, apesar de algumas condutas não terem, ainda, evidência científica comprovada, quanto aos benefícios e/ou prejuízos à sua prática.Conclusão:os enfermeiros abordaram aspectos importantes do aleitamento materno durante as consultas e trabalharam em prol da promoção e do resgate ao aleitamento materno exclusivo.

  12. Diabetes Mellitus: desafios relacionados ao autocuidado abordados em Grupo de Apoio Psicológico

    Directory of Open Access Journals (Sweden)

    Nunila Ferreira de Oliveira

    2011-04-01

    Full Text Available O objetivo foi identificar os sentimentos dos usuários associados ao diagnóstico do Diabetes Mellitus (DM, as dificuldades inerentes ao controle glicêmico e estratégias de enfrentamento adotadas diante das demandas impostas pela doença. Estudo qualitativo realizado com grupo de pessoas acompanhadas por equipe multiprofissional de um centro de pesquisa e extensão universitária de Ribeirão Preto, SP, Brasil. Quatro sessões grupais que constituíram o corpus da pesquisa, foram audiogravadas e transcritas. A análise temática originou as categorias: sentimentos despertados a partir do diagnóstico do DM; dificuldades no controle da doença e estratégias de enfrentamento. Os resultados evidenciaram diferentes modos de lidar com os desafios suscitados pela doença no cotidiano, que influenciam diretamente na adesão ao tratamento e constituem elementos relevantes para o planejamento de intervenções mais efetivas.

  13. Prevenção de acidentes: o reconhecimento das estratégias operatórias dos motociclistas profissionais como base para a negociação de acordo coletivo Accident prevention: recognition of motorcycle couriers’ work strategies as the basis for collective bargaining

    Directory of Open Access Journals (Sweden)

    Eugênio Paceli Hatem Diniz

    2005-12-01

    Full Text Available O objetivo deste artigo é apresentar como o estudo das estratégias operatórias contribui para elaborar medidas de prevenção dos acidentes sofridos pelos motociclistas profissionais, conhecidos popularmente como "motoboys". Os autores apresentam uma crítica à concepção do erro humano, hegemônica dentre os especialistas em segurança do trabalho. Os resultados apresentados foram obtidos de um estudo ergonômico iniciado por demanda do sindicato dos motociclistas profissionais de Minas Gerais. No total, 85 motociclistas profissionais foram observados e entrevistados. Os procedimentos adotados foram: registro da atividade por meio de filmagens nas ruas e avenidas da cidade; autoconfrontação das cenas do filme e das rotas elaboradas em mapas, e de certos aspectos das atividades de trabalho observadas na expedição das duas empresas selecionadas. Ao final, os autores discutem os limites das normas de segurança prescritas que não consideram o saber desenvolvido pelos próprios trabalhadores. As medidas de transformação das situações geradoras de acidentes elaboradas com apoio no estudo detalhado das estratégias implementadas pelos sujeitos estudados serviram para a elaboração da convenção coletiva de trabalho.The aim of this study is to present, as operational strategies, the contribuition to elaborate some prevention measures to protect the professional motorcyclists, popularly known as "motoboys", against accidents. The authors present a critic to the human error conception that is hegemonic to the experts at work security. The results come from an Ergonomics study that started over an Union demand of the professional motorcyclists in Minas Gerais. The total come to 85 professional motorciclists who were interviewed and observed. The procedures were: report the activity filmed in the city streets and avenues; selfconfrontation of the scenes and of the map rutes, and of some aspects obeserved in the two selected companies

  14. Alkali-soluble fluoride deposition on enamel after professional application of topical fluoride in vitro Formação de flúor fracamente ligado ao esmalte após a aplicação tópica profissional de flúor in vitro

    Directory of Open Access Journals (Sweden)

    Mitsue Fujimaki Hayacibara

    2004-03-01

    Full Text Available Since the efficacy of topical fluoride products is related to the fluoride (F availability and its reactivity with enamel, this study was conducted. The F concentration of the following materials was verified: I- acidulated phosphate fluoride (APF gel (1.23% F, II- APF foam (1.23% F and III- Varnish (2.26% F. Forty blocks of bovine enamel were divided into 4 groups and treated according to the materials described, being one of them used as control. Loosely bound fluoride (''CaF2'' was determined on enamel after extraction with 1.0M KOH and analyzed by ion-selective electrode. Total F concentration found in gel was 12,642, in foam 12,755 and in varnish 23,183 mg F/g. All products formed statistically higher amounts of ''CaF2'' on enamel compared to the control group (p 0.05. Thus, ''CaF2'' formation was not proportional to the total F content in the products, suggesting that the pH and the vehicle used are more important.Considerando que a eficácia dos produtos para aplicação tópica profissional de flúor (géis, espumas e vernizes está relacionada com a reatividade do flúor (F com o esmalte e sendo esta dependente da disponibilidade do F em cada produto, este estudo foi conduzido. A concentração de F nos seguintes produtos foi estudada: I - Flúor Fosfato Acidulado (FFA gel (1,23% F, II - FFA espuma (1,23% F e III- Verniz fluoretado (2,26% F. Foram confeccionados 40 blocos de esmalte bovino, tratados de acordo com os grupos descritos, sendo um deles utilizado como controle. O F fracamente ligado (''CaF2'' ao esmalte foi determinado após a extração com 1.0 M KOH e analisado em eletrodo específico. A concentração de F encontrada no gel foi de 12.642, na espuma 12.755 e no verniz 23.183 mg F/g. Todos os produtos formaram uma quantidade significantemente maior de ''CaF2'' na superfície do esmalte, comparado ao grupo controle (p 0,05. Assim, a formação de ''CaF2'' na superfície do esmalte não foi proporcional ao conteúdo de F nos

  15. Exigências de lisina, com base no conceito de proteína ideal, para suínos machos castrados dos 96 aos 120kg, selecionados para eficiência de crescimento Lysine requirements, based on ideal protein concept, for barrows with high genetic potential for growth efficiency, from 96 to 120kg

    Directory of Open Access Journals (Sweden)

    C.L.C. Arouca

    2005-02-01

    Full Text Available Determinaram-se as exigências de lisina para suínos machos castrados utilizando-se 50 animais em delineamento experimental de blocos ao acaso, com cinco tratamentos (0,5; 0,6; 0,7; 0,8 e 0,9% de lisina total, cinco repetições e dois animais por baia. Adicionaram-se aminoácidos sintéticos para manter o nível de acordo com o perfil da proteína ideal. Houve efeito quadrático dos tratamentos sobre o ganho de peso diário e conversão alimentar. O modelo linear response plateau ajustou-se melhor aos dados de conversão alimentar. Observou-se aumento linear do consumo de lisina diário, espessura de toucinho na 10ª costela e espessura de toucinho na última costela. Não houve efeito sobre o consumo de ração diário, espessura de toucinho no P1, espessura de toucinho no P2, profundidade de lombo, porcentagem de carne magra, taxa de deposição de carne magra diária, rendimento de carcaça, comprimento de carcaça pelo método brasileiro, comprimento de carcaça pelo método americano e sobre o peso e rendimento dos cortes cárneos. Suínos machos castrados de 96 a 120kg, selecionados para eficiência de crescimento, exigiram 0,61% de lisina total, correspondendo ao consumo de 22,74g/dia.Lysine requirements of hybrid barrows (AG 1050 grandmother’s brothers, using 50 animals in a completely randomized block design with five dietary treatments (.50; .60; .70; .80 and .90% of total lysine, five replicates and two animals per experimental unit were estimated. Crystalline amino acids were added to keep amino acids levels according to the ideal protein profile. Quadratic effects of treatments on average daily gain and on feed conversion were observed. Linear effects of treatments on daily lysine intake, on 10th rib fat depth and on last rib fat depth were observed. No effects of lysine level on daily feed intake, P1 back fat thickness, P2 back fat thickness, loin depth, lean percentage, daily lean gain, carcass yield, carcass length, carcass

  16. Jovens no trânsito: do sentido do dirigir ao desenvolvimento de consciência

    Directory of Open Access Journals (Sweden)

    Sonia Chébel Mercado Sparti

    2008-12-01

    Full Text Available Introdução: a complexa situação relativa à circulação humana tem suscitado muitas indagações. O advento do automóvel, ao lado das dimensões positivas, também trouxe consigo um conjunto de graves problemas, destacando-se pela sua magnitude e importância, os acidentes de trânsito. Objetivo: esta pesquisa buscou conhecer como a reflexão sobre o sentido do dirigir possibilita o desenvolvimento de consciência de jovens universitários/as. Metodologia: foram utilizadas duas Entrevistas Reflexivas, realizadas de maneira Coletiva, com dez universitários/as da PUC-São Paulo/campus Sorocaba, seguidas de devolução (com pré-análise dos dados. A opção pela Entrevista Reflexiva deveu-se, dentre outros fatores, ao seu caráter de intervenção, uma vez que a escuta atenta e respeitosa pode ser um momento de ajuda. A Grounded Theory foi utilizada para a organização dos dados. Resultados: este procedimento reflexivo possibilitou a compreensão dos aspectos positivos e negativos relativos à circulação humana e levantou fatores indicativos de prevenção: afirmações categóricas a respeito das próprias habilidades ao volante cederam lugar ao reconhecimento de que ainda há espaço para seu aperfeiçoamento; o olhar relativo ao outro foi se modificando, de maneira a considerá-lo parceiro, e não adversário; a preservação da vida sendo considerada um valor, em direção a um que fazer mais prudente, no espaço compartilhado do trânsito. Conclusão: estes resultados ratificam a proposta de que é possível (e desejável pensar a educação para o trânsito na perspectiva do desenvolvimento de consciência.

  17. Seca da semente de café ao sol Effect of sunlight on coffee seed viability

    Directory of Open Access Journals (Sweden)

    Oswaldo Bacchi

    1955-01-01

    Full Text Available O presente trabalho diz respeito a estudos realizados com o objetivo de observar a influência da luz solar sôbre a capacidade germinativa da semente despolpada de café e verificar, portanto, a possibilidade de se efetuar a seca desta semente exclusivamente ao sol. Além de um ensaio preliminar, foram efetuados mais outros dois, compreendendo, ao todo, duas secas ao sol, duas em um secador a baixa temperatura (±28°C, uma a sombra e uma em um secador a alta temperatura (±40°C. Pelas correlações entre as porcentagens de germinação e de umidade, que foram estabelecidas após diferentes períodos de secagem, foram tiradas as duas seguintes conclusões, que são as principais com relação ao objetivo dêstes ensaios : 1 Os raios solares são prejudiciais à capacidade germinativa da semente de café; sua nocividade acha-se, porém, intimamente ligada ao teor de umidade na semente. 2 À vista da conclusão acima, verifica-se que a semente despolpada de café e, muito provavelmente, também a não despolpada, podem ser perfeitamente sêcas a pleno sol sem que haja prejuízo para sua vitalidade, uma vez que sejam recolhidas antes que o seu teor de umidade caia abaixo do ponto crítico de 8% - 9%.In this paper the author deals with the question related to the coffee seed drying, with special attention to the effect of the sun radiations on seed viability. Based on the results obtained, the following conclusions were drawn : (a The sun rays have no specific influence on the viability of hulled coffee seed ; their effect is indirect and related to loss of moisture by the seed. (b Coffee seed can be dried in the sunlight without loss of viability if the water content does not drop under 8% to 9%. Below this critical level seed germination falls rapidly. (c The moisture content of coffee seed dried „in the sun may fall to about 7% in a short time with the consequent injury to viability. (d Under most conditions in the state of São Paulo

  18. Forma clínica e fatores de risco associados ao estrabismo na binocularidade visual

    Directory of Open Access Journals (Sweden)

    Maria Nice Araujo Moraes Rocha

    2016-02-01

    Full Text Available RESUMO Objetivo: Identificar e analisar fatores de risco associados ao estrabismo, dados oftalmológicos e antecedentes pessoais e familiares. Métodos: Estudo prospectivo, descritivo e analítico realizado com 240 pacientes que consultaram pela primeira vez nos ambulatórios de estrabismo. Foram avaliadas a frequência e associação entre estrabismo, dados de exames oftalmológicos e antecedentes pessoais e familiares para identificação dos fatores de risco. Resultados: Observou-se maior prevalência de estrabismo em mulheres (56,96% em relação aos homens (43,02%. A faixa etária mais atendida no ambulatório de estrabismo foi composta de crianças até 15 anos de idade (83,54%. Encontrou-se mais esotropia (55,27% que exotropia (42,20% e parcela menor de estrabismo vertical isolado (2,53%. A prematuridade foi associada ao estrabismo convergente (p=0,023 e não ao divergente (p=0,086. O diabetes mellitus materno foi associado à esotropia (p=0,024 e exotropia (p=0,036 no filho, mas a hipertensão arterial materna, uso de medicamentos para hipertensão e diabetes durante a gravidez e drogas ilícitas não foram estatisticamente significativos. Pacientes com paralisia cerebral tiveram mais associação com exotropia (p=0,008 que esotropia (p=0,019. Malformações congênitas, consanguinidade entre os pais e traumas oculares não apresentaram associação estatisticamente significativa para o estrabismo. A maioria dos pacientes com estrabismo apresentou boa acuidade visual corrigida e fundoscopia normal. Na análise de proporções a hipermetropia foi mais frequente na esotropia (68,7%. Conclusão: Os fatores de riscos internos e externos podem interferir na formação e desenvolvimento do olho na fase de plasticidade ocular, com prejuízo da binocularidade visual, podendo resultar em estrabismo. Há divergências com relação aos fatores de risco realmente associados e mais estudos são necessários para a identificação.

  19. Alterações reprodutivas em ratos machos expostos perinatalmente aos frutos da Solanum lycocarpum

    Directory of Open Access Journals (Sweden)

    Aline Schwarz

    2009-04-01

    Full Text Available Ratas prenhes foram tratadas do dia 06 da gestação (GD 06 ao dia 07 pós-natal (PND 07 com frutos verdes secos e moídos da Solanum lycocarpum (10% na ração. Após nascimento das ninhadas, foi avaliado na prole masculina adulta aos 60 e 90 dias de vida, o número de espermátides e a produção espermática diária nos testículos e o tempo de trânsito espermático no epidídimo. A exposição não foi capaz de promover alterações na produção espermática diária (DSP e no número de espermátides produzidas pelo testículo dos ratos expostos aos frutos verdes da S. lycocarpum durante a gestação e início da lactação. Não foram observadas alterações no tempo de trânsito espermático na cabeça do epidídimo, porém, foi constatado menor número de espermatozóides no corpo/cauda do epidídimo nos machos experimentais com 90 dias de vida, provavelmente resultante do menor tempo de trânsito espermático observado no corpo/cauda do epidídimo aos PND 90. Estes dados sugerem que a exposição de ratos aos frutos verdes da S. lycocarpum durante a gestação e início da lactação, não foi suficiente para promover alterações na produção mas sim no trânsito espermático, indicando possível alteração no eixo hormônio liberador das gonadotrofinas hipotálamo-hipófise-gônada

  20. Sobre o ódio ao professor Entrevista com Fernando Penna

    Directory of Open Access Journals (Sweden)

    Fernando Penna

    2016-01-01

    Full Text Available Ao tomar a decisão de pautar o tema da violência para compor o dossiê do terceiro número de Movimento – revista eletrônica de educação da Universidade Federal Fluminense –, o Conselho Editorial elencou um grande número de facetas da violência que historicamente se manifestam física e presencialmente no interior e fora do espaço escolar. O fenômeno relativamente recente das redes sociais e o vertiginoso processo de crescimento de trocas de informação, interação e mediação virtual a ele agregado, não apenas ampliou o espectro da violência como contribuiu decisivamente para articular o dentro e o fora da escola. Dentre outros exemplos, talvez o mais comum e antigo é o registro de cenas reais de alunos e alunas brigando nos pátios escolares ou nas redondezas da instituição postadas nas redes sociais, muitas delas viralizadas – para usar o barbarismoda ocasião – por um número sempre crescente de adeptos do bullying escolar. Nos últimos cinco anos, nas redes sociais, o exemplo de articulação da violência dentro-fora da escola que mais chama a atenção é o ódio ao professor, conforme observa o professor Fernando Penna na entrevista que publicamos a seguir. Estudioso da manifestação reivindicatória por uma escola sem ideologia trazida nos últimos anos por setores conservadores e reacionários da sociedade brasileira, Penna busca oferecer na entrevista algumas hipóteses para compreendermos o fenômeno do ódio ao professor, bem como algumas pistas para apreendermos os fundamentos que movem aqueles setores no combate ao que denominam de doutrinação ideológica de esquerda, e, concluindo, observa a urgência da resistência ao assédio moral feito dos conservadores ereacionários, chamando a atenção para a importância da ampliação do conhecimento crítico sobre o tema.

  1. Expressao genica associada ao estresse oxidativo no coracao de camundongo apos isquemia intestinal

    Directory of Open Access Journals (Sweden)

    Frederico Somaio Neto

    2014-03-01

    Full Text Available FUNDAMENTO: O fenômeno da isquemia e reperfusão intestinal é um evento frequente na clínica e está associado a repercussões deletérias em órgãos a distância, em especial ao coração. OBJETIVO: Investigar a expressão gênica do estresse oxidativo e defesa antioxidante no coração de camundongos isogênicos, submetidos a isquemia e reperfusão intestinal (IR. MÉTODOS: Doze camundongos (C57BL/6 foram distribuídos em dois grupos: Grupo IR (GIR com 60 min de oclusão da artéria mesentérica superior, seguidos de 60 min de reperfusão. Grupo Controle (GC submetidos a anestesia e a laparotomia sem o procedimento de IR observados por 120 min. As amostras de intestino e coração foram processadas pelo método (RT-qPCR / Reverse transcriptase - quantitative Polymerase Chain Reaction para determinar a expressão gênica de 84 genes relacionados ao estresse oxidativo ("t" de Student, p < 0,05. RESULTADOS: Observou-se no tecido intestinal (GIR uma expressão significantemente aumentada em 65 (74,71% genes em relação ao tecido normal (GC, e 37 (44,04% genes estiveram hiperexpressos (maior que três vezes o limiar permitido pelo algoritmo. No tocante aos efeitos da I/R intestinal a distância no tecido cardíaco verificou-se a expressão significantemente aumentada de 28 genes (33,33%, mas somente oito genes (9,52% se hiperexpressaram três vezes acima do limiar. Quatro (7,14% desses oito genes se expressaram simultaneamente nos tecidos intestinal e cardíaco. No GIR notaram-se cardiomiócitos com núcleos de menor tamanho, picnóticos, ricos em heterocromatina e raros nucléolos, indicando sofrimento cardíaco. CONCLUSÃO: A I/R intestinal promoveu a hiperexpressão estatisticamente significante de oito genes associados ao estresse oxidativo a distância no tecido miocárdico.

  2. Would be the photon a composed particle? / Sobre a possibilidade da quantiza\\c{c}\\~ao dos fluxos de campo na radia\\c{c}\\~ao eletromagn\\'etica

    CERN Document Server

    Duarte, Celso de Araujo

    2013-01-01

    Here it is made a comparative analysis between the classical and the quantum expressions for the energy of electromagnetic radiation (ER). The comparison points to the possibility of the quantization of the magnetic and the electric field fluxes in the ER. ----- Apresenta-se uma an\\'alise comparativa entre as express\\~oes cl\\'assica e qu\\^antica para a energia da radia\\c{c}\\~ao eletromagn\\'etica (RE). A compara\\c{c}\\~ao nos aponta para a possibilidade de haver uma quantiza\\c{c}\\~ao dos fluxos dos campos magn\\'etico e el\\'etrico na RE.

  3. Associação entre o padrão de atividade física materna, ganho ponderal gestacional e peso ao nascer em uma coorte de 118 gestantes no município de Campina Grande, Nordeste do Brasil Association between maternal physical activity, gestational weight gain and birth weight in a cohort of 118 pregnant women in Campina Grande, Northeast of Brazil

    Directory of Open Access Journals (Sweden)

    Jousilene de Sales Tavares

    2009-01-01

    Full Text Available OBJETIVO: Esta pesquisa estudou o efeito da atividade física sobre o ganho ponderal e peso ao nascer em gestantes do Programa Saúde da Família no município de Campina Grande, (PB. MÉTODOS: Realizou-se um estudo de coorte abrangendo 118 gestantes, entre 2005 e 2006. A avaliação do estado nutricional inicial seguiu os critérios de Atalah e o ganho ponderal materno foi avaliado de acordo com o Institute of Medicine. Analisou-se o padrão de atividade física de acordo com o medidor de estimativa de gasto calórico total (METs e sua associação com o ganho ponderal e o peso ao nascer. RESULTADOS: o padrão de atividade física predominante na 16ª semana foi o leve, alcançando 85,6% das gestantes. Observou-se uma redução importante do nível de atividade física com a evolução da gestação, com 98,3% das gestantes sendo consideradas sedentárias na 24ª semana e 100% na 32ª semana. No momento da captação, cerca de 50% das gestantes eram eutróficas, 23% com baixo peso e as demais com sobrepeso/obesidade. No segundo e no terceiro trimestres, aproximadamente 45% das gestantes ganharam peso excessivo. A distribuição do peso ao nascer mostrou um predomínio do peso adequado (85,6%, e uma alta prevalência de macrossomia (8,5%. Dentre os desfechos avaliados, foi observada associação apenas entre os valores de METs da 24ª.semana e o ganho ponderal materno no segundo trimestre gestacional (p=0,045. CONCLUSÃO: Todas as gestantes estavam sedentárias no terceiro trimestre; observou-se uma associação entre o padrão de atividade física e o ganho ponderal materno no segundo trimestre, mas não houve associação deste padrão com o peso ao nascer.OBJECTIVE: This survey evaluated the effects of physical activity on gestational weight gain and birth weight of pregnant women attended by the Family Health Program in Campina Grande, Northeast of Brazil. METHODS: A cohort study enrolling 118 pregnant women was conducted between 2005 and

  4. A Tn5051-like mer-containing transposon identified in a heavy metal tolerant strain Achromobacter sp. AO22

    Directory of Open Access Journals (Sweden)

    Bhave Mrinal

    2009-03-01

    Full Text Available Abstract Background Achromobacter sp. AO22 (formerly Alcaligenes sp. AO22, a bacterial strain isolated from a lead-contaminated industrial site in Australia, was previously found to be resistant to moderate to high levels of mercury, copper and other heavy metals. However, the nature and location of the genetic basis for mercuric ion resistance in this strain, had not been previously identified. Findings Achromobacter sp. AO22 contains a functional mer operon with all four essential genes (merRTPA and shows >99% DNA sequence identity to that of Tn501. The mer operon was present on a transposon, designated TnAO22, captured by introducing a broad-host-range IncP plasmid into Achromobacter sp. AO22 and subsequently transferring it to E. coli recipients. The transposition frequency of TnAO22 was 10-2 to 10-3 per target plasmid transferred. Analysis of TnAO22 sequence revealed it belonged to the Tn21 subgroup of the Tn3 superfamily of transposons, with the transposition module having >99% identity with Tn5051 of a Pseudomonas putida strain isolated from a water sample in New York. Conclusion TnAO22 is thus a new variant of Tn5051 of the Tn3 superfamily and the transposon and its associated mercury resistance system are among the few such systems reported in a soil bacterium. Achromobacter sp. AO22 can thus be exploited for applications such as in situ mercury bioremediation of contaminated sites, or the mobile unit and mer operon could be mobilized to other bacteria for similar purposes.

  5. A Tn5051-like mer-containing transposon identified in a heavy metal tolerant strain Achromobacter sp. AO22.

    Science.gov (United States)

    Ng, Shee Ping; Davis, Belinda; Palombo, Enzo A; Bhave, Mrinal

    2009-03-07

    Achromobacter sp. AO22 (formerly Alcaligenes sp. AO22), a bacterial strain isolated from a lead-contaminated industrial site in Australia, was previously found to be resistant to moderate to high levels of mercury, copper and other heavy metals. However, the nature and location of the genetic basis for mercuric ion resistance in this strain, had not been previously identified. Achromobacter sp. AO22 contains a functional mer operon with all four essential genes (merRTPA) and shows >99% DNA sequence identity to that of Tn501. The mer operon was present on a transposon, designated TnAO22, captured by introducing a broad-host-range IncP plasmid into Achromobacter sp. AO22 and subsequently transferring it to E. coli recipients. The transposition frequency of TnAO22 was 10-2 to 10-3 per target plasmid transferred. Analysis of TnAO22 sequence revealed it belonged to the Tn21 subgroup of the Tn3 superfamily of transposons, with the transposition module having >99% identity with Tn5051 of a Pseudomonas putida strain isolated from a water sample in New York. TnAO22 is thus a new variant of Tn5051 of the Tn3 superfamily and the transposon and its associated mercury resistance system are among the few such systems reported in a soil bacterium. Achromobacter sp. AO22 can thus be exploited for applications such as in situ mercury bioremediation of contaminated sites, or the mobile unit and mer operon could be mobilized to other bacteria for similar purposes.

  6. Medicina moderna: rumo à prevenção, à cura, ao bem-estar e à longevidade

    OpenAIRE

    Ajai Singh

    2010-01-01

    A medicina moderna tem realizado muitas coisas nos campos de doenças infecciosas e de emergências para assistir a cura. Na maior parte dos outros campos, ela visa, sobretudo, ao controle, que é outro nome para o tratamento paliativo. A farmacologia, na qual se inclui a psicofarmacologia, é igualmente dirigida ao controle e ao alívio. Está na hora de profissionais da área e pesquisadores voltarem-se decisivamente para a prevenção e para a cura. Ademais, o outro grande desafio da medicina moder...

  7. Trabalho experimental de combate ao acaro rajado Tetranychus urticae Koch, 1836 com formulações aplicadas por "electrodyn"

    OpenAIRE

    Arashiro,F.Y.; Silva, J. M.; Sugamara,C. A.; Motta, R; Raizer,A.J.; MARICONI,F.A.M.

    1987-01-01

    O presente trabalho teve como objetivo o combate experimental ao ácaro rajado Tetranyohus urtioae Koch, 1836 em cultura de algodão. Dois produtos, mediante pulverização eletrodinâmica, foram experimentados: bromopropilato e bifentrina, o primeiro em duas dosagens e o segundo, em três. Aos dias da aplicação, a bifentrina mostra os melhores resultados, embora não se diferencie es tatisticamente do bromopropilato. Aos 09 dias, os melhores são as duas dosagens mais fortes da bifentrina apesar de ...

  8. Growth and antimicrobial activity of lactic acid bacteria from rumen fluid according to energy or nitrogen source Crescimento e atividade antimicrobiana de bactérias ácido-láticas do líquido ruminal de acordo com a fonte de energia ou de compostos nitrogenados

    Directory of Open Access Journals (Sweden)

    Isabela Pena Carvalho de Carvalho

    2011-06-01

    ureia. Incubações sucessivas foram conduzidas para seleção dos microrganismos em função das fontes energéticas e de compostos nitrogenados. O amido favoreceu o crescimento de bactérias ácido-láticas em comparação à celulose. A suplementação com proteína verdadeira (peptona de soja e caseína estimulou o crescimento dessas bactérias em comparação ao controle (sem suplementação com compostos nitrogenados. A adição de ureia não estimulou o crescimento de bactérias ácido-láticas. Nenhuma atividade antimicrobiana foi detectada a partir das colônias de bactérias ácido-láticas isoladas. Fontes de proteína verdadeira incrementam a competição entre bactérias fermentadoras de carboidratos estruturais e não-estruturais.

  9. Pediatric multiple sclerosis: analysis of clinical and epidemiological aspects according to National MS Society Consensus 2007 Esclerose múltipla pediátrica: análise de aspectos clínicos e epidemiológicos de acordo com o Consenso de 2007 da Sociedade Americana de Esclerose Múltipla

    Directory of Open Access Journals (Sweden)

    Maria Lúcia Brito Ferreira

    2008-01-01

    Full Text Available OBJECTIVE: To describe the epidemiological and clinical characteristics of child/adolescence multiple sclerosis (MS. METHOD: According to a descriptive, cohort study, with comparison of groups, data of 31 cases of child/adolescent MS, diagnosed at State Reference Center for Demyelinating Diseases - Hospital da Restauração, Recife, Pernambuco, Brazil, from 1987 to July 2007, were analyzed. The variables were: sex, initial symptoms, time for diagnosis, time of disease onset (early childhood, later childhood and adolescence, time of follow-up, number of relapses, relapses index and disability. Using SPSS software, version 13.0, t Student and Mann-Whitney tests were performed, with significance level of 0.05. RESULTS: There were 3 (9.7% cases of early childhood MS, 9 (29%, of late childhood MS, and 19 (61.3%, of adolescence MS. The general sex rate female: male was 1.8:1, varying according to age of onset. The predominant deficits were motor (12; 38.7% and brainstem/cerebellum (7; 22.5% especially on subsequent relapses of relapsing/remitting form. Time for diagnosis and average relapses index were higher in early childhood than in adolescence class (p=0.049 and p=0.028, respectively. Disability was higher for primary and secondary MS, as well as for early childhood. CONCLUSION: Early childhood MS presents proper and different characteristics from adults, consisting in a difficult diagnosis that demands aid of expert neurologist on MS.OBJETIVO: Descrever características epidemiológicas e clínicas de casos de esclerose múltipla (EM de início precoce. MÉTODO: Em estudo descritivo, prospectivo, tipo coorte, com comparação de grupos, foram analisados 31 portadores de EM de início precoce, diagnosticados no Centro Estadual de Referência para Atenção a Pacientes Portadores de Doenças Desmielinizantes do Hospital da Restauração, Recife, Pernambuco, entre 1987 e julho de 2007. As classes ao primeiro surto foram: infantil precoce, infantil

  10. Sexual activity among female teenagers: a comparison between two groups of middle class adolescents from a private clinic according to pregnancy status Atividade sexual em mulheres adolescentes: uma comparação entre dois grupos de adolescentes de classe média de clínica particular de acordo com estado gravídico

    Directory of Open Access Journals (Sweden)

    Alexandre Faisal-Cury

    2008-09-01

    grávidas (46 ou tiveram gravidez prévia (16; outro grupo não grávidas (NPG, com 55 adolescentes que nunca engravidaram. Uma entrevista semi-estruturada foi conduzida pelo médico durante consulta clínica. Foram avaliados o conhecimento, atitudes e práticas acerca da atividade sexual. A comparação entre os grupos foi feita por meio do teste t de Student, qui-quadrado e teste exato de Fisher. RESULTADOS os dois grupos eram similares quanto aos aspectos sexuais, sendo a coitarca na idade de 15 e a média do número de parceiros, 1,5. Entretanto, adolescentes no PG iniciaram vida sexual mais cedo e usaram menos métodos contraceptivos na primeira relação sexual. Apesar do grande conhecimento sobre contracepção, parte considerável das adolescentes não usou nenhum método durante a coitarca. Na vida sexual atual, cerca de 81% das participantes refere atingir orgasmo. CONCLUSÕES: o conhecimento sobre técnicas contraceptivas não é suficiente para evitar gestações não planejadas, sugerindo a importância de investigar outros aspectos psicosexuais da maternidade e identidade materna entre adolescentes.

  11. Compressibilidade de um Latossolo Vermelho argiloso de acordo com a tensão de água no solo, uso e manejo Compressibility of a clayey Red Latosol as a function of water tension, use and management of the soil

    Directory of Open Access Journals (Sweden)

    G. C. Oliveira

    2003-10-01

    Full Text Available Uma das principais conseqüências do manejo inadequado do solo é a sua compactação, que leva à perda da sustentabilidade agrícola. O objetivo deste trabalho foi o de estudar o comportamento compressivo de um Latossolo Vermelho argiloso, sob quatro tensões de água no solo, sob cerrado, sob plantio direto e cultivo convencional, utilizando-se o arado de discos, após duas décadas de uso. Amostras não deformadas foram utilizadas na caracterização da porosidade do solo e nos ensaios de compressão uniaxial. As pressões de preconsolidação e os índices de compressão foram obtidos das curvas de compressão do solo. A densidade do solo foi também avaliada. Amostras deformadas foram utilizadas nas análises físicas e químicas do solo. As tensões de água no solo dentro da faixa compreendida entre capacidade de campo e ponto de murcha permanente e os sistemas de uso e manejo influíram na intensidade de deformação do solo, sendo os valores mais elevados na capacidade de campo do solo (6 kPa e no cerrado. Os valores de pressões que podem reduzir a porosidade do solo a níveis críticos ao crescimento de plantas variaram em todos os sistemas de manejo, mas apresentaram os menores valores para as condições mais úmidas, sendo função também da porosidade inicial do solo. Independentemente do sistema de manejo, tensão de água e profundidade do solo, os valores percentuais da redução do volume total de poros nas pressões que não provocam compactação adicional do solo (pressão de preconsolidação foram praticamente constantes e, em geral, abaixo de 10 %.Soil compaction is one of the main consequences of inadequate soil management and can lead to a loss of the agricultural sustainability. The compressive behavior of a clayey Red Latosol (Oxisol under four water tensions and under native vegetation, no-till, and conventional till with a disk plow for two decades was studied. Undisturbed soil samples were used to characterize

  12. Análise de sobrevivência relacionada ao sexo, após esplenectomia, em modelo animal Post-splenectomy survival analysis related to gender in animal model

    Directory of Open Access Journals (Sweden)

    Luiz R. Alberti

    2007-06-01

    Full Text Available É sabido que a esplenectomia causa propensão a infecções, principalmente aquelas causadas por microorganismos capsulados. Essas complicações acompanham-se de maior mortalidade e conseqüente menor sobrevida dos indivíduos asplênicos. O objetivo do presente trabalho foi avaliar a sobrevida em relação ao sexo de ratos submetidos a esplenectomia total. Foram estudados 34 ratos, distribuídos em dois grupos, sendo o Grupo 1 (n=14 controle, animais submetidos apenas a laparotomia e o Grupo 2 (n=20 submetidos a esplenectomia total. Os animais de cada grupo foram distribuídos em dois subgrupos iguais, sendo o Subgrupo A composto por machos e o Subgrupo B por fêmeas. Os ratos foram acompanhados por um período máximo de noventa dias com vista à sua sobrevivência. Observou-se que a mortalidade após esplenectomia total foi de 80% no Subgrupo dos animais machos e de 30% no das fêmeas. Não houve óbitos no Grupo 1. Os ratos esplenectomizados apresentaram sobrevida inferior à das ratas esplenectomizadas (p = 0,034. De acordo com os resultados obtidos, a esplenectomia diminui a sobrevida de ratos, e as fêmeas murinas apresentam maior resistência à asplenia e conseqüentemente menor mortalidade do que os machos.It is well known that splenectomy increases the risk of infections, mainly those caused by capsulated bacteria. These complications are associated with greater mortality and lower survival rates in asplenic individuals. The objective of the present work was to assess the survival of rats submitted to total splenectomy. Thirty-four rats were divided into 2 groups: Group 1 (n = 14: control animals, submitted only to laparotomy; Group 2 (n = 20: animals submitted to splenectomy. Both groups were subdivided into 2 subgroups, namely, subgroup A, male rats, and subgroup B, female rats. The animals were followed during a 90-day period to assess their survival. The mortality of animals in Group 2 was 80% for males and 30% for females. No

  13. Atenção médica à gestação e ao parto de mães adolescentes Medical care for teenage mothers during pregnancy and at delivery

    Directory of Open Access Journals (Sweden)

    Heloisa Bettiol

    1992-12-01

    Full Text Available Estudou-se em Ribeirão Preto, SP, Brasil, no período de 1º de junho de 1978 a 31 de maio de 1979, 98% do universo de nascidos vivos, totalizando 8878 crianças nascidas de parto único, sendo 6750 procedentes de Ribeirão Preto. Observou-se um aumento da proporção de mães adolescentes em Ribeirão Preto (14,1% quando comparada com estudo realizado 10 anos antes (11,7%. A idade materna menor de 20 anos esteve associada com os indicadores mais desfavoráveis para a saúde perinatal, no que diz respeito à atenção médica à gestação e ao parto. Essa situação ficou mais evidente entre as mães adolescentes de classes sociais menos favorecidas, revelando que o grupo de mães adolescentes não é homogêneo, mas apresenta diferentes proporções de risco para a saúde perinatal de acordo com as frações de classe social que existem no seu interior.Ninety-eight percent of all live births occuring in the city of Ribeirão Preto, state of São Paulo (Brazil, from June 1, 1978 to May 30, 1979 were studied, for a total of 8,878 single-delivery infants, 6,750 of whom were from this town. An increase in the proportion of teenage mothers in Ribeirão Preto (14.1% was observed in relation to a study carried out ten years before (11.7%. Maternal age of less than 20 years was associated with more unfavorable perinatal health indicators with respect to medical care and delivery. This situation was more evident among teenage mothers from underprivileged social classes, showing that the group of teenage mothers is not homogeneous but presents different risk rates for perinatal health according to the social strata of which the group is composed.

  14. Avaliação da resistência ao cisalhamento de braquetes da técnica lingual colados sobre superfície cerâmica Evaluation of shear strength of lingual brackets bonded to ceramic surfaces

    Directory of Open Access Journals (Sweden)

    Michele Balestrin Imakami

    2011-06-01

    Full Text Available OBJETIVO: avaliar a resistência ao cisalhamento de braquetes metálicos (American Orthodontics utilizados na técnica lingual, colados em facetas de cerâmica. MÉTODOS: foram utilizados 40 corpos de prova divididos em quatro grupos de 10, de acordo com o material de colagem e do preparo da porcelana: Grupo I -resina Sondhi Rapid-Set e ácido fluorídrico; Grupo II -resina Sondhi Rapid-Set e óxido de alumínio; Grupo III -resina Transbond XT e ácido fluorídrico; e Grupo IV -resina Transbond XT e óxido de alumínio. Previamente à colagem, os braquetes foram preparados com base de resina de carga pesada (Z-250 e as facetas de cerâmica receberam aplicação de silano. O teste de cisalhamento foi realizado por uma máquina de ensaios Kratos à uma velocidade de 0,5mm/min. RESULTADOS: os resultados obtidos foram analisados estatisticamente através do teste de Tukey (pOBJECTIVE: The aim of this study was to evaluate the shear strength of lingual metal brackets (American Orthodontics bonded to ceramic veneers. METHODS: A total of 40 specimens were divided into four groups of 10, according to bonding material and ceramics preparation: Group I -Sondhi Rapid-Set resin and Hydrofluoric acid, Group II -Sondhi Rapid-Set resin and aluminum oxide, Group III -Transbond XT resin and Hydrofluoric acid, and Group IV -Transbond XT resin and aluminum oxide. Prior to bonding, the brackets were prepared with heavy-duty resin base (Z-250 and the ceramic veneers were treated with silane. The shear test was conducted with a Kratos testing machine at a speed of 0.5 mm/min. RESULTS: The results were statistically analyzed by the Tukey test (p<0.05 and showed a statistically significant difference between groups I (2.77 MPa and IV (6.00 MPa, and between groups III (3.33 MPa and IV. CONCLUSION: In conclusion, the bonding of lingual brackets to ceramic surfaces exhibited greater shear strength when aluminum oxide was used in association with the two resins utilized in

  15. Effects of pesticides used in soybean crops to the egg parasitoid Trichogramma pretiosum Efeitos dos agroquímicos utilizados na cultura da soja ao parasitóide de ovos Trichogramma pretiosum

    Directory of Open Access Journals (Sweden)

    Adeney de Freitas Bueno

    2008-09-01

    Full Text Available This research aimed to study the effects of different insecticides, herbicides and fungicides on eggs, larvae and pupae of Trichogramma pretiosum. The results showed that studied pesticides had different impact on T. pretiosum. Esfenvalerate 7.5 and spinosad 24.0 grams ha-1 were classified as harmfull (class 4 while clorfluazuron 10.0, methoxyfenozide 19.2, lactofen 165.0, fomesafen 250.0, fluazifop 125.0, glyphosate 960.0 (Gliz® and Roundup Transorb®, azoxistrobin + ciproconazol 60.0 + 24.0, azoxistrobin 50.0 and myclobutanil 125.0 grams ha-1 were chemicals classified as harmless to all imature T. pretiosum stages. All the other chemicals evaluated had different impact on T. pretiosum being classified from harmless (class 1 to harmful (class 4 varying the impact accordingly to the different parasitoid stage. Then, less noxious products should be chosen whenever possible to be used in a soybean IPM program.Este trabalho teve como objetivo estudar os efeitos de diferentes inseticidas, herbicidas e fungicidas em ovos, larvas e pupas de Trichogramma pretiosum. Os resultados mostraram que os pesticidas estudados tiveram efeitos diferentes sobre T. pretiosum. Esfenvalerato 7,5 e espinosade 24,0 gramas ha-1 foram classificados como nocivos (classe 4, enquanto que clorfluazurom 10,0, metoxifenozida 19,2, lactofem 165,0, fomesafem 250,0, fluazifope 125,0, glifosato 960,0 (Gliz® e Roundup Transorb®, azoxistrobina + ciproconazole 60,0 + 24,0, azoxistrobina 50,0 e miclobutanil 125,0 gramas ha-1 foram classificados como seletivos (classe 1 para todas as fases imaturas de T. pretiosum. Todos os demais agroquímicos avaliados tiveram diferentes efeitos em T. pretiosum, sendo classificados de seletivo (classe 1 a nocivo (classe 4, variando o impacto de acordo com as diferentes fases do parasitóide. Portanto, produtos menos nocivos aos inimigos naturais devem ser escolhidos, sempre que possível, para serem usados em um programa de MIP-soja.

  16. Orientações ao pediatra sobre o manejo das drogas psicoativas e antiepilépticas

    OpenAIRE

    Rocha,Gibsi P.; Batista,Bianca H.; Nunes,Magda L.

    2004-01-01

    OBJETIVO: Revisar as indicações e o manejo clínico das drogas psicoativas e antiepilépticas na infância e adolescência. FONTES DE DADOS: Estudo baseado em revisão de literatura. Os autores organizam, de acordo com os quadros patológicos, uma rotina para o manejo dos psicofármacos e das drogas antiepilépticas na infância e na adolescência. SÍNTESE DOS DADOS: Indicação clínica, dosagem terapêutica e efeitos colaterais dos psicofármacos e drogas antiepilépticas são descritos. O uso de psicofárma...

  17. Cyberbullying – do diagnóstico de necesidades à construçao de um manual de formaçao.

    Directory of Open Access Journals (Sweden)

    Teressa Pessoa

    2011-01-01

    Full Text Available O impacto do cyberbullying na sociedade e junto das crianças e jovens, tão mais complexo quanto mais sofisticadas as ferramentas tecnológicas disponíveis, tem chamado a atenção para a importância, a nível internacional, da definição de estratégias de prevenção e intervenção junto de potenciais agentes educativos, isto é, para o desenvolvimento de uma proposta, com dimensão europeia, de Cyber- Training.Neste trabalho após uma breve apresentação do projectoCyberTraining: A Researchbased Training Manual On Cyberbullying1 dar-se-á a conhecer o processo de desenvolvimento de um manual de formação baseado numa investigação a nível europeu suportada na plataforma Moodle e, nesta, pela ferramenta Fórum. Através de uma análise de necesidades junto de formadores e do estudo, junto de especialistas, do estado de arte no domínio a nível de diferentes países, é mostrado todo um percurso inovador de construção colaborativa de conhecimento relativamente ao conceito cyberbullying assim como relativamente ao desenvolvimento de práticas de formação ou cybertraining.----------------------------------------------------------------The impact of the cyberbullying on society and among children and young people, revealed as ever more complex as more sophisticated technological tools becomeavailable, has called attention to the importance, at the international level, of a definition of strategies for prevention and intervention among potential educational agents, i.e. to develop a proposal for Cyber-Training, with a European dimension.In this paper, after a brief presentation of the European project CyberTraining: A Researchbased Training Manual on Cyberbullying, an account will be given of the process of developing a training manual based on research at European level supported in the Moodle platform, and within this, by the Forum tool. By means of a needs analysis among trainers and analysis by experts of the state of the art in

  18. Tracking and uncertainty in absorption spectrometry and atomic emission; Trazabilidad e incertidumbre en espectrometria de absorcion y emision atomica

    Energy Technology Data Exchange (ETDEWEB)

    Arvizu Torres, Maria del Rocio; Ramirez Cruz, Pedro [Centro Nacional de Metrologia (CENAM), Division de Materiales Metalicos, Area de Metrologia de Materiales, Departamento de Educacion Continua, El Marquez, Queretaro (Mexico)

    2008-04-18

    In this course it is described what methodology is, the measuring instruments and the importance of its calibration. The history of the International System of Units is described and what the meaning of tracking is. Also the general concepts of uncertainty in analytical measurements are shown, such as the measurements of central tendency and the variability measurements. [Spanish] En este curso se describe que es metodologia, los instrumentos de medicion y la importancia de calibrarlos. Se describe la historia del Sistema Internacional de Unidades y que es la trazabilidad. Tambien se presentan conceptos generales de incertidumbre en mediciones analiticas, como las medidas de tendencia central y las medidas de variabilidad.

  19. Assistencia ao cancer entre criancas e adolescentes: mapeamento dos fluxos origem-destino no Brasil

    Directory of Open Access Journals (Sweden)

    Marilia Fornaciari Grabois

    2013-06-01

    Full Text Available OBJETIVO: Analisar os fluxos de viagens de crianças e adolescentes com câncer, entre os locais de residência e serviço de saúde. MÉTODOS: Foram analisados os fluxos de viagens de crianças e adolescentes com câncer entre os locais de residência e de serviço de saúde atendidos no Sistema Único de Saúde (SUS, de 2000 a 2007. A unidade de análise foi a regional de saúde. Utilizou-se o sistema de informações geográficas e metodologia de redes por tipo de tratamento recebido (quimioterapia e radioterapia e internações hospitalares. RESULTADOS: Foram emitidas 465.289 autorizações de quimioterapia, 29.151 de radioterapia e 383.568 de internações hospitalares de crianças e adolescentes com diagnóstico de câncer para tratamento no SUS. O fluxo dominante formou 48 redes para quimioterapia, 53 para radioterapia e 112 para internações hospitalares. A maior parte do volume de atendimento ocorreu nas regionais de saúde das 12 maiores metrópoles do País com grande relacionamento entre elas e extensa área de influência direta acompanhando a estrutura da rede urbana brasileira. CONCLUSÕES: A identificação das redes estabelecidas no âmbito do SUS para o atendimento de crianças e adolescentes com câncer mostra que a maioria dos pacientes está contemplada pelas redes estruturadas. Cerca de 10% das viagens ocorrem fora do fluxo dominante, indicando a necessidade de regionalização alternativa. Os resultados evidenciam a importância do planejamento da distribuição dos serviços de acordo com as necessidades da população usuária.

  20. Percepções da pessoa idosa quanto aos cuidados fisioterapêuticos no seu envelhecer

    Directory of Open Access Journals (Sweden)

    Luzia Wilma Santana da Silva

    2014-06-01

    Full Text Available No Brasil, o envelhecimento populacional e a demanda crescente de pessoas com doenças crônicas e incapacidades funcionais têm despertado a atenção dos cientistas da saúde, visto que comprometem não apenas o processo de viver, mas também as relações sociais e o sistema familiar. Nesse contexto, a inserção da fisioterapia no nível primário apresenta-se como uma estratégia capaz de fortalecer a atenção básica, aumentando a resolutividade do Sistema Único de Saúde, no reforço à integralidade na assistência. Objetivo: Conhecer as percepções da pessoa idosa sobre os cuidados fisioterapêuticos desenvolvidos no contexto familiar/domiciliar. Método: Estudo exploratório e descritivo, com abordagem qualitativa; realizado em um município localizado no interior do Estado da Bahia, Brasil, no período de abril a julho de 2013, utilizando como instrumento: entrevista semiestruturada aplicada a quatro pessoas idosas, usuárias do serviço de fisioterapia domiciliar do Programa de Ação Continuada do Núcleo Interdisciplinar de Estudos e Extensão e que possuíam condições cognitivas preservadas, de acordo com Miniexame do Estado Mental (MEEM. Os resultados evidenciaram satisfação dos sujeitos quanto à evolução físico-funcional decorrente do atendimento fisioterapêutico domiciliar em seu bem-estar geral, bem como o domicílio, um espaço privilegiado para a ação reabilitadora proximal dos cuidados, que se reverteu em vínculos de solidariedade, de escuta sensível, de valorização pessoal e de amizade. Apesar disso, também foram identificadas insatisfações quanto à descontinuidade e resolutividade do tratamento no período de recesso acadêmico, fazendo alertar para a necessidade de motivação no direcionamento das capacidades resilientes das pessoas.

  1. Relative importance of the AO, NAO and Aleutian Low in predicting regional climate change

    Science.gov (United States)

    Paeth, H.; Rauthe, M.; Hense, A.

    2003-04-01

    In recent years, several observational and climate model studies have drawn a picture of Northern Hemisphere circulation modes which are largely sensitive to the greenhouse forcing with implications for regional climate change. The dominant candidates are the Arctic Oscillation (AO), the North Atlantic Oscillation (NAO) and the Aleutian Low (AL). Here, we consider all these modes equally and try to get insight into their relative importance with respect to temperature and rainfall variability over the Northern Hemisphere. The relative importance of AO, NAO and AL time series is determined by stepwise multiple regression with cross validation at every grid point of the globe. This tool is appropriate to sort the predictors - AO, NAO and AL - by their relative contribution to temperature and rainfall predictability and to evaluate the predictability with respect to an independent control data set. This allows to cut off the number of predictors as soon as the mean square error between the multiple regression model and the control data set is increasing. For better reliability of our results, the procedure is applied many times with 100 permutations. This part is based on the NCEP reanalysis data set. For estimating future temperature and rainfall anomalies, a broad model intercomparison study has been carried out, including most state-of-the-art models of the international modeler community. For each circulation mode superensemble-mean time series under greenhouse-gas (GHG) only and GHG plus sulphate aerosol conditions are determined respectively. Concerning annual-mean temperature, the total explained variance by an optimal number of predictors amounts to 60% over northern Europe, Siberia and North America. At most grid points of the Northern Hemisphere, the AO is the most prominent mode, also in the European-Atlantic sector where the NAO is supposed to be the main player. In the North Pacific sector and in some regions of the low latitudes the AL is dominating. The

  2. A contribution to our knowledge of Leonurus L., i-mu-ts'ao, the Chinese motherwort.

    Science.gov (United States)

    Hu, S

    1976-01-01

    This article deals with the ethnobotanical aspects of the Chinese motherwort. Since time immemorial the Chinese people have used various parts of motherwort to meet different physical needs. By the time a written language was developed and the medical uses were recorded. , motherwort was treated as an article of superior quality. At present, under the name of i-mu-ts'ao, the plant is used for improving bloodflow both by official physicians and herbal practitioners throughout the country as well as by villagers in isolated areas. According to Chinese classical literature on materia medica, the early uses were limited to the parts of the plant which met the most obvious needs of the prehistorical people in their struggle for existence-food and pain reliever. Evidently, in their search for food, the ancient people found that the four nutlets contained in the dry and spinose calyx of the Chinese motherwort resemble the seasame seed in size and oil content. They gathered them and used them for food in similar manner as with the sesame. Consequently, they discovered the good effects to the eyesight, the improvement of strength, and the uplift of spirit. These discoveries led to the use of the seed of the species as an eye medicine for improving the eyesight, and as a tonic for the increase of strength and the elevation of spirit. Contagious skin diseases caused serious problems for the ancient people. The use of the leafy shoot for a bath to release the discomfort of itches and shingles was also recorded in the 42-word first medicinal record of the species in the earliest known Chinese materia medica-the Shen-nung pen-ts'ao-ching. Translators of the Chinese classics have included the records of i-mu-ts'ao. According to my knowledge, these works are all partial translations with the selections of the medicinal properties and the omissions on the methods of preparation. They have the outline and abandon the details. Consequently most of them are not clear. In order to

  3. Ansiedade ao tratamento odontológico em atendimento de urgência

    Directory of Open Access Journals (Sweden)

    Kanegane Kazue

    2003-01-01

    Full Text Available OBJETIVO: Avaliar a freqüência de pacientes com ansiedade ou medo do tratamento odontológico em um setor de urgência. MÉTODOS: Participaram do estudo 252 pacientes, com 18 anos ou mais, que compareceram ao setor de urgência de uma faculdade de odontologia, de São Paulo, SP, entre agosto e novembro de 2001. Para avaliar a ansiedade, foram utilizadas a Modified Dental Anxiety Scale (MDAS, e a Escala de Medo de Gatchel. O grupo estudado respondeu a questões sobre: tempo decorrido desde a última visita ao dentista e desde o início dos sintomas, escolaridade, renda familiar e história prévia de trauma. Os resultados foram analisados pelos testes estatísticos (chi2 e Teste Exato de Fisher. RESULTADOS: Foram identificados 28,2% de indivíduos com algum grau de ansiedade, segundo a MDAS, na qual as mulheres foram consideradas mais ansiosas que os homens (chi2=0,01; e 14,3% de pacientes com alto grau de medo segundo a Escala de Medo de Gatchel. Em 44,4% da amostra a demora para procura de alívio dos sintomas foi > sete dias. Mulheres ansiosas procuraram atendimento mais rapidamente e em maior número. Experiência traumática anterior ocorreu em 46,5% dos pacientes ansiosos. Não foi possível relacionar escolaridade e renda familiar com ansiedade e/ou medo. CONCLUSÕES: Pacientes ansiosos, com destaque para as mulheres, são freqüentes no atendimento odontológico de urgência. Experiência prévia traumática mostrou-se importante para o desenvolvimento da ansiedade em relação ao atendimento odontológico.

  4. Proteinorraquia total: variações relacionadas ao sexo e à idade

    Directory of Open Access Journals (Sweden)

    A. Spina-França

    1963-03-01

    Full Text Available Foi estudada a proteinorraquia total de 1.011 pacientes com LCR normal para investigar a influência da idade e do sexo. O método empregado para a determinação da concentração protêica foi o turbidimétrico do ácido tricloracético. A influência do fator etário foi estudada entre 3 meses e 70 anos de idade. Os resultados permitiram verificar que a concentração protêica do LCR é maior entre 3 e 6 meses de idade. Entre 1 e 40 anos de idade os valores médios são próximos entre si, situando ao redor de 16 e 18 mg por 100 ml. A partir de 40 anos de idade verifica-se tendência para ser progressivamente maior a proteinorraquia total. Essa tendência se acentua com o avançar da idade. Em relação ao sexo, foi verificado que a proteinorraquia total tende a ser maior no homem do que na mulher. A diferença entre as médias encontradas para os homens e mulheres foi estatisticamente significante. Êsses dados confirmam observações anteriores, caracterizando-os em relação ao método empregado para a determinação da concentração protêica do LCR.

  5. Da casa ao hotel: entre a hospitalidade e a economia do turismo

    Directory of Open Access Journals (Sweden)

    Felipe José Comunello

    2015-01-01

    Full Text Available O município de São Joaquim, na região serrana de Santa Catarina, tem sido destacado pela imprensa escrita e televisiva nacional como a cidade mais fria do Brasil, ao longo dos últimos vinte anos. Em pesquisa realizada para tese de doutorado, identifiquei que muitas proprietárias de pousadas, as “pousadeiras” como elas mesmas se chamam, começaram abrigando turistas em dificuldades em dias de frio intenso, quando não há hotéis e pousadas suficientes na cidade. A partir disso, elas acreditaram ser possível transformar suas casas em pousadas, tendo diante de si um problema também compartilhado com os profissionais do turismo, a chamada sazonalidade dos turistas. Tal fato provoca dúvidas sobre a sustentação econômica das pousadas e inquietação aos profissionais quanto ao sucesso econômico do turismo. Nesse artigo, isso é analisado tendo como referência uma proposta de parceria recebida por meus interlocutores por parte da operadora de turismo CVC e da empresa de eventos da RBS, afiliada da Rede Globo em Santa Catarina. A discussão é em torno de questões a partir de uma antropologia da hospitalidade. A análise sugere que essa parceria ameaça uma ordem moral estabelecida com base em determinados valores de hospitalidade para com estranhos, principalmente o aquecimento perante o frio.

  6. AO3D: A Monte Carlo code for modeling of environmental light propagation

    Energy Technology Data Exchange (ETDEWEB)

    Bates, David E. [Hawaii Institute of Geophysics and Planetology, School of Ocean and Environmental Technology, University of Hawaii, 2525 Correa Road, Honolulu, HI 96822 (United States)], E-mail: bates@higp.hawaii.edu; Porter, John N. [Hawaii Institute of Geophysics and Planetology, School of Ocean and Environmental Technology, University of Hawaii, 2525 Correa Road, Honolulu, HI 96822 (United States)

    2008-07-15

    A Monte Carlo radiative transfer program (Atmosphere-Ocean 3-Dimensional, AO3D) for modeling the coupled atmosphere-ocean environment has been developed. The code allows for the specification of optical properties for the atmosphere, land and ocean. Light rays are tracked as they pass between the atmosphere and the ocean, reflect off the ocean surface, the ocean floor, and off land, or are absorbed. In this version the polarization of light rays is not considered. The optical properties of each horizontally homogeneous layer within the atmosphere and ocean can be set on a layer-by-layer basis with a choice of phase functions, absorption and scattering coefficients, and index of refraction. A wind-dependent Cox and Munk ocean surface realization (with whitecaps) is implemented to model refraction and reflection from surface waves. Either spherical- or flat-Earth models can be used, and all refraction and reflection are accounted for. The AO3D model has been tested by parts, and as a whole by comparison with single- and total-scattering calculations from other radiative transfer codes. Comparisons with Monte Carlo calculations by Adams and Kattawar (agreement in TOA radiance within the published precision {approx}2%), MODTRAN4 (agreement in spherical-shell atmosphere (SSA) sky radiance within about 2%) and Coupled DIScrete Ordinate Radiative Transfer (COART) (agreement in plane-parallel (PP) sky radiance within 2%) are shown. Sun photometer measurements (including large air mass values) at the Mauna Loa Observatory are compared to AO3D simulations (for a spherical Earth) and suggest that a thin aerosol layer was present above the observatory at the time of the measurements.

  7. Treatment of AO/OTA 31-A3 intertrochanteric femoral fractures with a percutaneous compression plate

    Directory of Open Access Journals (Sweden)

    Fei Luo

    2014-01-01

    Full Text Available OBJECTIVE: AO/OTA 31-A3 intertrochanteric femoral fractures have completely different fracture line directions and biomechanical characteristics compared with other types of intertrochanteric fractures. The choice of the fixation method has been a focus of dispute among orthopedic trauma surgeons. The purpose of this study was to review the outcomes of these fractures treated with a percutaneous compression plate at our institute. METHOD: Seventeen patients with AO/OTA 31-A3 intertrochanteric femoral fractures were treated with a percutaneous compression plate at our institute from January 2010 to December 2011. The clinical data and imaging results were retrospectively analyzed. RESULTS: The medical complication of popliteal vein thrombosis occurred in one patient. Sixteen patients were followed up for 12 to 21 months. Two patients had malunion and mild pain. Fracture collapse occurred in two patients, with one having head penetration. These two patients had moderate pain. There were no occurrences of nonunion or reoperation. The mean Harris hip score obtained during the last follow-up was 84.1 (61-97. Patients with a poor quality of reduction were more likely to have pain results (p = 0.001. A trend existed toward the presence of a poor quality of reduction (p = 0.05 in patients with a collapse of fracture. Patients with poor preoperative mobility were more likely to have a lower Harris hip score (p = 0.000. CONCLUSION: The percutaneous compression plate is an alternative device for the treatment of AO/OTA 31-A3 intertrochanteric femoral fractures. Good fracture reduction and an ideal placement position of the neck screw are important in the success of the device.

  8. Adesão ao tratamento no transtorno bipolar Compliance to treatment in bipolar disorder

    Directory of Open Access Journals (Sweden)

    Aida Santin

    2005-01-01

    Full Text Available O transtorno bipolar (TB é uma doença crônica, recorrente, presente em 1,5% da população, estando associada a altas taxas de mortalidade e prejuízos socioeconômicos. O lítio, a carbamazepina e o ácido valpróico são os estabilizadores de humor mais usados. Em tratamentos prolongados, como é o caso do TB, a má-adesão dos pacientes é uma das maiores dificuldades. Verifica-se que fatores ligados ao paciente, aos medicamentos e aos médicos possam ser responsáveis pela baixa adesão. A psicoeducação, a terapia cognitivo-comportamental e a terapia focada na família são estratégias propostas para o aumento da adesão.Bipolar disorder (BD is a chronic and recurrent illness that occurs in 1,5% of the population. This illness is associated with high rates of mortality and social/economic burden. Lithium, carbamazepine and valproic acid are the most used mood stabilizers. In long term treatments, as in BD, one of the main difficulties is the patient's adherence. It appears that factors associated to the patient, drug and the physician are responsible for the low adherence. The use of psycho-education, cognitive-behavioral therapy and focused family therapy have been put forward as a means to increase adherence.

  9. Desempenho de bezerros aleitados com soro de queijo em associação ao colostro

    Directory of Open Access Journals (Sweden)

    Renata Nayhara de Lima

    2012-08-01

    Full Text Available O objetivo deste trabalho foi avaliar o desempenho de bezerros mestiços, aleitados com soro de queijo em associação ao colostro. Foram utilizados 24 bezerros Holandês x Zebu, distribuídos em delineamento inteiramente casualizado, com três tratamentos e oito repetições. Os tratamentos consistiram de: leite integral, 50% de leite integral + 50% de soro de queijo, e 30% de colostro + 70% de soro de queijo. O desenvolvimento dos bezerros foi avaliado até os 60 dias de idade, por meio de pesagens semanais e mensurações corporais. Para a estimativa de consumo, foram feitas medições diárias de consumo da dieta sólida, pelo método oferta/sobra. O desempenho econômico foi avaliado pelo cálculo de indicadores de custos e receitas, e de medidas de resultados econômicos. Não houve influência da dieta líquida sobre o consumo de matéria seca e sobre as médias de medidas corporais dos bezerros. Foram observadas diferenças significativas no ganho de peso dos animais na segunda e na quarta semanas de vida. A dieta com colostro apresentou o maior lucro adicional em comparação ao tratamento controle. A associação do soro de queijo ao colostro é a opção mais vantajosa economicamente, já que a substituição de 100% do leite por esses subprodutos não prejudicou o desempenho dos animais.

  10. Gastrite hemorrágica por alergia ao leite de vaca: relato de dois casos

    Directory of Open Access Journals (Sweden)

    Machado Rodrigo Strehl

    2003-01-01

    Full Text Available OBJETIVO: descrever dois lactentes com gastrite hemorrágica, devido à alergia ao leite de vaca. DESCRIÇÃO DOS CASOS: ambos os pacientes apresentavam hematêmese, vômitos e desnutrição. Os pacientes apresentavam infiltrado eosinofílico em mucosa gástrica biopsiada e resolução dos sintomas após o início de dieta com exclusão da proteína do leite de vaca. COMENTÁRIOS: gastrite hemorrágica devido à alergia ao leite de vaca é um diagnóstico incomum. Até o momento foram relatados 10 pacientes com gastrite alérgica, e as principais manifestações clínicas são vômitos, desnutrição, anemia e hematêmese. A gastrite por alergia ao leite de vaca pode apresentar-se em diferentes graus de gravidade, e pode ser subdiagnosticada em muitos pacientes. A menos que o tratamento correto seja iniciado, o paciente desenvolverá desnutrição protéico-calórica grave e anemia. Doença alérgica do trato gastrointestinal superior deve ser considerada em todos os lactentes com vômitos recorrentes, particularmente se complicado com hematêmese. O diagnóstico de gastrite alérgica é clínico, auxiliado pela endoscopia e anatomia patológica.

  11. Direito ao aborto, gênero e a pesquisa jurídica em direitos fundamentais

    OpenAIRE

    Azevedo, André Freire

    2017-01-01

    Resumo A partir de um retrato da situação atual do abortamento inseguro e de uma breve reconstrução das lutas feministas pela descriminalização do aborto no Brasil, o trabalho discute o papel do constitucionalismo democrático no reconhecimento de novos sujeitos de direitos sexuais e reprodutivos. Recorremos ao fundamento político-filosófico dos direitos sexuais e reprodutivos para apontar que sua regulamentação jurídica só tem validade se os “sujeitos de direitos” construídos e pressupostos p...

  12. Abordagem ao Doente “ABCDE”. Biomecânica do Trauma

    OpenAIRE

    Amaral, T

    2013-01-01

    Apresentação na qual é efectuada uma caracterização epidemiológica do Trauma comparando a distribuição bimodal vs trimodal assim como a causa e local de morte. De seguida são definidos cuidados emergentes a nível pré-hospitalar e as competências indispensáveis à práxis por parte do Enfermeiro. Por último reflectimos de que forma a abordagem e o assegurar do continuum de cuidados desde o pré-hospitalar à UCI (com passagem no SU) contribuem para a melhoria dos cuidados ao doente politraumatizad...

  13. AIDS e religiosidade: influências intersubjetivas aos acometidos pela epidemia

    OpenAIRE

    Silva, Paulo Emanuel

    2009-01-01

    Nos dias atuais, apesar de todas as informações inerentes aos mais diversos tipos de doenças, algumas delas ainda são motivos de angústia, receios e preconceitos. Na antiguidade, a lepra e a peste e, a partir do século XIX, o câncer, a sífilis e a tuberculose permeavam as mentalidades e marcavam seus portadores, uma vez que os significados das doenças iam além de seus diferentes sintomas. Algo semelhante vem ocorrendo no mundo contemporâneo no que diz respeito à Síndrome da Imu...

  14. Educação: pensadores ao longo da história: Seymour Papert

    OpenAIRE

    Sousa, João Sérgio de Pina Carvalho (Ed.); Meirinhos, Manuel; Patrício, Maria Raquel; Gonçalves, Vitor

    2016-01-01

    Seymour Aubrey Papert (1928-2016) natural de Pretória, África do Sul, faleceu aos 88 anos nos Estados Unidos da América. Matemático de renome mundial, pioneiro da inteligência artificial e da computação educacional, foi docente do MIT Media Lab. Este poster evidencia os principais fundamentos teóricos e práticos da sua obra pedagógica, a atualidade da sua pedagogia e as suas implicações na educação. info:eu-repo/semantics/publishedVersion

  15. Future use of silicon photomultipliers for K AOS at MAMI and P¯ANDA at FAIR

    Science.gov (United States)

    Achenbach, P.; Lorente, A. Sanchez; Majos, S. Sánchez; Pochodzalla, J.

    2009-10-01

    A characterization of scintillating fibres with silicon photomultiplier read-out was performed in view of their possible application in fibre tracking detector systems. Such a concept is being considered for the K AOS spectrometer at the Mainz Microtron MAMI and as a time-of-flight start detector for the hypernuclear physics programme at the P¯ANDA experiment of the FAIR project. Results on particle detection efficiency and time resolution are discussed. In summary, the silicon devices are very suitable for the detection of the low light yield from scintillating fibres insofar a trigger scheme is found to cope with the noise rate characteristics.

  16. Concepções de mulheres sobre a terminologia relativa ao aparelho reprodutor feminino

    OpenAIRE

    Celina Deves Marques

    2005-01-01

    Esta é uma pesquisa qualitativa fenomenológica com embasamento filosófico na fenomenologia da percepção de Merleau-Ponty. Tem como propósito conhecer as concepções das mulheres sobre a terminologia relativa ao aparelho reprodutor feminino. Os sujeitos do estudo foram 10 mulheres não-gestantes, não-puérperas e não-nulíparas usuárias do Programa de Saúde da Família (PSF) Jenor Jarros. O instrumento de pesquisa utilizado foi entrevista semi-estruturada no qual perguntava-se sobre o significado d...

  17. On random walk de Lévy aplicado aos mapas de variâncias

    Science.gov (United States)

    Klafke, J. C.

    2003-08-01

    Uma pergunta que surge ao nos confrontarmos com os mapas de variâncias, ou s-Maps [Klafke, J. C. "Estudo da Difusão Caótica em Ressonâncias Asteroidais", Tese de Doutorado, IAG/USP, 2002] diz respeito ao conteúdo físico de tais representações do espaço de fase. Ou seja, o que representa as variâncias das ações obtidas para uma determinada condição inicial e como relacioná-las com o tempo de difusão das órbitas, supondo-se que estas de fato estejam envolvidas em um processo difusivo? Para discutirmos essa questão, lançamos mão da modelagem dos processos estocásticos subjacentes às variâncias determinadas e implementamos uma série de simulações do tipo Monte Carlo a partir das informações registradas nos s-Maps calculados para algumas ressonâncias asteroidais bem estudadas (p.ex. 3: 1, 2: 1 e 3: 2). Para tanto, temos usado uma função de densidade de probabilidade gaussiana ao definir os n passos que permitirão estabelecer uma relação direta entre o Mapa de Difusão e o Mapa de Variâncias. Contudo, os resultados obtidos até agora tem subestimado o tempo de difusão esperado para os fenômenos conhecidos. Tal se deve ao fato de que, no processo difusivo real, é possível existirem passos de comprimento consideravelmente maiores que a média estabelecida pelas distribuições gaussiana ou normal, sobretudo quando se cruza uma região caótica. Neste trabalho, apresentamos os resultados comparativos de simulações de Monte Carlo com base no random walk de Lévy [Klafter, J. et al. 2002. "Beyond Brownian motion", Phys. Today, Feb, 33-39.], o qual possibilita passos esporádicos de comprimento acima do valor médio (saltos) permitindo estabelecer uma escala de tempo mais próxima da esperada para a difusão.

  18. Atomic Oxygen (AO) and Nitrogen (AN) In-situ Flux Sensor

    Science.gov (United States)

    2016-03-10

    AFRL-AFOSR-VA-TR-2016-0126 DURIP 09) AN ATOMIC OXYGEN FLUX MONITOR FOR USE IN THE SEARCH FOR NEW AND BETT Malcolm Beasley LELAND STANFORD JUNIOR UNIV...Grant # FA9550-01-1-0433 M. R. Beasley, PI Stanford University Project Title: Atomic Oxygen (AO) and Nitrogen (AN) In-situ Flux Sensor...with its ability to achieve controlled layer-by-layer growth on the atomic level. In the case of oxides and nitrides, one problem has been the lack

  19. Translation between the Neer- and the AO/OTA-classification for proximal humeral fractures

    DEFF Research Database (Denmark)

    Brorson, Stig; Eckardt, Henrik; Audigé, Laurent

    2013-01-01

    The reporting and interpretation of data from clinical trials of proximal humeral fractures are hampered by the use of two partly incommensurable fracture classification systems: the Neer classification and the AO/OTA classification. It remains difficult to interpret and generalize results......, to conduct prognostic studies, and to obtain consensus on treatment recommendations when concise definitions and a common 'fracture language' are lacking. Thus, we compared both classifications systems using primary data from large clinical studies to assess how thoroughly both systems conveyed clinically...

  20. Peru: cultivo de coca, cocaína e combate ao narcotráfico

    Directory of Open Access Journals (Sweden)

    Marcelo Santos

    2010-06-01

    Full Text Available O artigo apresenta uma breve análise sobre a atual situação dos cultivos de coca, produção de cocaína e combate ao narcotráfico no Peru.

  1. Mortalidade atribuível ao tabagismo no Brasil em 2003

    OpenAIRE

    Paulo Cesar Rodrigues Pinto Correa

    2007-01-01

    Existem vários métodos para fazer a estimativa da mortalidade atribuível ao tabagismo (MAT). Estimativas confiáveis da MAT são muito importantes para planejar, implementar e avaliar o impacto de programas de controle do tabagismo. A presente dissertação descreve o resultado de uma revisão dos artigos sobre MAT publicados nas bases Medline, Lilacs e Bireme até 20/10/2005. Foram identificados e analisados sete métodos para cálculo da mesma. O método de Levin, o primeiro a ser descrito - em 1953...

  2. Suscetibilidade do capim-colonião e de cultivares de milho ao flúor

    Directory of Open Access Journals (Sweden)

    Rimena Ramos Domingues

    2011-01-01

    Full Text Available A emissão de fluoretos à atmosfera oriunda da produção de superfosfatos e de cerâmica tem causado preocupação pelo efeito tóxico às plantas, contudo são poucos os estudos desenvolvidos acerca do problema com espécie de interesse econômico agrícola. Desenvolveu-se o estudo para avaliar o efeito do flúor (F atmosférico em plantas de capim-colonião e de cultivares de milho, utilizando como referência espécies bioindicadoras do tipo sensível e tolerante. As plantas foram expostas à contaminação pelo F atmosférico por curtos períodos durante 32 dias em sistema de nebulização com 0,16 mol L-1 de ácido fluorídrico no ambiente interno de uma câmara (~0,20 mmol m-3 de F, havendo um controle não exposto, com quatro repetições. A exposição das plantas ao F causou aumento da concentração do elemento nas folhas até 60 mg kg-1 para o capim-colonião, e entre 100 mg kg-1 nas folhas novas e 170 mg kg-1 nas folhas velhas para quatro cultivares de milho, o que demonstrou o efeito cumulativo do elemento no ambiente. Sintomas visuais da toxicidade foram observados nas plantas e se caracterizaram pela ocorrência de cloroses e necroses na lâmina foliar. O capim-colonião é uma espécie bastante sensível ao poluente no ar. As cultivares de milho DKB 390 e Ômega 8315 também são mais sensíveis ao F quando comparadas às AG7088 e 2B707. Os teores de clorofila a nas plantas foram mais afetados pelo F em relação aos teores de clorofila b.

  3. Var??n de 30 a??os con dolor pretibial bilateral

    OpenAIRE

    Vargas-Hitos, Jos?? Antonio; Garc??a-Castro, Jos?? Miguel; Ja??n- ??guila, Fernando; Jim??nez-Alonso, Juan

    2012-01-01

    Var??n de 30 a??os que consultaba por dolor intenso y progresivo de dos meses de evoluci??n localizado en la cara anterior y distal de ambas piernas sin factor desencadenante aparente y mala respuesta a tratamiento analg??sico convencional. El paciente negaba otros s??ntomas a excepci??n de un rash eritematoso no pruriginoso generalizado que hab??a afectado tronco, palmas y plantas y que hab??a sido considerado como una reacci??n de hipersensibilidad a alguna de las medicaciones p...

  4. Fenómenos cognitivos subjacentes ao milenarismo: quando uma profecia falha

    OpenAIRE

    Soares Martins, José; Cameira, Miguel

    2012-01-01

    Apresenta-se o conceito de dissonância cognitiva (Festinger, 1957) como o mecanismo cognitivo explicativo do proselitismo que frequentemente sucede a profecias não verificadas. Pormenorizam-se as características da dissonância cognitiva ao nível individual e as tácticas de redução do desconforto provocado pela existência de cognições contraditórias (crença-evidência empírica). Discriminam-se as condições propostas por Festinger et al (1956) para o surgimento da necessidade de angariar novos c...

  5. Cateterismo cardíaco esquerdo: lacunas nas informações transmitidas aos pacientes

    OpenAIRE

    Cavalcanti,Taciana de Castilhos; Sarmento-Leite, Rogério; Carlos A.M. Gottschall; de Quadros, Alexandre Schaan; Goldmeier,Sílvia; De Souza, Emiliane Nogueira; de Moraes, Maria Antonieta Pereira

    2008-01-01

    INTRODUÇÃO: A prática dos procedimentos na Cardiologia Intervencionista está marcada por grandes avanços, mas o mesmo não se verifica no trato das informações e conhecimento dos pacientes acerca do tema. É imperativa a necessidade de consolidar as orientações transmitidas aos pacientes, instruindo-os sobre os benefícios alcançados pela sua compreensão sobre os exames invasivos. OBJETIVO: Verificar o conhecimento dos pacientes submetidos a cateterismo cardíaco em um hospital especializado em C...

  6. Por uma abordagem relacional ao conceito de vida no ensino de biologia

    OpenAIRE

    Coutinho,Francisco Ângelo; Martins,Rogério Parentoni; Ribeiro, Natália Almeida

    2015-01-01

    Segundo a teoria de perfil conceitual, o conceito “vida” possui três zonas diferenciadas correspondentes a três modos de compreensão. A internalista concebe “vida” como processo, propriedade ou objeto inerente ao vivente. A externalista propõe “vida” desvinculada do vivente, ou seja, vida apenas teria sentido a partir de uma referência externa como, por exemplo, admitem certas concepções religiosas e filosóficas. A relacional admite que vida deva expressar uma relação entre entidades e/ou sis...

  7. Ao serviço do líder: as campanhas eleitorais do Partido Socialista

    OpenAIRE

    Marco Lisi

    2008-01-01

    Este artigo procura analisar a evolução das campanhas eleitorais do Partido Socialista entre 1976 e 2005, evidenciando as suas principais características organizativas ao nível nacional e local. As conclusões apontam para a importância dos especialistas externos e para o reforço da centralização, que contribuem para o aumento da autonomia do líder socialista.This article analyses the development of the Socialist Party's election campaigns between 1976 and 2005, revealing their main organizati...

  8. Novas abordagens terapêuticas no combate ao Envelhecimento Cutâneo

    OpenAIRE

    Santos, Joana Loureiro Marques dos

    2011-01-01

    Trabalho apresentado à Universidade Fernando Pessoa como parte dos requisitos para obtenção do grau de Mestre em Ciências Farmacêuticas. O envelhecimento cutâneo é um processo complexo e multifatorial, que resulta em alterações funcionais e estéticas da pele. Os avanços na biologia da pele têm aumentado a compreensão da homeostasia deste órgão, assim como do seu processo de envelhecimento, levando ao desenvolvimento de tratamentos e técnicas com a finalidade de prevenir este mecanismo e de...

  9. Pela atenção ao comum: entrevista com Muniz Sodré

    Directory of Open Access Journals (Sweden)

    Anelise Angeli De Carli

    2017-09-01

    Full Text Available A entrevista com Muniz Sodré propõe ao teórico da comunicação algumas perguntas que atravessam a sua proposta de pensamento ampliado para o termo comunicação. O autor fala sobre a linguagem na perspectiva da reflexividade e sobre os efeitos e as limitações do bios midiático. Ainda, Sodré propõe pensar o algoritmo das tecnologias de informação como um tipo de imagem do contemporâneo.

  10. A visita de um afro-americano ao paraíso racial

    OpenAIRE

    Petrônio Domingues

    2006-01-01

    Em 1923, o jornalista e empresário afro-americano Robert Abbott visitou o Brasil. De volta aos Estados Unidos, publicou uma série de artigos no jornal Chicago Defender, informando que, aqui, os negros não enfrentavam problemas que dificultasse ou impedisse seu pleno desenvolvimento econômico, social, político, cultural, ou seja, eles viviam numa espécie de paraíso racial. A principal questão que vai ser investigada neste artigo é saber por que Abbott retratou um quadro tão mítico das relações...

  11. [Compression osteosyntheses with the new AO universal nail. Functional principle and biomechanical prerequisites].

    Science.gov (United States)

    Ritter, G

    1991-01-01

    The new AO universal nail, with its special construction, allows extremely stable compression osteosynthesis in correctly selected fractures. Compression osteosynthesis with an intramedullary brace has definite advantages for fracture healing and biomechanics. The basic requirement, especially for the long-term maintenance of pressure, is truly stable anchorage of the locking bolts in the bone. Previous investigations by the author have shown that this is only possible in the shaft of the bone. Anchoring stability is not sufficient in the cancellous juxta-articular bone. Five years of clinical experience fully confirm the theoretical expectations.

  12. Toxicidade subcrônica de lambaris Astyanax aff. bimaculatus expostos ao zinco

    OpenAIRE

    Condessa, Suellen Silva

    2009-01-01

    Muitos metais ocorrem naturalmente em ambientes aquáticos e são classificados como poluentes somente quando adicionados pelo homem em quantidades suficientes para produzir efeitos deletérios em organismos. Dentre estes metais já existentes no ambiente aquático pode-se citar o zinco (Zn) que é um elemento essencial para os seres vivos. Em concentrações elevadas, o Zn pode se tornar tóxico aos seres vivos por reduzir os níveis séricos de cobre, causando a diminuição da imunidade. O presente est...

  13. Marketing aplicado ao território o estudo de caso de Queluz

    OpenAIRE

    Marques, Sérgio Carlos Esteves

    2013-01-01

    A presente investigação visa compreender como o marketing poderá ser aplicado ao território através de um caso prático, a cidade de Queluz. O enquadre teórico base desta pesquisa contempla os conceitos de marketing territorial (Caroli 2006, 2010; Cidrais 1998; Kotler et al., 2003, 2004, 2007, 2009) e marca territorial (Azevedo, 2008, 2010; Elizagarate, 2008; Lencastre, 2007). A metodologia envolve observação directa, recolha de informação documental e de divulgação da cidade, t...

  14. Fatores imunogenéticos associados ao diabetes mellitus do tipo 1

    OpenAIRE

    Ana Paula Morais Fernandes; Ana Emilia Pace; Maria Lúcia Zanetti; Milton Cesar Foss; Eduardo Antonio Donadi

    2005-01-01

    O diabetes mellitus do tipo 1 tem sido considerado uma doença auto-imune órgão-específica, decorrente da destruição seletiva das células betapancreáticas. Apresenta patogenia complexa, envolvendo a participação de vários fatores, dentre esses a susceptibilidade imunogenética com forte associação aos genes de histocompatibilidade (HLA), eventos ambientais e resposta auto-imune com presença de auto-anticorpos e/ou linfócitos auto-reativos, culminando em anormalidades metabólicas. Neste estudo, ...

  15. Mecanismos e fatores associados aos sintomas gastrointestinais em pacientes com diabetes melito

    OpenAIRE

    Mônica Loureiro Celino Rodrigues; Maria Eugênia Farias Almeida Motta

    2012-01-01

    OBJETIVOS: Apresentar a frequência, os principais fatores causadores dos sintomas gastrointestinais em pacientes portadores do diabetes melito e controvérsias quanto à sua ocorrência em crianças e adolescentes. FONTES DOS DADOS: Revisão não sistemática nas bases de dados MEDLINE/PubMed e SciELO (1983-2011), além de capítulos de livros relevantes. Foram selecionados os artigos mais atuais e representativos do tema. SÍNTESE DOS DADOS: A prevalência do diabetes melito vem aumentando ao longo dos...

  16. Neuropatia Periférica Familiar por Susceptibilidade ao Entrapment (Neuropatia Tomaculosa)

    OpenAIRE

    Pinto Viana, J; Coimbra, J.; Goulart, Z; Bigotte de Almeida, L; Cabral Beirão, J

    1991-01-01

    Os autores apresentam um caso de neuropatia periférica familiar por susceptibilidade ao entrapment e comparam-no com os descritos na literatura. As principais características desta neuropatia são: hereditariedade autossómica dominante, mononeuropatias recorrentes de localização variável (cubital, mediano, ciático poplíteo, externo, plexo braquial) e aspectos morfológicos característicos na biópsia do nervo. O nervo sensitivo revela alterações predominantes desmielinizantes, com espessamentos ...

  17. Pneumonia em organização secundária ao uso de amiodarona

    Directory of Open Access Journals (Sweden)

    GULMINI LIA AUGUSTA DE SOUZA

    2001-01-01

    Full Text Available A pneumonia em organização secundária ao uso de amiodarona é rara, com apenas oito casos relacionados na literatura. No presente relato uma paciente de 75 anos, com uso cumulativo de 43g, apresentou tosse produtiva, dispnéia progressiva e infiltrados bilaterais na radiografia do tórax. A biópsia transbrônquica confirmou o diagnóstico. Com a retirada da droga houve melhora clínica e funcional.

  18. A experiência de adolescentes abandonados e institucionalizados frente ao desligamento institucional

    OpenAIRE

    Severino Ramos Lima de Souza

    2001-01-01

    Sabemos que muitas das crianças abrigadas em instituições para abandonados, infelizmente, não serão beneficiadas pelos Programas de Colocação em Lar Substituto (guarda, tutela e adoção). Desse modo, passam a viver na instituição até que completem a maioridade quando, inevitavelmente, terão que ser desligadas. Este estudo vem focalizar, portanto, a experiência de adolescentes abandonados e institucionalizados frente ao desligamento institucional, em função da maioridade. Trata-se de uma pesqui...

  19. Tratamento fungicida e peliculização de sementes de soja submetidas ao armazenamento

    OpenAIRE

    Pereira,Carlos Eduardo; Oliveira,João Almir; Guimarães,Renato Mendes; Vieira,Antônio Rodrigues; Evangelista,José Renato Emilioreli; Oliveira,Gustavo Evangelista

    2011-01-01

    O tratamento de sementes de soja com fungicidas vem sendo utilizado como importante ferramenta no controle de patógenos. Nesse trabalho, objetivou-se estudar o desempenho de sementes de soja tratadas com fungicidas e peliculizadas, antes e após o armazenamento. Foram utilizados cinco lotes de sementes, cultivar Monsoy 6101, submetidos aos tratamentos: thiabendazole+thiram sem polímero, carbendazin+thiram sem polímero, sem fungicida (testemunha) sem polímero, além desses tratamentos realizados...

  20. Do códige ao monitor: a trajetória do escrito

    Directory of Open Access Journals (Sweden)

    Roger Chartier

    1994-08-01

    Full Text Available Estariam os textos, de agora em diante, fadados a uma existência eletrônica? Os livros, na forma que conhecemos, desde o século XVI, estariam condenados a desaparecer progressiva e definitivamente? Antes de responder a essas perguntas, Roger Chartier percorre a longa história do livro até aos nossos dias: do volumen ao códice, da xilografia oriental à invenção de Gutenberg, da biblioteca de Alexandria até às nossas grandes bibliotecas modernas, do códice ao monitor. A nossa época encontra-se diante de um desafio: o de utilizar de modo adequado o suporte eletrônico do escrito, pois os significados de um texto dependem muito do suporte material deste. A felicidade extravagante vislumbrada diante da produção, consulta, comunicação imediata e universal de textos na telinha do computador deverá harmonizar-se com a consciência do papel reservado ao novo suporte: proteção, conservação e divulgação do patrimônio escrito da humanidade na sua materialidade tanto quanto na sua simbólica.Would texts, from now on, be fated to a mere electronic existence? Would books, in their format known since the sixteenth century, be condemned to disappear progressively and definitely? Before answering these questions we must follow the long history of books: from volumen to codex, from oriental xylography to Gutenberg's invention, from the Alexandrian bibliotheca to our great modern libraries, from codices to monitors. Our time faces a challenge: how to use appropriately the electronic support of writing, since the meanings of a text depend very much on its material support. The extravagant happiness gleamed before the production, the consultation, the immediate and universal communication of texts in the computer's screen should be in harmony with the conscience of the role reserved for the new support: protection, conservation and divulgation of the writing heritage of manking, both in its material and symbolic character.

  1. Vulnerabilidade de adolescentes afrodescencentes e brancos em relação ao HIV/Aids

    OpenAIRE

    Camargo, Brigido Vizeu; Giacomozzi, Andréia Isabel; Wachelke, João Fernando Rech; Aguiar, Adriana de

    2010-01-01

    Trata-se de um estudo quantitativo e comparativo entre adolescentes brancos e afrodescendentes sobre vulnerabilidade ao HIV/Aids. A amostra não é randômica e foi formada por 715 estudantes do ensino público noturno de escola de periferia de Santa Catarina. O instrumento utilizado foi um questionário autoadministrado com questões fechadas. Foram analisadas cinco dimensões: afetiva e sexual, conhecimento sobre Aids, atitude, risco e percepção de risco e conduta protetora. Verificou-se que 73,8%...

  2. Prevalência e fatores de risco relacionados ao uso de drogas entre escolares

    Directory of Open Access Journals (Sweden)

    José Baus

    2002-02-01

    Full Text Available OBJETIVO: Analisar a prevalência e os fatores de risco relacionados ao uso indevido de drogas entre estudantes de uma escola pública de primeiro e segundo graus. MÉTODOS: Foi realizado estudo descritivo transversal, utilizando, como instrumento de pesquisa, um questionário anônimo, padronizado e amplamente testado no Brasil para levantamento do uso de drogas. A população estudada foi constituída de 478 estudantes de escola pública de primeiro e segundo graus, de Florianópolis, SC. Os questionários foram aplicados por estudantes universitários devidamente treinados. Entre os estudantes pesquisados, 43% e 32% foram de faixa etária de 13 a 15 anos e de 16 a 18 anos, respectivamente, com predomínio de classes socioeconômicas mais altas. RESULTADOS: A prevalência de uso de maconha na vida (19,9%, solventes (18,2%, anfetamínicos (8,4% e álcool (86,8% foi elevada em Florianópolis, comparada a outras capitais da região Sul e à média brasileira. Notou-se elevado e freqüente uso (seis ou mais vezes por mês de álcool (24,2%, maconha (4,9%, solventes (2,5% e anfetamínicos (2,3%. Os fatores demográficos relacionados ao uso de drogas na vida foram idade, sexo, classe socioeconômica e vida junto aos pais. A chance de garotas usarem remédios para emagrecer ou ficarem acordadas foi o dobro da chance de garotos e, quanto ao uso de tranqüilizantes, quase o triplo. Os garotos tinham um risco quase duas vezes maior de uso de solvente do que as garotas. A classe socioeconômica alta foi associada a um risco duas vezes maior do uso de álcool do que a classe baixa. O risco de uso de cigarro e maconha na vida foi 84% e 67% maior, respectivamente, para alunos cujos pais estavam separados. CONCLUSÃO: Constatou-se alta prevalência de uso de várias drogas entre os alunos de primeiro e segundo graus.

  3. Prevalência e fatores de risco relacionados ao uso de drogas entre escolares

    Directory of Open Access Journals (Sweden)

    Baus José

    2002-01-01

    Full Text Available OBJETIVO: Analisar a prevalência e os fatores de risco relacionados ao uso indevido de drogas entre estudantes de uma escola pública de primeiro e segundo graus. MÉTODOS: Foi realizado estudo descritivo transversal, utilizando, como instrumento de pesquisa, um questionário anônimo, padronizado e amplamente testado no Brasil para levantamento do uso de drogas. A população estudada foi constituída de 478 estudantes de escola pública de primeiro e segundo graus, de Florianópolis, SC. Os questionários foram aplicados por estudantes universitários devidamente treinados. Entre os estudantes pesquisados, 43% e 32% foram de faixa etária de 13 a 15 anos e de 16 a 18 anos, respectivamente, com predomínio de classes socioeconômicas mais altas. RESULTADOS: A prevalência de uso de maconha na vida (19,9%, solventes (18,2%, anfetamínicos (8,4% e álcool (86,8% foi elevada em Florianópolis, comparada a outras capitais da região Sul e à média brasileira. Notou-se elevado e freqüente uso (seis ou mais vezes por mês de álcool (24,2%, maconha (4,9%, solventes (2,5% e anfetamínicos (2,3%. Os fatores demográficos relacionados ao uso de drogas na vida foram idade, sexo, classe socioeconômica e vida junto aos pais. A chance de garotas usarem remédios para emagrecer ou ficarem acordadas foi o dobro da chance de garotos e, quanto ao uso de tranqüilizantes, quase o triplo. Os garotos tinham um risco quase duas vezes maior de uso de solvente do que as garotas. A classe socioeconômica alta foi associada a um risco duas vezes maior do uso de álcool do que a classe baixa. O risco de uso de cigarro e maconha na vida foi 84% e 67% maior, respectivamente, para alunos cujos pais estavam separados. CONCLUSÃO: Constatou-se alta prevalência de uso de várias drogas entre os alunos de primeiro e segundo graus.

  4. “DAY AFTER”: O ADEUS AOS JOGOS OLÍMPICOS DE LONDRES/2012 E AS BOAS VINDAS AO RIO/2016

    Directory of Open Access Journals (Sweden)

    Silvan Menezes dos Santos

    2015-08-01

    Full Text Available Este trabalho discute os modos e as estratégias de enquadramento presentes na cobertura jornalística do encerramento dos Jogos Olímpicos de Londres/2012 realizada por três emissoras brasileiras de TV: Rede Globo, Bandeirantes e Record. Partindo dos dados obtidos, aborda os seguintes eixos de discussão: 1 o agendamento dos Jogos Olímpicos do Rio de Janeiro 2016; 2 a construção do ídolo esportivo; 3 infotenimento. Por fim, destaca a ocorrência de agendamento midiático dos Jogos Olímpicos de 2016 já no encerramento dos Jogos de Londres; o estabelecimento de relações de identificação entre atletas medalhistas e sentimentos otimistas em relação aos megaeventos por vir; e, finalmente, a confusão de fronteiras entre informação e entretenimento no discurso jornalístico esportivo.

  5. Qualidade da atenção ao parto em maternidades do Rio de Janeiro Quality of birth care in maternity hospitals of Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    Eleonora d'Orsi

    2005-08-01

    Full Text Available OBJETIVO: Avaliar a qualidade da atenção durante o processo de trabalho de parto de acordo com normas da Organização Mundial de Saúde. MÉTODOS: Trata-se de estudo do tipo caso-controle, realizado em duas maternidades: pública e conveniada com o Sistema Único de Saúde, no Município do Rio de Janeiro. A amostra foi composta por 461 mulheres na maternidade pública (230 partos vaginais e 231 cesáreas e por 448 mulheres na maternidade conveniada (224 partos vaginais e 224 cesáreas. De outubro de 1998 a março de 1999, foram realizadas entrevistas com puérperas e revisão de prontuários. Foi construído escore sumarizador da qualidade do atendimento. RESULTADOS: Observou-se baixa freqüência de algumas práticas que devem ser encorajadas, como presença de acompanhante (1% na maternidade conveniada, em ambos os tipos de parto, deambulação durante o trabalho de parto (9,6% das cesáreas na maternidade pública e 9,9% dos partos vaginais na conveniada e aleitamento na sala de parto (6,9% das cesáreas na maternidade pública e 8,0% das cesáreas na conveniada. Práticas comprovadamente danosas e que devem ser eliminadas como uso de enema (38,4%, tricotomia, hidratação venosa de rotina (88,8%, uso rotineiro de ocitocina (64,4%, restrição ao leito durante o trabalho de parto (90,1% e posição de litotomia (98,7% para parto vaginal apresentaram alta freqüência. Os melhores resultados do escore sumarizador foram obtidos na maternidade pública. CONCLUSÕES: As duas maternidades apresentam freqüência elevada de intervenções durante a assistência ao parto. A maternidade pública, apesar de atender clientela com maior risco gestacional, apresenta perfil menos intervencionista que maternidade conveniada. Procedimentos realizados de maneira rotineira merecem ser discutidos à luz de evidências de seus benefícios.OBJECTIVE: To evaluate the quality of birth care based on the World Health Organization guidelines. METHODS: A case

  6. Exposição ao fumo do tabaco (EFT e morbilidade respiratória em crianças em idade escolar

    Directory of Open Access Journals (Sweden)

    C. Constant

    2011-01-01

    Full Text Available Resumo: Introdução: A exposição ao fumo do tabaco (EFT é factor de risco para Doença Pulmonar Obstrutiva Crónica e um problema major de saúde pública. A EFT pré e/ou pós-natal determina redução precoce da função pulmonar e aumento da morbilidade respiratória, dependente da dose. Tem sido sugerido que a EFT domiciliária é influenciada por factores socioeconómicos. Métodos: Estudo de rastreio epidemiológico transversal de dados de 313 crianças (52% rapazes de 4 Escolas Básicas de Lisboa [1.° ano (54% e 4.° ano]. A EFT e sintomatologia respiratória foram avaliadas a partir de questionário auto-preenchido pelos pais. Todas as crianças efectuaram espirometria na escola e 54% foram consideradas aceitáveis de acordo com critérios ATS/ERS. Efectuou-se análise descritiva e bivariada das variáveis com maior interesse e análise de regressão logística múltipla ajustada para as variáveis com significado clínico/estatístico. Resultados: Em 41% dos casos a criança convivia com fumadores no domicílio (EFT na gravidez 18%, mãe fumadora 32%, pai fumador 38%. Os pais fumadores tinham escolaridade inferior e ocupações menos qualificadas. Tosse foi mais frequente nas crianças com mãe fumadora (OR ajustado = 2,1 95%CI 1,1–4,0 e sibilância nas crianças com EFT na gravidez e com mãe/pai fumadores. Todas as diferenças foram significativas (p <  0,05. Não se encontrou associação entre educação parental e sintomatologia respiratória ou ETF e infecções respiratórias/asma/diminuição de valores espirométricos. Conclusão: A EFT é frequente em crianças em idade escolar em Lisboa e condiciona morbilidade respiratória significativa. Intervenções dirigidas devem ter em conta condições sociais. Neste estudo a espirometria de campo foi pouco útil na detec

  7. Do encanto ao encontro de vozes afro-brasileiras na tradição oral

    Directory of Open Access Journals (Sweden)

    Josiley Francisco de Souza

    2010-12-01

    Full Text Available Ao longo da história, é possível perceber que, em todas as sociedades, a arte de contar sempre fez parte da nossa vida e garantiu a manutenção de memórias e saberes transmitidos no tecido das narrativas. Um dos lugares onde essa arte se faz presente com vigor é a África. As tradições orais têm sido apontadas por diversos pesquisadores como um traço distintivo da cultura africana. E, no exercício dessa arte, é possível ouvir diálogos e ressonâncias entre vozes africanas e brasileiras. Por intermédio de uma arte marcada pelo exercício do contar de novo, percebe-se contatos entre vozes que não se calam, que se traduzem e se inscrevem em histórias que se transmitem de boca a ouvido e da letra ao verbo. Portanto, o que se pretende neste artigo é, no processo de intensos entrecruzamentos de vozes e culturas que permeiam a tradição oral, analisar diálogos e ressonâncias transtextuais entre contos orais registrados no Brasil e em Angola.Palavras-chave: Tradição; Arte de contar; Conto oral; Memória; África; Brasil; Chatelain.

  8. Fatores associados ao aborto induzido entre jovens pobres na cidade de São Paulo, 2007

    Directory of Open Access Journals (Sweden)

    Rebeca de Souza e Silva

    2012-12-01

    Full Text Available Esse artigo investiga fatores associados ao aborto induzido entre jovens residentes numa comunidade pobre da cidade de São Paulo. A amostra foi composta por 102 homens e 99 mulheres de 14 a 25 anos de idade que já haviam iniciado suas vidas sexuais. Usou-se o modelo hierárquico de regressão logística. As variáveis não ter companheiro sexual no momento da entrevista, sexo do entrevistado, idade no momento da entrevista, priorizar morar só e número de gestações compuseram o modelo final. Dar muita importância a morar só quadruplica a chance de ocorrer um aborto. Jovens mais velhos foram menos propensos a se deparar com um aborto, dado que a chance de se optar pelo aborto se reduz 17% para cada incremento de um ano na idade dos jovens. Isso é indicativo de que as gestações ocorreram de forma inesperada, intempestiva, como é praxe nas condutas adolescentes, sendo as maiores candidatas a terminarem em aborto provocado. Evidencia-se, portanto, a necessidade de serem investidos recursos financeiros para obtenção de métodos contraceptivos eficazes e inócuos, destinados ao início da vida sexual.

  9. Trabalho em turnos: estado geral de saúde relacionado ao sono em trabalhadores de enfermagem

    Directory of Open Access Journals (Sweden)

    Sandra Soares Mendes

    2012-12-01

    Full Text Available O objetivo deste estudo foi identificar os sintomas referentes ao estado geral de saúde associado ao trabalho em turnos de enfermagem e relacioná-los com a qualidade do sono. O estudo foi realizado no Hospital da Irmandade da Santa Casa de Poços de Caldas, Minas Gerais. Participaram 136 profissionais de enfermagem, com média de idade de 33,1 anos, divididos nas seguintes categorias: enfermeiro (8,1%; técnico de enfermagem (80,9%; auxiliar de enfermagem dos turnos diurno e noturno (11%. Os sintomas de saúde foram identificados a partir do Inventário de Estado Geral de Saúde, e a qualidade do sono foi avaliada pelo Diário do Sono. Os dados foram estatisticamente significativos pelo Teste Qui-Quadrado (p=0,021 para a presença do sintoma de flatulência ou distensão abdominal no turno noturno. Constatou-se com a análise de regressão linear múltipla que os sujeitos do turno diurno que apresentaram os sintomas de má digestão (às vezes ou sempre e irritabilidade (sempre tiveram pior qualidade de sono noturno.

  10. LUCRO RESIDUAL E CONTABILIDADE: INSTRUMENTAL DE ANALISE FINANCEIRA E MENSURAcAO DE PERFORMACES

    Directory of Open Access Journals (Sweden)

    Gualter Portella

    2009-09-01

    Full Text Available Estes últimos anos, os mercados de capitais e financeiro tem sido invadidos por sistemas de administração financeira baseados no conceito de lucro residual. As firmas de consultoria financeira apresentam o Iucro residual rebatizado sob o nome de EVA (Economic value added ou Lucro Econômico - como instrumento de avaliação economico-financeira, alinhamento dos interesses de acionistas e administradores e mensuração de performance empresarial. Por essa multifuncionalidade, esses sistemas têm alcançado altos índices de popularidade junto ao empresariado. Entretanto, pouco tem se falado sobre a base te6rica desses sistemas de gerenciamento financeiro que liga os fundamentos de finanças com a disciplina contábil, sendo que e justamente esse elo o que os tem tornado populares. Afinal de contas, a contabilidade c conhecida como a linguagem dos neg6cios e por intermédio de seu vocabulário especifico são comunicados os desempenhos atuais c as expectativas em relação ao desempenho futuro das empresas. Por exemplo, os executivos utilizam-se de indicadores como o retorno sobre o patrimônio liquido (RSPL ou a margem de lucros para avaliar e comunicar a performance atual de suas empresas.

  11. Fatores associados aos óbitos entre homens envenenados por carbamato (“chumbinho”

    Directory of Open Access Journals (Sweden)

    Júlio César Santos da Silva

    Full Text Available RESUMO Objetivo Determinar os fatores associados aos óbitos em vítimas de envenenamento por carbamato (“chumbinho”. Método Estudo retrospectivo, epidemiológico tipo caso-controle, baseado nas fichas de notificação de intoxicação do centro de controle de intoxicações localizado na região metropolitana do Rio de Janeiro. Foram utilizadas 24 fichas de notificação de intoxicações de homens dos 20 aos 59 anos com história de envenenamento por carbamato entre 2005 e 2009. As fichas foram sorteadas aleatoriamente, respeitando-se a razão de 1:3 (um caso para três controles. A faixa etária variou de 23 a 58 anos; a média 43,83 anos. Resultados Os sintomas mais recorrentes foram: miose (OR = 1.0; IC 95%: 0,27 – 3,69. p= 1.0, sialorreia (OR = 0,83; IC 95%: 0,22 – 3,12. p= 0,78, dispneia (OR = 0,66; IC 95%: 0.14 – 3,03. p= 0,59. Conclusão Os óbitos apresentaram associação com sialorreia, miose e dispneia e uma forte associação com estertores pulmonares, broncoespasmos e os roncos pulmonares.

  12. VizieR Online Data Catalog: Robo-AO observed cool subdwarf companions (Ziegler+, 2015)

    Science.gov (United States)

    Ziegler, C.; Law, N. M.; Baranec, C.; Riddle, R. L.; Fuchs, J. T.

    2017-09-01

    We selected targets from the 564 spectral type F- through M-subdwarf candidates studied by Marshall (2007, J/AJ/134/778). These targets were selected from the New Luyten Two-Tenths catalog (NLTT; Luyten, 1979nlcs.book.....L; Luyten & Hughes 1980, Proper-Motion Survey with the Forty-Eight Inch Schmidt Telescope LV First Supplement to the NLTT Catalogue (Minneapolis, MN: Univ. Minnesota Press)) of high proper motion stars (>0.18 arcsec/yr) using a reduced proper motion diagram (RPM). Of the 552 subdwarfs confirmed by Marshall, a randomly selected sample of 348 G-, K-, and M-subdwarfs were observed by Robo-AO when available between other high priority surveys. We obtained high-angular-resolution images of the 348 subdwarfs during 32 separate nights of observations between 2012 September 3 and 2013 August 21 (UT). The observations were performed using the Robo-AO laser adaptive optics system (Riddle et al. 2012SPIE.8447E..2OR; Baranec et al. 2013, J. Visualized Exp. 72 e50021; 2014ApJ...790L...8B) mounted on the Palomar 60 inch telescope. (1 data file).

  13. Prevenção ao crime e teoria social Crime prevention and social theory

    Directory of Open Access Journals (Sweden)

    João Trajano Sento-Sé

    2011-01-01

    Full Text Available O artigo estabelece um diálogo entre a criminologia positivista e algumas correntes contemporâneas da prevenção ao crime inspiradas em teorias sociológicas. Através desse exercício, busca-se evidenciar que algumas das formulações focadas no campo da prevenção já aparecem, em estado embrionário, na agenda teórica positivista. Do mesmo modo, torna-se possível explicitar que alguns postulados empíricos e práticos do positivismo são menos estranhos às teorias contemporâneas de prevenção ao crime do que se costuma reconhecer.The article establishes a dialogue between positivist criminology and some contemporary currents on crime prevention inspired in sociological theories. Through this exercise, we seek to highlight that some of the formulations focused in the preventions field appear, in embryonic state, in the positivist theoretical agenda. Likewise, it is possible to explicit that some empirical and practical tenets of positivism are less foreign to contemporary theories of crime prevention than is usually recognized.

  14. LUCRO RESIDUAL E CONTABILIDADE: INSTRUMENTAL DE ANALISE FINANCEIRA E MENSURAcAO DE PERFORMACES

    Directory of Open Access Journals (Sweden)

    Gualter Portella

    2009-09-01

    Full Text Available Estes últimos anos, os mercados de capitais e financeiro tem sido invadidos por sistemas de administração financeira baseados no conceito de lucro residual. As firmas de consultoria financeira apresentam o Iucro residual rebatizado sob o nome de EVA (Economic value added ou Lucro Econômico - como instrumento de avaliação economico-financeira, alinhamento dos interesses de acionistas e administradores e mensuração de performance empresarial. Por essa multifuncionalidade, esses sistemas têm alcançado altos índices de popularidade junto ao empresariado. Entretanto, pouco tem se falado sobre a base te6rica desses sistemas de gerenciamento financeiro que liga os fundamentos de finanças com a disciplina contábil, sendo que e justamente esse elo o que os tem tornado populares. Afinal de contas, a contabilidade c conhecida como a linguagem dos neg6cios e por intermédio de seu vocabulário especifico são comunicados os desempenhos atuais c as expectativas em relação ao desempenho futuro das empresas. Por exemplo, os executivos utilizam-se de indicadores como o retorno sobre o patrimônio liquido (RSPL ou a margem de lucros para avaliar e comunicar a performance atual de suas empresas.

  15. Resistência de genótipos de tomateiro ao ácaro rajado

    Directory of Open Access Journals (Sweden)

    Maruyama Wilson Itamar

    2002-01-01

    Full Text Available Avaliou-se a resistência de genótipos de tomateiro selvagens [Lycopersicon pennellii (LA 716, L. hirsutum var. glabratum (PI 126449, PI 134417, L. hirsutum (PI 127826, PI 127827, L. peruvianum (CGO 6707, L. peruvianum var. dentatum (WYR 2020, LA 111, L. peruvianum var. glandulosum (LA 1113-1, LA 1113-2] e comerciais [(L. esculentum Gem Pride, Santa Clara, e híbridos Bruna VFN, Carmem, Fortaleza, Débora Plus VFN] ao ácaro rajado (Tetranychus urticae. O número médio de ovos, fases imaturas (larvas, protoninfas e deutoninfas e adultos por folíolo foi contado; o índice de preferência para oviposição (IPO foi calculado. O delineamento experimental foi blocos ao acaso, com 6 repetições. Os genótipos LA 716, PI 126449, PI 134417, PI 127827, PI 127826 e Gem Pride apresentaram não-preferência para oviposição do ácaro rajado, sendo deterrentes quanto à classificação do IPO, enquanto os genótipos LA 111, WYR 2020, LA 1113-2 e LA1113-1 foram os mais preferidos para a oviposição e foram considerados como estimulantes pelo IPO.

  16. PATOGENICIDADE DE BEAUVERIA BASSIANA (BALS. VUILL. AO ÁCARO Tetranychus urticae KOCH

    Directory of Open Access Journals (Sweden)

    Tamai Marco Antonio

    1999-01-01

    Full Text Available O estudo da patogenicidade de Beauveria bassiana (Bals. Vuill. ao ácaro Tetranychus urticae Koch foi desenvolvido a 25 ± 2°C, 70 ± 5% UR e 12 horas de fotofase, utilizando-se fêmeas recém-emergidas. Os ácaros foram mantidos durante seis dias em discos de folha de Canavalia ensiformis (L. DC. inoculadas com B. bassiana, isolado 447, nas concentrações: 5x106, 1x107, 5x107, 1x108, 5x108 e 1x109 conídios/ml. Este isolado mostrou-se patogênico a T. urticae, apresentando aumento nos valores das mortalidades acumuladas (total, corrigida e confirmada à medida que a suspensão de conídios se tornou mais concentrada. Nas seis concentrações testadas, os valores de mortalidade corrigida ao sexto dia, foram inferiores a 50%, sendo observada apenas na concentração de 1x109 conídios/ml, mortalidade total superior a 50%.

  17. Resistência de plantas daninhas aos herbicidas Weed resistance to herbicides

    Directory of Open Access Journals (Sweden)

    Pedro J. Christoffoleti

    1994-01-01

    Full Text Available A resistência de plantas daninhas aos herbicidas ocorre em função de um processo evolutivo. O desenvolvimento de biótipos de plantas daninhas resistentes é imposto pela agricultura moderna, através da pressão de seleção causada pelo uso intensivo dos herbicidas. O conhecimento dos mecanismos e fatores que favorecem o aparecimento de biótipos de plantas daninhas resistentes é fundamental para que técnicas de manejo sejam utilizadas no sentido de evitar ou retardar o aparecimento de plantas resistentes em uma área. São poucos os relatos ou citações de literatura no Brasil. Sendo assim, este trabalho de revisão procura relatar os principais avanços e descobertas na área de plantas daninhas resistentes aos herbicidas.Weed herbicide resistance has evolved from weed evolution. The modern agriculture is responsible for this evolution because of the intensive use of herbicides. The knowledge of mechanisms and factors that influence the weed herbicide resistance play an important role in the weed manegement techniques used to avoid or delay herbicide resistance appearence. There are not many report or scientific papers about herbi cide resistance in Brasil. Therefore, this literature review aims to provide information about the main advances and discoveries in the field of weed herbicide resistance.

  18. Sintomatologia osteomuscular e qualidade de vida de portadores de distúrbios osteomusculares relacionados ao trabalho

    Directory of Open Access Journals (Sweden)

    Giselle Santana Dosea

    Full Text Available RESUMO Objetivo: Analisar, a partir de um perfil ocupacional, os aspectos da sintomatologia osteomuscular e da qualidade de vida (QV de trabalhadores notificados como portadores de distúrbios osteomusculares relacionados ao trabalho (DORT no estado de Sergipe. Métodos: A pesquisa foi realizada entre os meses de julho/2013 e julho/2014 e utilizou-se os questionários Nórdico de Sintomas Osteomusculares e o SF-36, em 56 voluntários. Resultados: Observou-se maior severidade dos sintomas na região dos ombros e cervical, e baixas médias de QV em todos os domínios, com relação significativa entre sexo e sintomatologia nos membros superiores, e entre componentes mentais e físicos da QV e a sintomatologia em ombros e punhos. Considerações finais: Esta pesquisa possuiu limites metodológicos relacionados ao reduzido número de indivíduos da amostra, no entanto, ainda assim, foi possível atingir seus objetivos, através da análise do perfil ocupacional, da sintomatologia osteomuscular e da QV dos trabalhadores notificados como portadores de DORT no estado de Sergipe. A QV do portador de DORT é reduzida, embora sua relação com a sintomatologia da doença precise ser investigada mais profundamente.

  19. Durabilidade natural de espécies florestais madeireiras ao ataque de cupim de madeira seca

    Directory of Open Access Journals (Sweden)

    Fabricio Gomes Gonçalves

    Full Text Available Esta pesquisa objetivou avaliar a resistência de dez madeiras ao térmita, Cryptotermes brevis, em condições de laboratório. As espécies estudadas foram amoreira (Chlorophora tinctoria, angelim-pedra (Hymenolobium petraeum, angico-vermelho (Anadenanthera columbrinavar. cebil, angico-verdadeiro (Anadenanthera peregrina, jacarandá-da-bahia (Dalbergia nigra, parajú (Manilkara longifolia, roxinho (Peltogine nitens, pau-brasil (Caesalpiniaechinata, Eucalyptus cloeziana e Eucalyptus torelliana. As madeiras estudadas foram susceptíveis ao ataque de C. brevis, à exceção das madeiras de A. columbrina e M. Longifolia; H. petraeum, D. nigra e C. echinata apresentaram mortalidade inferior à média das demais espécies. As madeiras de D. nigra, H. petraeum, C. echinata e E. Cloeziana foram as mais consumidas pelos cupins. C. tinctoria, P. nitens e E. torelliana apresentaramdesgastes superficiais. Nas madeiras de maior densidade e maiores teores de extrativos e de cinzas, observaram-se maiores valores de mortalidade dos cupins. Não existe, porém, uma característica única, que permita ser empregada visando a relacionar o ataque provocado pelos cupins nas madeiras estudadas.

  20. O panorama das Drogas no México: da margem da sociedade ao centro da cultura

    Directory of Open Access Journals (Sweden)

    Diana Palaversich

    2013-12-01

    Full Text Available O artigo destaca o percurso das manifestações culturais ligadas ao tráfico de drogas no México, de um lugar marginal, de subcultura, na sociedade mexicana das décadas de 1970 e 1980, expressas principalmente através dos narcocorridos e do narcocine, para um lugar no mainstream cultural mexicano, desde o início do século 21, com destaque especial para a narcoliteratura. O aumento da violência, provocado pela guerra ao narcotráfico, produz uma proliferação da temática nos meios de comunicação e se reflete em áreas da cultura como as artes plásticas e a literatura, produzindo um novo tipo de expressão artística ou narrativa, que tanto pode ser oportunista e contribuir para a banalização da violência do narcotráfico como ser crítica e narrar o impacto individual e coletivo do tráfico de drogas, narrar a desenfreada e violenta realidade mexicana sem cair no estilo da imprensa marrom, do folclore ou dos lugares comuns dos romances de ação.