WorldWideScience

Sample records for atom ssa dan

  1. La représentation SSA: sémantique, analyses et implémentation dans GCC

    OpenAIRE

    Pop, Sebastian

    2006-01-01

    The Static Single Assignment (SSA) language is one of the intermediate representations commonly used in industrial compilers. However, there was little interest from the static program analysis community in this intermediate representation due to the weak formal grounds of the SSA. This thesis presents a denotational semantics of the SSA language, allowing formal definitions of static analyses on the SSA language based on the classical abstract interpretation framework. From a practical point...

  2. Analisa Unsur Hara Mg dalam Daun Kelapa Sawit dengan Metode Spektrofotometri Serapan Atom (SSA) untuk meningkatkan Produksi Buah pada Tanaman Kelapa Sawit (Elaeis guineensis Jacq.)

    OpenAIRE

    Fazariyani, Xerra

    2015-01-01

    Telah dilakukan analisa pengujian unsur hara magnesium (Mg) dalam daun pada tanaman kelapa sawit di Pusat Penelitian Kelapa Sawit (PPKS) Medan. Nilai unsur hara Magnesium (Mg) yang diukur dengan menggunakan larutan pengekstrak asam asetat (H2SO4) kemudian diukur dengan menggunakan Spektrofotometer Serapan Atom (SSA). Dari hasil pengukuran diperoleh nilai unsur hara magnesium yang rendah (defesiensi). Kadar hara magnesium (Mg) daun yang diperoleh pada umumnya sekitar 17 – 23 % Mg.

  3. PERANCANGAN DAN PEMBUATAB ALAT UKUR KADAR KROM DALAM AIR DENGAN MENGGUNAKAN PRINSIP SPEKTROSKOPI SERAPAN ATOM

    Directory of Open Access Journals (Sweden)

    Tin Yunis Mahfudloh, Mohammad Tirono

    2012-04-01

    Full Text Available Air adalah bahan yang berperan penting dalam berbagai aspek kehidupan manusia. Air steril dengan kandungan mineral yang cukup dan tidak terpolusi dapat berperan sebagai cairan yang menata keseimbangan tubuh. Apabila air yang dikosumsi manusia telah tercemar oleh sampah dan limbah industri yang mengandung zat-zat kimia/logam berat yang bersifat racun akan berbahaya Seperti kromium/krom dengan kode kimiawi Cr. Penelitian dilakukan untuk membuat alat ukur kadar krom dalam air dengan metode absorpsi dengan instrumen fotometri. Alat ukur kadar krom dalam air menggunakan prinsip spektroskopi serapan atom terdiri dari 2 sistem, yaitu sistem optik dan sistem elektronik. Sistem optik terdiri dari lampu halogen, filter cahaya dengan panjang gelombang 520.4, kuvet dan sensor photodioda. Sedangkan sistem elektronik terdiri dari ADC 0804, MCU AT89S51 dan LCD.  Prinsip keja alat ini adalah cahaya polikromatis yang dipancarkan oleh lampu halogen akan melewati filter sehingga cahaya polikromatis akan bersifat monokromatis. Cahaya akan melewati air dengan kadar krom 0% untuk mereset reagen dan pelarut kemudian dideteksi oleh sensor sehingga menghasilkan data I0. Setelah dideteksi air  akan bergeser ke atas dan sensor bergeser kebelakang untuk mendeteksi sampel yang mempunyai kadar krom tertentu dan menghasilkan data I1. Di dalam sampel ini terjadi penyerapan intensitas cahaya oleh atom krom. Kemudian data I0 dan I1 akan diolah oleh MCU AT89S51 dan ditampilkan pada LCD. Sampel yang digunakan adalah larutan H2O dengan K2Cr2O7 sebanyak 10 sampel dengan variasi kadar 0%, 1%, 1.5%, 2%, 2.5%, 3%, 3.5%, 4%, 4.5%, dan 5%. Larutan krom diperoleh dengan cara mengencerkan 10gr K2Cr2O7 dalam 100ml H2O sehingga didapatkan K2Cr2O7 10% sebagai larutan stok, selanjutnya untuk mendapatkan K2Cr2O7 dengan kadar tertentu, maka diambil dari larutan stok kemudian diencerkan sampai volume 25 ml sesuai dengan rumus M1 V1 =M 2 V2 Hasil pegujian pada sistem elektronik menunjukkan

  4. SSA Disability Claim Data

    Data.gov (United States)

    Social Security Administration — The dataset includes fiscal year data for initial claims for SSA disability benefits that were referred to a state agency for a disability determination. Specific...

  5. Safety precautions in atomic pile control (1962); Securite dans le controle des piles atomiques (1962)

    Energy Technology Data Exchange (ETDEWEB)

    Furet, J. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1962-07-01

    We have been led to study the problem of safety in atomic pile control as a result of our participation on the one hand in the planning of C.E.A. atomic piles, and on the other hand in the pile safety sub omission considering atomic pile safety of operational or planned C.E.A. piles. We have thus had to consider the wishes occurring in piles during their operation and also their behaviour in the dynamic state The present work deals mainly with the importance of intrinsic safety devices, with the influence of reactivity variations on the power fluctuations during accidental operation, and with the development of robust and reliable safety appliances. The starting p accident has been especially studied both for low-flux piles where a compromise is necessary between the response time of the safety appliances and the statistical fluctuations and for high lux piles where xenon poisoning has an effect on the lower limit of the velocity of reactivity liberation. The desirability has been stressed of automation as a safety factor in atomic pile control. The details required for an understanding of the diagrams of the apparatus are given. (author) [French] Nous avons aborde le probleme de la securite dans le controle des piles atomiques a la suite de notre participation d'une part aux avant rojets de piles atomiques du CE.A. et d'autre part a l'examen au sein de la sous ommission de surete des piles, de la securite des piles du CE.A. en fonctionnement ou en projet. Nous avons ete amenes a nous interesser alors aux risques encourus par les piles pendant leur fonctionnement et par la meme a leur comportement en regime dynamique. Ce travail traite principalement de l'importance des securites intrinseques, de l'influence des variations de reactivite sur les evolutions de puissance en regime d'accident et du developpement d'appareillages de securite robustes et de fonctionnement tres sur. L'accident de demarrage a ete particulierement

  6. Dicty_cDB: SSA230 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA230 (Link to dictyBase) - - - Contig-U04338-1 SSA230E (Link to Original site) SSA...230F 286 SSA230Z 485 SSA230P 771 SSA230E 683 Show SSA230 Library SS (Link to library) Clone ID SSA...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA2-B/SSA230Q.Seq.d/ Representative seq. ID SSA...230E (Link to Original site) Representative DNA sequence >SSA230 (SSA230Q) /CSM/SS/SSA2-B/SSA...degsntehsikeiinhvfqkdkdllylisvaedpitfpssaisavvvsetlkaierkhks ilinranlknlgvqnvkallgxgnhvgeavikaar*ksyslsggweg

  7. Dicty_cDB: SSA690 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA690 (Link to dictyBase) - G20257 DDB0214823 Contig-U16029-1 SSA...690F (Link to Original site) SSA690F 609 - - - - - - Show SSA690 Library SS (Link to library) Clone ID SSA...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA6-D/SSA690Q.Seq.d/ ...Representative seq. ID SSA690F (Link to Original site) Representative DNA sequence >SSA690 (SSA690Q) /CSM/SS/SSA6-D/SSA...nallslkkvlklfstklldl*--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA690 (SSA

  8. Dicty_cDB: SSA130 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA130 (Link to dictyBase) - - - Contig-U14356-1 SSA130P (Link to Original site) SSA...130F 308 SSA130Z 423 SSA130P 731 - - Show SSA130 Library SS (Link to library) Clone ID SSA... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-B/SSA130Q.Seq.d/ Representative seq. ID SSA...130P (Link to Original site) Representative DNA sequence >SSA130 (SSA130Q) /CSM/SS/SSA1-B/SSA1...qxkxqlxhxp--- ---*hdasgltkanppliknfskspfs*li*itpglssailgtwflatpkiplapgsvtn caflsl*mvwcgdnnekvnkslvadasvaknll

  9. Dicty_cDB: SSA384 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA384 (Link to dictyBase) - - - Contig-U12139-1 SSA384P (Link to Original site) SSA...384F 743 SSA384Z 553 SSA384P 1296 - - Show SSA384 Library SS (Link to library) Clone ID SSA...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA3-D/SSA384Q.Seq.d/ Representative seq. ID SSA...384P (Link to Original site) Representative DNA sequence >SSA384 (SSA384Q) /CSM/SS/SSA3-D/SSA...ghqrylcshcrktwqlqfty tasqpgthqkiidmamngvgcratarimgvglntilrhlknsgrsr*praysravtsssa rkwtnsgamsglnraxlavlrv*qsp

  10. SSA State Agency Workload Data

    Data.gov (United States)

    Social Security Administration — The dataset is revised and expanded from 4 to 71 data fields. It includes monthly data from October 2000 onwards for SSA disability cases that were referred to the...

  11. Dicty_cDB: SSA568 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA568 (Link to dictyBase) - - - Contig-U04420-1 SSA568E (Link to Original site) SSA...568F 423 SSA568Z 348 SSA568P 771 SSA568E 423 Show SSA568 Library SS (Link to library) Clone ID SSA...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-C/SSA568Q.Seq.d/ Representative seq. ID SSA...568E (Link to Original site) Representative DNA sequence >SSA568 (SSA568Q) /CSM/SS/SSA5-C/SSA...ces producing significant alignments: (bits) Value SSA568 (SSA568Q) /CSM/SS/SSA5-C/SSA568Q.Seq.d/ 529 e-149

  12. Dicty_cDB: SSA445 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA445 (Link to dictyBase) - - - Contig-U13900-1 SSA445E (Link to Original site) SSA...445F 425 SSA445Z 650 SSA445P 1075 SSA445E 982 Show SSA445 Library SS (Link to library) Clone ID SSA...inal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA4-B/SSA445Q.Seq.d/ Representative seq. ID SSA...445E (Link to Original site) Representative DNA sequence >SSA445 (SSA445Q) /CSM/SS/SSA4-B/SSA...uences producing significant alignments: (bits) Value SSA445 (SSA445Q) /CSM/SS/SSA4-B/SSA

  13. Dicty_cDB: SSA625 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA625 (Link to dictyBase) - - - Contig-U04437-1 SSA625F (Link to Original site) SSA...625F 672 - - - - - - Show SSA625 Library SS (Link to library) Clone ID SSA625 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA6-B/SSA625Q.Seq.d/ Representative seq. ID SSA62...5F (Link to Original site) Representative DNA sequence >SSA625 (SSA625Q) /CSM/SS/SSA6-B/SSA625Q.Seq.d/ CAAAC...niymlvmah*vlkqlqn*leylmlirvvklifmnmlhcinllif ymptf*pmtvivvvqltlkkfteh*vhldlifhltlliyfs*kphhvvmv*ssa

  14. Dicty_cDB: SSA871 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA871 (Link to dictyBase) - - - Contig-U15063-1 SSA871P (Link to Original site) SSA...871F 197 SSA871Z 507 SSA871P 704 - - Show SSA871 Library SS (Link to library) Clone ID SSA... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA8-C/SSA871Q.Seq.d/ Representative seq. ID SSA...871P (Link to Original site) Representative DNA sequence >SSA871 (SSA871Q) /CSM/SS/SSA8-C/SSA8...ng significant alignments: (bits) Value SSA871 (SSA871Q) /CSM/SS/SSA8-C/SSA871Q.Seq.d/ 1176 0.0 CHD325 (CHD3

  15. Dicty_cDB: SSA802 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA802 (Link to dictyBase) - - - Contig-U02290-1 SSA802P (Link to Original site) SSA...802F 312 SSA802Z 481 SSA802P 793 - - Show SSA802 Library SS (Link to library) Clone ID SSA... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA8-A/SSA802Q.Seq.d/ Representative seq. ID SSA...802P (Link to Original site) Representative DNA sequence >SSA802 (SSA802Q) /CSM/SS/SSA8-A/SSA8...nificant alignments: (bits) Value SSA802 (SSA802Q) /CSM/SS/SSA8-A/SSA802Q.Seq.d/

  16. Dicty_cDB: SSA472 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA472 (Link to dictyBase) - - - Contig-U01956-1 SSA472F (Link to Original site) SSA...472F 540 - - - - - - Show SSA472 Library SS (Link to library) Clone ID SSA472 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA4-C/SSA472Q.Seq.d/ Representative seq. ID SSA47...2F (Link to Original site) Representative DNA sequence >SSA472 (SSA472Q) /CSM/SS/SSA4-C/SSA472Q.Seq.d/ TAAAA... 854 0.0 SSC507 (SSC507Q) /CSM/SS/SSC5-A/SSC507Q.Seq.d/ 854 0.0 SSA650 (SSA650Q) /CSM/SS/SSA6-C/SSA650Q.Seq.d/ 854 0.0 SSA472 (SSA

  17. Dicty_cDB: SSA511 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA511 (Link to dictyBase) - - - - SSA511Z (Link to Original site) - - SSA...511Z 455 - - - - Show SSA511 Library SS (Link to library) Clone ID SSA511 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-A/SSA...511Q.Seq.d/ Representative seq. ID SSA511Z (Link to Original site) R...epresentative DNA sequence >SSA511 (SSA511Q) /CSM/SS/SSA5-A/SSA511Q.Seq.d/ XXXXXXXXXXTTTTACGATGATGAATATTNTAT

  18. Dicty_cDB: SSA812 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA812 (Link to dictyBase) - - - Contig-U16229-1 SSA812Z (Link... to Original site) - - SSA812Z 313 - - - - Show SSA812 Library SS (Link to library) Clone ID SSA812 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA8-A/SSA812Q.Seq.d/ Representative seq. ID SSA81...2Z (Link to Original site) Representative DNA sequence >SSA812 (SSA812Q) /CSM/SS/SSA8-A/SSA812Q.Seq.d/ XXXXX...KDVNAGTAVTLLSDGNSEFTKKIGLEMDGKAXLLGED RSQRYAMILDSGVVKHLAVEEGGKFDVSSAEAILKQL*t*nqs

  19. Dicty_cDB: SSA563 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA563 (Link to dictyBase) - - - - SSA563E (Link to Original site) - - - - - - SSA...563E 383 Show SSA563 Library SS (Link to library) Clone ID SSA563 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-C/SSA...563Q.Seq.d/ Representative seq. ID SSA563E (Link to Original site) R...epresentative DNA sequence >SSA563 (SSA563Q) /CSM/SS/SSA5-C/SSA563Q.Seq.d/ GATTCAGAAAAAATTAAAAAAGCCAGAGATTTT

  20. Dicty_cDB: SSA604 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA604 (Link to dictyBase) - - - Contig-U12705-1 SSA604F (Link to Original site) SSA...604F 585 - - - - - - Show SSA604 Library SS (Link to library) Clone ID SSA604 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA6-A/SSA604Q.Seq.d/ Representative seq. ID SSA60...4F (Link to Original site) Representative DNA sequence >SSA604 (SSA604Q) /CSM/SS/SSA6-A/SSA604Q.Seq.d/ AGAAT...w*qkrfgrskrchl*rgfcfcktkwfnfc gssaktgenveeaf--- Homology vs CSM-cDNA Score E Sequences producing significant

  1. Dicty_cDB: SSA249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available utative transporter protein SSA662 (ssa662) mRNA, complete cds. 40 9e-04 2 AC1155...SS (Link to library) SSA249 (Link to dictyBase) - - - Contig-U07966-1 - (Link to Original site) SSA...249F 236 - - - - - - Show SSA249 Library SS (Link to library) Clone ID SSA249 (Link to dicty...iol.tsukuba.ac.jp/CSM/SS/SSA2-C/SSA249Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >SSA249 (SSA249Q) /CSM/SS/SSA2-C/SSA249Q.Seq.d/ ACTTATCGTCACAATTC

  2. Dicty_cDB: SSA520 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA520 (Link to dictyBase) - - - Contig-U14093-1 SSA520Z (Link... to Original site) - - SSA520Z 473 - - - - Show SSA520 Library SS (Link to library) Clone ID SSA520 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-A/SSA520Q.Seq.d/ Representative seq. ID SSA52...0Z (Link to Original site) Representative DNA sequence >SSA520 (SSA520Q) /CSM/SS/SSA5-A/SSA520Q.Seq.d/ XXXXX...INDNDKDGDRK ITRDEVLQRFTEQGAEDPELITDSIFRQMDLDRDGVITCDEIKEFNRKKKFSFLKSSAPK Q*krnitnsplfemffcf*ir***n*mysfif*ik

  3. Dicty_cDB: SSA280 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA280 (Link to dictyBase) - - - Contig-U10122-1 SSA280Z (Link... to Original site) - - SSA280Z 582 - - - - Show SSA280 Library SS (Link to library) Clone ID SSA280 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA2-D/SSA280Q.Seq.d/ Representative seq. ID SSA28...0Z (Link to Original site) Representative DNA sequence >SSA280 (SSA280Q) /CSM/SS/SSA2-D/SSA280Q.Seq.d/ XXXXX...Frames) Frame A: ---mfrpiawvpvpiivcghygcggvaasfatpglglflywfsflgislsnlpnlssa*f nwkpfffspl*ikcrrplypfg*pppfafc

  4. Dicty_cDB: SSA134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA134 (Link to dictyBase) - - - Contig-U16443-1 SSA134F (Link to Original site) SSA...134F 590 - - - - - - Show SSA134 Library SS (Link to library) Clone ID SSA134 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-B/SSA134Q.Seq.d/ Representative seq. ID SSA13...4F (Link to Original site) Representative DNA sequence >SSA134 (SSA134Q) /CSM/SS/SSA1-B/SSA134Q.Seq.d/ TTTTA...XXXXXXXXXX sequence update 1998. 7.31 Translated Amino Acid sequence LDDRSVEFDYLVINSGSSYNSPFKESSVVSSARANTLRE

  5. Dicty_cDB: SSA770 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA770 (Link to dictyBase) - - - - SSA770F (Link to Original site) SSA...770F 172 - - - - - - Show SSA770 Library SS (Link to library) Clone ID SSA770 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA7-C/SSA...770Q.Seq.d/ Representative seq. ID SSA770F (Link to Original site) R...epresentative DNA sequence >SSA770 (SSA770Q) /CSM/SS/SSA7-C/SSA770Q.Seq.d/ ATTTATTCTTTATCGAATATCATAATTAAAAGA

  6. Dicty_cDB: SSA826 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA826 (Link to dictyBase) - - - Contig-U00472-1 SSA826Z (Link... to Original site) - - SSA826Z 395 - - - - Show SSA826 Library SS (Link to library) Clone ID SSA826 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA8-B/SSA826Q.Seq.d/ Representative seq. ID SSA82...6Z (Link to Original site) Representative DNA sequence >SSA826 (SSA826Q) /CSM/SS/SSA8-B/SSA826Q.Seq.d/ XXXXX...cmlessltpptinphrnq*ndhhgtvhitn*shspkitstth*tfgdlyr fkskssakcfpigskin*nvkkhwydd*ii

  7. Dicty_cDB: SSA286 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA286 (Link to dictyBase) - - - - SSA286Z (Link to Original site) - - SSA...286Z 495 - - - - Show SSA286 Library SS (Link to library) Clone ID SSA286 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA2-D/SSA...286Q.Seq.d/ Representative seq. ID SSA286Z (Link to Original site) R...epresentative DNA sequence >SSA286 (SSA286Q) /CSM/SS/SSA2-D/SSA286Q.Seq.d/ XXXXXXXXXXTAGCTCACAACTTTCATACTTTT

  8. Dicty_cDB: SSA248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA248 (Link to dictyBase) - - - Contig-U13424-1 - (Link to Original site) - - SSA...248Z 500 - - - - Show SSA248 Library SS (Link to library) Clone ID SSA248 (Link to dicty...iol.tsukuba.ac.jp/CSM/SS/SSA2-B/SSA248Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >SSA248 (SSA248Q) /CSM/SS/SSA2-B/SSA248Q.Seq.d/ XXXXXXXXXXTTTAGAT...nk*kkikxnkl*iy*k*kk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA248 (SSA

  9. Dicty_cDB: SSA675 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA675 (Link to dictyBase) - - - Contig-U03270-1 SSA675E (Link... to Original site) - - - - - - SSA675E 650 Show SSA675 Library SS (Link to library) Clone ID SSA675 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA6-D/SSA675Q.Seq.d/ Representative seq. ID SSA67...5E (Link to Original site) Representative DNA sequence >SSA675 (SSA675Q) /CSM/SS/SSA6-D/SSA675Q.Seq.d/ GTTTT...id sequence FDDDLASKLKQVEINLVNQTVEALLEENKSLKQENEFLKDRIMQFRVEIEKKTSSIRNSK DSTSQFNRLTQSISPSSAIDITQSMTSGLDIPKVT

  10. Dicty_cDB: SSA432 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA432 (Link to dictyBase) - - - Contig-U01120-1 SSA432F (Link to Original site) SS...A432F 290 - - - - - - Show SSA432 Library SS (Link to library) Clone ID SSA432 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA4-B/SSA432Q.Seq.d/ Representative seq. ID SSA43...2F (Link to Original site) Representative DNA sequence >SSA432 (SSA432Q) /CSM/SS/SSA4-B/SSA432Q.Seq.d/ GTAAA...LRGANLHKANLIG VNLKGANFDIRTVSSR*f*kkkni*fni*iqlqyiy--- Translated Amino Acid seque

  11. Dicty_cDB: SSA104 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA104 (Link to dictyBase) - - - Contig-U15035-1 SSA104E (Link to Original site) SSA...104F 622 SSA104Z 490 SSA104P 1112 SSA104E 744 Show SSA104 Library SS (Link to library) Clone ID SSA...inal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-A/SSA104Q.Seq.d/ Representative seq. ID SSA...104E (Link to Original site) Representative DNA sequence >SSA104 (SSA104Q) /CSM/SS/SSA1-A/SSA...TLPK*k*kkkkkkkkk kkkkkkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA104 (SSA

  12. Dicty_cDB: SSA348 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA348 (Link to dictyBase) ssa348 - - Contig-U16217-1 SSA348E ...(Link to Original site) SSA348F 650 SSA348Z 416 SSA348P 1066 SSA348E 1046 Show SSA348 Library SS (Link to library) Clone ID SSA...348 (Link to dictyBase) Atlas ID ssa348 NBRP ID - dictyBase ID - Link to Contig Contig-U1...6217-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA3-B/SSA348Q....Seq.d/ Representative seq. ID SSA348E (Link to Original site) Representative DNA sequence >SSA348 (SSA348Q) /CSM/SS/SSA3-B/SSA

  13. Dicty_cDB: SSA365 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA365 (Link to dictyBase) - G20758 DDB0185325 Contig-U04375-1 SSA...365E (Link to Original site) - - - - - - SSA365E 349 Show SSA365 Library SS (Link to library) Clone ID SSA...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA3-C/SSA365Q.Seq.d/ ...Representative seq. ID SSA365E (Link to Original site) Representative DNA sequence >SSA365 (SSA365Q) /CSM/SS/SSA3-C/SSA...core E Sequences producing significant alignments: (bits) Value SSA365 (SSA365Q) /CSM/SS/SSA3-C/SSA365Q.Seq.

  14. Dicty_cDB: SSA421 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA421 (Link to dictyBase) - - - Contig-U04342-1 SSA421E (Link... to Original site) - - - - - - SSA421E 481 Show SSA421 Library SS (Link to library) Clone ID SSA421 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA4-A/SSA421Q.Seq.d/ Representative seq. ID SSA42...1E (Link to Original site) Representative DNA sequence >SSA421 (SSA421Q) /CSM/SS/SSA4-A/SSA421Q.Seq.d/ AACAT...quences producing significant alignments: (bits) Value SSA421 (SSA421Q) /CSM/SS/SSA4-A/SSA421Q.Seq.d/ 761 0.

  15. Dicty_cDB: SSA496 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA496 (Link to dictyBase) - G20766 DDB0205487 Contig-U04407-1 SSA...496F (Link to Original site) SSA496F 583 - - - - - - Show SSA496 Library SS (Link to library) Clone ID SSA...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA4-D/SSA496Q.Seq.d/ ...Representative seq. ID SSA496F (Link to Original site) Representative DNA sequence >SSA496 (SSA496Q) /CSM/SS/SSA4-D/SSA...s producing significant alignments: (bits) Value SSA496 (SSA496Q) /CSM/SS/SSA4-D/SSA496Q.Seq.d/ 1110 0.0 VSE

  16. Dicty_cDB: SSA191 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA191 (Link to dictyBase) - G00581 DDB0191101 Contig-U16278-1 SSA...191E (Link to Original site) - - - - - - SSA191E 743 Show SSA191 Library SS (Link to library) Clone ID SSA...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-D/SSA191Q.Seq.d/ ...Representative seq. ID SSA191E (Link to Original site) Representative DNA sequence >SSA191 (SSA191Q) /CSM/SS/SSA1-D/SSA...lue SSC884 (SSC884Q) /CSM/SS/SSC8-D/SSC884Q.Seq.d/ 1273 0.0 SSA191 (SSA191Q) /CSM/SS/SSA1-D/SSA191Q.Seq.d/ 1

  17. Dicty_cDB: SSA649 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA649 (Link to dictyBase) - - - Contig-U14313-1 SSA649Z (Link... to Original site) - - SSA649Z 355 - - - - Show SSA649 Library SS (Link to library) Clone ID SSA649 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA6-C/SSA649Q.Seq.d/ Representative seq. ID SSA64...9Z (Link to Original site) Representative DNA sequence >SSA649 (SSA649Q) /CSM/SS/SSA6-C/SSA649Q.Seq.d/ XXXXX...SM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA649 (SSA649Q) /CSM/SS/SSA6-C/SSA

  18. Dicty_cDB: SSA413 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA413 (Link to dictyBase) - - - Contig-U16181-1 SSA413F (Link to Original site) SSA...413F 522 - - - - - - Show SSA413 Library SS (Link to library) Clone ID SSA413 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA4-A/SSA413Q.Seq.d/ Representative seq. ID SSA41...3F (Link to Original site) Representative DNA sequence >SSA413 (SSA413Q) /CSM/SS/SSA4-A/SSA413Q.Seq.d/ TAAAC...SSF702 (SSF702Q) /CSM/SS/SSF7-A/SSF702Q.Seq.d/ 613 e-174 SSA413 (SSA413Q) /CSM/SS/SSA4-A/SSA

  19. Dicty_cDB: SSA894 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA894 (Link to dictyBase) - - - Contig-U16275-1 SSA894Z (Link... to Original site) - - SSA894Z 440 - - - - Show SSA894 Library SS (Link to library) Clone ID SSA894 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA8-D/SSA894Q.Seq.d/ Representative seq. ID SSA89...4Z (Link to Original site) Representative DNA sequence >SSA894 (SSA894Q) /CSM/SS/SSA8-D/SSA894Q.Seq.d/ XXXXX... Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA894 (SSA894Q) /CSM/SS/SSA8-D/SSA

  20. Dicty_cDB: SSA315 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA315 (Link to dictyBase) - - - Contig-U04364-1 SSA315Z (Link... to Original site) - - SSA315Z 620 - - - - Show SSA315 Library SS (Link to library) Clone ID SSA315 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA3-A/SSA315Q.Seq.d/ Representative seq. ID SSA31...5Z (Link to Original site) Representative DNA sequence >SSA315 (SSA315Q) /CSM/SS/SSA3-A/SSA315Q.Seq.d/ XXXXX... SSM282 (SSM282Q) /CSM/SS/SSM2-D/SSM282Q.Seq.d/ 589 e-167 SSA315 (SSA315Q) /CSM/SS/SSA3-A/SSA315Q.Seq.d/ 589

  1. Dicty_cDB: SSA793 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA793 (Link to dictyBase) - - - Contig-U14071-1 SSA793Z (Link... to Original site) - - SSA793Z 446 - - - - Show SSA793 Library SS (Link to library) Clone ID SSA793 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA7-D/SSA793Q.Seq.d/ Representative seq. ID SSA79...3Z (Link to Original site) Representative DNA sequence >SSA793 (SSA793Q) /CSM/SS/SSA7-D/SSA793Q.Seq.d/ XXXXX...(SSF811Q) /CSM/SS/SSF8-A/SSF811Q.Seq.d/ 878 0.0 SSA793 (SSA793Q) /CSM/SS/SSA7-D/SSA793Q.Seq.d/ 878 0.0 SSG18

  2. Dicty_cDB: SSA345 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA345 (Link to dictyBase) - G20757 DDB0206062 Contig-U04372-1 SSA...345F (Link to Original site) SSA345F 257 - - - - - - Show SSA345 Library SS (Link to library) Clone ID SSA...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA3-B/SSA345Q.Seq.d/ ...Representative seq. ID SSA345F (Link to Original site) Representative DNA sequence >SSA345 (SSA345Q) /CSM/SS/SSA3-B/SSA...E Sequences producing significant alignments: (bits) Value SSA345 (SSA345Q) /CSM/SS/SSA3-B/SSA

  3. Dicty_cDB: SSA832 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA832 (Link to dictyBase) - G23600 DDB0233770 Contig-U04479-1 SSA...832Z (Link to Original site) - - SSA832Z 457 - - - - Show SSA832 Library SS (Link to library) Clone ID SSA...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA8-B/SSA832Q.Seq.d/ ...Representative seq. ID SSA832Z (Link to Original site) Representative DNA sequence >SSA832 (SSA832Q) /CSM/SS/SSA8-B/SSA...roducing significant alignments: (bits) Value SSA832 (SSA832Q) /CSM/SS/SSA8-B/SSA832Q.Seq.d/ 458 e-128 SFK35

  4. Dicty_cDB: SSA591 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA591 (Link to dictyBase) - - - Contig-U13413-1 SSA591Z (Link... to Original site) - - SSA591Z 607 - - - - Show SSA591 Library SS (Link to library) Clone ID SSA591 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-D/SSA591Q.Seq.d/ Representative seq. ID SSA59...1Z (Link to Original site) Representative DNA sequence >SSA591 (SSA591Q) /CSM/SS/SSA5-D/SSA591Q.Seq.d/ XXXXX...0 SSF123 (SSF123Q) /CSM/SS/SSF1-A/SSF123Q.Seq.d/ 963 0.0 SSA591 (SSA591Q) /CSM/SS/SSA5-D/SSA591Q.Seq.d/ 963

  5. Dicty_cDB: SSA680 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA680 (Link to dictyBase) - - - Contig-U04448-1 SSA680Z (Link... to Original site) - - SSA680Z 387 - - - - Show SSA680 Library SS (Link to library) Clone ID SSA680 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA6-D/SSA680Q.Seq.d/ Representative seq. ID SSA68...0Z (Link to Original site) Representative DNA sequence >SSA680 (SSA680Q) /CSM/SS/SSA6-D/SSA680Q.Seq.d/ XXXXX...ucing significant alignments: (bits) Value SSA680 (SSA680Q) /CSM/SS/SSA6-D/SSA680

  6. Dicty_cDB: SSA153 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA153 (Link to dictyBase) - - - Contig-U10248-1 SSA153F (Link to Original site) SSA...153F 463 - - - - - - Show SSA153 Library SS (Link to library) Clone ID SSA153 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-C/SSA153Q.Seq.d/ Representative seq. ID SSA15...3F (Link to Original site) Representative DNA sequence >SSA153 (SSA153Q) /CSM/SS/SSA1-C/SSA153Q.Seq.d/ ATTTG...ficant alignments: (bits) Value SSA153 (SSA153Q) /CSM/SS/SSA1-C/SSA153Q.Seq.d/ 918 0.0 SSH468 (SSH468Q) /CSM

  7. Dicty_cDB: SSA821 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA821 (Link to dictyBase) - - - Contig-U04477-1 SSA821F (Link to Original site) SSA...821F 298 - - - - - - Show SSA821 Library SS (Link to library) Clone ID SSA821 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA8-A/SSA821Q.Seq.d/ Representative seq. ID SSA82...1F (Link to Original site) Representative DNA sequence >SSA821 (SSA821Q) /CSM/SS/SSA8-A/SSA821Q.Seq.d/ CAGTT...producing significant alignments: (bits) Value SSA821 (SSA821Q) /CSM/SS/SSA8-A/SSA821Q.Seq.d/ 585 e-166 SSK4

  8. Dicty_cDB: SSA339 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA339 (Link to dictyBase) - - - Contig-U14696-1 SSA339F (Link to Original site) SSA...339F 482 - - - - - - Show SSA339 Library SS (Link to library) Clone ID SSA339 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA3-B/SSA339Q.Seq.d/ Representative seq. ID SSA33...9F (Link to Original site) Representative DNA sequence >SSA339 (SSA339Q) /CSM/SS/SSA3-B/SSA339Q.Seq.d/ ATTTT.../SSM403Q.Seq.d/ 737 0.0 SSA339 (SSA339Q) /CSM/SS/SSA3-B/SSA339Q.Seq.d/ 737 0.0 VH

  9. Dicty_cDB: SSA628 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA628 (Link to dictyBase) - - - Contig-U13975-1 SSA628F (Link to Original site) SSA...628F 689 - - - - - - Show SSA628 Library SS (Link to library) Clone ID SSA628 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA6-B/SSA628Q.Seq.d/ Representative seq. ID SSA62...8F (Link to Original site) Representative DNA sequence >SSA628 (SSA628Q) /CSM/SS/SSA6-B/SSA628Q.Seq.d/ AAAAA...SM6-B/SSM646Q.Seq.d/ 1314 0.0 SSA628 (SSA628Q) /CSM/SS/SSA6-B/SSA628Q.Seq.d/ 1314 0.0 SSG772 (SSG772Q) /CSM/

  10. Dicty_cDB: SSA306 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA306 (Link to dictyBase) - - - Contig-U12249-1 SSA306Z (Link... to Original site) - - SSA306Z 612 - - - - Show SSA306 Library SS (Link to library) Clone ID SSA306 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA3-A/SSA306Q.Seq.d/ Representative seq. ID SSA30...6Z (Link to Original site) Representative DNA sequence >SSA306 (SSA306Q) /CSM/SS/SSA3-A/SSA306Q.Seq.d/ XXXXX...nyl Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA306 (SSA306Q) /CSM/SS/SSA3-A/SSA

  11. Dicty_cDB: SSA536 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA536 (Link to dictyBase) - - - Contig-U16093-1 SSA536Z (Link... to Original site) - - SSA536Z 653 - - - - Show SSA536 Library SS (Link to library) Clone ID SSA536 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-B/SSA536Q.Seq.d/ Representative seq. ID SSA53...6Z (Link to Original site) Representative DNA sequence >SSA536 (SSA536Q) /CSM/SS/SSA5-B/SSA536Q.Seq.d/ XXXXX...y vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA536 (SSA536Q) /CSM/SS/SSA5-B/SSA

  12. Dicty_cDB: SSA585 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA585 (Link to dictyBase) - - - Contig-U01910-1 SSA585F (Link to Original site) SSA...585F 399 - - - - - - Show SSA585 Library SS (Link to library) Clone ID SSA585 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-D/SSA585Q.Seq.d/ Representative seq. ID SSA58...5F (Link to Original site) Representative DNA sequence >SSA585 (SSA585Q) /CSM/SS/SSA5-D/SSA585Q.Seq.d/ ATCAA...K546Q) /CSM/SS/SSK5-B/SSK546Q.Seq.d/ 448 e-125 SSA585 (SSA585Q) /CSM/SS/SSA5-D/SSA585Q.Seq.d/ 448 e-125 SFA2

  13. Dicty_cDB: SSA362 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA362 (Link to dictyBase) - - - Contig-U16560-1 SSA362Z (Link... to Original site) - - SSA362Z 549 - - - - Show SSA362 Library SS (Link to library) Clone ID SSA362 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA3-C/SSA362Q.Seq.d/ Representative seq. ID SSA36...2Z (Link to Original site) Representative DNA sequence >SSA362 (SSA362Q) /CSM/SS/SSA3-C/SSA362Q.Seq.d/ XXXXX...es producing significant alignments: (bits) Value SSA362 (SSA362Q) /CSM/SS/SSA3-C/SSA362Q.Seq.d/ 1027 0.0 SS

  14. Dicty_cDB: SSA582 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA582 (Link to dictyBase) - - - Contig-U16540-1 SSA582F (Link to Original site) SSA...582F 680 - - - - - - Show SSA582 Library SS (Link to library) Clone ID SSA582 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-D/SSA582Q.Seq.d/ Representative seq. ID SSA58...2F (Link to Original site) Representative DNA sequence >SSA582 (SSA582Q) /CSM/SS/SSA5-D/SSA582Q.Seq.d/ TGTAA...nificant alignments: (bits) Value SSA582 (SSA582Q) /CSM/SS/SSA5-D/SSA582Q.Seq.d/

  15. Dicty_cDB: SSA706 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA706 (Link to dictyBase) - G20773 DDB0206442 Contig-U04454-1 SSA...706F (Link to Original site) SSA706F 345 - - - - - - Show SSA706 Library SS (Link to library) Clone ID SSA...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA7-A/SSA706Q.Seq.d/ ...Representative seq. ID SSA706F (Link to Original site) Representative DNA sequence >SSA706 (SSA706Q) /CSM/SS/SSA7-A/SSA...s CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA706 (SSA706Q) /CSM/SS/SSA7-A/SSA

  16. Dicty_cDB: SSA188 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA188 (Link to dictyBase) - - - Contig-U14470-1 SSA188F (Link to Original site) SSA...188F 647 - - - - - - Show SSA188 Library SS (Link to library) Clone ID SSA188 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-D/SSA188Q.Seq.d/ Representative seq. ID SSA18...8F (Link to Original site) Representative DNA sequence >SSA188 (SSA188Q) /CSM/SS/SSA1-D/SSA188Q.Seq.d/ GGACA...core E Sequences producing significant alignments: (bits) Value SSA188 (SSA188Q) /CSM/SS/SSA1-D/SSA188Q.Seq.

  17. Dicty_cDB: SSA261 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA261 (Link to dictyBase) - G02045 DDB0235194 Contig-U04344-1 SSA...261F (Link to Original site) SSA261F 301 - - - - - - Show SSA261 Library SS (Link to library) Clone ID SSA...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA2-C/SSA261Q.Seq.d/ ...Representative seq. ID SSA261F (Link to Original site) Representative DNA sequence >SSA261 (SSA261Q) /CSM/SS/SSA2-C/SSA...I4-B/SSI429Q.Seq.d/ 436 e-122 SSA261 (SSA261Q) /CSM/SS/SSA2-C/SSA261Q.Seq.d/ 436 e-122 VSH479 (VSH479Q) /CSM

  18. Dicty_cDB: SSA449 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA449 (Link to dictyBase) - - - Contig-U12270-1 SSA449E (Link... to Original site) - - - - - - SSA449E 372 Show SSA449 Library SS (Link to library) Clone ID SSA449 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA4-C/SSA449Q.Seq.d/ Representative seq. ID SSA44...9E (Link to Original site) Representative DNA sequence >SSA449 (SSA449Q) /CSM/SS/SSA4-C/SSA449Q.Seq.d/ TAAAC...*ilkk kkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA449 (SSA449Q) /CSM/SS/SSA4-C/SSA

  19. Dicty_cDB: SSA182 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA182 (Link to dictyBase) - - - Contig-U12256-1 SSA182F (Link to Original site) SSA...182F 640 - - - - - - Show SSA182 Library SS (Link to library) Clone ID SSA182 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-D/SSA182Q.Seq.d/ Representative seq. ID SSA18...2F (Link to Original site) Representative DNA sequence >SSA182 (SSA182Q) /CSM/SS/SSA1-D/SSA182Q.Seq.d/ AAATA...producing significant alignments: (bits) Value SSA182 (SSA182Q) /CSM/SS/SSA1-D/SSA182Q.Seq.d/ 1269 0.0 SSJ38

  20. Dicty_cDB: SSA402 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA402 (Link to dictyBase) - - - Contig-U11996-1 SSA402Z (Link... to Original site) - - SSA402Z 556 - - - - Show SSA402 Library SS (Link to library) Clone ID SSA402 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA4-A/SSA402Q.Seq.d/ Representative seq. ID SSA40...2Z (Link to Original site) Representative DNA sequence >SSA402 (SSA402Q) /CSM/SS/SSA4-A/SSA402Q.Seq.d/ XXXXX... Score E Sequences producing significant alignments: (bits) Value SSA402 (SSA402Q) /CSM/SS/SSA4-A/SSA402Q.Se

  1. Dicty_cDB: SSA729 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA729 (Link to dictyBase) - G00595 DDB0206564 Contig-U01523-1 SSA...729P (Link to Original site) SSA729F 302 SSA729Z 503 SSA729P 805 - - Show SSA729 Library SS (Link to library) Clone ID SSA...ontig-U01523-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA7-B/SSA...729Q.Seq.d/ Representative seq. ID SSA729P (Link to Original site) Representative DNA sequence >SSA729 (SSA729Q) /CSM/SS/SSA...kl Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA729 (SSA

  2. Dicty_cDB: SSA396 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA396 (Link to dictyBase) - - - Contig-U16441-1 SSA396F (Link to Original site) SSA...396F 698 - - - - - - Show SSA396 Library SS (Link to library) Clone ID SSA396 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA3-D/SSA396Q.Seq.d/ Representative seq. ID SSA39...6F (Link to Original site) Representative DNA sequence >SSA396 (SSA396Q) /CSM/SS/SSA3-D/SSA396Q.Seq.d/ ATTCT...s CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA396 (SSA396Q) /CSM/SS/SSA

  3. Dicty_cDB: SSA662 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available putative transporter protein SSA662 (ssa662) mRNA, complete cds. 1267 0.0 4 AC115576 |AC115576.1 Dictyostel...SS (Link to library) SSA662 (Link to dictyBase) - G03081 DDB0185065 Contig-U07966-1 SSA...662P (Link to Original site) SSA662F 470 SSA662Z 664 SSA662P 1134 - - Show SSA662 Library SS (Link to library) Clone ID SSA...Contig-U07966-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA6-C/SSA...662Q.Seq.d/ Representative seq. ID SSA662P (Link to Original site) Representative DNA sequence >SSA662 (SSA662Q) /CSM/SS/SSA

  4. Dicty_cDB: SSA716 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA716 (Link to dictyBase) - - - Contig-U11768-1 SSA716P (Link to Original site) SSA...716F 257 SSA716Z 405 SSA716P 662 - - Show SSA716 Library SS (Link to library) Clone ID SSA... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA7-A/SSA716Q.Seq.d/ Representative seq. ID SSA...716P (Link to Original site) Representative DNA sequence >SSA716 (SSA716Q) /CSM/SS/SSA7-A/SSA7...fhqlqlvfkkkkkkifkniyi**in rriffffyskkkkkkkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA

  5. Dicty_cDB: SSA204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA204 (Link to dictyBase) - - - Contig-U14136-1 SSA204F (Link to Original site) SSA...204F 277 - - - - - - Show SSA204 Library SS (Link to library) Clone ID SSA204 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA2-A/SSA204Q.Seq.d/ Representative seq. ID SSA20...4F (Link to Original site) Representative DNA sequence >SSA204 (SSA204Q) /CSM/SS/SSA2-A/SSA204Q.Seq.d/ AAAAT...vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA484 (SSA484Q) /CSM/SS/SSA

  6. Dicty_cDB: SSA484 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA484 (Link to dictyBase) - - - Contig-U14136-1 SSA484F (Link to Original site) SSA...484F 277 - - - - - - Show SSA484 Library SS (Link to library) Clone ID SSA484 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA4-D/SSA484Q.Seq.d/ Representative seq. ID SSA48...4F (Link to Original site) Representative DNA sequence >SSA484 (SSA484Q) /CSM/SS/SSA4-D/SSA484Q.Seq.d/ ATAAT...vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA484 (SSA484Q) /CSM/SS/SSA

  7. Dicty_cDB: SSA703 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA703 (Link to dictyBase) - - - Contig-U16244-1 SSA703F (Link to Original site) SSA...703F 277 - - - - - - Show SSA703 Library SS (Link to library) Clone ID SSA703 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA7-A/SSA703Q.Seq.d/ Representative seq. ID SSA70...3F (Link to Original site) Representative DNA sequence >SSA703 (SSA703Q) /CSM/SS/SSA7-A/SSA703Q.Seq.d/ TTTAT...vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA703 (SSA703Q) /CSM/SS/SSA

  8. Dicty_cDB: SSA514 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA514 (Link to dictyBase) - - - Contig-U16397-1 - (Link to Original site) SSA...514F 382 - - - - - - Show SSA514 Library SS (Link to library) Clone ID SSA514 (Link to dicty...iol.tsukuba.ac.jp/CSM/SS/SSA5-A/SSA514Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >SSA514 (SSA514Q) /CSM/SS/SSA5-A/SSA514Q.Seq.d/ GTGTTTTAGTTGTTGGT...ng catheps... 74 2e-12 BT057383_1( BT057383 |pid:none) Salmo salar clone ssal-evf

  9. Dicty_cDB: SSA674 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA674 (Link to dictyBase) - - - - SSA674P (Link to Original site) SSA674F 517 SSA...674Z 442 SSA674P 959 - - Show SSA674 Library SS (Link to library) Clone ID SSA674 (Link ...to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA...6-D/SSA674Q.Seq.d/ Representative seq. ID SSA674P (Link to ...Original site) Representative DNA sequence >SSA674 (SSA674Q) /CSM/SS/SSA6-D/SSA674Q.Seq.d/ TTTTTTTTTTTTTTTTT

  10. Dicty_cDB: SSA118 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA118 (Link to dictyBase) - - - Contig-U14989-1 SSA118F (Link to Original site) SSA...118F 575 - - - - - - Show SSA118 Library SS (Link to library) Clone ID SSA118 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-A/SSA118Q.Seq.d/ Representative seq. ID SSA11...8F (Link to Original site) Representative DNA sequence >SSA118 (SSA118Q) /CSM/SS/SSA1-A/SSA118Q.Seq.d/ CGGAC...qfslfvssif slislvlvqt--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA118 (SSA

  11. Dicty_cDB: SSA210 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA210 (Link to dictyBase) ssa210 - - Contig-U04334-1 SSA210F ...(Link to Original site) SSA210F 105 - - - - - - Show SSA210 Library SS (Link to library) Clone ID SSA210 (Li...nk to dictyBase) Atlas ID ssa210 NBRP ID - dictyBase ID - Link to Contig Contig-U04334-1 Original site URL h...ttp://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA2-A/SSA210Q.Seq.d/ Representative seq. ID SSA...210F (Link to Original site) Representative DNA sequence >SSA210 (SSA210Q) /CSM/SS/SSA2-A/SSA210Q.Se

  12. Dicty_cDB: SSA774 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA774 (Link to dictyBase) - G00598 DDB0229401 Contig-U14168-1 SSA...774E (Link to Original site) SSA774F 896 SSA774Z 908 SSA774P 1804 SSA774E 909 Show SSA774 Library SS (Li... Contig Contig-U14168-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA7-D/SSA...774Q.Seq.d/ Representative seq. ID SSA774E (Link to Original site) Representative DNA sequence >SSA774 (SSA...774Q) /CSM/SS/SSA7-D/SSA774Q.Seq.d/ AATACACACATAAGAACACAGAGGANAAATGAGNTAATAATAATAAGATATTTCAATTTA

  13. Dicty_cDB: SSA112 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA112 (Link to dictyBase) - G20740 DDB0189738 Contig-U04308-1 SSA...112E (Link to Original site) SSA112F 568 SSA112Z 585 SSA112P 1153 SSA112E 585 Show SSA112 Library SS (Li... Contig Contig-U04308-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-A/SSA...112Q.Seq.d/ Representative seq. ID SSA112E (Link to Original site) Representative DNA sequence >SSA112 (SSA...112Q) /CSM/SS/SSA1-A/SSA112Q.Seq.d/ AAAGCTCATTTACATTCATTTAAACATCATGCATCATCAGTTAATGGAATTTTACTTGGT

  14. Dicty_cDB: SSA135 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA135 (Link to dictyBase) - - - Contig-U04314-1 SSA135F (Link to Original site) SSA...135F 531 - - - - - - Show SSA135 Library SS (Link to library) Clone ID SSA135 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-B/SSA135Q.Seq.d/ Representative seq. ID SSA13...5F (Link to Original site) Representative DNA sequence >SSA135 (SSA135Q) /CSM/SS/SSA1-B/SSA135Q.Seq.d/ AAAGA...omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA135 (SSA

  15. Dicty_cDB: SSA386 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA386 (Link to dictyBase) - G01158 DDB0203604 Contig-U04380-1 SSA...386E (Link to Original site) SSA386F 612 SSA386Z 577 SSA386P 1189 SSA386E 655 Show SSA386 Library SS (Li... Contig Contig-U04380-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA3-D/SSA...386Q.Seq.d/ Representative seq. ID SSA386E (Link to Original site) Representative DNA sequence >SSA386 (SSA...386Q) /CSM/SS/SSA3-D/SSA386Q.Seq.d/ CACCGGTTGGAGCTTACTAAATTAGGTAAAGAAATATCTAGAAAAAAAATAAAAAAAATA

  16. Dicty_cDB: SSA623 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA623 (Link to dictyBase) - - - Contig-U12232-1 SSA623F (Link to Original site) SSA...623F 621 - - - - - - Show SSA623 Library SS (Link to library) Clone ID SSA623 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA6-A/SSA623Q.Seq.d/ Representative seq. ID SSA62...3F (Link to Original site) Representative DNA sequence >SSA623 (SSA623Q) /CSM/SS/SSA6-A/SSA623Q.Seq.d/ TTCAA...vvlvvlnsqallkni*qklsy--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA623 (SSA

  17. Dicty_cDB: SSA863 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA863 (Link to dictyBase) - - - Contig-U14496-1 - (Link to Original site) - - SSA...863Z 436 - - - - Show SSA863 Library SS (Link to library) Clone ID SSA863 (Link to dicty...iol.tsukuba.ac.jp/CSM/SS/SSA8-C/SSA863Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >SSA863 (SSA863Q) /CSM/SS/SSA8-C/SSA863Q.Seq.d/ XXXXXXXXXXAGATTCA...ore E Sequences producing significant alignments: (bits) Value SSA863 (SSA863Q) /CSM/SS/SSA8-C/SSA863Q.Seq.d

  18. Dicty_cDB: SSA452 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA452 (Link to dictyBase) - G20763 DDB0185811 Contig-U04397-1... - (Link to Original site) SSA452F 433 - - - - - - Show SSA452 Library SS (Link to library) Clone ID SSA452 ...l site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA4-C/SSA452Q.Seq.d/ Repres...entative seq. ID - (Link to Original site) Representative DNA sequence >SSA452 (SSA452Q) /CSM/SS/SSA4-C/SSA4...ng significant alignments: (bits) Value SSA452 (SSA452Q) /CSM/SS/SSA4-C/SSA452Q.Seq.d/ 383 e-105 SLD553 (SLD

  19. Dicty_cDB: SSA765 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA765 (Link to dictyBase) - - - Contig-U16394-1 SSA765Z (Link... to Original site) - - SSA765Z 154 - - - - Show SSA765 Library SS (Link to library) Clone ID SSA765 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA7-C/SSA765Q.Seq.d/ Representative seq. ID SSA76...5Z (Link to Original site) Representative DNA sequence >SSA765 (SSA765Q) /CSM/SS/SSA7-C/SSA765Q.Seq.d/ XXXXX...htriyay*k*k*kkknnv*n*k Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA765 (SSA

  20. Dicty_cDB: SSA854 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA854 (Link to dictyBase) ssa854 - - Contig-U16352-1 SSA854F ...(Link to Original site) SSA854F 249 - - - - - - Show SSA854 Library SS (Link to library) Clone ID SSA854 (Li...nk to dictyBase) Atlas ID ssa854 NBRP ID - dictyBase ID - Link to Contig Contig-U16352-1 Original site URL h...ttp://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA8-C/SSA854Q.Seq.d/ Representative seq. ID SSA...854F (Link to Original site) Representative DNA sequence >SSA854 (SSA854Q) /CSM/SS/SSA8-C/SSA854Q.Se

  1. Dicty_cDB: SSA572 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA572 (Link to dictyBase) - - - Contig-U11935-1 SSA572F (Link to Original site) SSA...572F 580 - - - - - - Show SSA572 Library SS (Link to library) Clone ID SSA572 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-C/SSA572Q.Seq.d/ Representative seq. ID SSA57...2F (Link to Original site) Representative DNA sequence >SSA572 (SSA572Q) /CSM/SS/SSA5-C/SSA572Q.Seq.d/ ATGAA...ASSVIDTFLAPGSPLLNVV IHGHYLETAFNS--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA572 (SSA

  2. Dicty_cDB: SSA448 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA448 (Link to dictyBase) - G02048 DDB0219255 Contig-U14699-1 SSA...448E (Link to Original site) SSA448F 528 SSA448Z 654 SSA448P 1182 SSA448E 724 Show SSA448 Library SS (Li... Contig Contig-U14699-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA4-B/SSA...448Q.Seq.d/ Representative seq. ID SSA448E (Link to Original site) Representative DNA sequence >SSA448 (SSA...448Q) /CSM/SS/SSA4-B/SSA448Q.Seq.d/ AAAAAATATTATTAAAAAAAAAAAAAAAAAAAATGTTTGATTATTTTTTCGGTAGTAAAA

  3. Dicty_cDB: SSA477 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA477 (Link to dictyBase) - - - Contig-U15494-1 - (Link to Original site) SSA...477F 419 - - - - - - Show SSA477 Library SS (Link to library) Clone ID SSA477 (Link to dicty...iol.tsukuba.ac.jp/CSM/SS/SSA4-D/SSA477Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >SSA477 (SSA477Q) /CSM/SS/SSA4-D/SSA477Q.Seq.d/ ATAAAAAATGGTTCAAA... alignments: (bits) Value SSA477 (SSA477Q) /CSM/SS/SSA4-D/SSA477Q.Seq.d/ 813 0.0 VSJ385 (VSJ385Q) /CSM/VS/VS

  4. Dicty_cDB: SSA746 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA746 (Link to dictyBase) - G20777 DDB0188220 Contig-U16307-1 SSA...746E (Link to Original site) SSA746F 316 SSA746Z 496 SSA746P 812 SSA746E 775 Show SSA746 Library SS (Lin...Contig Contig-U16307-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA7-B/SSA...746Q.Seq.d/ Representative seq. ID SSA746E (Link to Original site) Representative DNA sequence >SSA746 (SSA...746Q) /CSM/SS/SSA7-B/SSA746Q.Seq.d/ AAATAATTTCCCATCAGGTTTATTAGATAATGAAACGAGAGAAGCTGTAGATTTCATGGT

  5. Dicty_cDB: SSA316 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA316 (Link to dictyBase) - - - Contig-U01085-1 SSA316E (Link... to Original site) - - - - - - SSA316E 461 Show SSA316 Library SS (Link to library) Clone ID SSA316 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA3-A/SSA316Q.Seq.d/ Representative seq. ID SSA31...6E (Link to Original site) Representative DNA sequence >SSA316 (SSA316Q) /CSM/SS/SSA3-A/SSA316Q.Seq.d/ CTTAA...KENEEKNK*nhqlflflf*ik*iilinn Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA316 (SSA

  6. Dicty_cDB: SSA516 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA516 (Link to dictyBase) - - - Contig-U16310-1 SSA516F (Link to Original site) SSA...516F 680 - - - - - - Show SSA516 Library SS (Link to library) Clone ID SSA516 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-A/SSA516Q.Seq.d/ Representative seq. ID SSA51...6F (Link to Original site) Representative DNA sequence >SSA516 (SSA516Q) /CSM/SS/SSA5-A/SSA516Q.Seq.d/ GTTTT...nificant alignments: (bits) Value VFC149 (VFC149Q) /CSM/VF/VFC1-C/VFC149Q.Seq.d/ 1348 0.0 SSA516 (SSA

  7. Dicty_cDB: SSA109 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA109 (Link to dictyBase) - - - Contig-U01494-1 | Contig-U15574-1 SSA...109P (Link to Original site) SSA109F 307 SSA109Z 571 SSA109P 878 - - Show SSA109 Library SS (Link to library) Clone ID SSA...94-1 | Contig-U15574-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-A/SSA...109Q.Seq.d/ Representative seq. ID SSA109P (Link to Original site) Representative DNA sequence >SSA109 (SSA...109Q) /CSM/SS/SSA1-A/SSA109Q.Seq.d/ ATGATTAATATATTAAAGGACATTCTTTATAAATCATATAGCTATTTAGCATTTCCTTTT

  8. Dicty_cDB: SSA676 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA676 (Link to dictyBase) - - - Contig-U09438-1 SSA676Z (Link... to Original site) - - SSA676Z 579 - - - - Show SSA676 Library SS (Link to library) Clone ID SSA676 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA6-D/SSA676Q.Seq.d/ Representative seq. ID SSA67...6Z (Link to Original site) Representative DNA sequence >SSA676 (SSA676Q) /CSM/SS/SSA6-D/SSA676Q.Seq.d/ XXXXX...mvplhlqmvn*krlmil kisfklqlfnnllek Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA676 (SSA

  9. Dicty_cDB: SSA220 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA220 (Link to dictyBase) - - - Contig-U16278-1 SSA220Z (Link... to Original site) - - SSA220Z 485 - - - - Show SSA220 Library SS (Link to library) Clone ID SSA220 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA2-A/SSA220Q.Seq.d/ Representative seq. ID SSA22...0Z (Link to Original site) Representative DNA sequence >SSA220 (SSA220Q) /CSM/SS/SSA2-A/SSA220Q.Seq.d/ XXXXX...y system >> prediction for SSA220 is nuc 5' end seq. ID - 5' end seq. - Length of 5' end seq. - 3' end seq. ID SSA

  10. Dicty_cDB: SSA242 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA242 (Link to dictyBase) - G00584 DDB0206451 Contig-U04342-1 SSA...242E (Link to Original site) SSA242F 327 SSA242Z 501 SSA242P 828 SSA242E 622 Show SSA242 Library SS (Lin...Contig Contig-U04342-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA2-B/SSA...242Q.Seq.d/ Representative seq. ID SSA242E (Link to Original site) Representative DNA sequence >SSA242 (SSA...242Q) /CSM/SS/SSA2-B/SSA242Q.Seq.d/ CAAAAAAATGGGACATGATATTAAAGCAATTATAGGTTTTTCTTGCGCATTTGCAGTTGG

  11. Dicty_cDB: SSA147 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA147 (Link to dictyBase) - G02039 DDB0235198 Contig-U13986-1 SSA...147P (Link to Original site) SSA147F 576 SSA147Z 686 SSA147P 1262 - - Show SSA147 Library SS (Link to library) Clone ID SSA...Contig-U13986-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-B/SSA...147Q.Seq.d/ Representative seq. ID SSA147P (Link to Original site) Representative DNA sequence >SSA147 (SSA147Q) /CSM/SS/SSA...1-B/SSA147Q.Seq.d/ ATTCATTCATACATTTAATCAAACAATGAATTCTACTCGTAATATCATTTCATTAGTTCG TCGTTAT

  12. Dicty_cDB: SSA612 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA612 (Link to dictyBase) - - - Contig-U15745-1 SSA612F (Link to Original site) SSA...612F 500 - - - - - - Show SSA612 Library SS (Link to library) Clone ID SSA612 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA6-A/SSA612Q.Seq.d/ Representative seq. ID SSA61...2F (Link to Original site) Representative DNA sequence >SSA612 (SSA612Q) /CSM/SS/SSA6-A/SSA612Q.Seq.d/ CTAAT...nqvvlitlvtnqptkrythlkmytyfkkkk--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA612 (SSA

  13. Improvements to the Psi-SSA representation

    OpenAIRE

    De Ferriere, Francois

    2007-01-01

    Published in proceedings for the workshop "Software and Compilers for Embedded Systems (SCOPES) 2007" Modern compiler implementations use the Static Single Assignment representation as a way to efficiently implement optimizing algorithms. However this representation is not well adapted to architectures with a predicated instruction set. The Psi-SSA representation extends the SSA representation such that standard SSA algorithms can be easily adapted to an architecture with a fully predicate...

  14. Improvements to the Psi-SSA representation

    CERN Document Server

    De Ferriere, Francois

    2007-01-01

    Modern compiler implementations use the Static Single Assignment representation as a way to efficiently implement optimizing algorithms. However this representation is not well adapted to architectures with a predicated instruction set. The Psi-SSA representation extends the SSA representation such that standard SSA algorithms can be easily adapted to an architecture with a fully predicated instruction set. A new pseudo operation, the Psi operation, is introduced to merge several conditional definitions into a unique definition.

  15. Dicty_cDB: SSA672 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA672 (Link to dictyBase) - - - Contig-U12249-1 SSA672E (Link... to Original site) - - - - - - SSA672E 573 Show SSA672 Library SS (Link to library) Clone ID SSA672 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA6-C/SSA672Q.Seq.d/ Representative seq. ID SSA67...2E (Link to Original site) Representative DNA sequence >SSA672 (SSA672Q) /CSM/SS/SSA6-C/SSA672Q.Seq.d/ ATTAT....Seq.d/ 1104 0.0 SSF809 (SSF809Q) /CSM/SS/SSF8-A/SSF809Q.Seq.d/ 1104 0.0 SSF627 (SSF627Q) /CSM/SS/SSF6-B/SSF627Q.Seq.d/ 1104 0.0 SSA

  16. Dicty_cDB: SSA166 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA166 (Link to dictyBase) - - - Contig-U14969-1 SSA166F (Link to Original site) SSA...166F 455 - - - - - - Show SSA166 Library SS (Link to library) Clone ID SSA166 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-C/SSA166Q.Seq.d/ Representative seq. ID SSA16...6F (Link to Original site) Representative DNA sequence >SSA166 (SSA166Q) /CSM/SS/SSA1-C/SSA166Q.Seq.d/ GCAAG... (bits) Value VSK402 (VSK402Q) /CSM/VS/VSK4-A/VSK402Q.Seq.d/ 137 2e-31 SSL708 (SSL708Q) /CSM/SS/SSL7-A/SSL708Q.Seq.d/ 137 2e-31 SSA

  17. Dicty_cDB: SSA276 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA276 (Link to dictyBase) - - - Contig-U16482-1 SSA276E (Link... to Original site) - - - - - - SSA276E 433 Show SSA276 Library SS (Link to library) Clone ID SSA276 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA2-D/SSA276Q.Seq.d/ Representative seq. ID SSA27...6E (Link to Original site) Representative DNA sequence >SSA276 (SSA276Q) /CSM/SS/SSA2-D/SSA276Q.Seq.d/ AAAGA...73 |pid:none) Salmo salar clone HM5_1670 ribosom... 145 6e-34 BT049913_1( BT049913 |pid:none) Salmo salar clone ssa

  18. Dicty_cDB: SSA586 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA586 (Link to dictyBase) - - - Contig-U16350-1 SSA586F (Link to Original site) SSA...586F 286 - - - - - - Show SSA586 Library SS (Link to library) Clone ID SSA586 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-D/SSA586Q.Seq.d/ Representative seq. ID SSA58...6F (Link to Original site) Representative DNA sequence >SSA586 (SSA586Q) /CSM/SS/SSA5-D/SSA586Q.Seq.d/ ATCAA...it*swswsw--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA

  19. Dicty_cDB: SSA269 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA269 (Link to dictyBase) - - - Contig-U16244-1 SSA269Z (Link... to Original site) - - SSA269Z 504 - - - - Show SSA269 Library SS (Link to library) Clone ID SSA269 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA2-C/SSA269Q.Seq.d/ Representative seq. ID SSA26...9Z (Link to Original site) Representative DNA sequence >SSA269 (SSA269Q) /CSM/SS/SSA2-C/SSA269Q.Seq.d/ XXXXX...letal 4.0 %: vacuolar 4.0 %: plasma membrane >> prediction for SSA269 is cyt 5' end seq. ID - 5' end seq. -

  20. Dicty_cDB: SSA584 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA584 (Link to dictyBase) - - - Contig-U16382-1 SSA584F (Link to Original site) SSA...584F 581 - - - - - - Show SSA584 Library SS (Link to library) Clone ID SSA584 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-D/SSA584Q.Seq.d/ Representative seq. ID SSA58...4F (Link to Original site) Representative DNA sequence >SSA584 (SSA584Q) /CSM/SS/SSA5-D/SSA584Q.Seq.d/ TTTTT...QKSKSHQLTQNNLRSTSECEI CQVFVSKLESYI--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA

  1. Dicty_cDB: SSA213 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA213 (Link to dictyBase) - - - Contig-U16397-1 SSA213Z (Link... to Original site) - - SSA213Z 537 - - - - Show SSA213 Library SS (Link to library) Clone ID SSA213 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA2-A/SSA213Q.Seq.d/ Representative seq. ID SSA21...3Z (Link to Original site) Representative DNA sequence >SSA213 (SSA213Q) /CSM/SS/SSA2-A/SSA213Q.Seq.d/ XXXXX...lkk*k*k**flivk k Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA

  2. Dicty_cDB: SSA154 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA154 (Link to dictyBase) - - - Contig-U16544-1 SSA154E (Link... to Original site) - - - - - - SSA154E 255 Show SSA154 Library SS (Link to library) Clone ID SSA154 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-C/SSA154Q.Seq.d/ Representative seq. ID SSA15...4E (Link to Original site) Representative DNA sequence >SSA154 (SSA154Q) /CSM/SS/SSA1-C/SSA154Q.Seq.d/ ATTTT...( C46264 ) thioredoxin 3 - slime mold (Dictyostelium discoid... 55 6e-07 BT057388_1( BT057388 |pid:none) Salmo salar clone ssa

  3. Dicty_cDB: SSA728 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA728 (Link to dictyBase) - G20776 DDB0168231 Contig-U14313-1 SSA...728P (Link to Original site) SSA728F 316 SSA728Z 474 SSA728P 790 - - Show SSA728 Library SS (Link to library) Clone ID SSA...ontig-U14313-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA7-B/SSA...728Q.Seq.d/ Representative seq. ID SSA728P (Link to Original site) Representative DNA sequence >SSA728 (SSA728Q) /CSM/SS/SSA...lated Amino Acid sequence (All Frames) Frame A: mmssani*nr*nksnnifkn*lnrfsplkrislknynqqlngiknykiqlnsslkeiqrk

  4. Dicty_cDB: SSA531 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA531 (Link to dictyBase) - - - Contig-U16448-1 SSA531Z (Link... to Original site) - - SSA531Z 597 - - - - Show SSA531 Library SS (Link to library) Clone ID SSA531 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-B/SSA531Q.Seq.d/ Representative seq. ID SSA53...1Z (Link to Original site) Representative DNA sequence >SSA531 (SSA531Q) /CSM/SS/SSA5-B/SSA531Q.Seq.d/ XXXXX...8270 ) hypothetical protein - slime mold (Dictyostelium ... 37 0.55 AF054615_1( AF054615 |pid:none) Fragaria x ananassa

  5. Dicty_cDB: SSA529 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA529 (Link to dictyBase) - - - Contig-U16448-1 SSA529E (Link... to Original site) - - - - - - SSA529E 552 Show SSA529 Library SS (Link to library) Clone ID SSA529 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-B/SSA529Q.Seq.d/ Representative seq. ID SSA52...9E (Link to Original site) Representative DNA sequence >SSA529 (SSA529Q) /CSM/SS/SSA5-B/SSA529Q.Seq.d/ AGAAA... mold (Dictyostelium ... 37 0.45 AF054615_1( AF054615 |pid:none) Fragaria x ananassa cellulase (Cel... 36 0.

  6. Penetapan Kadar Kalium, Natrium dan Magnsium pada Semangka (Citrullus vulgaris, Schard) secara Spektrofotometri Serapan Atom.

    OpenAIRE

    Saraan, Sri Muftri Diani

    2012-01-01

    Watermelon is a tropical fruit which is favoured by people cause of it tastes crisp and sweet. Some informed that this fruit can decrease blood pressure cause of its potassium content. The aim of this research is to have a quantitative levels of potassium, sodium and magnesium in yellow and red watermelon’s fruit flesh, also in seed and seedless watermelon. Quantitative analysis is done by atomic absorption spectrophotometer with acetylene-air flame. Potassium, sodium and magnesium are qua...

  7. Variational average atom in quantum plasmas; Atome moyen variationnel dans les plasmas quantiques (Variational Average-Atom in Quantum Plasmas, VAAQP)

    Energy Technology Data Exchange (ETDEWEB)

    Piron, R.

    2009-11-15

    Calculations of the radiative properties of dense plasmas are usually based on the concept of an atom in a plasma. Such a concept is often used in average-atom models which constitute a good starting point for more sophisticated statistical approaches. Average-atom models are also directly useful in the calculation of the equation of state and of some transport coefficients. Since Feynman, Metropolis and Teller application of the Thomas-Fermi model to dense plasmas, all attempts to construct a quantum extension of the model have led to some thermodynamic inconsistencies. This work concerns a variational average-atom model of dense plasmas. Contrary to other models, this one gives access to the thermodynamic equilibrium and respects the Virial theorem. In order to resolve the model's equations, a numerical code called VAAQP (Variational Average-Atom in Quantum Plasmas) was written. In particular, it allows us to calculate the equation of state. After a description of other models, we outline the variational model formalism in the framework of the Thomas-Fermi theory, of the non-relativistic quantum mechanics, and of the relativistic quantum mechanics. It is then shown that the variational model fulfills the Virial theorem and the thermodynamic inconsistencies of the other models are explained. The numerical methods which constitute the basis of the VAAQP code are described. Applications of the variational model to equation of state computations are presented and compared to results from other models, such as INFERNO. Comparisons to experiments on the Hugoniot shock adiabats are also shown. (author)

  8. Analisa Kadar Unsur Zn Dan Cu Pada Kopi Bubuk (Coffea spp.) Dengan Metode Spektrofotometri Serapan Atom

    OpenAIRE

    Mutiara

    2011-01-01

    The research done on the metal content of Zn and Cu from the coffee powder. Samples analyzed are ground coffee with coffee powder factory industry industrial households are analyzed each week for a month. Measurement of Zn and Cu metal concentrations in ground coffee is done by using basah.Pelarut dekstruksi method used was HNO 3 (p) and H 2 SO 4 (p) and pengoksidasinya H 2 O 2 30% and then analyzed by Atomic Absorption Sepektrofotometer on specific λ = 213.9 nm (Zn) and specific λ = 324.8 ...

  9. Register allocation for programs in SSA Form

    OpenAIRE

    Hack, Sebastian

    2007-01-01

    This book investigates register allocation for programs in static single-assignment form. Its main result is that the interference graphs of SSA-form programs are chordal. This gives the compiler precise knowledge over the register demand and allows for separating spilling, assignment and coalescing. For each of these phases, we present methods specially tailored to the SSA setting and provide a first evaluation.

  10. The Josephson effect in atomic contacts; Effect Josephson dans les contacts atomiques

    Energy Technology Data Exchange (ETDEWEB)

    Chauvin, M

    2005-11-15

    The Josephson effect appears when a weak-link establishes phase coherence between two superconductors. A unifying theory of this effect emerged in the 90's within the framework of mesoscopic physics. Based on two cornerstone concepts, conduction channels and Andreev reflection, it predicts the current-phase relation for the most basic weak-link: a single conduction channel of arbitrary transmission. This thesis illustrates this mesoscopic point of view with experiments on superconducting atomic size contacts. In particular, we have focused on the supercurrent peak around zero voltage, put into evidence the ac Josephson currents in a contact under constant bias voltage (Shapiro resonances and photon assisted multiple Andreev reflections), and performed direct measurements of the current-phase relation. (author)

  11. Événement et trauma dans Doctor Atomic de John Adams

    Directory of Open Access Journals (Sweden)

    Mathieu Duplay

    2011-04-01

    Full Text Available This article is based on the hypothesis that, by investigating the question of trauma, psychoanalysis has made an innovative contribution to the debate surrounding the concept of event, not so much because of the points explicitly made by Freud and his successors as because the ambiguities, contradictions, and aporias which characterize their discourse reveal some of the previously unseen difficulties inherent in such a discussion. Thus, the writer argues that a theory and/or poetics of event, however alien to the Freudian tradition, would benefit greatly by paying close attention to the lessons it teaches in this respect. John Adams’s 2005 opera Doctor Atomic, written in collaboration with Peter Sellars, is a case in point, not only because it deals with one of the most violent traumas in 20th‑century history—namely the nuclear test conducted at Los Alamos prior to the bombing of Hiroshima and Nagasaki—but also because, in addition to offering a potent meditation on the unthinkable, it reveals that all events, be they historical or aesthetic, call for new and as yet unformulated modes of thought ; as psychoanalysis suggests (sometimes in spite of itself, this is a clear sign of their traumatic nature.Cet article s’appuie sur l’hypothèse que le travail mené par la psychanalyse sur la notion de trauma jette un éclairage novateur sur la question de l’événement, et cela moins en raison des thèses tour à tour avancées que parce que les ambiguïtés, les revirements et les apories qui caractérisent le discours de Freud et de ses successeurs révèlent quelques‑unes des difficultés jusque-là inaperçues que cette problématique soulève ; c’est pourquoi, suppose‑t‑on, toute pensée et toute esthétique de l’événement, si étrangères soient‑elles à la tradition freudienne, ne peuvent aujourd’hui que gagner à méditer les enseignements dont elle est porteuse sur ce point. L’exemple de Doctor Atomic (2005

  12. FP-SSA框架中Au3Cu型有序合金相的特征原子势能配分函数%Characteristic atom potential energy partition function of Au3Cu type ordered alloys in FP-SSA framework

    Institute of Scientific and Technical Information of China (English)

    谢佑卿; 聂耀庄; 李小波; 刘心笔; 彭红建; 李艳芬

    2011-01-01

    The innovations of the characteristic atom potential energy (CAPE) partition function of Au3Cu type ordered alloys in the systematic science of alloys (SSA) based on first principle (FP)-electronic theory of alloys are concluded in the three aspects: the characteristic atoms AiAu and AiCu at centers of the basic clusters {AiAu -[(/-I)Au, iCu]} and { AiCu-[(I-I)Au,iCu]} are taken as structural unit sequences, which are used to replace the atomic pairs and atomic clusters; the potential energy levels εAu and εCu result from the influence of coordinative cluster [(I-I)Au,iCu] on the characteristic atoms, which are used to replace pairwise interaction energies and cluster interaction energies; the additive law of potential energies of characteristic atoms is established; the average potential energies of alloy phases and their components are calculated; the unity between the degeneracy factors of arrangements and the potential energy levels of characteristic atoms is taken into account for establishing CAPE-partition function and calculating configurational entropy. It reveals some shortcomings of the currently used solution theories and can lay the foundation for establishingGibbs energy partition function.%介绍以第一原理合金电子理论为基础的系统合金科学(FP-SSA)框架中Au3Cu型有序合金的特征原子势能(CAPE)配分函数.主要创新内容如下:以基本原子团{AiAu·[(I - i)Au,iCu]}和{AiCu·[(I- i)Au,iCu]}序列的中心特征原子AiAu和iCu为结构单元序列,替代原子对和原子团,建立了合金相的特征原子排列模型;以配位原子团[(I - i)Au,iCu]对作用于特征原子势场影响的方式替代原子对能量相互作用和原子团能量相互作用方式,以特征原子势能能级代替原子对能级和原子团能级,建立了合金相的“特征原子势能相加定律”,计算合金相及其组元的平均势能;在特征原子排列的简并因数与特征原子势能能级一致的条件下

  13. KANDUNGAN LOGAM BERAT PADA AIR DAN SEDIMEN DI PERAIRAN SOCAH DAN KWANYAR KABUPATEN BANGKALAN

    Directory of Open Access Journals (Sweden)

    Wahyu Andy Nugraha

    2009-10-01

    Full Text Available Logam berat sangat berbahaya bagi biota laut maupun trofik level diatasnya. Penelitian ini bertujuan untuk mengetahui kandungan logam berat di perairan Socah dan Kwanyar kabupaten Bangkalan. Penelitian ini dilaksanakan selama 3 bulan. Pengambilan sampel air menggunakan botol sampel, sedangkan pengambilan sampel sedimen menggunakan grab sampler. Sampel kemudian dianalisa dengan spektrofotometer serapan atom (SSA. Hasil menunjukkan bahwa kandungan logam berat Cd, Cu, Pb, dan Hg pada air di perairan Socah dan Kwanyar masih dibawah ambang batas baku mutu air laut, sedangkan kandungan logam berat di sedimen melebihi ambang batas baku mutu air laut untuk biota laut. Secara umum, kandungan logam berat di sedimen lebih tinggi dari pada kandungan logam berat di air. Kata Kunci : Logam berat, Pencemaran, Spektrophotometer  HEAVY METALS CONTENTS IN WATER AND SEDIMENT IN KWANYAR AND SOCAH WATER, BANGKALANHeavy metals are very dangerous for marine life as well as the trophic level above. This study aims to determine the content of heavy metals in the waters Socah and Kwanyar Bangkalan. This study was conducted over 3 months. Water sampled using a sample bottle, while sediment samples was taken using a grab sampler. The sample was then analyzed by atomic absorption spectrophotometer (AAS. Results showed that the content of heavy metals Cd, Cu, Pb and Hg in the water in the Socah and Kwanyar waters still below the seawater quality standard limits, whereas the heavy metal content in sediments exceeded the water quality standard for marine sea. In general, the content of heavy metals in sediment is higher than on the water.Keywords: Heavy metals, Pollution, AAS

  14. Reuse of sewage sludge ashes (SSA) in cement mixtures: the effect of SSA on the workability of cement mortars.

    Science.gov (United States)

    Monzó, J; Payá, J; Borrachero, M V; Girbés, I

    2003-01-01

    The influence of sewage sludge ash (SSA) on workability of cement mortars has been studied. The irregular morphology of SSA particles produced a decrease of mortar workability. A nonlinear reduction of workability in mortars containing SSA was observed, but when SSA content in mortars was increased the workability reduction was less significant. A superplasticizer is used in order to compensate the decrease of workability produced by SSA. When SSA sized fractions were used, only significant differences in workability for mortars prepared with high water volumes or with the presence of superplasticizer were observed.

  15. Atoms

    Institute of Scientific and Technical Information of China (English)

    刘洪毓

    2007-01-01

    Atoms(原子)are all around us.They are something like the bricks (砖块)of which everything is made. The size of an atom is very,very small.In just one grain of salt are held millions of atoms. Atoms are very important.The way one object acts depends on what

  16. Analisa Kadar Ion Besi, Kadmium Dan Kalsium Dalam Air Minum Kemasan Galon Dan Air Minum Kemasan Galon Isi Ulang Dengan Metode Spektrofotometri Serapan Atom

    OpenAIRE

    Susanti, Widia

    2010-01-01

    The analysis of iron, cadmium and calcium ion in drinking water has been carried out. The samples analyzed are drinking water packaging gallons from official agencies and drinking water packaging refill gallons. The water was distributed with tank from the mountains and the wells drilled. Samples were analyzed every week for a month. Water samples was added with HNO3 (c) and analyzed by using atomic absorption spectrophotometer. The concentration of iron, cadmium and calcium was determined wi...

  17. SSA-Caterpillar in Group Anonymity

    CERN Document Server

    Tavrov, Dan

    2011-01-01

    Nowadays, it is a common practice to protect various types of statistical data before publishing them for different researches. For instance, when conducting extensive demographic surveys such as national census, the collected data should be at least depersonalized to guarantee proper level of privacy preservation. In practice, even more complicated methods of data protection need to be used. All these methods can be generally divided into two classes. The first ones aim at providing individual data anonymity, whereas the other ones are focused on protecting information about a group of respondents. In this paper, we propose a novel technique of providing group anonymity in statistical data using singular spectrum analysis (SSA).Also, we apply SSA to defining hidden patterns in demographic data distribution.

  18. The colour potentials of SSA-containing mortar

    DEFF Research Database (Denmark)

    Kappel, Annemette; Ottosen, Lisbeth M.; Kirkelund, Gunvor Marie;

    2015-01-01

    is with a few exceptions landfilled and thus, wasted.The purpose of the experiments was to examine the influence of SSA and how it affected the colour of mortar samples. SSA was ground in 6 different intervals and added to mortar mixes by replacing 20% of the cement. An additional focus was to examine......This paper reports an experimental study of aesthetical qualities of mortar containing sewage sludgeash (SSA). SSA is the residue produced at water treatment plants where incineration of the sludge is applied in order to decrease volume and to prevent pathogens from spreading. Today SSA...... the possibilities to accentuate the colours of the hardened mortar by using paper cuttings in the production of the samples. The result of the experiments showed that a colour scale can be developed from ground SSA, and that paper may have the potential of providing divers textural qualities when it is used...

  19. Clients of SSA Net-Ready Data

    Science.gov (United States)

    Richmond, D.; Bicker, S.; Malloy, B.

    2014-09-01

    Multiple Net-Centric approaches have been developed to expose optical and radar sensor data. Client applications have been developed to ingest and process this data by NASIC and JMS. Data flows and formats used that integrate these Net-Centric approaches with JMS and NASIC will be presented. Example data collected and examples of improved SSA benefits will be discussed. Potential future improvements to increase the precision of the SOI processing algorithm will be addressed. Specifics regarding the process to gain access to the N-CSDS GEODSS sensor data in near real time will be identified.

  20. The Aesthetical quality of SSA-containing mortar and concrete

    DEFF Research Database (Denmark)

    Kappel, Annemette; Kirkelund, Gunvor Marie; Ottosen, Lisbeth M.;

    2014-01-01

    that gives a characteristic red colour. The process of grinding SSA has shown to improve the compressive strength of SSA- containing mortar (Donatello et al. 2010). Thus, in this study SSA was grinded in 6 different intervals ranging from 0 – 10 min, and then added to the mortar mix replacing 20% of cement....... The experiment revealed that the colour of the SSA-containing mortar intensified as the time interval of the grinding process increased. Each of the 6 steps within the time interval provided an additional colour tone and generated a colour scale consisting of mortar samples ranging from greyish to a more...

  1. The colour potentials of SSA-containing mortar

    DEFF Research Database (Denmark)

    Kappel, Annemette; Ottosen, Lisbeth M.; Kirkelund, Gunvor Marie;

    2015-01-01

    This paper reports an experimental study of aesthetical qualities of mortar containing sewage sludgeash (SSA). SSA is the residue produced at water treatment plants where incineration of the sludge is applied in order to decrease volume and to prevent pathogens from spreading. Today SSA is with a......This paper reports an experimental study of aesthetical qualities of mortar containing sewage sludgeash (SSA). SSA is the residue produced at water treatment plants where incineration of the sludge is applied in order to decrease volume and to prevent pathogens from spreading. Today SSA...... is with a few exceptions landfilled and thus, wasted.The purpose of the experiments was to examine the influence of SSA and how it affected the colour of mortar samples. SSA was ground in 6 different intervals and added to mortar mixes by replacing 20% of the cement. An additional focus was to examine...... the possibilities to accentuate the colours of the hardened mortar by using paper cuttings in the production of the samples. The result of the experiments showed that a colour scale can be developed from ground SSA, and that paper may have the potential of providing divers textural qualities when it is used...

  2. Atomes une exploration visuelle de tous les éléments connus dans l'univers

    CERN Document Server

    Gray, Theodore

    2013-01-01

    Quelle est leur température critique ? Qu'est-ce que la masse atomique, la densité d'un matériau, l'ordre de remplissage des électrons ? Cet ouvrage invite avec pédagogie et humour à un passionnant voyage au pays des éléments, à partir de leur tableau périodique universel. Soutenue par une exploration visuelle qui montre l'élément à l'état pur mais aussi ses composés et ses applications les plus caractéristiques dans la vie quotidienne, cette approche pratique offre une combinaison parfaite de science chimique et de photographies, qui séduira les lecteurs les plus avertis comme tous les autres habitants sensibles de l'univers.

  3. Dosage du mercure dans le gaz naturel par absorption atomique sans flammes Mercury Titration in Natural Gas by Flameless Atomic Absorption

    Directory of Open Access Journals (Sweden)

    La Villa F.

    2006-11-01

    Full Text Available Cet article présente la méthode mise au point par l'Institut Français du Pétrole pour déterminer par absorption atomique sans flamme, les traces de mercure métallique contenu dans un gaz naturel. La méthode d'analyse nécessite une extraction du mercure soit sous forme d'ion mercurique en faisant passer le gaz dans une solution oxydante, soit sous forme d'amalgame avec de l'or ou de l'argent. Le premier mode opératoire s'applique aux échantillons dont la concentration en mercure est supérieure à I ttg/Nm3, le second pour des concentrations inférieures à 5 pg/Nm3. Les seuils de détection sont respectivement 10 ng (en solution et 0,3 ng (en amalgame. La répétabilité pour 100 ng de mercure (en amalgame est de ± 7% pour une probabilité de.95 %. En conclusion, dans un échantillon de gaz naturel, compte tenu du volume des prélèvements effectués, il est possible de détecter des concentrations de l'ordre du nanogramme de mercure par mètre cube de gaz. This article describes the method developed by IFP using flameless atomic absorption to determine metallic mercury traces in a natural gas. The analyst method requires a mercury extraction either in the form of mercuric ions by making the gas pass through an oxidizing solution or in the form of an amalgam with gold or silver. The former operating method applies ta samples having a mercury concentration greater than I !ag/Nm3, and the latter for concentrations smaller than 5 (-Lg/Nm3. Detection thresholds are respectively 10 ng (in solution and 0.3 ng (in amalgam. The repeatability for 100 ng of mercury (in amalgam is ± 7 % with a probability of 95%. To conclude, in a sample of natural gas, considering the volume of the samples taken, it is possible ta detect concentrations in the vicinity of one nanogrom of mercury per cubic meter of gas.

  4. Arctic Region Space Weather Customers and SSA Services

    DEFF Research Database (Denmark)

    Høeg, Per; Kauristi, Kirsti; Wintoft, Peter;

    and communication can be established without errors resulting from Space Weather effects. An ESA project have identified and clarified, how the products of the four ESA Space Weather Expert Service Centres (SWE) in the ESA Space Situational Awareness Programme (SSA), can contribute to the requirements of SSA...

  5. Study of atomic jumps in quasi-crystals; Etude des sauts atomiques dans les quasi-cristaux

    Energy Technology Data Exchange (ETDEWEB)

    Lyonnard, S

    1997-05-07

    The terminology phason used in quasicrystals to refer to atomic jumps. The study of the hopping process is important for the understanding of many basic issues in quasi-crystallography: structure, stability, diffusion, phase transitions between quasicrystals and approximants, mechanical properties. Quasi-elastic neutron scattering allows to find the characteristics of each elementary jump: chemical species involves, relaxation times, activation energies, jump distances and orientations. We performed a series of experiments in the perfect icosahedral phases AlFeCu and AlMnPd, on both powders and single domain samples, using time-of-flight, backscattering and triple axis spectrometers. We evidenced the existence of very fast phason hopping, and studied about ten different atomic jumps. An unusual temperature dependence has been found systematically: each process is assisted by a thermally activated mechanism. The assistance process has to be determined case by case, but the more plausible explanation invokes assistance by phonons or phason clouds. Moreover, the dependence of the quasi elastic signal as a function of the momentum transfer shows that the jumps are local and do not give rise to any long-range diffusion. Phason hopping mainly corresponds to the atom moving forwards and backwards between two energetically equivalent sites. Finally, we have been able to show that the jumps occur along the various quasi-crystalline symmetry axes. (author) 91 refs.

  6. DAN PIENAAR GUN PARK LAUNCHES MUSEUM INTO 21ST CENTURY

    Directory of Open Access Journals (Sweden)

    C. Monick

    2012-02-01

    Full Text Available On 14 February 1992 there occurred the official opening of the Dan Pienaar Gun Park at the South African National Museum of Military History. The Gun Park is a newly completed exhibition area created by roofing and repairing the central courtyard between the exhibition's main halls. Lt Gen G L Meiring, SSA, SO, officially opened the Dan Pienaar Gun Park. The statue of Maj Gen D H ('Dan' Pienaar was officially unveiled by his widow (now Mrs Norma Seuffert. Maj Gen Pienaar's children, Fay, Barry and Nelia, were also present, in addition to a very wide representation of the Pienaar family.

  7. ESA-SSA Review of Space Weather Measurement Requirements

    Science.gov (United States)

    Luntama, Juha-Pekka; Glover, Alexi; Hilgers, Alain

    2012-07-01

    The ESA Space Situational Awareness (SSA) Preparatory Programme was started in 2009. The objective of the programme is to support the European independent utilisation of and access to space. The first phase of the ESA SSA system development will be finished in 2012 and the next phase is foreseen to be started after the ESA Ministerial Council meeting in November 2012. The definition of measurement requirements for the Space Weather Segment (SWE) of the ESA SSA system has been based on the space weather service requirements defined the by expected users of the system. This document, SSA SWE Customer Requirements Document (CRD), has been defined in a iterative process together with the members of the SSA User Representative Group (URG) and the delegates representing the European states participating the programme. Based on the SWE CRD, ESA with the support of the European industry has produced two documents: SSA SWE System Requirements Document (SRD) and SSA SWE Product Specification (PS). SWE PS contains the requirements for the measurements data required by the SSA SWE system. The SWE PS document has been recently rigorously reviewed by the SSA URG in the framework of the SSA System Requirements Review (SRR). The support provided by the Steering Board of the ESA Space Weather Working Team (SWWT) in this review was extremely useful. The members of the SWWT SB representing the scientific community and the provisional service providers were able to give very detailed comments regarding the measurement requirements for accuracy, cadence, timeliness, etc. As these parameters will be provisional design and cost drivers for the ESA SSA system, definition of the appropriate values at this point in the programme is crucial. This paper provides an overview of the measurement requirements for the SWE Segment of the ESA SSA Programme. The paper discusses the requirement definition process, the customer and service provider inputs, and the critical requirements as they have

  8. Adding the "Local" Layer to the SSA Picture

    Science.gov (United States)

    Zaman, F.; Duckett, M.

    2012-09-01

    The heritage of Space Situational Awareness (SSA) has been limited to Earth based observation of space to support collision avoidance and space object identification. In part, this has led to reliance on multiple CONUS locations for optical and non-optical ground based observation. It has also led to the specialization of many fields and industries, which are highlighted at conferences like AMOS through discussion of state-of-the-art of observation capabilities. This paradigm alone no longer addresses the current needs for situational awareness of space assets in the changing space culture. Events in recent years have shown that space based sensing capabilities are increasingly critical as complements to ground based radar and optical systems. The SSA community would be better served by adopting the concept of "local" SSA and proliferating technologies to accomplish this. The traditional definition of SSA would expand to encompass an understanding of the immediate natural and manmade environment of the satellite. Multiple insights would be enabled, including baseline trending to support anomaly identification and resolution, catastrophic failure investigation, and anomaly and/or failure attribution. Additionally, protection measures could potentially be enabled to ensure space asset availability. Moving forward with a combination of traditional SSA and "local" SSA capabilities would allow a potential "global" SSA picture to be developed. This enhanced understanding would consist of ground observations in addition to the satellite's "first person" perspective. The potential for an exponentially increased comprehension of SSA is created by this powerful combination. The first step toward demonstrating this combination of SSA knowledge has been achieved with data from the SASSA Technology Demonstration.

  9. Étude de la contribution de la diffusion simple et multiple à l'amplitude des atomes voisins du silicium dans SiO{2} : application à un granulat soumis à la réaction alcali-silice

    Science.gov (United States)

    Boinski, F.; Khouchaf, L.; Verstraete, J.; Tuilier, M. H.

    2004-11-01

    Les amplitudes des différentes distributions lointaines de la transformée de Fourier d'un spectre EXAFS contiennent des informations précieuses pour la caractérisation de l'ordre local autour d'un atome donné. Ces informations sont souvent nécessaires pour la proposition de modèles. Or souvent dans cette zone, les distances inter atomiques correspondent à des libres parcours moyens du photoélectron assez importants. La contribution due à la diffusion multiple perturbe le signal propre de la diffusion simple des atomes diffuseurs. Afin de mieux évaluer l'influence de la diffusion multiple dans nos échantillons constitués de granulats à base de SiO{2} attaqués par la réaction alcali-silice, nous avons calculé les différents parcours de diffusion simple et multiple dans ce composé. Les calculs montrent que lorsque la contribution de la diffusion multiple n'est pas atténuée, l'exploitation des voisins lointains est difficile voir impossible. La modélisation des spectres TF expérimentaux a pu être réalisée uniquement en négligeant la contribution de la diffusion multiple. Ce résultat va nous permettre l'exploitation des voisins lointains en particulier les atomes silicium dans le granulat brut et après dégradation en se basant sur le formalisme de la diffusion simple.

  10. An Extragalactic Spectroscopic Survey of the SSA22 Field

    CERN Document Server

    Saez, C; Bauer, F E; Stern, D; Gonzales, A; Rreza, I; Alexander, D M; Matsuda, Y; Geach, J E; Harrison, F A; Havashino, T

    2015-01-01

    We present VLT VIMOS, Keck DEIMOS and Keck LRIS multi-object spectra of 367 sources in the field of the z ~ 3.09 protocluster SSA22. Sources are spectroscopically classified via template matching, allowing new identifications for 206 extragalactic sources, including 36 z > 2 Lyman-break galaxies (LBGs) and Lyman-a emitters (LAEs), 8 protocluster members, and 94 X-ray sources from the ~ 400 ks Chandra deep survey of SSA22. Additionally, in the area covered by our study, we have increased by ~ 4, 13, and 6 times the number of reliable redshifts of sources at 1.0 3.4, and with X-Ray emission, respectively. We compare our results with past spectroscopic surveys of SSA22 to investigate the completeness of the LBGs and the X-Ray properties of the new spectroscopically-classified sources in the SSA22 field.

  11. TiSSA eelkonverents doktorantidele Tallinnas / Koidu Saame

    Index Scriptorium Estoniae

    Saame, Koidu

    2010-01-01

    Tallinna Ülikoolis toimunud TiSSA doktorantide eelkonverentsist 22.-24. aug. 2010.a. Doktorantide ettekannetest. Esinesid: Hans-Uwe Otto, Andriy Yuryev, Tiina Naarits, Ivar Tröner, Koidu Saame, Maija Jäppinen, Janissa Miettinen

  12. ANALISIS KARAKTERISASI VIBRASI MOLEKUL SENYAWA ORGANIK FENOL, ASAM AKSALAT DAN ETIL ASETAT SECARA SPEKTOSKOPI INFRA MERAH

    OpenAIRE

    Bannu, S.Si., M.Si.

    2005-01-01

    Telah dilakukan penelitian Analisis Karakterisasi Vibrasi Melekul Senayawa Organik Fenol, Asam Oksalat dan Etil Asetat. Hasil Penelitian yang diamati : 1) frekuensi serapan vibrasi untuk masing-masing ikatan antar atom pada molekul Fenol, Asam Oksalat dan Etil Asetat; 2) konstanta gaya pada molekul Fenol, Asam Oksalat dan Etil Asetat; 3) panjang ikatan antar Atom; 4) konstanta tak harmonik ikatan antar atom; dan 5) energi disosiasi iktan antar atom. Karakterisasi dari ke tiga senyawa men...

  13. 20 CFR 422.705 - When SSA employees may listen-in to or record telephone conversations.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false When SSA employees may listen-in to or record... ORGANIZATION AND PROCEDURES Use of SSA Telephone Lines § 422.705 When SSA employees may listen-in to or record telephone conversations. SSA employees may listen-in to or record telephone conversations on SSA...

  14. Clinical and Pathological Roles of Ro/SSA Autoantibody System

    Directory of Open Access Journals (Sweden)

    Ryusuke Yoshimi

    2012-01-01

    Full Text Available Anti-Ro/SSA antibodies are among the most frequently detected autoantibodies against extractable nuclear antigens and have been associated with systemic lupus erythematosus (SLE and Sjögren's syndrome (SS. Although the presence of these autoantibodies is one of the criteria for the diagnosis and classification of SS, they are also sometimes seen in other systemic autoimmune diseases. In the last few decades, the knowledge of the prevalence of anti-Ro/SSA antibodies in various autoimmune diseases and symptoms has been expanded, and the clinical importance of these antibodies is increasing. Nonetheless, the pathological role of the antibodies is still poorly understood. In this paper, we summarize the milestones of the anti-Ro/SSA autoantibody system and provide new insights into the association between the autoantibodies and the pathogenesis of autoimmune diseases.

  15. Preliminary approach of the MELiSSA loop energy balance

    Science.gov (United States)

    Poulet, Lucie; Lamaze, Brigitte; Lebrun, Jean

    Long duration missions, such as the establishment of permanent bases on the lunar surface or the travel to Mars, require a huge amount of life support consumables (e.g. food, water and oxygen). Current rockets are at the moment unable to launch such a mass from Earth. Consequently Regenerative Life Support Systems are necessary to sustain long-term manned space mission to increase recycling rates and so reduce the launched mass. Thus the European and Canadian research has been concentrating on the MELiSSA (Micro-Ecological Life Support System Alternative) project over the last 20 years. MELiSSA is an Environmental Controlled Life Support System (ECLSS), i.e. a closed regenerative loop inspired of a lake ecosystem. Using light as a source of energy, MELiSSA's goal is the recovery of food, water and oxygen from CO2 and organic wastes, using microorganisms and higher plants. The architecture of a ECLSS depends widely on the mission scenario. To compare several ECLSS architectures and in order to be able to evaluate them, ESA is developing a multi criteria evaluation tool: ALISSE (Advanced LIfe Support System Evaluator). One of these criteria is the energy needed to operate the ECLSS. Unlike other criteria like the physical mass, the energy criterion has not been investigated yet and needs hence a detailed analysis. It will consequently be the focus of this study. The main objective of the work presented here is to develop a dynamic tool able to estimate the energy balance for several configurations of the MELiSSA loop. The first step consists in establishing the energy balance using concrete figures from the MELiSSA Pilot Plant (MPP). This facility located at the Universitat Autonoma de Barcelona (UAB) is aimed at the ground demonstration of the MELiSSA loop. The MELiSSA loop is structured on several subsystems; each of them is characterized by supplies, exhausts and process reactions. For the purpose of this study (i.e. a generic tool) the solver EES (Engineering

  16. [Anti-Ro/SSA antibodies in congenital heart block].

    Science.gov (United States)

    Barrios Prieto, Ernesto; Martínez Ceccopieri, David Alejandro; Panduro Barón, J Guadalupe; Fajardo Dueñas, Sergio

    2012-06-01

    Describe a case of a female patient having anti-Ro/SSA antibodies without any other risk factor or collagen disease. In her first pregnancy a congenital heart block and hydrops in the fetus were diagnosed, and these caused stillbirth. In a second pregnancy an in utero treatment resulted in the succesful delivery of a normal child.

  17. 76 FR 41685 - Electronic Substitutions for Form SSA-538

    Science.gov (United States)

    2011-07-15

    ... From the Federal Register Online via the Government Publishing Office SOCIAL SECURITY ADMINISTRATION 20 CFR Part 416 RIN 0960-AH02 Electronic Substitutions for Form SSA-538 AGENCY: Social Security... our use of electronic case processing at the initial and reconsideration levels of our...

  18. Capture de forces à atomes piégés dans un réseau optique : caractérisation des performances

    OpenAIRE

    Hilico, Adèle

    2014-01-01

    The thesis presents the set up of the second version of the experiment FORCA-G (CAsimir FORce and Gravitation at short range). The purpose of this experiment is the measurement of short-range interactions between an atom and a massive surface. The measurement is realised thanks to atom interferometers using atoms trapped in a 1D vertical optical lattice. The energy levels of atoms in such a trap are shifted from lattice site to another by the force we aim at measuring. We move the atoms from ...

  19. On the Complexity of Spill Everywhere under SSA Form

    CERN Document Server

    Bouchez, Florent; Rastello, Fabrice

    2007-01-01

    Compilation for embedded processors can be either aggressive (time consuming cross-compilation) or just in time (embedded and usually dynamic). The heuristics used in dynamic compilation are highly constrained by limited resources, time and memory in particular. Recent results on the SSA form open promising directions for the design of new register allocation heuristics for embedded systems and especially for embedded compilation. In particular, heuristics based on tree scan with two separated phases -- one for spilling, then one for coloring/coalescing -- seem good candidates for designing memory-friendly, fast, and competitive register allocators. Still, also because of the side effect on power consumption, the minimization of loads and stores overhead (spilling problem) is an important issue. This paper provides an exhaustive study of the complexity of the ``spill everywhere'' problem in the context of the SSA form. Unfortunately, conversely to our initial hopes, many of the questions we raised lead to NP-...

  20. PENGEMBANGAN INSTRUMEN ASESMEN DIRI DAN TEMAN SEJAWAT KOMPETENSI BIDANG STUDI PADA MAHASISWA

    Directory of Open Access Journals (Sweden)

    Enny Wijayanti

    2015-10-01

    Kata kunci: asesmen diri dan asesmen teman sejawat, kompetensi fisika   DEVELOPING SELF-ASSESSMENT AND PEER-ASSESSMENT FOR STUDENTS’ SUBJECT-MATTER COMPETENCY Abstract This study aimed to: (1 develop the construct of the Students’ Self-Assessment (SSA and Students’ Peer-Assessment (SPA as supplementary formative assessment on physics teaching and learning, (2 find out the chracteristic of the SSA and SPA, (3 find out the effectivenes and (4 find out the usefulness of the SSA and SPA. The development procedure consisted of two stages: development and validation, based of the spiral model from Cennamo and Kalk, with five phases, namely define, design, demonstrate, develop, and deliver. Content validity was determined by expert judgment through coefficient validity analysis from Aiken, focus group discussion, and Delphi technique. Construct validity was analyzed using software SmartPLS. The subjects of this study were sixth semester students majoring on Physics Education at Palangka Raya University. The result of the study can be concluded as follows: (1 the result of model fit, the GFI values 0.996 and the SRMR values of 0.062, may be taken to indicate good fit, (2 the characteristic of the SSA and SPA consisted of validity, reliability, difficulty index and discriminant index had been verified, (3 the effectiveness of group SSA and SPA is better than group of non SSA and SPA, besides students’ response declares SSA and SPA are reasonably effective, (4 SSA and SPA are very useful as feedback for the learning process, progress, and the learning outcome improvement. Keywords: Peer-and Self-assessment, Physics competency

  1. Pengaruh Konsentrasi H2SO4 Dan HCL Pada Zeolit Alam Teraktivasi Serta PH Larutan Terhadap Adsorbsi Logam Kobal (Co) DAN Nikel (N) Dalam Larutan Standar Dengan Metode Spektrofotometri Serapan Atom

    OpenAIRE

    Rivan

    2012-01-01

    The influence of variations in concentrate H2SO4 and HCl of natural zeolite most activated on adsorbtion of the metal cobalt (Co) and nickel (Ni) in the standard solution by Atomic Absorption Spectrophotometric method has been studied. In the activation process of natural zeolites assessed by concentrate effect’s of H2SO4 and HCl which is 1.0, 2.0, 3.0, 4.0, and 5.0 N for each one. Into a standard solution of cobalt (Co) and nickel (Ni) was added 5 grams of natural zeolites that have been ac...

  2. BOREAS TE-1 SSA-Fen Soil Profile Nutrient Data

    Science.gov (United States)

    Papagno, Andrea; Anderson, Darwin; Newcomer, Jeffrey A. (Editor); Hall, Forrest G. (Editor)

    2000-01-01

    The BOREAS TE-1 team collected various data to characterize the soil-plant systems in the BOREAS SSA. Particular emphasis was placed on nutrient biochemistry, the stores and transfers of organic carbon, and how the characteristics were related to measured methane fluxes. The overall traniect in the Prince Albert National Park (Saskatchewan, Canada) included the major plant communities and related soils that occurred in that section of the boreal forest. Soil physical, chemical, and biological measurements along the transect were used to characterize the static environment, which allowed them to be related to methane fluxes. Chamber techniques were used to provide a measure of methane production/uptake. Chamber measurements coupled with flask sampling were used to determine the seasonality of methane fluxes. This particular data set contains soil profile measurements of various nutrients at the SSA-Fen site. The data were collected from 23-May to 21-Oct- 1994. The data are stored in tabular ASCII files. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).

  3. 30 kW SSA Test for the KOMAC MEBT

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Seong-Gu; Seol, Kyung-Tae; Kwon, Hyeok-Jung; Kim, Han-Sung; Song, Young-Gi; Cho, Yong-Sub [Korea Atomic Energy Research Institute, Gyeongju (Korea, Republic of)

    2015-10-15

    The 100 MeV proton accelerator is constructed in the KOMAC, KOMAC has been provided with the proton beam for the many industrial applications. In the 100 MeV proton linear accelerator (Linac) for KOMAC, the RF source will power two-accelerator cavities (an RFQ, a DTL1) operated at a frequency of 350 MHz. The low level RF (LLRF) system for 100 MeV proton linear accelerator provides field control including an RFQ and a DTL at 350 MHz. In our system, an accelerating electric field stability of ± 1% in amplitude and ± 1° in phase is required for the RF system. Now a total of 9 RF systems are being operated. To improve the beam quality, the additional RF system for MEBT (Medium Energy Beam Transport) is needed. An addition of a MEBT RF system will reduce loss of beam quantity caused by gab between 20 MeV DTL tank and 100 MeV DTL tank. To this end, we have developed MEBT RF system, and test 30 kW SSA which is key element of the RF system. The transmission lines from the RF control rack to the MEBT tank were installed. RF system for MEBT is being installed. LLRF analog and SSA have been tested.

  4. 20 CFR 411.330 - How will SSA evaluate an EN's performance?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false How will SSA evaluate an EN's performance...-SUFFICIENCY PROGRAM Employment Networks § 411.330 How will SSA evaluate an EN's performance? (a) We will periodically review the results of the work of each EN to ensure effective quality assurance in the...

  5. Human Decision Processes: Implications for SSA Support Tools

    Science.gov (United States)

    Picciano, P.

    2013-09-01

    Despite significant advances in computing power and artificial intelligence (AI), few critical decisions are made without a human decision maker in the loop. Space Situational Awareness (SSA) missions are both critical and complex, typically adhering to the human-in-the-loop (HITL) model. The collection of human operators injects a needed diversity of expert knowledge, experience, and authority required to successfully fulfill SSA tasking. A wealth of literature on human decision making exists citing myriad empirical studies and offering a varied set of prescriptive and descriptive models of judgment and decision making (Hastie & Dawes, 2001; Baron, 2000). Many findings have been proven sufficiently robust to allow information architects or system/interface designers to take action to improve decision processes. For the purpose of discussion, these concepts are bifurcated in two groups: 1) vulnerabilities to mitigate, and 2) capabilities to augment. These vulnerabilities and capabilities refer specifically to the decision process and should not be confused with a shortcoming or skill of a specific human operator. Thus the framing of questions and orders, the automated tools with which to collaborate, priming and contextual data, and the delivery of information all play a critical role in human judgment and choice. Evaluating the merits of any decision can be elusive; in order to constrain this discussion, ‘rational choice' will tend toward the economic model characteristics such as maximizing utility and selection consistency (e.g., if A preferred to B, and B preferred to C, than A should be preferred to C). Simple decision models often encourage one to list the pros and cons of a decision, perhaps use a weighting schema, but one way or another weigh the future benefit (or harm) of making a selection. The result (sought by the rationalist models) should drive toward higher utility. Despite notable differences in researchers' theses (to be discussed in the full

  6. MELiSSA Food Characterization general approach and current status

    Science.gov (United States)

    Weihreter, Martin; Chaerle, Laury; Secco, Benjamin; Molders, Katrien; van der Straeten, Dominique; Duliere, Eric; Pieters, Serge; Maclean, Heather; Dochain, Denis; Quinet, Muriel; Lutts, Stanley; Graham, Thomas; Stasiak, Michael; Rondeau Vuk, Theresa; Zheng, Youbin; Dixon, Mike; Laniau, Martine; Larreture, Alain; Timsit, Michel; Aronne, Giovanna; Barbieri, Giancarlo; Buonomo, Roberta; Veronica; Paradiso, Roberta; de Pascale, Stafania; Galbiati, Massimo; Troia, A. R.; Nobili, Matteo; Bucchieri, Lorenzo; Page, Valérie; Feller, Urs; Lasseur, Christophe

    Higher plants play an important role in closed ecological life support systems as oxygen pro-ducers, carbon dioxide and water recyclers, and as a food source. For an integration of higher plant chambers into the MELiSSA (Micro Ecological Life Support System Alternative) loop, a detailed characterization and optimization of the full food production and preparation chain is needed. This implies the prediction and control of the nutritional quality of the final products consumed by the crew, the prediction of the wastes quality and quantity produced along the chain for further waste treatment (MELiSSA waste treatment) and the optimization of overall efficiencies. To reach this goal several issues have to be studied in an integrated manner: the physiological responses of crops to a range of environmental parameters, crop yield efficiencies and respective ratio and composition of edible and inedible biomass, the processability and storability of the produced food and last but not least composition of wastes in view of further degradation (fiber content). Within the Food Characterization (FC) project several compar-ative plant growth bench tests were carried out to obtain preliminary data regarding these aspects. Four pre-selected cultivars of each of the four energy-rich crops with worldwide usage -wheat, durum wheat, potato and soybean -were grown under well-characterized environmental conditions. The different cultivars of each species are screened for their performance in view of a closed loop application by parameter ranking. This comprises the characterization of edi-ble/inedible biomass ratio, nutritional quality, processability and overall performance under the specific conditions of hydroponic cultivation and artificial illumination. A second closely linked goal of the FC project is to develop a mechanistic physiological plant model, which will ease the integration of higher plants compartments in the MELiSSA concept by virtue of its predictive abilities

  7. Point defects and irradiation in oxides: simulations at the atomic scale; Defauts ponctuels et irradiation dans les oxydes: simulation a l'echelle atomique

    Energy Technology Data Exchange (ETDEWEB)

    Crocombette, J.P

    2005-12-15

    The studies done by Jean-Paul Crocombette between 1996 and 2005 in the Service de Recherches de Metallurgie Physique of the Direction de l'Energie Nucleaire in Saclay are presented in this Habilitation thesis. These works were part of the material science researches on the ageing, especially under irradiation, of oxides of interest for the nuclear industry. In this context simulation studies at the atomic scale were performed on two elementary components of ageing under irradiation : point defects and displacement cascades ; using two complementary simulation techniques : ab initio electronic structure calculations and empirical potential molecular dynamics. The first part deals with point defects : self defects (vacancies or interstitials) or hetero-atomic dopants. One first recalls the energetics of such defects in oxides, the specific features of defects calculations and the expected accuracy of these calculations. Then one presents the results obtained on uranium dioxide, oxygen in silver and amorphous silica. The second part tackles the modelling of disintegration recoil nuclei in various?displacement cascades created by crystalline matrices for actinide waste disposal. Cascade calculations give access to the amorphization mechanisms under irradiation of these materials. One thus predicts that the amorphization in zircon takes place directly in the tracks whereas in lanthanum zirconate, the amorphization proceeds through the accumulation of point defects. Finally the prospects of these studies are discussed. (author)

  8. Phase separation in Al-Zr-Sc alloys: from atomic jumps to ordered precipitates growth; Separation de phase dans les alliages Al-Zr-Sc: du saut des atomes a la croissance de precipites ordonnes

    Energy Technology Data Exchange (ETDEWEB)

    Clouet, E

    2004-07-01

    Zirconium and scandium addition to aluminium alloys leads to the formation of ordered precipitates. This study aims to a better understanding of precipitation kinetics thanks to an approach combining atomic and mesoscopic models. An experimental work has been undertaken too so as to characterize by transmission electron microscopy Al{sub 3}Zr kinetics of precipitation. We mainly focus on the nucleation stage and, in this purpose, an atomic model lying on a rigid lattice has been built for Al-Zr-Sc system allowing us to study precipitation with kinetic Monte Carlo simulations. While keeping the vacancy exchange mechanism for diffusion, we introduce multi-site interactions going thus beyond a simple pair interaction model, and test the influence of these interactions on kinetics of precipitation. The comparison between Monte Carlo simulations and classical nucleation theory shows that mesoscopic models can lead to a good description of the nucleation stage of Al{sub 3}Zr and Al{sub 3}Sc as long as the order tendency of the system has been taken into account to calculate input parameters of these models. For the ternary Al-Zr-Sc system, atomic simulations allow a better understanding of the precipitation kinetic path. It is then possible to extend the field of classical nucleation theory so as to model nucleation in a ternary alloy where the stoichiometry of the precipitates is unknown. (author)

  9. Pengaruh Variasi Waktu Ultrasonikasi dan Waktu Tahan Hydrothermal terhadap Struktur dan Konduktivitas Listrik Material Graphene

    Directory of Open Access Journals (Sweden)

    Muhammad Junaidi

    2014-03-01

    Full Text Available Graphene merupakan satu lapis atom karbon yang mengalami hibridisasi sp2 membentuk struktur heksagonal 2D. Graphene memiliki potensi besar untuk aplikasi nanoelectronic materials. Penelitian ini bertujuan menganalisis waktu ultrasonikasi dan hidrothermal terbaik untuk mensintesis Graphene. Graphene disintesis dengan metode reduksi Grafit Oksida (GO. Grafit dioksidasi membentuk GO dengan modifikasi metode Hummer. GO diultrasonikasi dengan variasi waktu 60, 90 dan 120 menit. Kemudian proses reduksi GO dilakukan secara kimia dengan penambahan serbuk Zn dan teknik hidrothermal 200 oC dengan variasi waktu tahan 12, 18 dan 24 jam. Analisis morfologi dan struktur graphene dilakukan dengan pengujian SEM dan XRD. Pengujian Iodine Number untuk mengetahui kemampuan graphene menyerap Iodin. Pengujian FTIR untuk mengetahui gugus fungsi yang terbentuk  pada GO dan Graphene. Pengujian Four Point Probe Test (FPP untuk mengukur konduktivitas listrik Graphene. Hasil analsis menunjukkan bahwa graphene hasil ultrasonikasi 120 menit dan Holding 12 jam memiliki struktur Single Layer Graphene (SLG dengan konduktivitas listrik terbaik 0.0105 S/m

  10. Formal Verification of an SSA-based Middle-end for CompCert

    OpenAIRE

    Barthe, Gilles; Demange, Delphine; Pichardie, David

    2011-01-01

    CompCert is a formally verified compiler that generates compact and efficient PowerPC, ARM and x86 code for a large and realistic subset of the C language. However, CompCert foregoes using Static Single Assignment (SSA), an intermediate representation that allows for writing simpler and faster optimizers, and that is used by many compilers. In fact, it has remained an open problem to verify formally an SSA-based compiler middle-end. We report on a formally verified, SSA-based, middle-end for ...

  11. Anti-TNFa treatment in patients with rheumatoid arthritis and anti-Ro/SSA antibodies

    OpenAIRE

    Airò, P; R. Gorla; M. Vianelli; M. Frassi; Danieli, E; F. Franceschini; I. Cavazzana; Cattaneo, R

    2011-01-01

    Objective: To analyse clinical efficacy, onset of new autoantibodies or symptoms of autoimmune disease in patients affected by rheumatoid arthritis with anti-Ro/SSA treated with anti-TNFa agents. Methods: Six anti-Ro/SSA positive subjects with RA were studied every six months until 24th month of treatment in order to detect ANA titer (IFI), anti-dsDNA (Farr), anti-cardiolipin and anti-beta2glycoprotein I (ELISA), anti-ENA (CIE). The titre of anti-Ro/SSA were analysed by ELISA. Four patients w...

  12. Ultracold lithium-6 atoms in the BEC-BCS crossover: experiments and the construction of a new apparatus; Atomes de lithium-6 ultra froids dans la transition BEC-BCS: experiences et construction d'un montage experimental

    Energy Technology Data Exchange (ETDEWEB)

    Teichmann, M

    2007-09-15

    We use a fermionic gas of Lithium-6 as a model system to study superfluidity. The limiting cases of superfluidity are Bose-Einstein condensation (BEC) and superconductivity, described by the theory by Bardeen, Cooper and Schrieffer (BCS). In Lithium-6 gases, we can explore the whole range between the two cases, known as the BEC-BCS crossover, using a Feshbach resonance. We study the change of the momentum distribution of the gas in this cross-over and compare to theoretical models. We also investigate the hydrodynamic expansion, characteristic for a superfluid gas. We observe a sudden change of the ellipticity of the gas close to the transition to the superfluid phase. Moreover, we localized heteronuclear Feshbach resonances between {sup 6}Li and {sup 7}Li. We are currently constructing a second generation of the experimental setup. An new laser system, based on high power laser diodes, was developed. Changes in the vacuum chamber, including a complete reconstruction of the Zeeman slower, have increased the atomic flux, allowing us to increase the repetition rate of our experiment. Modifications of the geometry of the magnetic traps lead to a higher number of trapped atoms. (author)

  13. Lyman continuum leaking AGN in the SSA22 field

    CERN Document Server

    Micheva, Genoveva; Inoue, Akio K

    2016-01-01

    Subaru/SuprimeCam narrowband photometry of the SSA22 field reveals the presence of four Lyman continuum (LyC) candidates among a sample of 14 AGN. Two show offsets and likely have stellar LyC in nature or are foreground contaminants. The remaining two LyC candidates are Type I AGN. We argue that the average LyC escape fraction of high redshift quasars is not likely to be unity, as often assumed in the literature. From direct measurement we obtain the average LyC-to-UV flux density ratio and ionizing emissivity for a number of AGN classes and find it at least a factor of two lower than values obtained assuming f_esc = 1. Comparing to recent Ly{\\alpha} forest measurements, AGNs at redshift z\\sim3 make up at most \\sim20% and as little as 3% of the total ionizing budget. Our results suggest that AGNs are unlikely to dominate the ionization budget of the Universe at high redshifts.

  14. VBA SSA Acc To Fed Rec Online (SAFRO) - Also known as Veterans Benefit Administration Query (VBAQ).

    Data.gov (United States)

    Social Security Administration — The purpose of this query is to provide SSA field office personnel with real-time access to military discharge data from the VA BIRLS database. This information is...

  15. 77 FR 74913 - Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA...

    Science.gov (United States)

    2012-12-18

    ... From the Federal Register Online via the Government Publishing Office SOCIAL SECURITY ADMINISTRATION Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA)/Office of Personnel Management (OPM))--Match Number 1307 AGENCY: Social Security Administration....

  16. Isolated anti-Ro/SSA thrombocytopenia: a rare feature of neonatal lupus

    OpenAIRE

    Ayadi, Imene Dahmane; Hamida, Emira Ben; Boukhris, Mohamed Riadh; Bezzine, Ahlem; Chaouachi, Sihem; Marrakchi, Zahra

    2015-01-01

    We report a rare case of isolated thrombocytopenia related to anti-Ro/SSA antibodies. The mother was followed for unlabeled familial thrombocytopenia. The mother had positive anti-Ro/SSA antibodies. She was asymptomatic without skin lesions or other criteria neither of systemic lupus erythematosus nor other connective tissue disease. Pregnancy was uneventful. The postnatal examination was normal. On the first day of life, blood cells count showed thrombocytopenia at 40 x 109/L. Within the sec...

  17. GillespieSSA: Implementing the Gillespie Stochastic Simulation Algorithm in R

    Directory of Open Access Journals (Sweden)

    Mario Pineda-Krch

    2008-02-01

    Full Text Available The deterministic dynamics of populations in continuous time are traditionally described using coupled, first-order ordinary differential equations. While this approach is accurate for large systems, it is often inadequate for small systems where key species may be present in small numbers or where key reactions occur at a low rate. The Gillespie stochastic simulation algorithm (SSA is a procedure for generating time-evolution trajectories of finite populations in continuous time and has become the standard algorithm for these types of stochastic models. This article presents a simple-to-use and flexible framework for implementing the SSA using the high-level statistical computing language R and the package GillespieSSA. Using three ecological models as examples (logistic growth, Rosenzweig-MacArthur predator-prey model, and Kermack-McKendrick SIRS metapopulation model, this paper shows how a deterministic model can be formulated as a finite-population stochastic model within the framework of SSA theory and how it can be implemented in R. Simulations of the stochastic models are performed using four different SSA Monte Carlo methods: one exact method (Gillespie's direct method; and three approximate methods (explicit, binomial, and optimized tau-leap methods. Comparison of simulation results confirms that while the time-evolution trajectories obtained from the different SSA methods are indistinguishable, the approximate methods are up to four orders of magnitude faster than the exact methods.

  18. Evaluasi Sistem Monitoring dan Penertiban Frekuensi dan Perangkat Telekomunikasi

    Directory of Open Access Journals (Sweden)

    Amry Daulat Gultom

    2014-03-01

    Full Text Available Spektrum Frekuensi Radio merupakan Sumber Daya Alam yang terbatas, yang dalam hal pengelolaannya memberikan dampak strategis dan ekonomis bagi kesejahteraan masyarakat. Direktorat Jenderal (Ditjen Sumber Daya dan Perangkat Pos dan Informatika (SDPPI Kementerian Komunikasi dan Informatika merupakan Lembaga Pengelola Spektrum Frekuensi Radio yang diakui International Telecommunication Union (ITU sebagai Administrasi Telekomunikasi, mewakili Indonesia dalam konferensi internasional dan regional di bidang pengelolaan spektrum frekuensi radio. Tujuan dari penelitian ini adalah untuk mengevaluasi kondisi penyelenggaraan monitoring dan penertiban frekuensi dan perangkat telekomunikasi, serta menghasilkan konsep strategi guna  peningkatan penyelenggaraan monitoring dan penertiban frekuensi dan perangkat  telekomunikasi.  Penelitian  ini  menggunakan  teknik analisis data kuantitatif SWOT dan menghasilkan 5 (lima strategi utama yaitu pemanfaatan cakupan wilayah, optimalisasi SDM dan penyetaraan organisasi, optimalisasi gedung dan perangkat, peningkatan sistem administrasi dan pelaporan, perbaikan sistem penanganan kasus.

  19. Anti-Ro/SSA antibodies and cardiac arrhythmias in the adult: facts and hypotheses.

    Science.gov (United States)

    Lazzerini, P E; Capecchi, P L; Laghi-Pasini, F

    2010-09-01

    It is well established that the passive trans-placental passage of anti-Ro/SSA antibodies from mother to foetus is associated with the risk to develop an uncommon syndrome named neonatal lupus (NLE), where the congenital heart block represents the most severe clinical feature. Recent evidence demonstrated that also adult heart, classically considered invulnerable to the anti-Ro/SSA antibodies, may represent a target of the arrhythmogenicity of these autoantibodies. In particular, the prolongation of the QTc interval appears the most frequent abnormality observed in adults with circulating anti-Ro/SSA antibodies, with some data suggesting an association with an increased risk of ventricular arrhythmias, also life threatening. Moreover, even though the association between anti-Ro/SSA antibodies and conduction disturbances is undoubtedly less evident in adults than in infants, from the accurate dissection of the literature data the possibility arises that sometimes also the adult cardiac conduction tissue may be affected by such antibodies. The exact arrhythmogenic mechanisms involved in foetus/newborns and adults, respectively, have not been completely clarified as yet. However, increasing evidence suggests that anti-Ro/SSA antibodies may trigger rhythm disturbances through an inhibiting cross-reaction with several cardiac ionic channels, particularly the calcium channels (L-type and T-type), but also the potassium channel hERG, whose different expression and involvement in the cardiac electrophysiology during lifespan might account for the occurrence of age-related differences.

  20. Retrieval of snow Specific Surface Area (SSA) from MODIS data in mountainous regions

    Science.gov (United States)

    Mary, A.; Dumont, M.; Dedieu, J.-P.; Durand, Y.; Sirguey, P.; Milhem, H.; Mestre, O.; Negi, H. S.; Kokhanovsky, A. A.

    2012-05-01

    This study describes a method to retrieve snow specific surface area (SSA) from satellite radiance reasurements in mountainous terrain. It aims at comparing different retrieval methods and at addressing topographic corrections of reflectance, namely slope and aspect of terrain and multiple reflections on neighbouring slopes. We use an iterative algorithm to compute reflectance from radiance of the MODerate resolution Imaging Spectrometer (MODIS) with a comprehensive correction of local illumination with regards to topography. The retrieved SSA is compared to the results of the snowpack model Crocus, fed by driving data from the SAFRAN meteorological analysis, over a large domain in the French Alps. We compared SSA retrievals with and without topographic or anisotropy correction, and with a spherical or non-spherical snow reflectance model. The topographic correction enables SSA to be retrieved in better agreement with those from SAFRAN-Crocus. The root mean square deviation is 10.0 m2 kg-1 and the bias is -0.6 m2 kg-1, over 3829 pixels representing seven different dates and snow conditions. The standard deviation of MODIS retrieved data, larger than the one of SAFRAN-Crocus estimates, is responsible for half this RMSD. It is due to the topographic classes used by SAFRAN-Crocus. In addition, MODIS retrieved data show SSA gradients with elevation and solar exposition, physically consistent and in good agreement with SAFRAN-Crocus.

  1. Retrieval of snow Specific Surface Area (SSA from MODIS data in mountainous regions

    Directory of Open Access Journals (Sweden)

    A. Mary

    2012-05-01

    Full Text Available This study describes a method to retrieve snow specific surface area (SSA from satellite radiance reasurements in mountainous terrain. It aims at comparing different retrieval methods and at addressing topographic corrections of reflectance, namely slope and aspect of terrain and multiple reflections on neighbouring slopes. We use an iterative algorithm to compute reflectance from radiance of the MODerate resolution Imaging Spectrometer (MODIS with a comprehensive correction of local illumination with regards to topography. The retrieved SSA is compared to the results of the snowpack model Crocus, fed by driving data from the SAFRAN meteorological analysis, over a large domain in the French Alps. We compared SSA retrievals with and without topographic or anisotropy correction, and with a spherical or non-spherical snow reflectance model. The topographic correction enables SSA to be retrieved in better agreement with those from SAFRAN-Crocus. The root mean square deviation is 10.0 m2 kg−1 and the bias is −0.6 m2 kg−1, over 3829 pixels representing seven different dates and snow conditions. The standard deviation of MODIS retrieved data, larger than the one of SAFRAN-Crocus estimates, is responsible for half this RMSD. It is due to the topographic classes used by SAFRAN-Crocus. In addition, MODIS retrieved data show SSA gradients with elevation and solar exposition, physically consistent and in good agreement with SAFRAN-Crocus.

  2. Keratoacanthoma Dan Perawatannya

    OpenAIRE

    Indah Heriyanti

    2008-01-01

    Keratoacanthoma adalah suatu tumor jinak yang berasal dari jaringan epitel dan biasanya di jumpai pada permukaan kulit yang umumnya terjadi pada bagian kulit yang sering terkena sinar matahari dimana tumor ini dapat sembuh dengan spontan. Lesi ini biasanya berawal sebagai makula yang kecil yang berwarna merah dan kemudian menjadi papula yang kokoh dan bersisik pada permukaanya. Papul ini dengan cepat membesar selama 2 sampai 8 minggu. Pada awalnya berbentuk bulat atau oval,kokoh menonjol ...

  3. DEPRESI DAN GANGGUAN TIDUR

    Directory of Open Access Journals (Sweden)

    Wayan Eko Radityo

    2012-12-01

    Full Text Available Depresi merupakan gangguan mood berupa kesedihan yang intens, berlangsung dalamwaktu lama, dan mengganggu kehidupan normal yang insidennya semakin meningkatseiring dengan meningkatnya tekanan hidup. Tahun 2020, depresi diperkirakanmenempati urutan kedua penyakit di dunia. Gejala-gejala depresi terdiri dari gangguanemosi, gangguan kognitif, keluhan somatik, gangguan psikomotor, dan gangguanvegetatif. Salah satu gejala depresi yang muncul adalah gangguan tidur yang bisaberupa insomnia, bangun secara tiba-tiba, dan hipersomnia. Hal ini disebabkan olehgangguan neurotransmiter dan regulasi hormon. Selain sebagai gejala depresi, gangguantidur juga bisa merupakan penyebab depresi. Beberapa penelitian memberikanhubungan gangguan tidur dapat meningkatkan risiko depresi di kemudian hari.

  4. RFI suppression in SAR based on filtering interpretation of SSA and fast implementation

    Science.gov (United States)

    Wang, Xiaoyu; Yu, Weidong; Qi, Xiangyang; Liu, Yue

    2012-12-01

    Synthetic aperture radar (SAR) has proven to be a powerful remote sensing instrument for underground and obscured object detection. However, SAR echoes are often contaminated by radio frequency interferences (RFI) from multiple broadcasting stations. Essentially, RFI suppression problem is one-dimensional stationary time series denoising problem. This article proposed a novel RFI suppression algorithm based on singular spectral analysis (SSA) from a linear invariant systems perspective. It can be seen that SSA algorithm has an equivalence relation with finite impulse response (FIR) filter banks. Besides, this article first introduce two approximated methods which can remarkably speed up spectral decomposition--Nyström method and Column-Sampling approximation--to obtain the coefficients of above SSA-FIR-filter. Simulation results and imaging results of measured data have proved the efficiency and validity of this algorithm.

  5. Anti-Ro/SSA antibodies and cardiac rhythm disturbances: Present and future perspectives.

    Science.gov (United States)

    Santos-Pardo, Irene; Villuendas, Roger; Salvador-Corres, Iñaki; Martínez-Morillo, Melania; Olivé, Alejandro; Bayes-Genis, Antoni

    2015-04-01

    Several case reports, small case series, and original research papers have recently suggested that the action of certain auto-antibodies related to connective tissue diseases may be responsible for significant cardiac rhythm disturbances in adults. The relationship between anti-Ro/SSA antibodies and congenital complete atrioventricular block is well recognized in the fetal heart. Herein we review the emerging evidences of the link to increased levels of anti-Ro/SSA antibodies with rhythm disorders of unknown origin in the adult. Confirmation of this distinct etiology may eventually be the basis for new therapies.

  6. 77 FR 32709 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of Homeland Security...

    Science.gov (United States)

    2012-06-01

    ... From the Federal Register Online via the Government Publishing Office ] SOCIAL SECURITY ADMINISTRATION Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Department of Homeland Security (DHS))--Match Number 1010 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal...

  7. 76 FR 71417 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Law Enforcement Agencies (LEA...

    Science.gov (United States)

    2011-11-17

    ...), the Master Beneficiary Record SSA/ORSIS (60-0090), the Master Representative Payee File System SSA... program that we are currently conducting with LEA. DATES: We will file a report of the subject matching... in a system of records are matched with other Federal, State, or local government records....

  8. Fisiologi dan Gangguan Keseimbangan Natrium, Kalium dan Klorida serta Pemeriksaan Laboratorium

    Directory of Open Access Journals (Sweden)

    Rismawati Yaswir

    2012-09-01

    Full Text Available AbstrakElektrolit adalah senyawa di dalam larutan yang berdisosiasi menjadi partikel yang bermuatan (ion positifatau negatif. Sebagian besar proses metabolisme memerlukan dan dipengaruhi oleh elektrolit. Konsentrasielektrolit yang tidak normal dapat menyebabkan banyak gangguan. Pemeliharaan tekanan osmotik dan distribusibeberapa kompartemen cairan tubuh manusia adalah fungsi utama empat elektrolit mayor, yaitu natrium (Na+,kalium (K+, klorida (Cl-, dan bikarbonat (HCO3-. Pemeriksaan keempat elektrolit mayor tersebut dalam klinisdikenal sebagai ”profil elektrolit. Natrium adalah kation terbanyak dalam cairan ekstrasel, kalium kation terbanyakdalam cairan intrasel dan klorida merupakan anion terbanyak dalam cairan ekstrasel. Jumlah natrium, kalium danklorida dalam tubuh merupakan cermin keseimbangan antara yang masuk terutama dari saluran cerna dan yangkeluar terutama melalui ginjal. Gangguan keseimbangan natrium, kalium dan klorida berupa hipo- dan hiper-. Hipoterjadibila konsentrasi elektrolit tersebut dalam tubuh turun lebih dari beberapa miliekuivalen dibawah nilai normaldan hiper- bila konsentrasinya meningkat diatas normal.Pemeriksaan laboratorium untuk menentukan kadarnatrium, kalium dan klorida adalah dengan metode elektroda ion selektif, spektrofotometer emisi nyala,spektrofotometer atom serapan, spektrofotometri berdasarkan aktivasi enzim, pemeriksaan kadar klorida denganmetode titrasi merkurimeter, dan pemeriksaan kadar klorida dengan metode titrasi kolorimetrik-amperometrik.Kata kunci: elektrolit, keseimbangan, gangguan keseimbanganAbstractElectrolyte is compound in condensation which is disociation become particle which is charged (ionnegative or positive. Most metabolism processes need and influenced by electrolyte. Electrolyte concentrationwhich abnormal can cause many troubles. Conservancy of osmotic pressure and distribution some human beingbody fluid compartment are especial function four major electrolyte, that is natrium (Na

  9. Fis is required for proper regulation of ssaG expression in Salmonella enterica serovar Typhimurium.

    Science.gov (United States)

    Lim, Sangyong; Kim, Byeongkwan; Choi, Hyun-Sook; Lee, Younghoon; Ryu, Sangryeol

    2006-07-01

    Salmonella pathogenicity island 2 (SPI2) encodes a type III secretion system (TTSS) necessary for bacterial survival and replication in intracellular environment of host cells. SPI2 genes are transcribed preferentially after Salmonella enters the host cells. Transcriptional regulation of ssaG encoding the component of SPI2-TTSS apparatus was studied in vivo and in vitro. Fis, one of the major components of bacterial nucleoid, activated the stationary phase-specific expression of ssaG when Salmonella was grown in LB media. Gel-shift and footprinting analysis showed Fis bound to four distinct sites of the ssaG promoter region with different affinities. All four Fis-binding sites were required for timely transcription activation of ssaG after Salmonella entered macrophage cells. Gentamicin protection experiments using bacteria grown to stationary phase prior to infection showed that the ability of the fis mutant strain to replicate within the RAW264.7 macrophage cells was lower than the wild type. These observations confirm that Fis plays an important role in regulations of SPI2 as well as SPI1 for an efficient regulation of the virulence genes.

  10. 77 FR 43639 - Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA...

    Science.gov (United States)

    2012-07-25

    ... From the Federal Register Online via the Government Publishing Office SOCIAL SECURITY ADMINISTRATION Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA.... ACTION: Notice of a renewal of an existing computer matching program that expired on May 10,...

  11. 77 FR 54943 - Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA...

    Science.gov (United States)

    2012-09-06

    ... From the Federal Register Online via the Government Publishing Office SOCIAL SECURITY ADMINISTRATION Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA.... ACTION: Notice of a renewal of an existing computer matching program that will expire on October 1,...

  12. 20 CFR 411.250 - How will SSA evaluate a PM?

    Science.gov (United States)

    2010-04-01

    ...) Business relations; and (5) Customer satisfaction. (b) Our Project Officer will perform the evaluation. The PM will have an opportunity to comment on the evaluation, and then the Contracting Officer will... Evaluation of Program Manager Performance § 411.250 How will SSA evaluate a PM? (a) We will...

  13. The Adsorption Capacity, Pore Structure, and Thermal Behavior of the Modified Clay Containing SSA

    Directory of Open Access Journals (Sweden)

    Haijun Lu

    2016-01-01

    Full Text Available Sewage sludge ash (SSA was created by burning municipal sludge. The potential of clay containing 1 or 3 or 5% SSA was assessed for use as a landfill liner-soil material. Batch adsorption, low temperature N2 adsorption, and TG-DTA tests were performed to evaluate the adsorption capacity, micropore structure, thermostability, and components of soils under Cr(VI and Pb(II chemical solutions. With the increasing amount of SSA in modified clay, the adsorption capacity of Cr(VI and Pb(II to the modified clay increases gradually. After absorption, the pore size of modified clay ranges from 2 nm to 8 nm. With the increasing amount of absorption, the pore volume decreases and the specific surface area increases. With the increasing of adsorption concentration of Cr(VI and Pb(II, the mass loss percentage of modified clay increases to 23.4% and 12.6%, respectively. The modified clay containing SSA may be used as a good barrier material to attenuate contamination of Cr(VI and Pb(II in landfills.

  14. [Neonatal lupus erythematosus: complete atrioventricular block and SSA/Ro antibodies].

    Science.gov (United States)

    Prados, R; Maroto, E; López Longo, J; Monteagudo, I; Carreño, L; García, E J

    1987-06-01

    A newborn boy with complete A-V block and positive anti-SSA/Ro antibodies is reported. Authors comment on pathological findings of neonatal lupus erythematosus. They also review prognosis and clinical course and point out management of these patients before and after birth.

  15. The MELiSSA Pilot Plant Facility: Objectives and Integration Strategy

    Science.gov (United States)

    Gødia, F.; Pérez, J.; Albiol, J.; Lasseur, C.; Lamaze, B.; Ordónez, L.

    MELiSSA Micro-Ecological Life Support System Alternative is a closed artificial ecosystem intended as a tool for the development of a bio-regenerative life support system for long-term manned missions i e planetary base For its study and implementation the MELiSSA loop has been divided in five interconnected compartments organized in three different loops solid liquid and gas This compartments are microbial bioreactors and higher plant chambers The MELiSSA Pilot Plant facility an ESA External Laboratory located at Universitat Aut o noma of Barcelona has been conceived to achieve a preliminary terrestrial demonstration of the MELiSSA concept at pilot scale using animals as a model to substitute the crew The experience gained in the operation of such a facility will be highly relevant for planning future life support systems in Space In order to fulfill this challenging objective a number of steps have to be covered from the individual design of each compartment to the continuous operation of the complete loop with all compartments interconnected operating in sterile conditions in controlled conditions and in a biosafe manner A new site for the MELISSA Pilot Plant facility has been recently completed to host the final integration of the complete loop The contribution will cover the general design aspects of the loop including the current state of the different compartments and their interconnection with solid liquid and gas loops and the future plans of how these different elements will be integrated to achieve the final

  16. Establishment of Stable SSA/Ro52 Gene Silencing Cell Lines by Lentiviral Vectors%通过慢病毒载体构建SSA/Ro52稳定基因沉默细胞系

    Institute of Scientific and Technical Information of China (English)

    郭娟; 周炜

    2014-01-01

    Objective ToestablishthestableSSA/Ro52genesilencingcelllinesbylentiviralvestorsexpressing RNA interference molecule which should be powerful tools facilitating the study of SSA/Ro52 function. Methods Four specific sequences of SSA/Ro52 (clone 1 TGGCATGGTCTCCTTCTACAA;clone 2 CTGCCT-TCTTTATGGGACTTA;clone 9 TGAGAAGTTGGAAGTGGAAAT;clone 1 1 AGTTATCCTATGGTCCTGG-GT)and unrelated control sequence S were cloned into lentiviral vector pLKO-puro,which could express short hairpin RNA (shRNA)and inhibit expression of specific gene by RNA interference mechanism. Clone 1,2,9,11 which expressing SSA/Ro52 specific sequences and control clone S were packed with pGag-Pol and pVSV-G respectively,then 293 T cells were co-transfected. Culture medium containing virus particles were collected. The viral particles which expressing specific sequences SSA/Ro52 and unrelated control sequences were used to infected Hela cells,after antibiotic selection,stable cell lines were established. We used GAPDH as an internal control in real-time PCR for the detecting of SSA/Ro52 mRNA expression. Immunoblot was performed to detect SSA/Ro52 protein expression. The degree of gene expression inhibition was represented by the ratio of SSA/Ro52 expression level in Clone1,2,9,11 transfected cells and that in cloneS.Results LentiviruseffectivelyinfectedHelacells,thevectorDNAcontainingshRNAexpressing cassette were integrated into the cellullar gemone and stable cell lines were established. After antibiotics screening for 3 days,compared to transfected cells,the control clone S,the mRNA level of SSA/Ro52 of the transfected cells Clone 1,2,9,11 were 25. 5%,31. 2%,13. 0% and 77. 2%,respectively. While the protein level of SSA/Ro52 in the experimental group were 5%,50%,10%and 80%. After 4 weeks of culture,SSA/Ro52 protein expression did not change significantly. After stimulated by interferonα(IFN-α), the transfected cells with control clone expressed increased level of SSA/Ro52 protein;while the protein level

  17. Anti-TNFa treatment in patients with rheumatoid arthritis and anti-Ro/SSA antibodies

    Directory of Open Access Journals (Sweden)

    P. Airò

    2011-09-01

    Full Text Available Objective: To analyse clinical efficacy, onset of new autoantibodies or symptoms of autoimmune disease in patients affected by rheumatoid arthritis with anti-Ro/SSA treated with anti-TNFa agents. Methods: Six anti-Ro/SSA positive subjects with RA were studied every six months until 24th month of treatment in order to detect ANA titer (IFI, anti-dsDNA (Farr, anti-cardiolipin and anti-beta2glycoprotein I (ELISA, anti-ENA (CIE. The titre of anti-Ro/SSA were analysed by ELISA. Four patients were diagnosed as overlap RA/SS. Results: Six female patients (mean age 58ys, SD 9.8ys, with long-standing RA (mean 7ys, range 5-22 ys were treated with anti-TNFa agents for a mean of 31 months (SD: 20.4 m: 4 with Infliximab and 2 with Etanercept. All the patients showed a significant reduction of DAS until 24th month (p<0.006 with stability of sicca symptoms. The titer of ANA and anti-Ro/SSA was stable, while 4 subjects developed anti-dsDNA at low titer within 6-12 months. One patient withdrawn the treatment, because of lupus-like features; another one, with HCV hepatitis, interrupted Etanercept because of elevation of liver enzymes. No anticardiolipin or antibeta2GPI antibodies were detected. One subject with RA-SS also presented a primary biliary cirrhosis: clinical and histological features of cholangitis remained stable during Etanercept treatment. Conclusions: Anti-TNFa treatment showed good efficacy and safety in anti-Ro/SSA positive patients with RA. Anti-ds- DNA antibodies at low titer appeared in most patients while the onset of lupus-like disease could be considered a rare event also in RA patients with a rich autoimmune repertoire.

  18. Phenotypic and chemotypic studies using Arabidopsis and yeast reveal that GHB converts to SSA and induce toxicity.

    Science.gov (United States)

    Mekonnen, Dereje Worku; Ludewig, Frank

    2016-07-01

    γ-Hydroxybutyric acid (GHB) is a naturally occurring compound. It is detected in organisms such as yeasts, plants and mammals. GHB is produced from the reduction of succinic semialdehyde (SSA) by the activity of GHB dehydrogenase. Arabidopsis genome contains two GHB dehydrogenase encoding genes. The accumulation of GHB in ssadh mutants led to the speculation that GHB is the cause of aberrant phenotypes. Conversely, the accumulation of GHB in Arabidopsis plants subjected to abiotic stresses was described as a way of avoiding SSA induced damage. To resolve these contrasting views on GHB, we examined the effect of exogenous GHB and SSA on the growth of yeast and Arabidopsis plants. GHB concentrations up to 1.5 mM didn't affect shoots of Arabidopsis plants; however, root growth was inhibited. In contrast, 0.3 mM SSA has severely affected the growth of plants. Treatment of yeast wild-type strain with 10 mM SSA and 10 mM GHB didn't affect the growth. However, the growth of yeast uga2 mutant was greatly inhibited by the same concentration of SSA, but not GHB. Metabolic analysis and enzyme activity assay on native gel showed that Arabidopsis, but not yeast, possesses a GHB dehydrogenase activity that converts GHB back to SSA. The enzymatic assay has also indicated the existence of an additional GHB dehydrogenase encoding gene(s) in Arabidopsis genome. Taken together, we conclude that GHB is less toxic than SSA. Its accumulation in ssadh mutants and during abiotic stresses is a response to avoid the SSA induced damage. PMID:27037708

  19. Phenotypic and chemotypic studies using Arabidopsis and yeast reveal that GHB converts to SSA and induce toxicity.

    Science.gov (United States)

    Mekonnen, Dereje Worku; Ludewig, Frank

    2016-07-01

    γ-Hydroxybutyric acid (GHB) is a naturally occurring compound. It is detected in organisms such as yeasts, plants and mammals. GHB is produced from the reduction of succinic semialdehyde (SSA) by the activity of GHB dehydrogenase. Arabidopsis genome contains two GHB dehydrogenase encoding genes. The accumulation of GHB in ssadh mutants led to the speculation that GHB is the cause of aberrant phenotypes. Conversely, the accumulation of GHB in Arabidopsis plants subjected to abiotic stresses was described as a way of avoiding SSA induced damage. To resolve these contrasting views on GHB, we examined the effect of exogenous GHB and SSA on the growth of yeast and Arabidopsis plants. GHB concentrations up to 1.5 mM didn't affect shoots of Arabidopsis plants; however, root growth was inhibited. In contrast, 0.3 mM SSA has severely affected the growth of plants. Treatment of yeast wild-type strain with 10 mM SSA and 10 mM GHB didn't affect the growth. However, the growth of yeast uga2 mutant was greatly inhibited by the same concentration of SSA, but not GHB. Metabolic analysis and enzyme activity assay on native gel showed that Arabidopsis, but not yeast, possesses a GHB dehydrogenase activity that converts GHB back to SSA. The enzymatic assay has also indicated the existence of an additional GHB dehydrogenase encoding gene(s) in Arabidopsis genome. Taken together, we conclude that GHB is less toxic than SSA. Its accumulation in ssadh mutants and during abiotic stresses is a response to avoid the SSA induced damage.

  20. Penyebab dan Penangannan Halotosis

    OpenAIRE

    Irmadani Anwar, Ayub

    2007-01-01

    Halitosis adau bau mulut adalah masalah kesehatan gigi dan mulut yang banyak dikeluhkan. Akibat yang dapat ditimbulkan oleh halitosis dapat bersifat psikososial seperti malu atau rendah diri, menghindari pergaulan, tidak bebas bicara, tidak ada rasa percaya diri.

  1. Liever kraanwater dan bronwater

    NARCIS (Netherlands)

    Kole, A.P.W.

    2011-01-01

    Een test in het Restaurant van de Toekomst van de invloed van CO2-labels op het aankoopgedrag van consumenten, heeft nog geen duidelijk beeld opgeleverd. Wel pakten mensen vaker kraanwater dan bronwater.

  2. Dan Performer Mei Lanfang

    DEFF Research Database (Denmark)

    Risum, Janne

    2010-01-01

    The convention of performing female characters (dan characters) in Beijing opera, as practised by its most prominent male performer of female characters Mei Lanfang, and its and his cultural context and aesthetic aim...

  3. The East Asian Development Experience: Policy Lessons, Implications, and Recommendations for Sub-Saharan Africa (SSA Global Competitiveness

    Directory of Open Access Journals (Sweden)

    Ashford C. Chea

    2012-07-01

    Full Text Available The paper looks at the development experience of East Asia and draws lessons for Sub-Saharan Africa in building global competitiveness. It starts with a historical perspective of both regions’ developmental trajectories. This is followed by an analysis of the causes of East Asia’s superior economic performance and development and SSA underdevelopment. The article also draws policy lessons from East Asia development strategies for SSA global competitiveness. The paper ends with a presentation of policy implications and recommendations for building SSA global competitiveness in the region’s efforts to transform from poverty to prosperity.

  4. MELiSSA Pilot Plant: A facility for ground demonstration of a closed life support system

    Science.gov (United States)

    Godia, Francesc; Fossen, Arnaud; Peiro, Enrique; Gerbi, Olivier; Dussap, Gilles; Leys, Natalie; Arnau, Carolina; Milian, Ernest

    MELiSSA (Micro Ecological Life Support System Alternative) is an international collaborative effort focused on the development of a Life Support System for long-term Space missions. The goals of the MELiSSA loop are the recovery of food, water and oxygen from wastes, i.e. CO2 and organic wastes, using light as a source of energy. It is conceived as a series of compartments, each one performing a specific function within this cycle, inspired in the terrestrial ecological systems. Each one of the compartments is colonized with specific bacteria or higher plants depending on its dedicated function. Therefore, its design and operational conditions should guarantee that only a given specific biological activity takes place in each compartment. Moreover, this has to be done in a controlled manner, both at the subsystems level (i.e., compartments) and at the overall system level (i.e., complete loop). In order to achieve the complete operation of such a Closed Ecological System, in a first step each compartment has to be developed at individual level, and its operation demonstrated under its associated control law. In a second step, the complete loop needs to be integrated by the connection of the different compartments in the gas, loop and solid phases. An extensive demonstration of MELiSSA loop under terrestrial conditions is a mandatory step in the process of its adaptation to space. This is the main goal of the MPP. The demonstration scenario for the MPP is the respiration equivalent of a human being, and production of 20 percent of the diet of one person. To serve this goal, the different compartments of the MELiSSA loop have been designed and sized at the pilot scale level, and further characterized. Nowadays, the focus of the MELiSSA Pilot Plant is on the integration of its compartments. To this end, the integration challenge is concentrated in three compartments devoted to the following functions: nitrification (Compartment 3, an axenic co-culture of Nitrosomonas

  5. Pembuatan Dan Karakterisasi Aspal Beton Berbasis Dreg Dan Grit

    OpenAIRE

    Newdesnetty Butarbutar

    2009-01-01

    Telah dilakukan penelitian tentang pembuatan dan karakterisasi aspal beton berbasis dreg dan grit. Penelitian ini dilakukan dengan metode pengadukan dengan menggunakan mixer beton, tujuan untuk memperoleh bahan aspal beton dari dreg dan grit untuk mengurangi volume pasir dengan variasi rasio pasir terhadap dreg dan grit adalah: 100 : 0 : 0; 90 : 5 : 5; 80 : 10 : 10; 70 : 15 : 15; 60 : 20 : 20; 50 : 25 : 25; 40 : 30 : 3; 30 : 35 : 35; 20 : 40 : 40; 10 : 45 : 45; 0 : 50 : 5...

  6. Nonlinear time series analysis of vibration data from a friction brake: SSA, PCA, and MFDFA

    International Nuclear Information System (INIS)

    We use the methodology of singular spectrum analysis (SSA), principal component analysis (PCA), and multi-fractal detrended fluctuation analysis (MFDFA), for investigating characteristics of vibration time series data from a friction brake. SSA and PCA are used to study the long time-scale characteristics of the time series. MFDFA is applied for investigating all time scales up to the smallest recorded one. It turns out that the majority of the long time-scale dynamics, that is presumably dominated by the structural dynamics of the brake system, is dominated by very few active dimensions only and can well be understood in terms of low dimensional chaotic attractors. The multi-fractal analysis shows that the fast dynamical processes originating in the friction interface are in turn truly multi-scale in nature

  7. SISTEM BERBASIS PENGETAHUAN UNTUK KESEHATAN DAN PERAWATAN GIGI DAN MULUT

    OpenAIRE

    I Wayan Shandyasa

    2011-01-01

    Sistem berbasis pengetahuan untuk kesehatan dan perawatan gigi dan mulut ini merupakan sistem yang menghadirkan solusi penyakit dalam mengatasi masalah kesehatan gigi memberikan informasi perawatan untuk setiap masalah penyakit yang dihadapi. Sistem ini menyediakan fasilitas diagnosa penyakit untuk mengidentifikasi masalah kesehatan yang sedang dihadapi. Proses identifikasi dilakukan melalui interaksi tanya jawab antar sistem dengan user dan penginputan gejala penyakit. Metode penelusuran kes...

  8. PREFERENSI PEMBIAYAAN USAHA MIKRO DAN KECIL : PERSPEKTIF GENDER DAN ENTREPRENEURABILITY

    Directory of Open Access Journals (Sweden)

    Khaira Amalia Fachrudin

    2013-06-01

    Full Text Available Preferensi pembiayaan dalam perusahaan besar lebih didasarkan pada karakteristik perusahaan tersebut.  Namun dalam usaha mikro dan kecil hal ini mungkin berbeda dan bergantung pada karakteristik pemiliknya seperti gender dan entrepreneurability.   Perbedaan gender mungkin juga membedakan entrepreneurability dan dukungan yang diterima.  Penelitian ini akan menguji apakah terdapat perbedaan preferensi pembiayaan berdasarkan gender, entrepreneurability berdasarkan gender dan berdasarkan preferensi pembiayaan, serta perbedaan dukungan berdasarkan gender.  Sampel dari usaha mikro dan kecil yang bergerak dalam bidang kuliner  diuji dengan uji beda Independent Sample t Test dan kemudian dengan Crosstabulation untuk lebih memperinci hasilnya.  Hasil uji menunjukkan bahwa tidak terdapat perbedaan yang signifikan preferensi pembiayaan berdasarkan gender dan berdasarkan  entrepreneurability, namun entrepreneurability berbeda signifikan berdasarkan gender dan juga ditemukan bahwa dukungan moral, tenaga, dan modal yang diterima pemilik usaha pria dan wanita tidak berbeda signifikan (p value lebih kecil dari 0.05.   Hasil ini menunjukkan bahwa terdapat kesetaraan gender dalam pembiayaan usaha dan entrepreneurability lebih tinggi pada pria.  Pria pemilik usaha juga mendapatkan dukungan tenaga kerja yang lebih banyak daripada wanita.  Dukungan tenaga ini adalah salah satu bentuk  financial bootstrapping karena dapat mengurangi pembiayaan usaha

  9. Transverse Myelitis Associated with Anti-Ro (SSA) Autoantibodies: A Record of Two Cases

    OpenAIRE

    Melikyan, G.; Abdelrahman, M. H.; A. D’Suoza; Akhtar, N; Elzouki, A. N.; Hammoudeh, M.

    2012-01-01

    Transverse myelitis (TM) is an inflammatory process involving a restricted area of the spinal cord. The usual dramatic presentation makes TM a medical emergency. Early detection and aggressive therapy are required in order to improve the prognosis. The association of this unique clinical phenotype and autoantibody provides circumstantial evidence that an autoimmune aetiology might be involved. We describe two cases of TM associated with anti-Ro (SSA) autoantibodies without connective tissue d...

  10. Rapid assessment of populations trends of invasive species: Singular Spectrum Analysis (SSA)

    OpenAIRE

    DANA, ED

    2010-01-01

    Singular Spectrum Analysis (SSA) is a powerful analytical approach for biodi-versity management. Its main advan-tages are due to its intuitive processing and visualization, since mathematical workflow is conceptually similar to the widely accepted Principal Components Analysis. Detailed analyses of popula-tion trends with mathematical tools are often difficult to achieve for managers by a number of reasons (large numbers or areas monitored, large number of species, insufficient statistics ski...

  11. Resolving Changing Chemical and Physical Properties of SSA Particle Types during Laboratory Phytoplankton Blooms using Online Single Particle Analysis

    Science.gov (United States)

    Sultana, C. M.; Prather, K. A.; Richardson, R.; Wang, X.

    2015-12-01

    Changes in the chemical composition of sea spray aerosols (SSA) can modify their climate-relevant properties. Recent studies have shown a diverse set of distinct SSA particle types, however there are conflicting reports on how and whether biological activity controls the organic fraction and mixing state of SSA. This study leverages an aerosol time-of-flight mass spectrometer to give an accounting of the temporally resolved mixing state of primary SSA (0.4 - 3 µm vacuum aerodynamic diameter), encompassing 97% of particles detected over the course of laboratory phytoplankton blooms. The influence of biological activity on the climate relevant properties of defined particle types is also investigated. Spatial chemical particle heterogeneity and particularly the surface chemical composition of particles are described along with particle type specific water-particle interactions. These online measurements in tandem with chemical composition could give new insight on the link between seawater chemistry, marine aerosols, and climate properties.

  12. Rapid assessment of populations trends of invasive species: Singular Spectrum Analysis (SSA

    Directory of Open Access Journals (Sweden)

    DANA, ED

    2010-01-01

    Full Text Available Singular Spectrum Analysis (SSA is a powerful analytical approach for biodi-versity management. Its main advan-tages are due to its intuitive processing and visualization, since mathematical workflow is conceptually similar to the widely accepted Principal Components Analysis. Detailed analyses of popula-tion trends with mathematical tools are often difficult to achieve for managers by a number of reasons (large numbers or areas monitored, large number of species, insufficient statistics skills, strong knowledge level in demographic analyses, etc.. SSA has been used since the 1970’s in signal processing to clarify signal vs. noisy information, but it has also been used in climate change analy-sis and other developmental areas. Be-sides, SSA is a rapid-learning method for technicians and managers with medium level of mathematical knowledge. Free software in Unix environment is avail-able. Unfortunately, no free and friendly software is available for Win-dows SO. Although R package may offer solutions for really advanced users, it does not fit real work situations for managers of biological invasions. Cater-pillar (Gistat Group, Ltd is by now, the best option found by the author in terms of price, facility for results inter-pretation and time consumed in learn-ing. The main disadvantage is the poor content of tutorial files

  13. Pregnancy outcomes in patients with autoimmune diseases and anti-Ro/SSA antibodies.

    Science.gov (United States)

    Brucato, Antonio; Cimaz, Rolando; Caporali, Roberto; Ramoni, Véronique; Buyon, Jill

    2011-02-01

    Anti-Ro/SSA antibodies are associated with neonatal lupus (congenital heart block (CHB), neonatal transient skin rash, hematological and hepatic abnormalities), but do not negatively affects other gestational outcomes, and the general outcome of these pregnancies is now good, when followed by experienced multidisciplinary teams. The prevalence of CHB, defined as an atrioventricular block diagnosed in utero, at birth, or within the neonatal period (0-27 days after birth), in the offspring of an anti-Ro/SSA-positive women is 1-2%, of neonatal lupus rash around 10-20%, while laboratory abnormalities in asymptomatic babies can be detected in up to 27% of cases. The risk of recurrence of CHB is ten times higher. Most of the mothers are asymptomatic at delivery and are identified only by the birth of an affected child. Half of these asymptomatic women develop symptoms of a rheumatic disease, most commonly arthralgias and xerophtalmia, but few develop lupus nephritis. A standard therapy for CHB is still matter of investigation, although fluorinated corticosteroids have been reported to be effective for associated cardiomyopathy. Serial echocardiograms and obstetric sonograms, performed at least every 1-2 weeks starting from the 16th week of gestational age, are recommended in anti-Ro/SSA-positive pregnant women to detect early fetal abnormalities that might be a target of preventive therapy.

  14. Clinical characteristics of children with positive anti-SSA/SSB antibodies.

    Science.gov (United States)

    Chen, Pei-Hsuan; Yang, Yao-Hsu; Lin, Yu-Tsan; Lee, Jyh-Hong; Wang, Li-Chieh; Yu, Hsin-Hui; Chiang, Bor-Luen

    2014-08-01

    This study aimed to characterize the manifestations of clinical symptoms and signs, primary rheumatic diseases, and other autoantibodies in pediatric patients with positive anti-SSA and/or anti-SSB antibodies. Subjects under age 18 with positive anti-SSA and/or anti-SSB antibodies were screened and enrolled in a tertiary hospital in Taiwan. Data were collected via medical records,including age, gender, onset of the primary rheumatic disease, clinical symptoms and signs, and the medication used. Schirmer test for Sjögren's syndrome (SS) screening was performed in all enrolled patients. Among twenty enrolled subjects, seventeen of them had systemic lupus erythematosus; four of them were diagnosed as SS with positive Schirmer test. In addition to antinuclear antibodies and anti-DNA antibodies, other common autoantibodies were anti-RNP antibodies (50 %) and anti-Sm antibodies(30 %). The most common symptoms were arthritis (60 %)followed by malar rash (40 %). In conclusion, we observed that a low proportion of childhood SS (4/20) exists in our patients with positive SSA and/or anti-SSB antibodies. It is suggested that clinicians should focus more on the clinical symptoms in these patients, rather than undertaking invasive diagnostic interventions to rule out Sjögren's syndrome.

  15. Surviving space flight: case study on MELiSSA's CIII nitrifying compartment

    Science.gov (United States)

    Ilgrande, Chiara; Lasseur, Christophe; Mastroleo, Felice; Paille, Christel; Leys, Natalie; Morozova, Julia; Ilyin, Vyacheslav; Clauwaert, Peter; Christiaens, Marlies E. R.; Lindeboom, Ralph E. F.; Vlaeminck, Siegfried; Prat, Delphine; Arroyo, Jose M. C.; Conincx, Ilse; Van Hoey, Olivier; Roume, Hugo; Udert, Kai; Sas, Benedikt

    2016-07-01

    Space synthetic biology offers key opportunities for long-term space missions. Planets mining, terraformation, space medicine and Life Support technologies would all benefit from an integrative biological approach. However, space is a harsh environment for life: microgravity, temperature, UV and cosmic radiation can affect the health and functionality of microorganisms and plants, possibly preventing the optimal performance of the systems. The European Space Agency's Life Support System (MELiSSA) has been developed as a model for future long term Space missions and Space habitation. MELiSSA is a 5 compartment artificial ecosystem with microorganisms and higher, that aims at completely recycling gas, liquid and solid waste. In this study, the survival and functional activity after Lower Earth Orbit conditions of microbial nitrogen conversions, relevant for MELiSSA's CIII compartment, was tested. Synthetic communities containing Nitrosomonas europeae, Nitrosomonas ureae, Nitrobacter winogradskyi, Nitrospira moscoviensis and Cupriavidus pinatubonensis were exposed to the Lower Earth Orbit conditions of the International Space Station (ISS) for 7 days. Nitrosomonas europeae, Nitrobacter winogradskyi, Cupriavidus pinatubonensis, and three mixed communities (a urine nitrification sludge, a sludge containing aerobic ammonia oxidizing bacteria and anammox bacteria (OLAND), and an aquaculture sludge containing ammonia oxidizing archaea) were exposed to Lower Earth Orbit conditions for 44 days. Survival after both space flights was demonstrated because nitritation, nitratation, denitrification and anammox activity could be restored at a rate comparable to ground storage conditions. Our results validate the potential survival feasibility and suggest future space applications for N-related microorganisms.

  16. Substructure within the SSA22 protocluster at $z\\approx3.09$

    CERN Document Server

    Topping, Michael W; Steidel, Charles C

    2016-01-01

    We present the results of a densely sampled spectroscopic survey of the SSA22 protocluster at $z\\approx 3.09$. Our sample with Keck/LRIS spectroscopy includes 106 Ly$\\alpha$ Emitters (LAEs) and 40 Lyman Break Galaxies (LBGs) at $z=3.05-3.12$. These galaxies are contained within the $9'\\times9'$ region in which the protocluster was discovered, which also hosts the maximum galaxy overdensity in the SSA22 region. The redshift histogram of our spectroscopic sample reveals two distinct peaks, at $z=3.069$ (blue, 43 galaxies) and $z=3.095$ (red, 103 galaxies). Furthermore, objects in the blue and red peaks are segregated on the sky, with galaxies in the blue peak concentrating towards the western half of the field. These results suggest that the blue and red redshift peaks represent two distinct structures in physical space. Although the double-peaked redshift histogram is traced in the same manner by LBGs and LAEs, and brighter and fainter galaxies, we find that nine out of 10 X-ray AGNs in SSA22, and all seven sp...

  17. Participation in global horticulture value chains:Implications for poverty alleviation in the Sub-Saharan Africa (SSA) region

    OpenAIRE

    Afari-Owusu, Elizabeth

    2014-01-01

    There are approximately one billion people predominantly in Asia and sub-Saharan Africa (SSA) who live in extreme poverty because they are adversely linked to the process of globalization and not optimally integrated in global value chains. In the SSA region, agriculture is the main occupation where most of the rural population are employed and earn incomes. The horticulture sector a subset of agriculture is one of the value creating sectors where opportunities exist for the rural population ...

  18. Dan Johnson the mentor

    Science.gov (United States)

    McKinley, Richard

    2003-04-01

    I first met Dan Johnson in early 1975 as I was interviewing for an engineering job with Henning von Gierke's bioengineering and bionics laboratory at Wright-Patterson Air Force Base. From the very beginning Dan was always direct and forthright. Over the ensuing next 27 years my knowledge and respect of Dan constantly grew. This presentation will review Dan's technical and personal contributions while at the laboratory at Wright-Patterson Air Force Base. He was instrumental in the development of a national noise exposure criteria with the equal-energy-rule, an accurate single number hearing protector attenuation measure based on ``C-A,'' an impulse noise exposure criteria, a longitudinal study of hearing loss in children, development of noise dosimeters, and description of hearing damage risk from nonoccupational noise exposures such as disco's, bowling alleys, lawn mowers, and school buses. Dan has had a significant effect on my career. I and the many people who knew him at the laboratory miss him greatly.

  19. Toxicology Selective Toxicity dan Test

    OpenAIRE

    Mansyur

    2002-01-01

    Toxicology adalah pemahaman-pemahaman mengenai effek-effek bahan kimia yang merugikan bagi organisme. Dari definisi tersebut, jelas terdapat unsur-unsur bahan kimia dan organisme, dimana didalam kedua unsur-unsur ini terdapat istilah-istilah toksisitas dan animal test-test. Tulisan ini bermaskud membicarakan mengenai selective toxicity dan animal toxicity tetst. kedokteran-mansyur5

  20. DanRIS

    DEFF Research Database (Denmark)

    Skou, Carl Verner

    2009-01-01

    Windows 2000/XP/Vista platform computerprogram til DanRIS indberetning baseret på indskrivning af klienter på CPR, klientsforløb, faseforløb, ASI EuropASI composite score beregninger. Udgave: 2.1.0.5 Udgivelsesdato: 01-01-2009......Windows 2000/XP/Vista platform computerprogram til DanRIS indberetning baseret på indskrivning af klienter på CPR, klientsforløb, faseforløb, ASI EuropASI composite score beregninger. Udgave: 2.1.0.5 Udgivelsesdato: 01-01-2009...

  1. Kondisi oral higiene dan karies gigi pada vegetarian dan non vegetarian di Maha Vihara Maitreya Medan

    OpenAIRE

    Prawira, Albert

    2011-01-01

    Perbedaan pola makan antara vegetarian dan non vegetarian dapat mempengaruhi kesehatan gigi dan mulut. Tujuan penelitian adalah untuk mengetahui kondisi oral higiene dan karies gigi pada umat vegetarian dan non vegetarian di Maha Vihara Maitreya Medan. Jenis penelitian adalah survei deskriptif. Sampel terdiri atas 74 vegetarian dan 65 non vegetarian. Pemeriksaan oral higiene dan karies gigi masing-masing menggunakan indeks OHIS Greene dan Vermillion dan indeks DMFT Klein, se...

  2. Utilisation and Further Development of Space Science Results in the ESA SSA Programme Space Weather Service Network

    Science.gov (United States)

    Glover, Alexi; Luntama, Juha-Pekka; Keil, Ralf

    2016-04-01

    ESA SSA Programme is approaching the end of its second period. Service development activities within the current period aim at advancing the SSA SWE Service Network from the initial utilisation of existing European assets toward development of these and new assets together with the associated coordination infrastructure necessary to provide consistently reliable services. The SSA SWE Service Network is based on a federated architecture where service provision is carried out by Expert Service Centres in the Programme Member States with overall coordination and helpdesk functions provided by a central node and coordination centre located at the Space Pole in Brussels, Belgium. The SSA SWE Service Network builds on the wealth of space weather expertise available within the Member States, and consequently, as the network continues to develop, emphasis will continue to be placed on building services based on demonstrated space science advances in key areas such as those highlighted by the COSPAR-ILWS Space Weather Roadmap, published in 2015. Activities supported by programmes including the ESA technology programmes, EC FP7 and H2020 have all demonstrated promising results, and the SSA SWE Network is actively investigating their potential application to SSA SWE Customer Requirements, and in many cases already adopting these as part of the suite of products provided via the Network to its registered users. This presentation will provide an overview of recent advances in the SSA SWE Service Network, emphasising the utilisation of scientific results within a pre-operational context. The presentation will show the layout of the federated Expert Service Centres, highlighting ongoing and upcoming service developments and provide a perspective on the service development plans for the next phase of the programme.

  3. The SSB-positive/SSA-negative antibody profile is not associated with key phenotypic features of Sjögren's syndrome

    DEFF Research Database (Denmark)

    Baer, Alan N; McAdams DeMarco, Mara; Shiboski, Stephen C;

    2015-01-01

    established SS, we compared anti-SSA/anti-SSB reactivity profiles against concurrent phenotypic features. We fitted logistic regression models to explore the association between anti-SSA/anti-SSB reactivity profile and each key SS phenotypic feature, controlling for potential confounders. RESULTS: Among 3297...... participants, 2061 (63%) had negative anti-SSA/anti-SSB, 1162 (35%) had anti-SSA with or without anti-SSB, and 74 (2%) anti-SSB alone. Key SS phenotypic features were more prevalent and had measures indicative of greater disease activity in those participants with anti-SSA, either alone or with anti-SSB, than......OBJECTIVE: To determine whether the Sjögren's syndrome B (SSB)-positive/Sjögren's syndrome A (SSA)-negative antibody profile is associated with key phenotypic features of SS. METHODS: Among registrants in the Sjögren's International Collaborative Clinical Alliance (SICCA) with possible or...

  4. MODAL MANUSIA DAN PRODUKTIVITAS

    Directory of Open Access Journals (Sweden)

    Erlinda Puspita Sari

    2014-03-01

    Full Text Available Modal manusia dianggap sebagai salah satu faktor penentu produktivitas. Modal manusia merupakan dimensi kualitatif dari sumberdaya manusia, seperti keahlian dan keterampilan, yang akan memengaruhi kemampuan produktif manusia tersebut. Dimensi kualitatif tersebut diperoleh melalui pendidikan, pelatihan dan kesehatan. Penelitian ini bertujuan untuk menganaliss efek dari modal manusia terhadap tingkat produktivitas di provinsi-provinsi di Indonesia. Dalam penelitian ini, tingkat pendidikan diukur dengan beberapa indikator, yaitu; angka melek huruf dan angka partisipasi murni tingkat SD, SMP maupun SMA. Tingkat kesehatan diukur dengan angka kematian bayi. Data yang digunakan adalah data panel dari 25 provinsi di Indonesia selama perioede 1996-2010 yang dianalisis dengan menggunakan Model Panel Data Fixed Effect. Hasil analisis menunjukkan bahwa modal manusia yang diukur dari tingkat pendidikan (APM dan tingkat kesehatan (AKB merupakan faktor yang berpengaruh dan signifikan untuk menjelaskan variasi produktivitas meskipun magnitude-nya lebih kecil dibandingkan dengan modal fisik. Hasil analisis juga menunjukkan bahwa variabel pendidikan memiliki magnitude yang lebih besar dibandingkan dengan variabel kesehatan. Human capital is regarded as one of the determining factors of productivity. Human capital is qualitative dimension of human resource which includes skills and knowledge. These qualitative dimensions are internalized through education, training and health. This study aimed to analyze the effect of human capital on productivity level across provinces in Indonesia. In this study, the level of education was measured by literacy and school enrollment rate (in primary, secondary and high school. The level of health was measured by infant mortality rate. The study employed a panel data of 25 provinces in Indonesia during the period of 1996-2010. Using fixed effect method, the result showed that secondary school enrollment rate and infant mortality

  5. Overview of Human-Centric Space Situational Awareness (SSA) Science and Technology (S&T)

    Science.gov (United States)

    Ianni, J.; Aleva, D.; Ellis, S.

    2012-09-01

    A number of organizations, within the government, industry, and academia, are researching ways to help humans understand and react to events in space. The problem is both helped and complicated by the fact that there are numerous data sources that need to be planned (i.e., tasked), collected, processed, analyzed, and disseminated. A large part of the research is in support of the Joint Space Operational Center (JSpOC), National Air and Space Intelligence Center (NASIC), and similar organizations. Much recent research has been specifically targeting the JSpOC Mission System (JMS) which has provided a unifying software architecture. This paper will first outline areas of science and technology (S&T) related to human-centric space situational awareness (SSA) and space command and control (C2) including: 1. Object visualization - especially data fused from disparate sources. Also satellite catalog visualizations that convey the physical relationships between space objects. 2. Data visualization - improve data trend analysis as in visual analytics and interactive visualization; e.g., satellite anomaly trends over time, space weather visualization, dynamic visualizations 3. Workflow support - human-computer interfaces that encapsulate multiple computer services (i.e., algorithms, programs, applications) into a 4. Command and control - e.g., tools that support course of action (COA) development and selection, tasking for satellites and sensors, etc. 5. Collaboration - improve individuals or teams ability to work with others; e.g., video teleconferencing, shared virtual spaces, file sharing, virtual white-boards, chat, and knowledge search. 6. Hardware/facilities - e.g., optimal layouts for operations centers, ergonomic workstations, immersive displays, interaction technologies, and mobile computing. Secondly we will provide a survey of organizations working these areas and suggest where more attention may be needed. Although no detailed master plan exists for human

  6. Potential use of sewage sludge ash (SSA as a cement replacement in precast concrete blocks

    Directory of Open Access Journals (Sweden)

    Pérez-Carrión, M.

    2014-03-01

    Full Text Available The present study explored the technological feasibility of re-using sewage sludge ash (SSA as a Portland cement replacement in commercially manufactured pre cast concrete blocks. The blocks analysed were made to the guidelines laid down in Spain’s National Plan for Waste Water Treatment Plant Sludge, 2001–2006, and European Union specifications (CE marking for such products. Performance was compared in three families of blocks, with 0, 10 and 20% SSA. The findings proved that SSA is apt for pre cast concrete block manufacture and that, in addition to the economic and environmental benefits afforded, its use would improve certain of the properties of conventional block.El objetivo de esta investigación es estudiar el uso potencial de las cenizas de lodos de depuradora (CLD, como sustitución del cemento Portland en bloques de hormigón prefabricados, de forma que se pueda lograr una revalorización de este material de desecho mediante este procedimiento. La metodología utilizada en este trabajo se rige por las directrices del Plan Nacional Español de Lodos de Aguas Residuales de 2001–2006, y por las exigencias del Consejo Europeo (marcado CE, que es obligatorio para este tipo de productos. Se han utilizado dos niveles de sustitución de cemento (10% y 20%, y todos los resultados han sido referidos a las muestras control. Los resultados obtenidos muestran que es posible utilizar una sustitución parcial del cemento por CLD, en la fabricación de bloques de hormigón prefabricados, y por lo tanto, se pueden conseguir beneficios económicos y ambientales, así como la mejora de una serie de propiedades.

  7. Substructure within the SSA22 Protocluster at z≈3.09

    Science.gov (United States)

    Topping, Michael W.; Shapley, Alice E.; Steidel, Charles C.

    2016-06-01

    We present the results of a densely sampled spectroscopic survey of the SSA22 protocluster at z ≈ 3.09. Our sample with Keck/LRIS spectroscopy includes 106 Lyα emitters (LAEs) and 40 Lyman break galaxies (LBGs) at z = 3.05–3.12. These galaxies are contained within the 9‧ × 9‧ region in which the protocluster was discovered, which also hosts the maximum galaxy overdensity in the SSA22 region. The redshift histogram of our spectroscopic sample reveals two distinct peaks, at z = 3.069 (blue; 43 galaxies) and z = 3.095 (red; 103 galaxies). Furthermore, objects in the blue and red peaks are segregated on the sky, with galaxies in the blue peak concentrating toward the western half of the field. These results suggest that the blue and red redshift peaks represent two distinct structures in physical space. Although the double-peaked redshift histogram is traced in the same manner by LBGs and LAEs, and brighter and fainter galaxies, we find that 9 out of 10 X-ray AGNs in SSA22, and all 7 spectroscopically confirmed giant Lyα “blobs,” reside in the red peak. We combine our data set with sparsely sampled spectroscopy from the literature over a significantly wider area, finding preliminary evidence that the double-peaked structure in redshift space extends beyond the region of our dense spectroscopic sampling. In order to fully characterize the three-dimensional structure, dynamics, and evolution of large-scale structure in the SSA22 overdensity, we require the measurement of large samples of LAE and LBG redshifts over a significantly wider area, as well as detailed comparisons with cosmological simulations of massive cluster formation. Based on data obtained at the W.M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California, and the National Aeronautics and Space Administration, and was made possible by the generous financial support of the W.M. Keck Foundation.

  8. Transverse Myelitis Associated with Anti-Ro (SSA) Autoantibodies: A Record of Two Cases.

    Science.gov (United States)

    Melikyan, G; Abdelrahman, M H; D'Suoza, A; Akhtar, N; Elzouki, A N; Hammoudeh, M

    2012-01-01

    Transverse myelitis (TM) is an inflammatory process involving a restricted area of the spinal cord. The usual dramatic presentation makes TM a medical emergency. Early detection and aggressive therapy are required in order to improve the prognosis. The association of this unique clinical phenotype and autoantibody provides circumstantial evidence that an autoimmune aetiology might be involved. We describe two cases of TM associated with anti-Ro (SSA) autoantibodies without connective tissue disease manifestations. The two patients were treated successfully with IV steroids and cyclophosphamide.

  9. BOREAS Forest Cover Data Layers over the SSA-MSA in Raster Format

    Science.gov (United States)

    Nickeson, Jaime; Gruszka, F; Hall, F.

    2000-01-01

    This data set, originally provided as vector polygons with attributes, has been processed by BORIS staff to provide raster files that can be used for modeling or for comparison purposes. The original data were received as ARC/INFO coverages or as export files from SERM. The data include information on forest parameters for the BOREAS SSA-MSA. Most of the data used for this product were acquired by BORIS in 1993; the maps were produced from aerial photography taken as recently as 1988. The data are stored in binary, image format files.

  10. MELiSSA third compartment: Nitrosomonas europaea and Nitrobacter winogradskyi axenic cultures in bioreactors

    Science.gov (United States)

    Cruvellier, Nelly; Lasseur, Christophe; Poughon, Laurent; Creuly, Catherine; Dussap, Gilles

    Nitrogen is a key element for the life and its balance on Earth is regulated by the nitrogen cycle. This loop includes several steps among which nitrification that permits the transformation of the ammonium into nitrate. The MELiSSA loop is an artificial ecosystem designed for life support systems (LSS). It is based on the carbon and nitrogen cycles and the recycling of the non-edible part of the higher plants and the waste produced by the crew. In this order, all the wastes are collected in the first compartment to degrade them into organic acids and CO2. These compounds are joining the second compartment which is a photoheterotrophic compartment where at the outlet an organic-free medium containing ammonium is produced. This solution will be the substrate of the third compartment where nitrification is done. This compartment has to oxidize the ammonium into nitrate, and this biological reaction needs two steps. In the MELiSSA loop, the nitrification is carried out by two bacteria: Nitrosomonas europaea ATCC® 19718™ which is oxidizing ammonia into nitrite and Nitrobacter winogradskyi ATCC® 25391™ which is producing nitrate from nitrite in the third compartment. These two bacteria are growing in axenic conditions on a fixed bed bioreactor filled with Biostyr® beads. The nitrogen compounds are controlled by Ionic Chromatography and colorimetric titration for each sample. The work presented here deals with the culture of both bacteria in pure cultures and mixed cultures in stirred and aerated bioreactors of different volumes. The first aim of our work is the characterization of the bacteria growth in bioreactors and in the nitrifying fixed-bed column. The experimental results confirm that the growth is slow; the maximal growth rate in suspended cultures is 0.054h-1 for Nitrosomonas europaea and 0.022h-1 for Nitrobacter winogradskyi. Mixed cultures are difficult to control and operate but one could be done for more than 500 hours. The characterization of the

  11. Pro-inflammatory role of Anti-Ro/SSA autoantibodies through the activation of Furin-TACE-amphiregulin axis.

    Science.gov (United States)

    Lisi, Sabrina; Sisto, Margherita; Lofrumento, Dario Domenico; Cucci, Liana; Frassanito, Maria Antonia; Mitolo, Vincenzo; D'Amore, Massimo

    2010-09-01

    Prolonged inflammation can be detrimental because it may cause host toxicity and tissue damage. Indeed, excessive production of inflammatory cytokines is often associated with many autoimmune diseases. In this study we demonstrate that the anti-Ro/SSA autoantibodies (Abs) stimulate the production of pro-inflammatory cytokines IL-6 and IL-8 by human healthy salivary gland epithelial cells (healthy SGEC). The secretion of these cytokines is due to amphiregulin (AREG) that is overexpressed in healthy SGEC treated with anti-Ro/SSA Abs and in Sjögren's syndrome. We have discovered that the up-regulation of AREG occurs through TNF-alpha produced following anti-Ro/SSA Abs treatment. The gene silencing technique was used to study the AREG-TNF-alpha-IL-6/IL-8 secretion pathway, demonstrating that: (i) TNF-alpha gene silencing provokes a significant decrease of proinflammatory cytokines production and AREG expression in anti-Ro/SSA Abs-treated healthy SGEC; (ii) AREG gene silencing has a potent inhibitory effect on TNF-alpha-induced IL-6 and IL-8 secretion in healthy SGEC treated with anti-Ro/SSA Abs. These findings indicate that TACE-mediated AREG shedding plays a critical role in TNF-alpha-induced IL-6 and IL-8 secretion by the human healthy salivary gland epithelial cells, suggesting that this may be one of the possible intracellular mechanisms involved in the salivary glands inflammatory response in Sjögren's syndrome.

  12. Kitab kuning dan perempuan, perempuan dan kitab kuning

    OpenAIRE

    Bruinessen, M.M. van

    2007-01-01

    Kitab Kuning dan Emansipasi Perempuan: Konflik Budaya? Pengamatan-pengamatan Masdar mengenai kedudukan perempuan dalam diskursus (wacana, bahasan) dominan kitab kuning terasa tidak enak didengar tetapi memang sulit dibantah. Baik dalam penggunaan bahasa (yang sangat memihak kepada jenis mudzakkar) maupun pilihan aspek kehidupan perempuan yang dijadikan pokok bahasan kitab-kitab fiqh, terdapat bias yang begitu dalam dan transparan. Tolok ukur untuk segala hal ialah laki-laki, dan perbedaan ant...

  13. Dislocations and elementary processes of plasticity in FCC metals: atomic scale simulations; Dislocations et processus elementaires de la plasticite dans les metaux CFC: apports des simulations a l'echelle atomique

    Energy Technology Data Exchange (ETDEWEB)

    Rodney, D

    2000-07-01

    We present atomic-scale simulations of two elementary processes of FCC crystal plasticity. The first study consists in the simulation by molecular dynamics, in a nickel crystal, of the interactions between an edge dislocation and glissile interstitial loops of the type that form under irradiation in displacement cascades. The simulations show various atomic-scale interaction processes leading to the absorption and drag of the loops by the dislocation. These reactions certainly contribute to the formation of the 'clear bands' observed in deformed irradiated materials. The simulations also allow to study quantitatively the role of the glissile loops in irradiation hardening. In particular, dislocation unpinning stresses for certain pinning mechanisms are evaluated from the simulations. The second study consists first in the generalization in three dimensions of the quasi-continuum method (QCM), a multi-scale simulation method which couples atomistic techniques and the finite element method. In the QCM, regions close to dislocation cores are simulated at the atomic-scale while the rest of the crystal is simulated with a lower resolution by means of a discretization of the displacement fields using the finite element method. The QCM is then tested on the simulation of the formation and breaking of dislocation junctions in an aluminum crystal. Comparison of the simulations with an elastic model of dislocation junctions shows that the structure and strength of the junctions are dominated by elastic line tension effects, as is assumed in classical theories. (author)

  14. BAHAYA RADIASI DAN CARA PROTEKSINYA

    Directory of Open Access Journals (Sweden)

    Badunggawa P

    2014-09-01

    Full Text Available Radiasi yang kita terima setiap saat, termasuk radiasi untuk tujuan kedokteran, mempunyai dampak positif dan negatif terhadap keselamatan manusia dan lingkungan. Dampak positif dari radiasi terhadap keselamatan manusia diantaranya adalah digunakan sebagai pengobatan dan dampak negatifnya adalah tergantung dari besar dosis yang diterima diantaranya adalah mulai dari mual, muntah, pusing-pusing, rambut rontok, menyebabkan kanker, diturunkan secara genetik, dan yang lebih berbahaya lagi adalah menyebabkan kematian. Oleh karena itu kita harus berhati-hati terhadap bahaya yang ditimbulkannya, baik terhadap pekerja radiasi maupun masyarakat umum termasuk pasien. Perlindungan terhadap bahaya yang ditimbulkan radiasi ini dikenal dengan istilah proteksi radiasi. Sehingga dosis yang diterima pertahun oleh pekerja atau masyarakat umum tidak melebihi batas dosis yang ditetapkan oleh Bapeten. Berbagai upaya telah dilakukan untuk meminimalkan bahaya tersebut sehingga pekerja dan pasien merasa aman melakukan dan dikenai tindakan medik.[medicina 2009;40:47-51].  

  15. Metode Pengukuran Saliva Dan Pemeriksaan Kelenjar Saliva

    OpenAIRE

    Deddy A. Simatupang

    2008-01-01

    Saliva merupakan cairan utama di rongga mulut yang dihasilkan oleh kelenjar saliva mayor dan minor. Saliva memiliki fungsi dan peranan penting dalam menjaga dan memelihara kesehatan secara umum. Kebiasaan bemafas melalui mulut, akibat terapi radiasi pada kepala dan leher, kemsakan saraf, obat-obatan, dan penyakit-penyakit tertentu dapat menyebabkan penurunan produksi saliva yang disebut dengan xerostomia atau mulut kering. Xerostomia dapat menyebabkan karies gigi, mukositis dan kandidiasi...

  16. KINERJA Jurnal Bisnis dan Ekonomi

    OpenAIRE

    Pickering, Paul; Suprapto, Budi; Kufepaksi, Mahatma; Suhardjanto, Djoko; Ariani, D. Wahyu; Haryono, Tulus; Soeroso, Amiluhur

    2010-01-01

    1. Effects Of Relationship Marketing Upon Nz Micro-Enterprise Internationals Within The Asian Marketplace oleh Paul Pickering dan Russel P J Kingshott. 2. Service Recovery Strategy And Customer Satisfaction: Evidence From Hotel Industry In Yogyakarta-Indonesia oleh Budi Suprapto dan Galang Yunanto Hashym 3. Investor Overconfident Dalam Penilaian Saham: Perspektif Gender Dalam Eksperimen Pasar oleh Mahatma Kufepaksi 4. Pengaruh Corporate Governance, Etnis, Dan Latar Belakang Pendi...

  17. Characterizing the Space Debris Environment with a Variety of SSA Sensors

    Science.gov (United States)

    Stansbery, Eugene G.

    2010-01-01

    Damaging space debris spans a wide range of sizes and altitudes. Therefore no single method or sensor can fully characterize the space debris environment. Space debris researchers use a variety of radars and optical telescopes to characterize the space debris environment in terms of number, altitude, and inclination distributions. Some sensors, such as phased array radars, are designed to search a large volume of the sky and can be instrumental in detecting new breakups and cataloging and precise tracking of relatively large debris. For smaller debris sizes more sensitivity is needed which can be provided, in part, by large antenna gains. Larger antenna gains, however, produce smaller fields of view. Statistical measurements of the debris environment with less precise orbital parameters result. At higher altitudes, optical telescopes become the more sensitive instrument and present their own measurement difficulties. Space Situational Awareness, or SSA, is concerned with more than the number and orbits of satellites. SSA also seeks to understand such parameters as the function, shape, and composition of operational satellites. Similarly, debris researchers are seeking to characterize similar parameters for space debris to improve our knowledge of the risks debris poses to operational satellites as well as determine sources of debris for future mitigation. This paper will discuss different sensor and sensor types and the role that each plays in fully characterizing the space debris environment.

  18. Solar Flare Prediction Science-to-Operations: the ESA/SSA SWE A-EFFort Service

    Science.gov (United States)

    Georgoulis, Manolis K.; Tziotziou, Konstantinos; Themelis, Konstantinos; Magiati, Margarita; Angelopoulou, Georgia

    2016-07-01

    We attempt a synoptical overview of the scientific origins of the Athens Effective Solar Flare Forecasting (A-EFFort) utility and the actions taken toward transitioning it into a pre-operational service of ESA's Space Situational Awareness (SSA) Programme. The preferred method for solar flare prediction, as well as key efforts to make it function in a fully automated environment by coupling calculations with near-realtime data-downloading protocols (from the Solar Dynamics Observatory [SDO] mission), pattern recognition (solar active-region identification) and optimization (magnetic connectivity by simulated annealing) will be highlighted. In addition, the entire validation process of the service will be described, with its results presented. We will conclude by stressing the need for across-the-board efforts and synergistic work in order to bring science of potentially limited/restricted interest into realizing a much broader impact and serving the best public interests. The above presentation was partially supported by the ESA/SSA SWE A-EFFort project, ESA Contract No. 4000111994/14/D/MRP. Special thanks go to the ESA Project Officers R. Keil, A. Glover, and J.-P. Luntama (ESOC), M. Bobra and C. Balmer of the SDO/HMI team at Stanford University, and M. Zoulias at the RCAAM of the Academy of Athens for valuable technical help.

  19. Batch Model for Batched Timestamps Data Analysis with Application to the SSA Disability Program

    Science.gov (United States)

    Yue, Qingqi; Yuan, Ao; Che, Xuan; Huynh, Minh; Zhou, Chunxiao

    2016-01-01

    The Office of Disability Adjudication and Review (ODAR) is responsible for holding hearings, issuing decisions, and reviewing appeals as part of the Social Security Administration’s disability determining process. In order to control and process cases, the ODAR has established a Case Processing and Management System (CPMS) to record management information since December 2003. The CPMS provides a detailed case status history for each case. Due to the large number of appeal requests and limited resources, the number of pending claims at ODAR was over one million cases by March 31, 2015. Our National Institutes of Health (NIH) team collaborated with SSA and developed a Case Status Change Model (CSCM) project to meet the ODAR’s urgent need of reducing backlogs and improve hearings and appeals process. One of the key issues in our CSCM project is to estimate the expected service time and its variation for each case status code. The challenge is that the systems recorded job departure times may not be the true job finished times. As the CPMS timestamps data of case status codes showed apparent batch patterns, we proposed a batch model and applied the constrained least squares method to estimate the mean service times and the variances. We also proposed a batch search algorithm to determine the optimal batch partition, as no batch partition was given in the real data. Simulation studies were conducted to evaluate the performance of the proposed methods. Finally, we applied the method to analyze a real CPMS data from ODAR/SSA.

  20. BOREAS TE-1 CH4 Flux Data Over The SSA-OA

    Science.gov (United States)

    Anderson, Darwin; Papagno, Andrea; Hall, Forrest G. (Editor); Newcomer, Jeffrey A. (Editor)

    2000-01-01

    The BOREAS TE-1 team collected various data to characterize the soil-plant systems in the BOREAS SSA. Particular emphasis was placed on nutrient biochemistry, the stores and transfers of organic carbon, and how the characteristics were related to measured methane fluxes. The overall transect in the Prince Albert National Park (Saskatchewan, Canada) included the major plant communities and related soils that occurred in that section of the boreal forest. Soil physical, chemical, and biological measurements along the transect were used to characterize the static environment, which allowed them to be related to methane fluxes. Chamber techniques were used to provide a measure of methane production/uptake. Chamber measurements coupled with flask sampling were used to determine the seasonality of methane fluxes. This particular data set contains methane flux and soil profile methane concentration values from the SSA-OA site. The data were collected from 29-May to 17-Sep-1994. The data are stored in tabular ASCII files. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).

  1. BOREAS TE-1 CO2 and CH4 Flux Data Over the SSA-OBS Site

    Science.gov (United States)

    Anderson, Darwin; Papagno, Andrea; Hall, Forrest G. (Editor); Newcomer, Jeffrey A. (Editor)

    2000-01-01

    The BOREAS TE-1 team collected various data to characterize the soil-plant systems in the BOREAS SSA. Particular emphasis was placed on nutrient biochemistry, the stores and transfers of organic carbon, and how the characteristics were related to measured methane fluxes. The overall transect in the Prince Albert National Park (Saskatchewan, Canada) included the major plant communities and related soils that occurred in that section of the boreal forest. Soil physical, chemical, and biological measurements along the transect were used to characterize the static environment, which allowed them to be related to methane fluxes. Chamber techniques were used to provide a measure of methane production/uptake. Chamber measurements coupled with flask sampling were used to determine the seasonality of methane fluxes. This particular data set contains carbon dioxide and methane flux values from the SSA-OBS site. The data were collected from 09-Jun to 04-Sep-1994. The data are stored in tabular ASCII files. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).

  2. Isolated anti-Ro/SSA thrombocytopenia: a rare feature of neonatal lupus.

    Science.gov (United States)

    Ayadi, Imene Dahmane; Ben Hamida, Emira; Boukhris, Mohamed Riadh; Bezzine, Ahlem; Chaouachi, Sihem; Marrakchi, Zahra

    2015-01-01

    We report a rare case of isolated thrombocytopenia related to anti-Ro/SSA antibodies. The mother was followed for unlabeled familial thrombocytopenia. The mother had positive anti-Ro/SSA antibodies. She was asymptomatic without skin lesions or other criteria neither of systemic lupus erythematosus nor other connective tissue disease. Pregnancy was uneventful. The postnatal examination was normal. On the first day of life, blood cells count showed thrombocytopenia at 40 x 10(9)/L. Within the second day of life, platelet level dropped to 20 x 10(9)/L. The management of thrombocytopenia included platelet transfusion and human immunoglobulin infusion. On the fifth day of life, there has been a drop in platelet count to 10 x 10(9)/L requiring renewed platelet transfusion and human immunoglobulin infusion. On the 10(th) of life platelets rate was stable around 60 x 10(9)/L. The infant had no evidence of cardiac, dermatologic or hepatobilary involvement initially or throughout follow up.

  3. SSA Building Blocks - Transforming Your Data and Applications into Operational Capability

    Science.gov (United States)

    Buell, D.; Hawthorne, Shayn, L.; Higgins, J.

    The Electronic System Center's 850 Electronic Systems Group (ELSG) is currently using a Service Oriented Architecture (SOA) to rapidly create net-centric experimental prototypes. This SOA has been utilized effectively across diverse mission areas, such as global air operations and rapid sensor tasking for improved space event management. The 850 ELSG has deployed a working, accredited, SOA on the SIPRNET and provided real-time space information to five separate distributed operations centers. The 850 ELSG has learned first-hand the power of SOAs for integrating DoD and non-DoD SSA data in a rapid and agile manner, allowing capabilities to be fielded and sensors to be integrated in weeks instead of months. This opens a world of opportunity to integrate University data and experimental or proof-of-concept data with sensitive sensors and sources to support developing an array of SSA products for approved users in and outside of the space community. This paper will identify how new capabilities can be proactively developed to rapidly answer critical needs when SOA methodologies are employed and identifies the operational utility and the far-reaching benefits realized by implementing a service-oriented architecture. We offer a new paradigm for how data and application producer's contributions are presented for the rest of the community to leverage.

  4. SSA, PCA, TDPSC, ACFA: Useful combination of methods for analysis of short and nonstationary time series

    Energy Technology Data Exchange (ETDEWEB)

    Vitanov, Nikolay K. [Institute of Mechanics, Bulgarian Academy of Sciences, Akad. G. Bonchev Street, Bl. 4, 1113 Sofia (Bulgaria)], E-mail: vitanov@imech.imbm.bas.bg; Sakai, Kenshi [Department of Eco-Regional Science, Tokyo University of Agriculture and Technology, 3-5-8 Saiwai-cho, Fuchu-shi, Tokyo, 183-8509 (Japan); Dimitrova, Zlatinka I. [Institute of Solid State Physics, Bulgarian Academy of Sciences, Blvd. Tzarigradsko Chausee 72, 1784 Sofia (Bulgaria)

    2008-07-15

    Singular spectrum analysis (SSA), principal component analysis (PCA), and autocorrelation function analysis (ACFA) are useful tools for extracting information from time series. But the combination of these methods and the time delay phase space construction (TDPSC) is not much used. In this paper we present the opportunities of this bundle of four methods for analysis of short and nonstationary time series. The basis of our analysis are time series for the piglet prices and production in Japan before and after the Japan government intervention in the agriculture sector aiming at stabilization of the agriculture prices after the oil crisis in 1974. As a comparison we analyse long stationary chaotic time series from the classical Lorenz system. We show that SSA, PCA and TDPSC perfectly recognize the dimension of the Lorenz system only on the basis of time series for one of its three variables. The bundle of four methods leads us to enough information to make the conclusion that the intervention of the Japan government in agriculture sector was very successful and leaded (i) to stabilization of prices; (ii) to a coupling between the prices and production cycles and (iii) to decreasing the dimension of the phase space of price and production fluctuations around the year trend thus making their dynamics more forecastable.

  5. Advantageous use of SSA technique to observe effects of thickness, antioxidant and oxygen in gamma irradiated low density polyethylene

    Energy Technology Data Exchange (ETDEWEB)

    Perez, C.J., E-mail: cjperez@fi.mdp.edu.ar [Research Institute of Material Science and Technology (INTEMA), National Research Council (CONICET), Engineering Faculty, Mar del Plata University, Av. J.B. Justo 4302, 7600 Mar del Plata (Argentina); Failla, M.D. [Planta Piloto de Ingenieria Quimica-PLAPIQUI (UNS-CONICET), Camino ' La Carrindanga' Km 7, 8000 Bahia Blanca (Argentina); Carella, J.M. [Research Institute of Material Science and Technology (INTEMA), National Research Council (CONICET), Engineering Faculty, Mar del Plata University, Av. J.B. Justo 4302, 7600 Mar del Plata (Argentina)

    2012-06-20

    Highlights: Black-Right-Pointing-Pointer Information from successive self-nucleation and annealing technique is analyzed. Black-Right-Pointing-Pointer Oxygen and antioxidants reduce crosslinking efficiency by reaction with free radicals. Black-Right-Pointing-Pointer Recognizable differences are obtained in samples irradiated at different atmospheres. - Abstract: Information obtained from successive self-nucleation and annealing (SSA) technique is analyzed, paying special attention to the observable effects of samples thickness and antioxidant and oxygen concentrations. Molecular structure changes for low density polyethylene (LDPE) samples, irradiated under three different atmospheres for doses between 33 and 222 kGy were analyzed, with emphasis on the changes of longer polymethylene crystallizable lengths. Antioxidant and oxygen concentrations were varied for samples of different thickness to study the effects on degradation. The changes in the molecular structure were followed simultaneously by SSA and Infrared spectroscopy (FTIR) via carbonyl group concentration. Preliminary quantifications of the SSA technique sensitivity are also advanced.

  6. Hepatitis B dan Permasalahannya

    OpenAIRE

    Zain, Lukman Hakim

    2008-01-01

    Pada tahun 1965, Blumberg dan kawan- kawan di Philadelphia menemukan suatu antibodi pada pasien yang ditransfusi yang berasal dari suku Aborigin Australia, sehingga ant igen tersebut dikenal dengan nama Antigen Australia. Pada tahun 1977, Blumberg mendapat hadiah nobel untuk penemuannya itu. Sekarang antigen tersebut dikenal dengan nama hepatitis B surface antigen (HBsAg). Hepatitis B merupakan penyakit infeksi pada jaringan hati yang disebabkan oleh virus yang berasal da...

  7. PERBEDAAN PROSES PEMBELAJARAN DAN PRESTASI BELAJAR SISWA SD EKS-RSBI DAN SDSN DI DIY

    OpenAIRE

    Herjan Haryadi; Heri Retnawati

    2014-01-01

    Penelitian ini bertujuan untuk mengetahui perbedaan proses pembelajaran dan prestasi belajar siswa eks-RSBI dan SDSN di DIY pada mata pelajaran matematika, IPA dan Bahasa Indonesia. Penelitian ini merupakan studi penelitian komparasi. Populasi dalam penelitian ini adalah seluruh siswa kelas IV dan V SD eks-RSBI dan SDSN di DIY. Analisis data menggunakan (1) statistik deskriptif untuk mendeskripsikan proses penelitian dan menggambarkan mean dari data yang diperoleh; dan (2) statistik inferensi...

  8. ASIMETRI INFORMASI DAN UNDERPRICING

    Directory of Open Access Journals (Sweden)

    Tety Anggita Safitri

    2013-03-01

    Full Text Available Tujuan penelitian ini adalah untuk menguji pengaruh asimetri informasi terhadap underpricing. Penelitian ini menggunakan sampel 63 perusahaan yang melakukan penawaran umum perdana di Bursa Efek Indonesia dalam kurun waktu 2005-2010. Analisis data menggunakan regresi linier berganda, yaitu menguji proksi asimetri informasi yang terdiri atas ukuran perusahaan, umur perusahaan, proporsi saham yang ditawarkan kepada masyarakat, reputasi underwriter dan reputasi auditor terhadap underpricing. Hasil penelitian ini mengindikasikan bahwa reputasi underwriter dan reputasi auditor berpengaruh terhadap underpricing. Ukuran perusahaan, umur perusahaan dan proporsi saham yang ditawarkan tidak berpengaruh terhadap underpricing.The aim of this research is to examine the effect of assymetric information on underpricing. This research used a sample of 63 companies that make initial public offering on the Indonesia Stock Exchange in the period of 2005-2010. The data analysis is using multiple linear regression, which is testing the proxy of asymmetric information which consists of the firm size, the firm age, the proportion of shares offered to the public, underwriter reputation and auditor reputation on underpricing. This research indicates that underwriter reputation and auditor reputation have a significant effect on underpricing. The firm size, the firm age and the proportion of shares offered to the public have no significant effect on underpricing.

  9. Ductal constriction during dexamethasone treatment in an anti-SSA-antibody-exposed fetus with signs of myocardial inflammation.

    Science.gov (United States)

    Talemal, Lauren; Olivieri, Laura; Krishnan, Anita

    2016-06-01

    This report describes the clinical course and multi-modality imaging findings in an anti-SSA-antibody-exposed fetus with suspected myocardial inflammation. Postnatal cardiac MRI - using fast acquisition, free-breathing with feed-and-swaddle technique - was used to evaluate for myocardial fibrosis/inflammation. This is the first published report, to our knowledge, of ductal constriction temporally associated with oral dexamethasone therapy in an anti-SSA-antibody-exposed fetus and of the use of this unique postnatal MRI protocol in this setting. PMID:27087593

  10. Ultrasound findings in fetal congenital heart block associated with maternal anti-Ro/SSA and Anti-La/SSB antibodies.

    Science.gov (United States)

    Lai, Jasmine; Clark, Toshi J; Tan, Justin H; Delaney, Shani; Jolley, Jennifer A

    2015-03-01

    We present the sonographic features of a second-trimester fetus diagnosed with a bradyarrhythmia at 19 weeks' gestation. The mother carried a diagnosis of Sjögren syndrome, including the presence of SSA and SSB antibodies. Ultrasound M-mode and fetal echocardiogram revealed the etiology of the bradycardia to be a complete fetal congenital heart block, likely due to transplacental passage of autoimmune anti-Ro/SSA and anti-La/SSB antibodies. Consequential to the congenital heart block, the fetus developed hydrops fetalis at 21 weeks' gestational age. We discuss the 2 major etiologies of congenital heart block and the implications in subsequent pregnancies.

  11. Effect of sewage sludge ash (SSA on the mechanical performance and corrosion levels of reinforced Portland cement mortars

    Directory of Open Access Journals (Sweden)

    Andión, L. G.ª

    2006-06-01

    Full Text Available The article describes a study conducted to determinecorrosion in reinforcement embedded in Portland cement(PC mortars with different percentages of sewage sludgeash (SSA admixtures. The polarization resistancetechnique was used to determine the steel corrosion rate(Icorr in the test specimens. The samples were subjectedto different environmental conditions and aggressiveagents: 100% relative humidity (RH, accelerated carbonationat 70% RH and seawater immersion. Portlandcement was partially substituted for SSA in the mixes atrates of 0, 10, 20, 30 and 60% (by mass to make thedifferent mortars. The results show that where cementwas replaced by SSA at rates of up to 10% by mass,mortar corrosion performance was comparable to thebehaviour observed in SSA-free mortars (control mortar:0% SSA. Data for higher rates are also shown. From themechanical standpoint, SSA exhibited moderate pozzolanicactivity and the best performance when SSA wasadded at a rate of 10% to mixes with a water/(binder:PC + SSA (w/b ratio of 0.5.Se ha estudiado el nivel de corrosion que presentan lasarmaduras embebidas en morteros fabricados con cementoPortland (CP con diferentes porcentajes de sustitucion deceniza de lodo de depuradora (CLD. Se ha utilizado la tecnicade la Resistencia a la Polarizacion para determinar lavelocidad de corrosion del acero embebido en las muestrasestudiadas. Las muestras se han sometido a diferentes condicionesambientales y agentes agresivos: 100% de humedadrelativa (HR, carbonatacion acelerada al 70% HR einmersion en agua de mar. Para la fabricacion de los distintosmorteros, el cemento Portland ha sido parcialmente sustituidopor CLD en los siguientes porcentajes en masa: 0,10, 20, 30 y 60%. Los resultados muestran que sustitucionesde cemento por CLD de hasta el 10% en masa no alteranel comportamiento frente a la corrosion de los morterosal compararlos con los morteros libres de CLD (morteroscontrol: 0% de sustitucion de cemento por CLD. Se

  12. SARANA PENGUJIAAN MUTU MAKANAN PADA BEBERAPA PABRIK MAKANAN YANG MEMPRODUKSI PRODUK OLAHAN HASIL PETERNAKAN DAN PERIKANAN

    Directory of Open Access Journals (Sweden)

    Ani Isnawati

    2012-10-01

    oleh 7 pabrik (30,4 %, Gas Chromatografi dan Spektrofotometer Serapan Atom dimiliki hanya oleh 1 pabrik (4,3%. Untuk uji Mikrobiologi peralatan yang dipunyai pabrik adalah autoclave dan oven dipunyai 12 pabrik (52,2 % dan Laminar air flow hanya dimiliki oleh 2 pabrik  (8, 7 %.

  13. 78 FR 48170 - Privacy Act of 1974; CMS Computer Match No. 2013-12; HHS Computer Match No. 1307; SSA Computer...

    Science.gov (United States)

    2013-08-07

    ..., published at 78 FR 8538 (Feb. 6, 2013) and 78 FR 32256 (May 29, 2013). The matching program will also be... Applications, SSA/ OEEAS, 60-0058, 75 FR 82121 (December 29, 2010), as amended 78 FR 40542 (July 5, 2013); Prisoner Update Processing System (PUPS), SSA/OPB, 60- 0269, 64 FR 11076 (March 8, 1999), as amended 72...

  14. A study on atomic skips in AlFeCu perfect quasicrystals: application of the isotopic substitution method in neutron diffusion; Etude des sauts atomiques dans les quasicristaux parfaits AlFeCu: une application de la methode de substitution isotopique dans la diffusion des neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Coddens, G. [Laboratoire Leon Brillouin (LLB) - Centre d`Etudes de Saclay, 91 - Gif-sur-Yvette (France); Soulie, E. [CEA Centre d`Etudes de Saclay, 91 - Gif-sur-Yvette (France). Dept. de Recherche sur l`Etat Condense, les Atomes et les Molecules

    1994-12-31

    In order to better understand the crystal structure and the atomic skip or phason in quasi-crystals, three samples of the AlFeCu ternary alloy have been experimentally studied: Al{sub 62}Cu{sub 25.5}Fe{sub 12.5} (perfect sample), Al{sub 63}Cu{sub 24.5}Fe{sub 12.5} (non-perfect sample), Al{sub 50}Cu{sub 25}Fe{sub 25} (beta phase). Quasielastic neutron scattering variations with temperature and Q were recorded and signals have been enhanced through the use of isotope labelled samples. 4 figs., 2 tabs., 19 refs.

  15. Dislocation glide in Ni-Al solid solutions from the atomic scale up: a molecular dynamics study; Etude du glissement des dislocations dans la solution solide Ni-Al par simulation a l'echelle atomique

    Energy Technology Data Exchange (ETDEWEB)

    Rodary, E

    2003-01-01

    The glide of an edge dislocation in solid solutions is studied by molecular dynamics, at fixed temperature and imposed external stress. We have optimized an EAM potential for Ni(1 a 8% A1): it well reproduces the lattice expansion, local atomic order, stacking fault energy as a function of composition, as well as the elastic properties of the {gamma}' phase with L1{sub 2} structure. On increasing the stress, the dislocation is first immobile, then glides with a velocity proportional to the stress and the velocity saturates on reaching the transverse sound velocity. However, only beyond a static threshold stress, {sigma}{sub s}, does the dislocation glide a distance large enough to allow macroscopic shear; the linear part of the velocity-stress curve extrapolates to zero at a dynamical threshold stress, {sigma}{sub d}, The friction coefficient, and the threshold stresses ({sigma}{sub s} and {sigma}{sub d}), increase with the A1 concentration and decrease with temperature (300 and 500 K). Close to the critical shear stress, {sigma}{sub s}, the dislocation glide is analysed with a 'stop and go' model. The latter yields the flight velocity between obstacles, the mean obstacle density and the distribution of the waiting time on each obstacle as a function of stress, composition and temperature. The obstacle to the glide is proposed to be the strong repulsion between Al atoms brought into nearest neighbour position by the glide process, and not the dislocation-solute interaction. The microscopic parameters so defined are introduced into a micro-mechanical model, which well reproduces the known behaviour of nickel base solid solutions. (author)

  16. Latest update on the SSA/Ro auto-antibodies system and arrhythmia%SSA/Ro抗原及其自身抗体与心律失常的研究进展

    Institute of Scientific and Technical Information of China (English)

    黄媛; 帅宗文

    2014-01-01

    The ribonucleoprotein SSA/Ro, which is the target antigen of anti-SSA/Ro antibodies, is composed of Ro proteins and hYRNAs. Ro proteins include Ro60 protein and Ro52 protein, among which, Ro60 protein consists of HEAT repeats domain and vWFA domain while Ro52 protein has the structural characteristics of TRIM family members. Both the Ro60 and Ro52 antigens are composed of a series of epitopes, which have their own specific autoantibodies, and the autoantibodies to the different epitopes may be related with miscellaneous clinical manifestations of the autoimmune diseases. Anti-SSA/Ro antibodies could be passed from mother to fetus through placenta, and then lead to inflammatory damages in fetal cardiomyocytes or interfered with the function of calcium ion channels, and eventually results in fetal or neonatal atrioventricular block. Moreover, the other arrhythmia has also been reported, such as QTc interval prolongation and sinus bradycardia. Recent studies demonstrated that also adult heart, classically considered invulnerable to anti-SSA/Ro antibodies, could be affected. Anti-SSA/Ro antibodies have inhibitory effect on KCNH2 potassium channel and disturbed myocardial repolarization, and then result in QTc interval prolongation. Besides, it was reported constantly that anti-SSA/Ro antibodies might correlate with atrioventricular block in adult. However, the exact arrhythmogenic mechanisms have not been completely clarified as yet. It was not clear that how antibodies to the epitopes on SSA/Ro distributed in arrhythmia. The study would have important theoretical and clinical significance which revealed the relationships between auto-antibodies to the epitopes on SSA/Ro and arrhythmia.%抗SSA/Ro抗体的靶抗原SSA/Ro核蛋白由Ro蛋白和hYRNA两部分组成,其中Ro蛋白包括Ro60和Ro52两种类型,Ro60蛋白是由Heat重复区域和vWFA区域两结构域组成, Ro52蛋白则具有三结构域蛋白家族成员的结构特征。Ro60抗原与Ro52抗原均

  17. Antropologi dan Jaringannya di Indonesia

    OpenAIRE

    Jonris G. Purba

    2009-01-01

    Jika melihat tulisan ini sepintas dari judulnya, maka kita akan bertanya mengapa antropologi mempunyai jaringan. Di samping itu kita juga akan bertanya: jaringan seperti apa yang ada dalam antropologi itu? Bagaimana terbentuknya jaringan itu? Dan apa yang menjadi latar belakang munculnya jaringan antropologi tersebut? Serta apa saja manfaat dan kegiatan yang dilaksanakan dalam jaringan tersebut? ker-jul2006- (3)

  18. Atom Chips

    CERN Document Server

    Folman, R; Cassettari, D; Hessmo, B; Maier, T; Schmiedmayer, J; Folman, Ron; Krüger, Peter; Cassettari, Donatella; Hessmo, Björn; Maier, Thomas

    1999-01-01

    Atoms can be trapped and guided using nano-fabricated wires on surfaces, achieving the scales required by quantum information proposals. These Atom Chips form the basis for robust and widespread applications of cold atoms ranging from atom optics to fundamental questions in mesoscopic physics, and possibly quantum information systems.

  19. WHIRL SSA: a New Optimization Infrastructure Based on High-level Intermediate Representation%WHIRL SSA:一种基于高级中间表示的优化结构

    Institute of Scientific and Technical Information of China (English)

    杨克峤; 李健; 胡益斌; 许铝才

    2012-01-01

    中间表示对编译器的性能、效率和可扩展性都起着决定性作用.0pen64编译器采用一种树型结构的中间表示WHIRL,能表示各种高级控制流结构,但不能显式的提供数据流信息.本文基于WHIRL对SSA(Static Single Assignment)进行扩展,提出了一个新的优化结构WHIRL SSA.WHIRL SSA通过将SSA信息标注在WHIRL节点上,显式的为数据流分析提供使用-定义(UD)信息.相比于传统的数据流信息构建方法,WHIRL SSA提供了更精确、有效的数据流信息.本文讨论了WHIRL SSA的设计与实现和基于WHIRL SSA的优化.%Intermediate Representation is a determining factor of the capability, efficiency, and scalability of compiler optimizations. WHIRL, the Intermediate Representation (IR) of Open64 compiler, is a tree-form IR. While capable of describing various high-level control flow structures, WHIRL IR doesn't provide explicit UD information. This paper presents an extension of Static Single Assignment (SSA) infrastructure to WHIRL. Compared to traditional DU manager, the WHIRL SSA provides more efficiently and precisely data flow information. The paper describes the design and implementation of the WHIRL SSA, and discusses its applications and future work.

  20. Diketene-based neat four-component synthesis of the dihydropyrimidinones and dihydropyridine backbones using silica sulfuric acid (SSA)

    Institute of Scientific and Technical Information of China (English)

    Sadegh Rostamnia; Kamran Lamei

    2012-01-01

    Heterocyclic skeleton building blocks to afford dihydropyrimidinones and dihydropyridines based on neat adducts of diketene,alcohols and aldehydes via silica sulfuric acid (SSA) catalyzed ring opening of diketene in four-c6mponent Biginelli-type and Hantzsch-type reactions are presented.

  1. Subclinical Sjögren's syndrome and anti-Ro/SSA-positive autoimmune fatigue syndrome in children.

    Science.gov (United States)

    Itoh, Y; Imai, T; Fujino, O; Igarashi, T; Fukunaga, Y

    2002-09-01

    Abstract Although Sjögren's syndrome (SS) is quite rare among children, subclinical conditions without any sicca symptoms have been reported. This condition is characterized by nonspecific rheumatic symptoms and histopathological findings in salivary glands which are equivalent to SS. Many children with subclinical SS are positive for anti-Ro/SSA. On the other hand, autoimmune fatigue syndrome (AIFS) is characterized by chronic nonspecific complaints and positive antinuclear antibodies, with or without fulfilling the criteria for chronic fatigue syndrome. Although a novel autoantibody against a 62 kD nuclear protein (anti-Sa) is detected in about 40% of AIFS patients, few marker antibodies for autoimmune diseases, such as anti-DNA, anti-Sm, anti-U1-ribonucleoprotein (RNP), or anticardiolipin, are found in AIFS patients. In this study, however, anti-Ro/SSA was detected in sera from 8 out of 122 AIFS patients. Seven of the 8 anti-Ro/SSA-positive patients were female. All 8 patients had fatigue and low-grade fever, but none complained of xerosis. Western immunoblot analysis revealed that 7 sera reacted with Ro52, and that none was positive for anti-La/SSB or anti-Sa. Two of the 8 patients had histories of recurrent parotitis. Lip biopsies showed mild chronic inflammation compatible with subclinical SS in these 2 patients, although the other 6 patients had no abnormal histopathology. Thus, at least some anti-Ro/SSA-positive patients could be diagnosed as having SS.

  2. 75 FR 18251 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Internal Revenue Service (IRS...

    Science.gov (United States)

    2010-04-09

    ... the Privacy Act, as amended. ] Dated: March 31, 2010. Michael G. Gallagher, Deputy Commissioner for... File) system of records, SSA/ORSIS 60-0321, originally published at 69 FR 77816 (December 28, 2004), and as revised at 71 FR 42159 (July 25, 2006). IRS extracts return information with respect...

  3. Comment s'inventer un père écrivain: Albert camus chez Maïssa Bey

    NARCIS (Netherlands)

    M. Rosello

    2015-01-01

    This article focuses on the role played by Camus in Maïssa Bey’s work. Focusing on the ambivalent and paradoxical place he occupies in Au commencement était la mer and l’Ombre d’un homme qui marche au soleil, I analyse the construction of the father or rather Bey’s definition of fathers. The biologi

  4. The ESA SSA NEO Coordination Centre contribution to NEO hazard monitoring and observational campaigns

    Science.gov (United States)

    Micheli, Marco; Borgia, Barbara; Drolshagen, Gerhard; Koschny, Detlef; Perozzi, Ettore

    2015-08-01

    The NEO Coordination Centre (NEOCC) has recently been established in Frascati, near Rome, within the framework of the ESA Space Situational Awareness (SSA) Programme. Among its tasks is the coordination of observational activities related to the NEO hazard, and the distribution of relevant and up-to-date information on NEOs to both the scientific community and general users through its web portal (http://neo.ssa.esa.int).On the observational side, the NEOCC is linked to an increasingly large worldwide network of collaborating observatories, ranging from amateurs observers to large professional telescopes. The Centre organizes observation campaigns, alerting the network to suggest urgent or high-priority observations, and providing them with observational support.The NEOCC is also directly obtaining astrometric observations of high-priority targets, especially Virtual Impactors (VIs), on challenging objects as faint as magnitude 26.5, thanks to successful collaborations with ESO VLT in Chile and the INAF-sponsored LBT in Arizona. In addition, the Centre carries out regular monthly runs dedicated to NEO follow-up, recovery and survey activities with the 1-meter ESA OGS telescope in Tenerife.From a service perspective, the NEO System hosted at the NEOCC collects data and information on NEOs produced by various European services (e.g. NEODyS, EARN) and makes them available to a variety of users, with a particular focus on objects with possible collision solutions with the Earth. Among the tools provided through the web portal are the Risk List (a table of all known NEOs with impact solutions), a table of recent and upcoming close approaches, a database of physical properties of NEOs and the so-called Priority List, which allows observers to identify NEOs in most urgent need of observations, and prioritise their observational activities accordingly.The results of our recent observation campaigns and some major recent improvements to the NEO System will presented and

  5. PENINGKATAN KUALITAS DAN PROSES PEMBUATAN BIODIESEL DARI BLENDING MINYAK KELAPA SAWIT (PALM OIL) DAN MINYAK KELAPA (COCONUT OIL) DAN BANTUAN GELOMBANG ULTRASONIK

    OpenAIRE

    Hantoro Satriadi; Favian Nafiega; W Widayat; Rheza Dipo

    2015-01-01

    Keterbatasan solar sebagai sumber energi bahan bakunya tidak dapat diperbaharui menuntut adanya bahan baku alternatif yang dapat diperbaharui dan ramah lingkungan untuk pembuatan biodiesel. Reaksi utama produksi biodiesel adalah esterifikasi dan transestirifikasi yang berlangsung lambat dan membutuhkan banyak katalis dan alkohol. Reaksi yang terjadi belum sempurna dan belum memenuhi standar SNI dan ASTM. Untuk memperbaiki mutu biodiesel serta menghasilkan yield maksimal, maka dilakukan blendi...

  6. Quantification of ion or atom transfer phenomena in materials implanted by nuclear methods; Quantification de phenomenes de transferts ioniques ou atomiques dans des materiaux implantes par la mise en oeuvre de methodes nucleaires

    Energy Technology Data Exchange (ETDEWEB)

    Oudadesse, Hassane [Clermont-Ferrand-2 Univ., 63 - Aubiere (France)

    1998-05-18

    Knowledge of transfer of the constituents of a system from regions of higher to lower concentration is of interest for implanted bio-materials. It allows determining the rate at which this material is integrated in a living material. To evaluate the ossification kinetics and to study the bio-functionality in corals of Ca and Sr, irradiations with a 10{sup 13} n.cm{sup -2}.s{sup -1} was performed, followed by the examination of changes in the localization of these elements. By using PIXE analysis method the distribution of Ca, P, Sr, Zn and Fe in the implant, bone and bone-implant interfaces were determined. Thus, it was shown that resorption of coral in sheep is achieved in 5 months after implantation and is identical to the cortical tissues 4 months after implantation in animals as for instance in hares. We have analyzed the tissues from around the prostheses extracted from patients. The samples were calcined and reduced to powder weighting some milligrams. We have adopted for this study the PIXE analysis method. The samples were irradiated by a proton beam of 3 MeV and about 400 {mu}m diameter. The results show the presence of the elements Ti, Fe, Cr, Ni or Zn according to the type of the implanted prosthesis. This dispersal of the metallic ions and atoms contaminate the tissues. The transfer factors translate the exchanges between bone and the implanted material. The solvatation phenomenon and the electric charge equilibrium explain the transfer order of cations Mg{sup 2+}, Ca{sup 2+} and Sr{sup 2+} and of the anion PO{sub 4}{sup 3-}. We have also determined these factors for the elements Ti, Cr and Ni. An original technique to study the bone bio-functionality was used. Use of phosphate derivatives labelled by {sup 99m}Tc allows obtaining information about the fixation of radioactive tracer. It was found that only after the eighth month at the implantation the neo-formed bone fixes the MDP (methyl diphosphate) labelled by {sup 99m}Tc in a similar way as in the

  7. Kitab kuning dan perempuan, perempuan dan kitab kuning

    NARCIS (Netherlands)

    Bruinessen, M.M. van

    2007-01-01

    Kitab Kuning dan Emansipasi Perempuan: Konflik Budaya? Pengamatan-pengamatan Masdar mengenai kedudukan perempuan dalam diskursus (wacana, bahasan) dominan kitab kuning terasa tidak enak didengar tetapi memang sulit dibantah. Baik dalam penggunaan bahasa (yang sangat memihak kepada jenis mudzakkar) m

  8. KINERJA DAN EFISIENSI BANK PEMERINTAH (BUMN) DAN BUSN YANG GO PUBLIK DI INDONESIA

    OpenAIRE

    Sugeng Haryanto

    2012-01-01

    Penelitian ini menganalisis kinerja dan tingkat efisiensi bank-bank BUMN dan BUSN yang go Publik di Bursa Efek Indonesia.  Sample penelitian ini mengambil  tiga bank BUMN Bank BNI 46, Bank Mandiri dan Bank BRI)  dan tiga bank BUSN (Bank BCA, Bank Niaga dan Bank Panin) dengan periode analisis tahun 2005-2011. Varibael yang digunakan meliputi ROA, ROE, LAR. LDR, NPL dan BOPO. Tujuan dari penelitian ini adalah melihat dan menganalisis perbedaan kinerja antara Bank BUMN dan BUSN yang go public di...

  9. KONSEP DAN PRAKTIK PENDIDIKAN MULTIKULTURAL DI AMERIKA SERIKAT DAN INDONESIA

    Directory of Open Access Journals (Sweden)

    Juju Masunah

    2011-11-01

    Full Text Available Abstract: Concepts and Practices of Multi Cultural Education in the United States and in Indonesia. The purpose of this article is to discuss multicultural education consepts and practices in the U.S.A and its application to Indonesia. Data is based on a case study research of two dance educators who implemented multicultural education concept in Columbus, Ohio in year 2007. The result of this research is that two dance educators teach students equally by developing a curriculum and pedagogy that face democracy for all students. This concept and practice is possible to be applied to dance education in Indonesia. Abstrak: Konsep dan Praktik Pendidikan Multikultural di Amerika Serikat dan Indonesia. Tujuan artikel ini adalah untuk mendiskusikan konsep dan praktik pendidikan multikultural di Amerika Serikat dan Indonesia. Data-data diperoleh dari hasil penelitian studi kasus dua orang pendidik tari di Columbus, Ohio yang menerapkan konsep pendidikan multikultural dalam pembelajaran tari pada tahun 2007. Peneli­tian ini menyimpulkan bahwa dua guru tari tersebut memberi perlakuan yang sama dan adil terhadap se­mua siswa dengan cara yang demokratis dengan memperhatikan keberagaman dan keperbedaan siswa. Cara-cara ini sangat memungkinkan untuk diaplikasikan dalam pendidikan tari di Indonesia.

  10. Atom chips

    CERN Document Server

    Reichel, Jakob

    2010-01-01

    This book provides a stimulating and multifaceted picture of a rapidly developing field. The first part reviews fundamentals of atom chip research in tutorial style, while subsequent parts focus on the topics of atom-surface interaction, coherence on atom chips, and possible future directions of atom chip research. The articles are written by leading researchers in the field in their characteristic and individual styles.

  11. Parameterization of single-scattering albedo (SSA) and absorption Ångström exponent (AAE) with EC / OC for aerosol emissions from biomass burning

    Science.gov (United States)

    Pokhrel, Rudra P.; Wagner, Nick L.; Langridge, Justin M.; Lack, Daniel A.; Jayarathne, Thilina; Stone, Elizabeth A.; Stockwell, Chelsea E.; Yokelson, Robert J.; Murphy, Shane M.

    2016-08-01

    Single-scattering albedo (SSA) and absorption Ångström exponent (AAE) are two critical parameters in determining the impact of absorbing aerosol on the Earth's radiative balance. Aerosol emitted by biomass burning represent a significant fraction of absorbing aerosol globally, but it remains difficult to accurately predict SSA and AAE for biomass burning aerosol. Black carbon (BC), brown carbon (BrC), and non-absorbing coatings all make substantial contributions to the absorption coefficient of biomass burning aerosol. SSA and AAE cannot be directly predicted based on fuel type because they depend strongly on burn conditions. It has been suggested that SSA can be effectively parameterized via the modified combustion efficiency (MCE) of a biomass burning event and that this would be useful because emission factors for CO and CO2, from which MCE can be calculated, are available for a large number of fuels. Here we demonstrate, with data from the FLAME-4 experiment, that for a wide variety of globally relevant biomass fuels, over a range of combustion conditions, parameterizations of SSA and AAE based on the elemental carbon (EC) to organic carbon (OC) mass ratio are quantitatively superior to parameterizations based on MCE. We show that the EC / OC ratio and the ratio of EC / (EC + OC) both have significantly better correlations with SSA than MCE. Furthermore, the relationship of EC / (EC + OC) with SSA is linear. These improved parameterizations are significant because, similar to MCE, emission factors for EC (or black carbon) and OC are available for a wide range of biomass fuels. Fitting SSA with MCE yields correlation coefficients (Pearson's r) of ˜ 0.65 at the visible wavelengths of 405, 532, and 660 nm while fitting SSA with EC / OC or EC / (EC + OC) yields a Pearson's r of 0.94-0.97 at these same wavelengths. The strong correlation coefficient at 405 nm (r = 0.97) suggests that parameterizations based on EC / OC or EC / (EC + OC) have good predictive

  12. Obituary: Professor Paul Dan Cristea

    OpenAIRE

    Tabus, Ioan; Serpedin, Erchin; Astola, Jaakko

    2013-01-01

    Paul Dan Cristea, professor of Electrical Engineering and Computer Science at ‘Politehnica’ University of Bucharest died on 17 April 2013, following several years of bravely battling a perfidious illness.

  13. KINERJA Jurnal Bisnis dan Ekonomi

    OpenAIRE

    Kaaro, Hermeindito; Sukamulja, Sukmawati; Kusumastuti, Sri Yani; Krisnadewara, P. Didit; Lako, Andreas; Widiastuti, Theresia Diah; Ellitan, Lena; Priyogo, C. Jarot

    2004-01-01

    1. Kebangkrutan Versus Restrukturisasi:Evaluasi dan Prediksi Kelangsungan Hidup Perusahaan Pasca Krisis Keuangan 1997 oleh Hermeindito Kaaro 2. Morning LosSQS and Afternoon Price Volatility: Evidence of Jsksrts Stock Exchange oleh Sukmawati Sukamulja 3. Penentuan NilaiTukar: Pengujian Purchasing Power Parity diIndonesia oleh Sri Yani Kusumastuti 4. SurveiKinerja KoneksiInternet dan Kemampuan lnvestasi Warnet di Yogyakarta oleh P. Didit Krisnadewara 5. Peranan Corporate Str...

  14. The influence of quorum sensing in compartment II of the MELiSSA loop

    Science.gov (United States)

    Condori, Sandra; Mastroleo, Felice; Wattiez, Ruddy; Leys, Natalie

    MELiSSA (Micro-Ecological Life Support System Alternative) has been conceived as a 5 compartments microorganisms and higher plants recycling system for long haul space flights. Rhodospirillum rubrum S1H colonizes compartment II. Previous work reported that continuous culture of the bacterium in a photobioreactor could lead to thick biofilm formation, leading to bioreactor arrest. Our aim is to investigate the unknown quorum sensing (QS) system of R. rubrum S1H, specifically under MELiSSA relevant culture conditions meaning light anaerobic (LAN) and using acetate as carbon source. In that purpose an autoinducer synthase gene (Rru_A3396) knockout mutant was constructed by allelic exchange generating strain M68. In addition phenotypic comparison between wild type (WT) and M68 was performed. Results of thin layer chromatography assay where Agrobacterium tumefaciens NT1 have been used as reporter strain showed that WT produces acyl-homoserine lactones (AHLs) from C4 to C12 acyl carbon chain length; however, in M68 no AHLs were detected confirming that gene Rru_A3396 (named rruI) encodes an autoinducer synthase. Interestingly under a low shear or static environment M68 showed cell aggregation similar as reported in a closely related bacterium Rhodobacter sphaeroides (cerI mutant). In contrast to WT, M68 did not form biofilm and exhibited a decreased motility and pigment content. M68 vs wild type transcriptomics results showed that 326 genes were statistically significant differentially expressed. Downregulation of genes related to photosynthesis e.g., reaction center subunits, light harvesting complex and photosynthetic assembly proteins was observed. Similar results were obtained for preliminary proteomic analysis. Results obtained showed that in R. rubrum S1H the AHL-based QS system regulates almost 8% of the genome which is linked to biofilm formation among other biological processes described above. Since strain M68 could not be used in compartment II due to its less

  15. Atomic Physics

    CERN Document Server

    Foot, Christopher J

    2007-01-01

    This text will thoroughly update the existing literature on atomic physics. Intended to accompany an advanced undergraduate course in atomic physics, the book will lead the students up to the latest advances and the applications to Bose-Einstein Condensation of atoms, matter-wave inter-ferometry and quantum computing with trapped ions. The elementary atomic physics covered in the early chapters should be accessible to undergraduates when they are first introduced to the subject. To complement. the usual quantum mechanical treatment of atomic structure the book strongly emphasizes the experimen

  16. Atom interferometry

    International Nuclear Information System (INIS)

    We will first present a development of the fundamental principles of atom interferometers. Next we will discuss a few of the various methods now available to split and recombine atomic De Broglie waves, with special emphasis on atom interferometers based on optical pulses. We will also be particularly concerned with high precision interferometers with long measurement times such those made with atomic fountains. The application of atom interferometry to the measurement of the acceleration due to gravity will be detailed. We will also develop the atom interferometry based on adiabatic transfer and we will apply it to the measurement of the photon recoil in the case of the Doppler shift of an atomic resonance caused by the momentum recoil from an absorbed photon. Finally the outlook of future developments will be given. (A.C.)

  17. KAJIAN BIOAKTIF DAN ZAT GIZI PROPOLIS INDONESIA DAN BRASIL

    Directory of Open Access Journals (Sweden)

    Eliza Halim

    2012-11-01

    Full Text Available ABSTRACTIndonesia has a potency to produce its own propolis, however the propolis market in Indonesia is dominated by imported product, such as from Brazil. Currently, still there is no reasearch which evaluate bioactive compound and nutrient content of Indonesian Propolis (IP compare with Brazilian Propolis (BP. The objectivesof this study were to analyze bioactive compounds and nutrient contents of IP compared to BP. Bioactive compounds and nutrients content were analyzed by gas chromatography–mass spectrophotometry. The resultsshowed both IP and BP contain fenol, α-amyrin, cylolanost, and pyrimidines. Bioactive compounds which specifically found in IP were eudesmane compound, ethyl acridine, lupeol, friedooleanan; while β amyrin and cinnamic acid compound only found in BP. The nutrient contents of IP were higher than BP except for vitamin A. In conclusion, IP might have potential health benefit, similar to BP.Key words: propolis, bioactive, nutrientABSTRAKIndonesia mempunyai potensi untuk menghasilkan propolis tetapi pemasaran propolis di Indonesia didominasi oleh propolis impor seperti propolis yang berasal Brasil. Sampai saat ini belum ada penelitian yang mengungkapkandungan bioaktif dan zat gizi propolis Indonesia (PI dibandingkan dengan propolis Brasil (PB. Oleh karena itu tujuan penelitian ini adalah untuk melakukan kajian kandungan bioaktif dan zat gizi (vitamin dan mineral PI dibandingkan dengan PB. Komponen bioaktif dan kandungn gizi dianalisis dengan metode gas chromatography–mass spectrometry. Hasil analisis menyatakan bahwa baik PI maupun PB mengandung senyawa fenol, α-amyrin, cylolanost, dan pirimidin. Komponen bioaktif unik yang ditemukan di dalam PI adalah senyawaeudesmane, ethyl acridine, lupeol dan friedooleanan; sedangkan β-amyrin dan senyawa asam sinamat hanya ditemukan di dalam PB. Kandungan zat gizi PI lebih tinggi dari PB kecuali kandungan vitamin A. Hal ini menunjukkan bahwa PI kemungkinan mempunyai khasiat untuk

  18. Hazard Analysis for the Mark III Space Suit Assembly (SSA) Used in One-g Operations

    Science.gov (United States)

    Mitchell, Kate; Ross, Amy; Blanco, Raul; Wood, Art

    2012-01-01

    This Hazard Analysis document encompasses the Mark III Space Suit Assembly (SSA) and associated ancillary equipment. It has been prepared using JSC17773, "Preparing Hazard Analyses for JSC Ground Operation", as a guide. The purpose of this document is to present the potential hazards involved in ground (23 % maximum O2, One-g) operations of the Mark III and associated ancillary support equipment system. The hazards listed in this document are specific to suit operations only; each supporting facility (Bldg. 9, etc.) is responsible for test specific Hazard Analyses. A "hazard" is defined as any condition that has the potential for harming personnel or equipment. This analysis was performed to document the safety aspects associated with manned use of the Mark III for pressurized and unpressurized ambient, ground-based, One-g human testing. The hazards identified herein represent generic hazards inherent to all standard JSC test venues for nominal ground test configurations. Non-standard test venues or test specific configurations may warrant consideration of additional hazards analysis prior to test. The cognizant suit engineer is responsible for the safety of the astronaut/test subject, space suit, and suit support personnel. The test requester, for the test supported by the suit test engineer and suited subject, is responsible for overall safety and any necessary Test Readiness Reviews (TRR).

  19. Searching for candidates of Lyman continuum sources - revisiting the SSA22 field

    CERN Document Server

    Micheva, Genoveva; Inoue, Akio K; Matsuda, Yuichi; Yamada, Toru; Hayashino, Tomoki

    2015-01-01

    We present the largest to date sample of hydrogen Lyman continuum (LyC) emitting galaxies at any redshift, with $18$ LyA Emitters (LAEs) and $7$ Lyman Break Galaxies (LBGs), obtained from the SSA22 field with Subaru/Suprime-Cam. The sample is based on the $136$ LBGs and $159$ LAEs observed in the field, all with spectroscopically confirmed redshifts, and they are selected as galaxies with counterpart in a narrow-band filter image which traces LyC at $z\\geq 3.06$. Many LyC candidates show a spatial offset between the rest-frame non-ionizing ultraviolet (UV) detection and the LyC-emitting substructure or between the LyA emission and LyC. Statistically it is highly unlikely that all candidates in our sample are contaminants, and there should be $\\sim9$ and $\\sim2$ viable LyC candidates among the LAEs and LBGs. There is some evidence for a positive LyC/LyA correlation, suggesting that both LyC and LyA escape via a similar mechanism. "Standard" SED models cannot explain the observed LyC LAEs colors, instead requir...

  20. Thermal properties of poly(ethylene oxide)/lauric acid blends. A SSA-DSC study

    Energy Technology Data Exchange (ETDEWEB)

    Pielichowski, Krzysztof; Flejtuch, Kinga [Department of Chemistry and Technology of Polymers, Cracow University of Technology, ul. Warszawska 24, 31-155 Krakow (Poland)

    2006-03-15

    A series of poly(ethylene oxide) (PEO)/lauric acid blends with different compositions has been prepared and characterised by differential scanning calorimetry (DSC) in dynamic mode. It has been found that the enthalpy of melting and crystallisation reaches its highest value for PEO/lauric acid blend (1:1, w/w) which makes this system a promising candidate for thermal energy storage applications. Further studies by step-scan alternating (SSA)-DSC revealed that an increase of the temperature step causes that the average total heating rate is also increasing and the heat flow is characterised by higher values. Reversing component of the heat flow during melting reaches lowest values at highest step (step=1{sup o}) when the re-crystallisation of PEO is hindered. An increase of step generally leads to an increase of the number of non-equilibrium effects and facilitates the activation of kinetic non-reversing processes, hindering the overall crystallisation of PEO. For lauric acid, due to facile crystallisation and self-association, formation of ordered regular structures takes place faster and is influenced by non-reversing processes in higher proportion. (author)

  1. Are crude oil markets multifractal? Evidence from MF-DFA and MF-SSA perspectives

    Science.gov (United States)

    He, Ling-Yun; Chen, Shu-Peng

    2010-08-01

    In this article, we investigated the multifractality and its underlying formation mechanisms in international crude oil markets, namely, Brent and WTI, which are the most important oil pricing benchmarks globally. We attempt to find the answers to the following questions: (1) Are those different markets multifractal? (2) What are the dynamical causes for multifractality in those markets (if any)? To answer these questions, we applied both multifractal detrended fluctuation analysis (MF-DFA) and multifractal singular spectrum analysis (MF-SSA) based on the partition function, two widely used multifractality detecting methods. We found that both markets exhibit multifractal properties by means of these methods. Furthermore, in order to identify the underlying formation mechanisms of multifractal features, we destroyed the underlying nonlinear temporal correlation by shuffling the original time series; thus, we identified that the causes of the multifractality are influenced mainly by a nonlinear temporal correlation mechanism instead of a non-Gaussian distribution. At last, by tracking the evolution of left- and right-half multifractal spectra, we found that the dynamics of the large price fluctuations is significantly different from that of the small ones. Our main contribution is that we not only provided empirical evidence of the existence of multifractality in the markets, but also the sources of multifractality and plausible explanations to current literature; furthermore, we investigated the different dynamical price behaviors influenced by large and small price fluctuations.

  2. Viable Biomass Sensor integration in the MELiSSA CI and CIII compartments

    Science.gov (United States)

    Duatis Juarez, Jordi; Peiro, Enrique; Bragos, Ramon

    Traditionally, the biomass quantity and quality in complex substrate reactor (e.g. activated sludge, high density, fixed bed,..) is determined off-line in laboratories. Within this study, the VIAMASS Sensor System, which uses Electrical Impedance Spectroscopy (EIS) techniques, has been tested for MELiSSA compartment CI and C III, the liquefying and the nitrifying compartment respectively. This sensor is able to measure viable cells on basis of an impedance spectroscopy measurement. The fact that viable biomass can be detected, distinguishes the sensor from classical biomass sensors used in wastewater treatment plants. Detection of viable biomass and composition of the biomass can be very useful for calibration and validation of biological models. The sensor can be used to detect toxicity in system leading to die-off of organisms. The technology developed initially for space applications has been adapted and will be also able to give overall information on the population distribution of cells, distinguishing what type of biomass is dominant (for example, bacteria or protozoa).

  3. Spontaneous rupture of atrioventricular valve tensor apparatus as late manifestation of anti-Ro/SSA antibody-mediated cardiac disease.

    Science.gov (United States)

    Cuneo, Bettina F; Fruitman, Deborah; Benson, D Woodrow; Ngan, Bo-Yee; Liske, Michael R; Wahren-Herlineus, Marie; Ho, S Yen; Jaeggi, Edgar

    2011-03-01

    Atrioventricular (AV) block and endocardial fibroelastosis associated with dilated cardiomyopathy are the most common clinical manifestations of anti-Ro/SSA-mediated fetal cardiac disease. Valvar dysfunction has not been a prominent feature of this disease; however, recent anecdotal cases have suggested an association between rupture of the AV valve tensor apparatus and maternal anti-Ro/SSA antibodies. In the present study, we have described the clinical and laboratory findings and reviewed the published data for infants of anti-Ro/SSA-positive pregnancies with AV valve insufficiency due to chordal rupture from the papillary muscles. The histopathologic features of the papillary muscle and ventricular free wall and septum biopsy specimens were examined and compared to the sections of AV leaflets from 6 autopsied fetuses with anti-Ro/SSA-mediated complete AV block without chordal disruption. Specific epitopes to the p200 region of Ro52, and Ro60 antibodies were evaluated in cases with chordal rupture. Severe AV valve insufficiency was detected prenatally (as early as 34 weeks of gestation) or postnatally (as late as 182 days) after areas of patchy echogenicity were noted in the papillary muscle at 19 to 22 weeks of gestation. Postnatally, urgent valve surgery was performed in 5 of 6 patients; 1 of 6 patients died preoperatively. All patients tested positive for Ro52. Valve leaflet tissue from the autopsy specimens was normal. The ventricular free wall and septum biopsy specimens from a patient with chordal rupture showed normal tissue; however, the papillary muscle biopsy specimens demonstrated severe atrophy with near total replacement of myocytes by fibrosis and dystrophic calcifications, and negative immunochemistry findings. In conclusion, these findings have defined an underappreciated complication of fetal antibody-mediated cardiac inflammation.

  4. EKSTRAKSI DAN SINTESIS NANOSILIKA BERBASIS PASIR BANCAR DENGAN METODE BASAH

    Directory of Open Access Journals (Sweden)

    Munasir .

    2013-11-01

    Full Text Available The Purification and synthesis nanosilika extracts from quartz sand base material taken Bancar Tuban area ( north of the Island of Java-Indonesia has been carried out in this study . Physically Tuban Bancar sand grains have a slightly rough shape and bright yellow. Sand Bancar has elements Si atoms (69 %Wt, and elements of the dominant impurity atoms is Ca (7.5 %Wt and K (4.8 %Wt. Diffraction pattern shows a dominant intesistas occurs at an angle (2Ɵ~26o the phase of quartz ( the most stable in nature. Size finely divided powder sand about 5-50 micrometers. Synthesis nanosilika based natural sand used wet method, which consists of two processes, namely: (1 sand powder processed by the hydrothermal method using alkaline compounds (NaOH with molarity 7M, to obtain a clear solution of sodium silicate (Na2O.xSiO2, and (2 a solution of sodium silicate acts as prcursor processed by co-precipitation method, sodium silicate solution was titrated with HCl 2 M (co-precipitation method to obtain a slurry silicite Si(OH4. The final product in the form of silica powder with amorphous and crystalline structures (quartz ; purity (%Wt Si reached 95.7 % and marfologi analysis showed that the SiO2 particles tend to form agglomeration and particle size of about ~ 58 nm Key words: nanosilica, bancar sands, amorphous, quartz   Abstrak Pemurnian, ekstrak dan sintesis nanosilika dari bahan dasar pasir kuarsa yang diambil di daerah Bancar Tuban (utara Pulau Jawa-Indonesia telah dilakukan pada penelitian ini. Secara fisik pasir  Bancar Tuban  mempunyai bentuk butiran agak kasar dan berwarna kuning cerah. Pasir Bancar mempunyai unsur atom Si (69%Wt, dan unsur atom pengotor dominan adalah Ca (7,5%wt dan K (4,8%wt. Pola difraksinya menunjukan intesistas dominan terjadi pada sudut (2 theta ~26o, fase quartz (paling stabil di alam. Ukuran serbuk pasir yang telah dihaluskan sekitar 5-50 mikrometer. Sintesis nanosilika berbasis pasir alam digunakan metode basah, yang

  5. MUWUJUDKAN BUDAYA POLITIK SANTUN, BERSIH DAN BERETIKA DALAM RANGKA MEMPERKOKOH KEHIDUPAN BERBANGSA DAN BERNEGARA

    Directory of Open Access Journals (Sweden)

    Wahyu Widodo

    2014-11-01

    Full Text Available Abstract Makalah ini membahas konsep budaya politik berpusat pada imajinasi (pikiran dan perasaan manusia yang merupakan dasar semua tindakan. Dalam rangka menuju arah pembangunan dan modernisasi suatu masyarakat akan menempuh jalan yang berbeda antara satu masyarakat dengan yang lain, dan itu terjadi karena peranan kebudayaan sebagai salah satu faktor. Budaya politik dapat membentuk aspirasi, harapan, preferensi, dan prioritas tertentu dalam menghadapi tantangan yang ditimbulkan oleh perubahan sosial politik. Pada gilirannya, disimpulkan bahwa peran budaya politik santun, bersih dan beretika dalam rangka memperkokoh kehidupan berbangsa dan bernegara menuju Indonesia baru adalah: pertama, etika politik dan pemerintahan mengandung misi kepada setiap pejabat dan elite politik untuk bersikap jujur, amanah, sportif, siap melayani, berjiwa besar, memiliki keteladanan, rendah hati, dan siap untuk mundur dari jabatan publik apabila terbukti melakukan kesalahan dan secara moral kebijakannya bertentangan dengan hukum dan rasa keadilan masyarakat. Kedua, perlu dilakukan upaya penanaman suatu kesadaran bahwa politik yang hendak kita perjuangkan bukan semata politik kekuasaan, melainkan suatu politik yang mengedepankan panggilan pengabdian demi kesejahteraan masyarakat luas, dialektika antara partai dan politikus serta masyarakat yang kritis. Ketiga, budaya politik santun, bersih dan beretika ini diperlukan karena dapat membuat para elite politik menjauhi sikap dan perbuatan yang dapat merugikan bangsa Indonesia. Akhirnya, disarankan agar dilaksanakan kembali pendidikan budi pekerti yang merupakan pondasi bagi pelaksanaan Civic Education agar tercipta generasi yang tidak hanya mau menjadi politisi, namun paham budaya dan etika politik.   Kata kunci: budaya politik, kehidupan berbangsa dan bernegara, menuju Indonesia baru

  6. Atrioventricular Conduction Delay in Fetuses Exposed to Anti-SSA/Ro and Anti-SSB/La Antibodies: A Magnetocardiography Study

    Directory of Open Access Journals (Sweden)

    Annette Wacker-Gußmann

    2012-01-01

    Full Text Available Background. The presence of anti-SSA/Ro and anti-SSB/La antibodies during pregnancy is associated with fetal congenital heart block (CHB, which is primarily diagnosed through fetal echocardiography. Conclusive information about the complete electrophysiology of the fetal cardiac conducting system is still lacking. In addition to echocardiography, fetal magnetocardiography (fMCG can be used. fMCG is the magnetic analogue of the fetal electrocardiogram (ECG. Patients and Methods. Forty-eight pregnant women were enrolled in an observational study; 16 of them tested positive for anti-SSA/Ro and anti-SSB/La antibodies. In addition to routine fetal echocardiography, fMCG was used. Fetal cardiac time intervals (fCTIs were extracted from the magnetic recordings by predefined procedures. ECGs in the neonates of the study group were performed within the first month after delivery. Results. The PQ segment of the fCTI was significantly prolonged in the study group (P=0.007, representing a delay of the electrical impulse in the atrioventricular (AV node. Other fCTIs were within normal range. None of the anti-SSA/Ro and/or anti-SSB/La fetuses progressed to a more advanced heart block during pregnancy or after birth. Conclusion. The study identified a low-risk population within antibody positive mothers, where PQ segment prolongation is associated with a lack of progression of the disease.

  7. Autoantibodies from mice exposed to Libby amphibole asbestos bind SSA/Ro52-enriched apoptotic blebs of murine macrophages

    International Nuclear Information System (INIS)

    Asbestos exposure is associated with increased autoimmune responses in humans. For example, in Libby, MT where significant asbestos exposure has occurred due to an asbestos-contaminated vermiculite mine near the community, residents have developed increased autoimmune responses compared to an unexposed population. However, the exact mechanism by which Libby amphibole asbestos generates autoimmune responses is unclear. A murine model of amphibole asbestos-induced autoimmunity was recently established, and one of the targets of the autoantibodies (AAs) was the SSA/Ro52 autoantigen. The purpose of this study was to determine whether the SSA/Ro52 autoantigen is exposed at the surface of cells as a result of asbestos exposure as a possible mechanism leading to antigenicity. Our results indicate that Libby asbestos induces apoptosis in murine macrophages as determined by phosphatidylserine exposure, cleavage of poly(ADP-ribose) polymerase and morphological changes such as nuclear condensation. Moreover, asbestos-induced apoptosis results in the formation of apoptotic cell surface blebs enriched in SSA/Ro52 as determined by confocal microscopy. Most importantly, apoptotic cell surface blebs are recognized by AAs from mice exposed to amphibole asbestos suggesting that these cell surface structures may be antigenic when presented in a pro-inflammatory context. This study supports the hypothesis that the induction of apoptosis plays a key role in environmentally induced autoimmunity through cell surface exposure of a known autoantigen

  8. RANCANG BANGUN MODEL KOMPRESI DAN TARIK PERMODELAN SANDBOX DAN MANFAATNYA

    Directory of Open Access Journals (Sweden)

    Fahrudin Fahrudin

    2015-07-01

    Full Text Available Permodelan sandbox dibuat dengan system tektonik konvergen dan divergen dengan menggunakan pergerakan satu sumbu. Permodelan ini bertujuan untuk membuat alat mesin sandbox yang bisa digunakan untuk penelitian dan pengajaran. Mesin berhasil dibuat dan sudah diujicobakan. Ujicoba dengan menggunakan satu lapisan pasir yang diambil dari Formasi Ngrayong. Percobaan selanjutnya dengan beberapa lapisan. Percobaan dilakukan dengan pengamatan yang meliputi pengamatan permukaan dan penampang verikal. Pengamatan yang aspek morfologi, kelurusan struktur, dan perkembangan sesar yang terbentuk. Hasil percobaan menunjukkan bahwa pembentukan morfologi sangat berkaitan dengan pembentukan sesar. Struktur sesar dengan pola forward propagating thrust faults. Sesar tersebut disebabkan imbrikasi. Lipatan yang terbentuk akibat mekanisme propagasi sesar.[Design of Compression and Extensional of the Sandbox Model and Its Benefit] Divergent and convergent tectonic sytem can be studied from the sandbox modelling. This model has a axis of movement. Sandbox models itends to study the progress of structural geology such as fault and fold. We successfully made machine of sandbox. This machine has basal detachment from duraluminum. Material for model is taken by loose sand from Ngrayong Formation. This experiment focused to observation about morphology in surface and thrust or backthrust in subsurface. This experiment has compression system. Result of model was that morphological sequences associated with fault sequences. Fault is formed to have the pattern of forward propagating thrust faults. It’s caused by imbricate thrust system. Folding is formed by the mechanism of fault propagation folding. 

  9. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block

    OpenAIRE

    Fritsch, Christine; Hoebeke, Johan; Dali, Hayet; Isenberg, David A; Meyer, Olivier; Muller, Sylviane; Ricchiuti, Vincent

    2005-01-01

    Neonatal lupus erythematosus is a rare disorder caused by the transplacental passage of maternal autoantibodies. The 52-kDa Ro/SSA antigen (Ro52) ribonucleoprotein represents an antigenic target strongly associated with the autoimmune response in mothers whose children have neonatal lupus and cardiac conduction disturbances, mainly congenital heart block. The objective of this study was to identify putative Ro52/60-kDa Ro/SSA antigen (Ro60) epitopes associated with neonatal lupus and congenit...

  10. KINERJA KEPALA SEKOLAH DALAM KEGIATAN BIMBINGAN DAN KONSELING

    Directory of Open Access Journals (Sweden)

    Abu Bakar M.Luddin

    2014-06-01

    Abstrak: Kinerja Kepala Sekolah dalam Kegiatan Bimbingan dan Konseling. Penelitian ini bertujuan mendeskripsikan kinerja kepala sekolah dalam pelaksanaan kegiatan bimbingan dan konseling. Penelitian dilaksanakan di SMU Negeri 2 Kota Binjai, dengan memergunakan rancangan deskriptif kualitatif. Subjek penelitian adalah kepala sekolah, koordinator bimbingan dan konseling, dan guru pembimbing. Data di­kumpulkan dengan observasi, wawancara mendalam, dan kajian dokumen, dan selanjutnya dianalisis sete­lah melalui proses triangulasi antarsubjek dan informasi. Temuan penelitian menunjukkan bahwa kinerja kepala sekolah terkait dengan pelaksanaan kegiatan bimbingan dan konseling masih belum sepenuhnya sebagaimana yang diharapkan. Kepala sekolah perlu meningkatkan kinerjanya dalam menjalankan fungsi koordinasi dan kepengawasan untuk mencapai kegiatan bimbingan dan konseling yang efektif.

  11. ANALISIS PERBANDINGAN SPAP, IAS DAN SPKN

    OpenAIRE

    Maylia Pramono Sari

    2012-01-01

    Dalam mewujudkan Good Goveronance  akan dilakukan analisis perbandingan mengenai standar pemeriksaan nasional yaitu SPAP, ISA, dan SPKN untuk menemukan standar yang lebih tepat dan lebih lengkap untuk pemeriksaan sektor publik. Persamaan SPKN dan ISS  adalah tanggungjawab manajemen dan tanggungjawab auditor sedangkan perbedaannya adalah badan yang menerbitkannya. Perbedaan yang mendasar terletak pada karakter pemeriksaan BPK. Karakter tersebut adalah keharusan pemeriksa BPK untuk merancang ...

  12. Atomic physics

    International Nuclear Information System (INIS)

    Research activities in atomic physics at Lawrence Berkeley Laboratory during 1976 are described. Topics covered include: experiments on stored ions; test for parity violation in neutral weak currents; energy conservation and astrophysics; atomic absorption spectroscopy, atomic and molecular detectors; theoretical studies of quantum electrodynamics and high-z ions; atomic beam magnetic resonance; radiative decay from the 23Po,2 levels of helium-like argon; quenching of the metastable 2S/sub 1/2/ state of hydrogen-like argon in an external electric field; and lifetime of the 23Po level of helium-like krypton

  13. Pengelolaan Pupuk Organik Dan Kalium Terhadap Pertumbuhan Dan Produksi Tanaman Rosela (Hibiscus sabdariffa L.)

    OpenAIRE

    Hutasoit, Christina

    2010-01-01

    CHRISTINA HUTASOIT: Pengelolaan Pupuk Organik dan Kalium terhadap Pertumbuhan dan Produksi Tanaman Rosela (Hibiscus sabdariffa L.), dibimbing oleh J. M. Sitanggang dan Sabar Ginting. Penelitian ini bertujuan Untuk mengetahui dosis pupuk Organik dan pupuk Kalium terhadap pertumbuhan dan produksi tanaman rosella (Hibiscus sabdariffa L.). Penelitian telah dilakukan di lahan percobaan Kelurahan Sempakata, Kecamatan Medan Selayang pada bulan Desember – April 2010 menggunakan Rancangan Acak Kelo...

  14. PRINSIP DAN METODE ANALISIS RISIKO KESEHATAN LINGKUNGAN

    Directory of Open Access Journals (Sweden)

    Defriman Djafri

    2014-04-01

    Full Text Available Analisis risiko kesehatan lingkungan merupakan penilaian atau penaksiran risiko kesehatan yang bisa terjadi di suatu waktu pada populasi manusia berisiko. Kajian prediktif ini menghasilkan karakteristik risiko secara kuantitatif, pilihan-pilihan manajemen risiko dan strategi komunikasi untuk meminimalkan risiko tersebut. Data kualitas lingkungan yang bersifat agent specific dan site specific, karakteristik antropometri dan pola aktivitas populasi terpajan dibutuhkan untuk kajian ini.

  15. PRINSIP DAN METODE ANALISIS RISIKO KESEHATAN LINGKUNGAN

    OpenAIRE

    Defriman Djafri

    2014-01-01

    Analisis risiko kesehatan lingkungan merupakan penilaian atau penaksiran risiko kesehatan yang bisa terjadi di suatu waktu pada populasi manusia berisiko. Kajian prediktif ini menghasilkan karakteristik risiko secara kuantitatif, pilihan-pilihan manajemen risiko dan strategi komunikasi untuk meminimalkan risiko tersebut. Data kualitas lingkungan yang bersifat agent specific dan site specific, karakteristik antropometri dan pola aktivitas populasi terpajan dibutuhkan untuk kajian ini.

  16. Hubungan Stress Dengan Penyakit Dan Perawatan Periodontal

    OpenAIRE

    Der, William

    2009-01-01

    Stress adalah istilah yang mendefenisikan reaksi psiko-fisiologis tubuh terhadap berbagai rangsangan emosional atau fisik yang mengganggu homeostasis, dan ditemukan dapat mengeksaserbasi hasil dari penyakit infeksi bakteri dan virus pada model hewan dan manusia. Stres telah lama dinyatakan sebagai suatu faktor predisposisi yang penting untuk Gingivitis Ulseratif Nekrotik Akut (GUNA). Banyak penelitian telah menunjukkan bahwa stres psikologis atau kondisi psikosomatik mendorong terjadinya peru...

  17. Frequency chain to measure the 2S-8S/8D transitions in atomic hydrogen: measurement of the Rydberg constant in frequency unit; Chaine de frequence optique pour mesurer les transitions 2S-8S/8D dans l'atome d'hydrogene: mesure de la constante de Rydberg en unite de frequence

    Energy Technology Data Exchange (ETDEWEB)

    Nez, F

    1993-10-15

    The aim of this thesis is to make a pure measurement of the frequency of the 2S-8S/8D two-photon transition in atomic hydrogen. In that purpose we have built a frequency chain in which hydrogen frequencies are compared with the difference of two optical standards, the methane stabilized He-Ne laser (3.39 {mu}m) and the iodine stabilized He-Ne laser (633 nm). The radiation from a home made Ti-sapphire laser (TS2) at 778 nm is mixed, in a LiIO{sub 3} crystal, with the one of a auxiliary He-Ne laser at 3.39 {mu}m to produce a synthesized radiation at 633 nm. The frequency of the Ti-sapphire (TS1) laser used for the two photon excitation is 89 GHz away from the one of TS2. To compare these two lasers, we have used a Schottky diode. The two lasers and a microwave radiation at 89 GHz, produced by a Gunn diode, are focused on the Schottky diode. The Gunn diode is phase locked on an ultra-stable quartz oscillator. In this way, we have linked an optical frequency of atomic hydrogen to the cesium clock without interferometry. From our measurements, we have deduced a new value of the Rydberg constant: R{sub {infinity}} equals 109737.3156834 (24) cm{sup -1} with an uncertainty of 2.2 10{sup -11}. Our uncertainty is near the one of the Q.E.D calculations giving the theoretical values of the energy levels. This value, which is currently the most precise available, is in good agreement with the recent result obtained from the 1S-2S and 2S-4D transitions. (author)

  18. Atomic physics

    CERN Document Server

    Born, Max

    1989-01-01

    The Nobel Laureate's brilliant exposition of the kinetic theory of gases, elementary particles, the nuclear atom, wave-corpuscles, atomic structure and spectral lines, electron spin and Pauli's principle, quantum statistics, molecular structure and nuclear physics. Over 40 appendices, a bibliography, numerous figures and graphs.

  19. Pengaturan dan Pengawasan pada Bank Syariah

    Directory of Open Access Journals (Sweden)

    Ali Syukron

    2012-06-01

    Full Text Available Peran bank dalam melaksanakan tugas dan fungsinya perlu diatur secara baik dan benar. Hal ini bertujuan untuk menjaga kepercayaan nasabah terhadap aktivitas perbankan. Salah satu peraturan yang perlu dibuat untuk mengatur perbankan adalah peraturan mengenai permodalan bank yang berfungsi sebagai penyangga terhadap kemungkinan terjadinya kerugian. Tulisan ini merupakan studi pustaka dimana penulis mengelaborasi bagaimana pengaturan dan pengawasan pada bank syariah yang ada di berbagai negera. Dalam tulisan ini, penulis mengambil sampel negara Malaysia,  Pakistan, Kuwait, dan Inggris. Alasan memilih keempat negara tersebut karena Malaysia dan Kuwait memiliki kemiripan dengan Indonesia yang mengadopsi dual banking system.

  20. Contribution to the study of the {sup 31}P, {sup 1}H spin spin coupling constant N. M. R. in three co-ordinated phosphorus compounds. Influence of the bond orientation and of the nature of the substituent around the phosphorus atom; Contribution a l'etude des constantes de couplage {sup 31}P, {sup 1}H en R.M.N. dans les composes organo-phosphores tricoordines. Influence des facteurs geometriques et de la nature des substituants au niveau du phosphore

    Energy Technology Data Exchange (ETDEWEB)

    Robert, J.B. [Commissariat a l' Energie Atomique, Grenoble (France). Centre d' Etudes Nucleaires

    1969-07-01

    In order to investigate the influence of the configuration at the phosphorus atom and the influence of the substituents attached to the phosphorus atom on the J{sub PH} spin spin coupling constant, we have performed the NMR spectrum analysis of some three coordinated organo-phosphorus compounds. The studied coupling constants are {sup 3}J{sub PH} through P-O-C-H and P-C-C-H fragments and {sup 2}J{sub PH} through P-C-H fragment. The results clearly show that on the NMR time scale, in all the studied compounds (1,3,2-dioxaphospholanes, 1,3,2-dioxaphosphorinanes, 3-phospha-cyclopentene and 4-phosphorinanone) there is no inversion of the bonds around phosphorous. This conclusion held also for secondary phosphines. For a given geometry of the bonds joining the P and H atoms, and a given disposition of the bonds around the phosphorus atom, there is only a little influence of the nature of the substituents on the J{sub PH} spin coupling constants. The geometrical dependence of the {sup 3}J{sub PH} cannot be explained by a 'Karplus law'. There is an influence of the bond disposition around phosphorus. In the case of the {sup 2}J{sub P-C-H}, one can plot a curve {sup 2}J{sub P-C-H} = f({alpha}) (0{<=} {alpha} {<=} 180), {alpha} denote the dihedral angle of the two plane defined the first one by the P, C and H atoms, and the second one by the P-C bond together with the three-fold axis of the bond around phosphorus assuming a regular pyramidal arrangement. The function {sup 2}J{sub P-C-H} = f({alpha}) has two maxima, one for {alpha} = 0 degrees and the other for {alpha} = 180 degrees, and also a minimum for {alpha} = 110 degrees. (author) [French] Ce travail consiste en l'analyse par resonance magnetique nucleaire des constantes de couplage phosphore-proton dans des derives organo-phosphores tricoordines dans un double but: examen de la stabilite des liaisons au niveau du phosphore et etude de l'influence de la disposition des liaisons et de la nature de

  1. STRUKTUR DAN PRODUKSI LEBAH Trigona spp. PADA SARANG BERBENTUK TABUNG DAN BOLA

    Directory of Open Access Journals (Sweden)

    Putu Ade Hinduari Putra

    2015-12-01

    Full Text Available Lebah tanpa sengat (Trigona spp. dapat menghasilkan madu yang bermanfaat bagi kesehatan. Penelitian bertujuan untuk mengetahui : (1 morfologi Trigona spp., (2 struktur internal sarang Trigona spp. pada sarang berbentuk tabung dan bola, (3 volume sarang serta perkiraan produksi madu, beebread dan selanakan Trigona spp. pada sarang berbentuk tabung dan bola. Penelitian dilaksanakan pada bulan November 2014. Sampel yang digunakan adalah koloni dan sarang Trigona spp. berbentuk tabung dan bola yang diambil di Desa Padang Tunggal,Kecamatan Selat, Kabupaten Karangasem, Bali. Hasil penelitian menunjukan bahwa nama spesies dari sampel koloni Trigona spp. pada sarang berbentuk tabung dan bola adalah Trigona laeviceps. Struktur internal sarang Trigona spp. pada sarang berbentuk tabung dan bola mempunyai pola susunan yaitu pot madu, pot beebread dan pot sel anakan. Volume sarang besar memberikan perkiraan total jumlah produksi madu, beebread dan selanakan lebih banyak dibandingkan volume sarang kecil.

  2. PENGARUH PEMBERIAN HIJAUAN DAN KONSENTRAT MENGANDUNG UREA-KAPUR DAN UBI KAYU TERHADAP PENAMPILAN KAMBING PE

    Directory of Open Access Journals (Sweden)

    I G. Mahardika

    2015-06-01

    Full Text Available Penelitian telah dilakukan untuk mengetahui pengaruh pemberian hijauan dan konsentrat yang mengandung urea-kapur dan ubi kayu terhadap produktivitas kambing. Penelitian menggunakan Rancangan Acak Lengkap dengan 4 perlakuan dan 4 ulangan. Ke empat perlakuan yang dicobakan adalah Perlakuan A: ransum dengan 75% konsentrat (mengandung 4% urea, 2% kapur dan 50% ubikayu dan 25% hijauan (40% gamal dan 60% rumput raja, perlakuan B: rasnsum yang terdiri 60% konsentrat 40% hijauan, perlakuan C: ransum dengan 45% konsentrat dan 55% hijauan dan perlakuan D: ransum dengan 30% konsentrat dan 70% hijauan. Hasil penelitian mendapatkan bahwa produktivitas kambing yang mendapat ransum dengan level konsentrat 45% sampai 75% tidak berbeda sedangkan yang mendapat ransum dengan level konsentrat 30% lebih rendah. Ransum yang memebrikan nilai ekonomi tertinggi adalah ransum yang mengandung konsentrat antara 45% sampai 60%.

  3. 抗-SSA/Ro抗体三种检测方法的比较%Detection of anti-SSA/Ro antibody by ELISA, double immunodiffusion,and immunoblotting: a comparative study

    Institute of Scientific and Technical Information of China (English)

    佟胜全; 史群; 温晓宏; 甘晓丹; 史艳萍; 赵岩; 曾小峰; 张奉春; 董怡

    2006-01-01

    目的 比较酶联免疫吸附实验(ELISA)、免疫双扩散(ID)和免疫印迹(IB)3种方法检测抗-SSA/Ro抗体,评价3种方法的符合度,同时提高IB检测相对分子质量52 000条带的认识.方法 采用ELISA法、IB法及ID法检测以下3组对象的抗-SSA/Ro抗体水平:正常献血员血清122份;实验室常规检测血清7736份;诊断明确结缔组织病血清166份.结果 (1)正常献血员122份血清ELISA、ID和IB检测抗-SSA/Ro抗体全部阴性;(2)实验室常规检测的7736份血清,IB检测相对分子质量52 000阳性1085例,其中抗核抗体和其他抗-ENA抗体均阴性的有92份,该组病人经过ID和ELISA两种方法检测全部阴性;(3)结缔组织病组166例,ELISA、ID和IB检测抗-SSA/Ro抗体的阳性率分别是76.5%(127/166),65.1%(108/166),49.4%(82/166);(4)结缔组织病166份血清中,ELISA和ID两种方法检测的符合率88.6%(147/166),两种方法的比较,χ2=17.1,P<0.001;ID和IB两种方法检测的符合率为75.9%(126/166),两种方法的比较,χ2=15.6,P<0.001;(5)ELISA和ID进行Spearman等级相关分析,相关系数为0.828,P<0.001.结论 (1)ELISA和ID特异性优于IB.(2)IB特异性较差,但如果同时ANA和或抗-ENA其他条带阳性,特异性会显著提高.(3)ELISA敏感性优于ID,ID敏感性优于IB.(4)ELISA和ID结果在数值上存在显著的正相关关系.

  4. Corner Office: Google's Dan Clancy

    Science.gov (United States)

    Albanese, Andrew Richard; Oder, Norman

    2009-01-01

    This article presents an interview with Dan Clancy, engineering director for Google Book Search. In this interview, Clancy talks about the pending Google Book Search settlement, involving millions of volumes digitized from libraries, which drew a lawsuit from the Association of American Publishers and the Authors Guild. He also discusses pricing,…

  5. Lõuka tuuliku restaureerimine / Dan Lukas

    Index Scriptorium Estoniae

    Lukas, Dan

    2005-01-01

    Hiiumaal Pühalepa vallas Vahtrepa külas Lõuka talu maadel asuva pukktuuliku ajaloost, restaureerimise käigust. Teostus: Dan Lukas. Muinsuskaitseline järelevalve: Tõnu Sepp, tema kommentaar. Ill.:pukktuuliku lõiked ja korruste plaanid, 7 värv. fotot

  6. Gangguan Fungsi Penghidu dan Pemeriksaannya

    Directory of Open Access Journals (Sweden)

    Effy Huriyati

    2014-01-01

    Full Text Available AbstrakLatar belakang: Fungsi penghidu pada manusia memegang peranan penting. Gangguan penghidu dapat mempengaruhi keselamatan dan kualitas hidup seseorang. Tujuan: Untuk mengetahui jenis gangguan penghidu, penyebab gangguan penghidu, dan pemeriksaannya. Tinjauan Pustaka: Gangguan penghidu dapat berupa anosmia yaitu hilangnya kemampuan penghidu, atau hiposmia yaitu berkurangnya kemampuan penghidu. Gangguan penghidu disebabkan gangguan konduksi, gangguan sensoria dan gangguan neural. Penyakit tersering penyebab gangguan penghidu yaitu rinosinusitis kronis, rinitis alergi, infeksi saluran nafas atas dan trauma kepala. Ada beberapa modalitas pemeriksaan kemosensoris fungsi penghidu diantaranya Tes “Sniffin sticks”. Dengan tes „Sniffin sticks” dapat diketahui ambang penghidu, diskriminasi penghidu dan identifikasi penghidu seseorang. Kesimpulan: Gangguan penghidu memerlukan perhatian khusus. Diantara beberapa modalitas pemeriksaan kemosensoris penghidu, tes “Sniffin sticks” mempunyai beberapa kelebihan.Kata kunci: Gangguan penghidu, anosmia, hiposmia, tes “Sniffin sticks”.AbstractBackground: Olfactory function in humans plays an important role. Olfactory disorders can affect the safety and quality of life. Objective: To determine the type of olfactory disorder, the causes of olfactory disorders, and the examination. Literature Review: Olfactory disorder can be not smell anything or anosmia, and reduced of smell or hyposmia. Olfactory disorders caused by conduction disturbances, neural disturbances and sensoris disturbances. Disease that often causes disturbances of olfactory function is, chronic rhinosinusitis, allergic rhinitis, upper respiratory tract infections and head trauma. There are several modalities to examine chemosensoris smelling function, one of them is “Sniffin sticks” test. This test can examine threshold, discrimination, and identification of smelling. Conclusions: Impaired smelling require special attention

  7. PENINGKATKAN MOTIVASI DAN HASIL BELAJAR BAHASA INDONESIA MENGGUNAKAN MODEL PEMBELAJARAN KREATIF DAN PRODUKTIF

    Directory of Open Access Journals (Sweden)

    Rini Ntowe Oya

    2014-01-01

    Full Text Available Penelitian ini bertujuan sebagai berikut: (1 mengetahui pelaksanaan model pembelajaran kreatif dan produktif dalam upaya peningkatan motivasi dan hasil belajar siswa kelas V SDN Bhayangkara pada mata pelajaran Bahasa Indonesia dan (2 mengetahui peningkatan hasil belajar siswa kelas V SDN Bhayangkara pada mata pelajaran Bahasa Indonesia setelah menggunakan model pembelajaran kreatif dan produktif. Penelitian ini merupakan Penelitian Tindakan Kelas yang  dilaksanakan dalam dua siklus. Hasil penelitian menunjukkan bahwa (1 pembelajaran bahasa Indonesia dengan menggunakan model pembelajaran kreatif dan produktif kelas V di SDN Bhayangkara untuk peningkatan motivasi dan hasil belajar siswa telah terlaksana dan dilakukan dengan tahapan yaitu: (1 tahap orientasi, (2 tahap eksplorasi, (3 tahap interpretasi, (4 tahap rekreasi, dan (5 tahap evaluasi. Hasil lembar observasi menunjukkan bahwa motivasi dan hasil belajar bahasa Indonesia di akhir Siklus II telah mencapai kategori sangat baik yaitu hasil observasi motivasi dan hasil belajar siswa 100%. (2 Peningkatan hasil belajar siswa dapat dilihat dari hasil belajar pada siklus 1 sebanyak 27 siswa atau 87,09% telah memenuhi KKM dan 4 siswa atau 12,91% belum memenuhi KKM. Setelah dilakukan perbaikan hasil belajar siswa pada siklus 2, jumlah siswa yang memenuhi KKM sebanyak 31 siswa atau 100%. Kata kunci: model pembelajaran kreatif dan produktif, motivasi, dan hasil belajar.

  8. KINERJA DAN EFISIENSI BANK PEMERINTAH (BUMN DAN BUSN YANG GO PUBLIK DI INDONESIA

    Directory of Open Access Journals (Sweden)

    Sugeng Haryanto

    2012-06-01

    Full Text Available Penelitian ini menganalisis kinerja dan tingkat efisiensi bank-bank BUMN dan BUSN yang go Publik di Bursa Efek Indonesia.  Sample penelitian ini mengambil  tiga bank BUMN Bank BNI 46, Bank Mandiri dan Bank BRI  dan tiga bank BUSN (Bank BCA, Bank Niaga dan Bank Panin dengan periode analisis tahun 2005-2011. Varibael yang digunakan meliputi ROA, ROE, LAR. LDR, NPL dan BOPO. Tujuan dari penelitian ini adalah melihat dan menganalisis perbedaan kinerja antara Bank BUMN dan BUSN yang go public di Bursa Efek Indonesia tahun 2005-2011.  Pendekatan pengukuran kinerja yang digunakan adalah Return on Asset (ROA, Return on Equity (ROE dan Loan to Deposit Ratio (LDR, Loan to Asset Ratio (LAR,  dan efisiensi bank. Hasil dari penelitian menunjukkan bahwa 1 Bank-bank nasional, baik itu bank BUMN maupun BUSN menunjukkan kinerja yang semakin baik, 2 tidak terdapat perbedaan yang signifikan antara kinerja bank BUMN dan BUSN untuk variabel ROA, ROE, LAR, LDR, dan BOPO sedangkan variabel NPL yang merupakan indikator risiko kredit menunjukkan adanya perbedaan yang signifikan antara Bank BUMN dan BUSN

  9. Production characteristics of lettuce Lactuca sativa L. in the frame of the first crop tests in the Higher Plant Chamber integrated into the MELiSSA Pilot Plant

    Science.gov (United States)

    Tikhomirova, Natalia; Lawson, Jamie; Stasiak, Michael; Dixon, Mike; Paille, Christel; Peiro, Enrique; Fossen, Arnaud; Godia, Francesc

    Micro-Ecological Life Support System Alternative (MELiSSA) is an artificial closed ecosystem that is considered a tool for the development of a bioregenerative life support system for manned space missions. One of the five compartments of MELiSSA loop -Higher Plant Chamber was recently integrated into the MELiSSA Pilot Plant facility at Universitat Aut`noma deo Barcelona. The main contributions expected by integration of this photosynthetic compartment are oxygen, water, vegetable food production and CO2 consumption. Production characteristics of Lactuca sativa L., as a MELiSSA candidate crop, were investigated in this work in the first crop experiments in the MELiSSA Pilot Plant facility. The plants were grown in batch culture and totaled 100 plants with a growing area 5 m long and 1 m wide in a sealed controlled environment. Several replicates of the experiments were carried out with varying duration. It was shown that after 46 days of lettuce cultivation dry edible biomass averaged 27, 2 g per plant. However accumulation of oxygen in the chamber, which required purging of the chamber, and decrease in the food value of the plants was observed. Reducing the duration of the tests allowed uninterrupted test without opening the system and also allowed estimation of the crop's carbon balance. Results of productivity, tissue composition, nutrient uptake and canopy photosynthesis of lettuce regardless of test duration are discussed in the paper.

  10. Integration of a Higher Plant Chamber into the European Space Agency's MELiSSA Pilot Plant: The Canadian Role in Advanced Life Support Test-Bed Development

    Science.gov (United States)

    Waters, Geoffrey; Lawson, Jamie; Gidzinski, Danuta; Stasiak, Michael; Dixon, Mike; Peiro, Enrique; Godia, Francesc; Paille, Christel; Fossen, Arnaud; Lamaze, Brigitte; Lasseur, Christophe

    The European Space Agency's Micro-Ecological Life Support System Alternative (MELiSSA) project has been conceived as a tool for developing the technology of future biological life support systems required for long-term human space exploration missions to the Moon or Mars. The main life support functions of MELiSSA are the recycling of waste (inedible plant biomass, human excrement), carbon dioxide and minerals and the production of food, fresh water and air revitalization. Based on the principle of an aquatic ecosystem, MELiSSA is comprised of four microbial compartments and a higher plant compartment integrated in a closed loop. Each compartment is studied, designed and demonstrated at laboratory scale before being scaled-up for subsequent integration into the MELISSA Pilot Plant (MPP) at the Universitat Aut`noma de Barcelona. Work related to higher plant cultivation systems, o which have been historically focussed at the University of Guelph's Controlled Environment Systems Research Facility (CESRF), has included design of the HPC for the MPP, the metabolic characterization of MELiSSA candidate crops and the validation of theoretical gas exchange and nutrient dynamic models, The presented paper will review some of the recent data and HPC design work of CESRF conducted as part of Canada's involvement in the MELiSSA program and its partnership in the development of the MPP terrestrial demonstration test-bed.

  11. Pengaruh Citra Merek dan Reputasi Perusahaan Terhadap Keputusan Pembelian Smartphone Samsung pada Mahasiswa Fakultas Ekonomi dan Bisnis Universitas Sumatera Utara

    OpenAIRE

    Tarigan, Roy Marthin

    2015-01-01

    Penelitian ini bertujuan untuk mengetahui dan menganalisis seberapa besar pengaruh citra merek dan reputasi perusahaan terhadap pengambilan keputusan pembelian smartphone Samsung pada mahasiswa Fakultas Ekonomi dan Bisnis Universitas Sumatera Utara. Penelitian ini dilaksanakan di Fakultas Ekonomi dan Bisnis Universitas Sumatera Utara. Metode penelitian yang digunakan yakni dengan metode observasi, kuesioner dan studi kepustakaan yang dilakukan secara sistematik berdasarkan tujuan penelit...

  12. Construcción de mutantes de Salmonella enterica por inactivación de los genes invG/invE y ssaJ/ssaK de las islas de patogenicidad 1 y 2

    Directory of Open Access Journals (Sweden)

    Judith Velasco

    2010-10-01

    To understand the genetic basis of Salmonella pathogenicity mechanisms, various methods have been described to manipulate and generate mutant genomic DNA with specific characteristics. In this study we report the construction of mutants from several serotypes of S. enterica, substitution and inactivation of genes invG/invE in SPI-1 gene and ssaJ/ssaK in SPI-2 by the technique of phage λ Red recombinase, as described by Datsenko and Wanner (2000. The gene deletion in SPI-1 and SPI-2 encodes proteins involved in the formation of type III secretion systems responsible for the invasion and intracellular survival of S. enterica in the host cells. The results of this work will allow in vivo studies to evaluate the possible attenuation of virulence of the mutant strains, as well as to provide new insights into the genetic mechanisms involved in the pathogenesis of diseases caused by these bacteria. Moreover, this technique is recommended to efficiently generate mutants of different serotypes of S. enterica in order to study the chromosomal genes and their products. Key words: red recombinasa, mutation, pathogenicity islands, Salmonella enterica.

  13. INDUSTRIALISASI DAN TANTANGANNYA PADA SEKTOR PENDIDIKAN

    Directory of Open Access Journals (Sweden)

    Arif Unwanullah

    2015-10-01

    Full Text Available Abstrak: Industrialisasi dan Tantangannya pada Sektor Pendidikan. Sumbangan pendidikan dalam perubahan dan pembangunan masa lalu telah bergeser dengan kemajuan teknoekonomi dan komunikasi. Perubahan yang terjadi telah menggeser tatanan kehidupan dan pandangan masyarakat. Materialisme, kapitalisme, efisiensi, dan efektivitas telah menjadi tujuan dan semangat hidup. Pergeseran pandangan masyarakat telah mengubah pula pandangan keberhasilan dan mutu pendidikan, di mana pendidikan diukur dari keberhasilan dalam keterserapan lulusan dalam dunia kerja, oleh karenanya pendidikan dianalisis dari karakteristik sebagai investasi (capital-investment. Pergeseran makna dan tanggung jawab pendidikan mendorong dunia pendidikan melakukan pembaruan dengan alternatif: membangun pembaruan penalaran warganya menuju pemerdekaan dan pendewasaan, pendidikan dilaksanakan secara komprehensif dan bekerjasama dengan semua pihak secara kemitraan, dan membangun visi pendidikan secara komprehensif dan simultan dengan semua pihak. Kata kunci: perubahan sosial, materialistik, modernisasi dan kapitalis Abstract: Industrialization and its education Sector challenges. Contribution of education has shifted with the progress of technology, economy, and communication. The changes have shifted the society's views. Materialism, capitalism, efficiency, and effectiveness have become of interest and enthusiasm for life. The shift has changed society's view, i.e. the view of success and quality of education, in which education is measured from a rate of the absorption of graduates into labor market, therefore education is analyzed from the characteristics of an investment (capital-investment. A shift in meaning and responsibility of education encourages the education sector to create reformation through these following alternatives: creating new thoughts towards liberation and maturation, implementing education comprehensively and cooperating with all parties in partnership, and creating

  14. TRANSFORMASI ORGANISASIONAL DAN MSDM: HAMBATAN DAN IMPLIKASINYA PADA REKRUTMEN DAN SELEKSI

    Directory of Open Access Journals (Sweden)

    Licen Indahwati Darsono

    2002-01-01

    Full Text Available Rapid change of environment is an external force that causes the organization to transform. Fundamentally, the main purpose of the transformation is to change the organizational structure to be more flexible and competitive with fewer hierarchial levels, managers, and employees. The transformation needs to be radical, causing resistance from the organization's members. Their resistance can cause the transformation to fail, therefore organization must find ways to lessen this resistance. First, organization must learn about the diversity of its members' cultures and values. Second, organization must build its own organizational culture which can support the success of the transformation, by communicating it with the members of the organization. To support organizational culture building efforts, it needs changes in human resources practices, especially recruitment and selection. Abstract in Bahasa Indonesia : Perubahan yang cepat dalam lingkungan merupakan kekuatan eksternal yang mengakibatkan transformasi dalam sebuah organisasi. Pada dasarnya, tujuan utama dari transformasi tersebut adalah merubah struktur organisasi agar menjadi lebih fleksibel dan mampu bersaing, dengan tingkat structural yang sedikit, serta jumlah manajer dan karyawan yang lebih kecil. Transformasi tersebut harus menyeluruh, dan hal ini dapat menyebabkan resistensi dari para anggota organisasi yang memperhambat perubahan tersebut. Resistensi itu bisa menyebabkan perubahan tersebut batal, oleh karena itu organisasi harus mencari jalan untuk mengurangi hambatan-hambatan tersebut. Pertama, organisasi harus belajar keanekaragaman dari budaya dan nilai anggotanya. Kedua, organisasi harus mengembangkan budaya organisasi sendiri melalui komunikasi yang baik dengan anggotanya. Untuk mendukung usaha mengembangkan budaya organisasi, harus ada perubaban pada kebijakan sumber daya manusia, terutama dalam rekrutmen dan seleksi karyawan. Kata kunci: transformasi, resistensi, budaya

  15. Atomic secrecy

    International Nuclear Information System (INIS)

    An article, The H-Bomb Secret: How We Got It, Why We're Telling It, by Howard Morland was to be published in The Progressive magazine in February, 1979. The government, after learning of the author's and the editors' intention to publish the article and failing to persuade them to voluntarily delete about 20% of the text and all of the diagrams showing how an H-bomb works, requested a court injunction against publication. Acting under the Atomic Energy Act of 1954, US District Court Judge Robert W. Warren granted the government's request on March 26. Events dealing with the case are discussed in this publication. Section 1, Progressive Hydrogen Bomb Case, is discussed under the following: Court Order Blocking Magazine Report; Origins of the Howard Morland Article; Author's Motives, Defense of Publication; and Government Arguments Against Disclosure. Section 2, Access to Atomic Data Since 1939, contains information on need for secrecy during World War II; 1946 Atomic Energy Act and its effects; Soviet A-Bomb and the US H-Bomb; and consequences of 1954 Atomic Energy Act. Section 3, Disputed Need for Atomic Secrecy, contains papers entitled: Lack of Studies on H-Bomb Proliferation; Administration's Position on H-Bombs; and National Security Needs vs Free Press

  16. Les immigrants dans les regions metropolitaines de recensement au Canada

    OpenAIRE

    Schellenberg, Grant

    2004-01-01

    Dans ce rapport, on examine les facteurs des immigrants dans les regions metropolitaines de recensement (RMR) au Canada, les repercussions sur les services publics offerts dans les regions urbaines et les caracteristiques de l'emploi des immigrants.

  17. KESESUAIAN BERAT BADAN DAN TINGGI BADAN TERHADAP ESTIMASI BERAT BADAN DAN TINGGI BADAN PADA ETNIS MANDAR

    OpenAIRE

    Nurfadilla; Citrakesumasari; Syam, Aminuddin

    2015-01-01

    Data berat badan dan tinggi badan sangat diperlukan dalam penilaian status gizi dan penentuan kebutuhan zat gizi pasien. Penelitian ini bertujuan mengetahui kesesuaian (koefisien korelasi) antara BBA dengan estimasi BB berdasarkan LiLA dan TBA dengan estimasi TB berdasarkan tinggi lutut, dan rentang lengan pada usia dewasa etnis mandar. Jenis penelitian adalah penelitian deskriptif numerik dengan desain cross sectional. Teknik sampling menggunakan systematic random sampling, sebanyak 111 oran...

  18. Bruxims Dan Pengaruhnya Pada Wajah Dan Mulut Anak

    OpenAIRE

    Ringan Mariana Sitepu

    2008-01-01

    Bruxism merupakan salah satu kebiasaan buruk yang dilakukan anak. Kebiasaan ini biasanya dilakukan selama tidur tanpa disadari oleh anak. Suara bising yang ditimbulkan oleh kekuatan grinding biasanya didengar oleh orang tua atau orang yang menemani anak tidur. Awalnya bruxism tidak memberi pengaruh terhadap gigi tetapi selalu menimbulkan sakit kepala dan kelelahan otot pada miofasial ketika bangun tidur pada pagi hari, Rasa sakit pada kepala inilah yang sering dikeluhkan oleh anak pender...

  19. An enhanced merger fraction within the galaxy population of the SSA22 protocluster at z ~ 3.1

    CERN Document Server

    Hine, N K; Alexander, D M; Lehmer, B D; Chapman, S C; Matsuda, Y

    2015-01-01

    The over-dense environments of protoclusters of galaxies in the early Universe z>2 are expected to accelerate the evolution of galaxies, with an increased rate of stellar mass assembly and black hole accretion compared to co-eval galaxies in the average density `field'. These galaxies are destined to form the passive population of massive systems that dominate the cores of rich clusters today. While signatures of accelerated growth of galaxies in the SSA22 protocluster z=3.1 have been observed, the mechanism driving this remain unclear. In this work we show an enhanced rate of galaxy-galaxy mergers could be responsible. We morphologically classify Lyman-break Galaxies (LBGs) in the SSA22 protocluster and compare these to those of galaxies in a typical density field at z=3.1 as either active mergers or non-merging using Hubble Space Telescope F814W imaging, probing the rest frame ultraviolet stellar emission. We measure a merger fraction of 48+/-10% for LBGs in the protocluster compared to 30+/-6% for the fiel...

  20. BOREAS HYP-8 DEM Data Over The NSA-MSA and SSA-MSA in The AEAC Projection

    Science.gov (United States)

    Knapp, David E.; Hall, Forrest G. (Editor); Wang, Xue-Wen; Band, L. E.; Smith, David E. (Technical Monitor)

    2000-01-01

    These data were derived from the original Digital Elevation Models (DEMs) produced by the Boreal Ecosystem-Atmosphere Study (BOREAS) Hydrology (HYD)-8 team. The original DEMs were in the Universal Transverse Mercator (UTM) projection, while this product is projected in the Albers Equal-Area Conic (AEAC) projection. The pixel size of the data is 100 meters, which is appropriate for the 1:50,000-scale contours from which the DEMs were made. The original data were compiled from information available in the 1970s and 1980s. This data set covers the two Modeling Sub-Areas (MSAs) that are contained within the Southern Study Area (SSA) and the Northern Study Area (NSA). The data are stored in binary, image format files. The DEM data over the NSA-MSA and SSA-MSA in the AEAC projection are available from the Earth Observing System Data and Information System (EOSDIS) Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC). The data files are available on a CD-ROM (see document number 20010000884).

  1. PERBEDAAN KUALITAS TIDUR DAN KUALITAS MIMPI ANTARA MAHASISWA LAKI-LAKI DAN MAHASISWA PEREMPUAN

    Directory of Open Access Journals (Sweden)

    Fuad Nashori, R. Rachmy Diana R. Rachmy Diana

    2012-11-01

    Full Text Available AbstrakPenelitian ini bertujuan untuk mengetahui perbedaan kualitas tidur dan kualitas mimpiantara mahasiswa pria dan mahasiswa wanita. Hipotesis yang diajukan adalah (a adaperbedaan kualitas tidur antara mahasiswa laki-laki dan mahasiswa perempuan,mahasiswawanita memiliki kualitas tidur yang lebih tinggi dibanding mahasiswa laki-laki, dan (b adaperbedaan kualitas mimpi antara mahasiswa laki-laki dan mahasiswa perempuan, mahasiswawanita memiliki kualitas mimpi yang lebih tinggi dibanding mahasiswa laki-laki.Alat ukur yang digunakan dalam penelitian ini adalah Skala Kualitas Tidur danSkala Kualitas Mimpi. Alat ukur Skala Kualitas Tidur dan Skala Kualitas Mimpidirumuskan berdasarkan teori kualitas tidur yang disusun oleh penulis. Subjek penelitian iniadalah 319 mahasiswa Universitas Islam Indonesia Yogyakarta, yang berasal dari delapanfakultas (psikologi, kedokteran, matematika dan ilmu pengetahuan, teknologi industri, teksniksipil dan perencanaan, ilmu agama islam, hukum, dan ekonomi.Hasil penelitian menunjukkan (a ada perbedaan kualitas tidur antara mahasiswa priadan wanita; mahasiswa wanita memiliki kualitas tidur yang lebih tinggi dibanding mahasiswalaki-laki, dan (b tidak ada perbedaan kualitas mimpi antara mahasiswa pria dan wanita.Kata kunci:    kualitas tidur, kualitas mimpi, jenis kelamin

  2. Atomic theories

    CERN Document Server

    Loring, FH

    2014-01-01

    Summarising the most novel facts and theories which were coming into prominence at the time, particularly those which had not yet been incorporated into standard textbooks, this important work was first published in 1921. The subjects treated cover a wide range of research that was being conducted into the atom, and include Quantum Theory, the Bohr Theory, the Sommerfield extension of Bohr's work, the Octet Theory and Isotopes, as well as Ionisation Potentials and Solar Phenomena. Because much of the material of Atomic Theories lies on the boundary between experimentally verified fact and spec

  3. ANALISIS PERBEDAAN CITRA MRI BRAIN PADA SEKUENT1SE DAN T1FLAIR

    Directory of Open Access Journals (Sweden)

    Nursama Heru Apriantoro

    2015-10-01

    Full Text Available MRI adalah bagian dari ilmu kedokteran untuk mediagnosa kelainan organ dengan memanfaatkan medan magnet dan pergerakan proton atom hidrogen. Salah satu pemeriksaan MRI adalah pemeriksaan brain. Pemeriksaan MRI brain dapat dilakukan T1 weighted image Spin Echo (T1 SE atau T1 Fluid Attenuated Inversion Recovery (T1 FLAIR. Kajian dilakukan untuk menentukan perbedaan T1 SE dan T1 FLAIR dari segi citra berdasarkan nilai Rasio Signal terhadap Noise (SNR dengan MRI GE Type Signa HD xt 1.5 Tesla. Penelitian menggunakan pendekatan kuantitatif.  20 pasien  telah diambil pada pemeriksaan MRI brain pada potongan axial, dengan parameter T1 SE potongan axial dengan parameter Time Repetition (TR 700 ms, Time Echo (TE 20 ms, Field of View (FOV 240 mm, Slice Thickness 5,0 mm, Spacing 1,0 mm, Number of Excitations (NEX 1, Phase 224, dan total slice 20. T1 FLAIR  parameter TR 3000 ms, TE 13,9 ms, TI 920 ms, FOV 240 mm, slice thickness 5,0 mm, spacing 1,0 mm,   NEX 1, phase 224, dan total slice 20. SNR dihitung pada anatomi brain meliputi CSF (Cerebro Spinal Fluid, White Matter dan Gray Matter. Hasil penelitian kedua sequence tersebut menunjukkan bahwa sequence T1 SE lebih baik daripada sequence T1 FLAIR.

  4. Expression and secretion of Salmonella pathogenicity island-2 virulence genes in response to acidification exhibit differential requirements of a functional type III secretion apparatus and SsaL.

    Science.gov (United States)

    Coombes, Brian K; Brown, Nat F; Valdez, Yanet; Brumell, John H; Finlay, B Brett

    2004-11-26

    Salmonella pathogenicity island (SPI)-2 is pivotal to the intracellular survival of Salmonella and for virulence in mammals. SPI-2 encodes virulence factors (called effectors) that are translocated into the host cell, a type III secretion apparatus and a two-component regulatory system that regulates intracellular expression of SPI-2. Salmonella SPI-2 secretion activity appears to be induced in response to acidification of the vacuole in which it replicates. Here we show that the expression of the SPI-2 proteins, SseB and SseD (filament and pore forming components of the secretion apparatus, respectively) in response to acidification requires an intact secretion system and SsaL, a Salmonella homologue of SepL, a regulator required for type III-dependent secretion of translocators but not effectors in attaching and effacing gastrointestinal pathogens. We show that the expression of SPI-2-encoded effectors is acid-regulated but can be uncoupled from the expression of filament and translocon components, thus showing a differential requirement of SsaL for expression. The secretion and translocation of SPI-2-encoded effectors requires SsaL, but SsaL is dispensable for the secretion of SPI-2 effectors encoded in other pathogenicity loci, suggesting a secretion regulation function for SsaL. Further, we demonstrate that the differential expression of adjacent genes within the sseA operon (sseD and sseE) occurs at the transcriptional level. These data indicate that a Salmonella SPI-2 activation state is achieved by an acidregulated response that requires SsaL. These data also suggest the existence of a previously unrecognized regulatory element within SPI-2 for the "effector operon" region downstream of sseD that might demarcate the expression of translocators and effectors.

  5. RETRACTED: Blockade of TNF-α signaling suppresses the AREG-mediated IL-6 and IL-8 cytokines secretion induced by anti-Ro/SSA autoantibodies.

    Science.gov (United States)

    Sisto, Margherita; Lisi, Sabrina; Lofrumento, Dario Domenico; Cucci, Liana; Mitolo, Vincenzo; D'Amore, Massimo

    2010-09-20

    The aim of this study was to analyze the Furin-TNF-α-converting enzyme (TACE)-amphiregulin (AREG)-IL-6/IL-8 secretion pathway in non-neoplastic human salivary gland epithelial cells (SGECs) stimulated with anti-Ro/SSA autoantibodies (Abs). We examined whether anti-Ro/SSA Abs-mediated TACE activation is responsible for AREG activation. As recent studies have demonstrated that AREG could induce proinflammatory cytokines secretion in epithelial cells, we discuss how TACE-mediated AREG shedding, caused by anti-Ro/SSA Abs treatment, could have a critical role in TNF-α-induced IL-6 and IL-8 secretion by SGEC. Furthermore, the effects of TNF-α blockade on AREG expression and TNF-α-AREG-mediated IL-6 and IL-8 secretion were evaluated. We have discovered that the upregulation of AREG occurs through TNF-α produced after anti-Ro/SSA Abs uptake via Fcγ receptors. Biological drug adalimumab and the gene silencing technique were used to study the AREG-IL-6/IL-8 secretion pathway, demonstrating that (i) adalimumab-mediated TNF-α blocking and TNF-α gene silencing provoke a significant decrease of proinflammatory cytokines production and AREG expression in anti-Ro/SSA Abs-treated SGEC; (ii) AREG gene silencing has a potent inhibitory effect on TNF-α-induced IL-6 and IL-8 secretion in SGEC treated with anti-Ro/SSA Abs; (iii) an inspection of the kinetics of cytokine production after exogeni TNF-α and AREG addition, and the use of cycloheximide in the presence of exogenous TNF-α as stimulant, clarified that TNF-α induces IL-6 and IL-8 secretion through AREG.Laboratory Investigation advance online publication, 20 September 2010; doi:10.1038/labinvest.2010.168.

  6. Dayak Punan: Eksploitasi Gaharu dan Ancaman Subsistensi

    OpenAIRE

    Marahalim Siagian

    2009-01-01

    Studi lapangan ini melihat subsistensi masyarakat Dayak Punan di interior hutan Kalimantan Timur (Kaltim) yang terisolasi, di mana gaharu (Aquilaria becacariana) merupakan hasil hutan utama yang diperdagangkan dan merupakan produk yang terintegrasi dengan pasar internasional. Tingginya harga dan permintaan pasar menyebabkan gaharu terus dieksploitasi. Akibat eksploitasi gaharu yang terus-menerus, gaharu menjadi sangat langka dan pencaharian Punan mulai terancam. ker-jul2006- (1)

  7. Des paysans dans la jungle

    OpenAIRE

    Krauskopff, Gisèle

    2003-01-01

    Cet article décrit les techniques de piégeage au filet utilisées par les Tharu. paysans qui vivent dans la forêt paludéenne du Terai. La chasse, comme la pêche, se pratique sans effusion de sang. Lorsqu'ils s'adressent aux esprits de la malemort, responsables de la plupart des maladies, les prêtres utilisent des techniques rituelles différentes selon la « catégorie du paysage » à laquelle les esprits sont associés, site habité ou forêt. « Dans la forêt », le prêtre, installé sur ses ma...

  8. Violence dans l’appareil

    OpenAIRE

    Bégin, Richard

    2008-01-01

    Dans une communauté médiatique comme la nôtre, de plus en plus fondée sur l’accessibilité de l’information (Youtube), l’économie des télé-réalités (Loft Story) et les diverses marques d’authenticité (Facebook), l’image s’échange et se monnaie davantage qu’elle ne se manifeste et ne se révèle à l’esprit. En d’autres termes, l’image dans l’hypermodernité occidentale perd constamment de sa force évocatrice au “profit” des seuls pouvoirs de la représentation et de la communication. L’image ainsi ...

  9. Ultraviolet radiation (UVR) induces cell-surface Ro/SSA antigen expression by human keratinocytes in vitro: a possible mechanism for the UVR induction of cutaneous lupus lesions

    Energy Technology Data Exchange (ETDEWEB)

    Jones, S.K. (Bristol Royal Infirmary (United Kingdom))

    1992-06-01

    Antinuclear antibodies are useful markers of connective tissue disease. In this study, UVB but not UVA induced the expression of Ro/SSA antigen on keratinocyte surfaces in vitro. This expression was also found with the extractable nuclear antigens RnP and Sm, but not with single or double-stranded DNA. The expression was prevented by blocking protein synthesis, suggesting that it was an active process. The results suggest that UVB exposure may result in the expression of Ro/SSA antigen on the surfaces of basal keratinocytes in vivo. This antigen could then bind circulating antibody leading to the cutaneous lesions in neonatal and subacute cutaneous lupus erythematosus. (Author).

  10. KOMPLIKASI, PENCEGAHAN DAN PENANGANAN EKSTRAVASASI AGEN KEMOTERAPI

    Directory of Open Access Journals (Sweden)

    I G A Mirah K

    2012-12-01

    Full Text Available Ekstravasasi agen kemoterapi ke jaringan sekitarnya merupakan kecelakaan yangdapat menyebabkan kerusakan jaringan progresif ireversibel dalam hitungan jamsampai hari. Manifestasi klinis ekstravasasi berupa nyeri, edema, eritema, danindurasi yang kemudian berkembang menjadi ulkus dan eschar hitam dankerusakan jaringan yang mendasarinya. Pencegahan terjadinya ekstravasasi dapatdilakukan dengan menggunakan pembuluh darah yang paten dan dengan aliranyang cepat dan tetap memperhatikan keluhan yang disampaikan pasien. Setiaptenaga kesehatan yang akan menangani pasien kanker dengan kemoterapi, dituntutmemiliki pengetahuan mengenai ekstravasasi agen kemoterapi yang bergunadalam meningkatkan pelayanan pada pasien dan mengurangi morbiditas.

  11. EFEK PENAMBAHAN KAFEIN, HEPARIN DAN CALSIUM IONOPHORE TERHADAP PENINGKATAN KUALITAS SEMEN KAMBING BOER HASIL PEMISAHAN KROMOSOM X DAN Y

    OpenAIRE

    Sutomo Syawal, S.Pt.

    2005-01-01

    Tujuan penelitian ini yaitu untuk membandingkan kualitas semen kabing Boer hasil pemisahan kromosom X dan Y dengan penambahan kafein, heparin dan calsium ionophore. Rancangan yang digunakan adalah Rancangan Acak Lengkap (RAL) pola faktorial 2 x 3 x 6 dengan 3 kali ulangan. Faktor pertama adalah medium pemisah (10% dan 30%), faktor kedua penambahan kafein (0,1,2 dan 4 mM/L), heparin (0,1,2 dan 4 IU/mL) dan calsium ionophore (0,0,1,0,2 dan 0,4 mm/L ) dan faktor ketiga adalah lama penyimpanan (1...

  12. Dramaturgies de l'humour dans le théâtre francophone contemporain : détachement et connivence face aux malaises dans l'identification chez Grumberg, Benaïssa et Pourveur

    OpenAIRE

    Castadot, Elisabeth

    2013-01-01

    This dissertation focuses on the role played by humor in the writing of three contemporary Francophone playwrights that investigate the process of identification: Jean-Claude Grumberg, a French and Jewish author, Slimane Benaissa, an Algerian bilingual playwright, and Paul Pourveur, a Belgian playwright who writes both in Dutch and French. Their works have each one a unique aesthetic, thematic and style, but these authors have in common a position of in-between, sharing different cultural aff...

  13. Atomic arias

    Science.gov (United States)

    Crease, Robert P.

    2009-01-01

    The American composer John Adams uses opera to dramatize controversial current events. His 1987 work Nixon in China was about the landmark meeting in 1972 between US President Richard Nixon and Chairman Mao Zedong of China; The Death of Klinghoffer (1991) was a musical re-enactment of an incident in 1985 when Palestinian terrorists kidnapped and murdered a wheelchair-bound Jewish tourist on a cruise ship. Adams's latest opera, Doctor Atomic, is also tied to a controversial event: the first atomic-bomb test in Alamogordo, New Mexico, on 16 June 1945. The opera premièred in San Francisco in 2005, had a highly publicized debut at the Metropolitan Opera in New York in 2008, and will have another debut on 25 February - with essentially the same cast - at the English National Opera in London.

  14. ANALISIS TINGKAT KEPUASAN DAN HARAPAN PASEN TERHADAP PELAYANAN PUSKESMAS DAN RUMAH SAKIT DAERAH PROVINSI DIY

    Directory of Open Access Journals (Sweden)

    Sunarto Sunarto

    2010-10-01

    Full Text Available Kepuasan merupakan perasaan seseorang mengenai kesenangan atau kekecewaan sebagai hasil membandingkan antara kinerja dan harapan. Jumlah kunjungan Puskesmas tahun 2007 sebesar 3.094.027 pasien yang terdiri dari 3.076442 rawat jalan dan 17.585 rawat inap. Penelitian untuk mengentahui gambaran tingkat kepuasan dan untuk mengetahui perbedaan tingkat kepuasan dan harapan pasien yang mendapatkan pelayanan Puskemas dan rumah sakit menurut wilayah Kabupatet / Kota di Propinsi DIY Penelitian ini merupakan penelitian deskriptif analitik dengan menggunakan rancangan cros sectional. Instrumen penelitian yang digunakan adalah kuisioner dengan 35 item pernyataan yang diambil dari atribut-atribut SERVQUAL dalam 5 dimensi. Total sampel untuk lima Kabupaten Kota sebanyak 1000, masing-masing Kabupaten Kota 200. Penelitian ini dilakukan terhadap pasien yang menerima pelayanan kesehatan di Puskesmas dan Rumah Sakit Daerah di Kabupaten-Kota Daerah Istimewa Yogyakarta. Penilaian tingkat kepuasan pasien ketika mereka berobat ke Puskesmas dan Rumah Sakit di Propinsi DIY, dengan menggunakan skala O sampai 4. Hasilnya adalah dimensi tangibles, rata-rata kepuasan pasien (2,96 cukup dan harapan pasien (3,38 pada dimensi reliability, rata-rata kepuasan pasien (3,01 bagus dan harapan pasien (3,40. Pada dimensi responsiveness, rata-rata kepuasan pa-sien (3,07 bagus dan harapan pasien (3,42. Dimensi assurance, rata-rata kepuasan pasien (3, 1 0 bagus dan harapan pasien (3 ,42. pada dimensi emphaty, rata-rata kepuasan pasien (3,02 bagus dan harapan pasien (3,35. Hasil uji statistik didapatkan nilai p > 0.05, berarti pada alpha 5%, dapat disimpulkan bahwa tidak terdapat perbedaan tingkat kepuasan diantara kelima wilayah kabupaten/kota di DIY. Penilaian tingkat kepuasan pasien, ketika mereka berkunjung ke Puskesmas dan Rumah Sakit di DIY secara rata-rata bagus dan tidak ada perbedaan tingkat kepuasan menurut wilayah Kabupaten-Kota di Propinsi DIY. Kata Kunci : Kepuasan, harapan

  15. Atomic physics

    Energy Technology Data Exchange (ETDEWEB)

    Livingston, A.E.; Kukla, K.; Cheng, S. [Univ. of Toledo, OH (United States)] [and others

    1995-08-01

    In a collaboration with the Atomic Physics group at Argonne and the University of Toledo, the Atomic Physics group at the University of Notre Dame is measuring the fine structure transition energies in highly-charged lithium-like and helium-like ions using beam-foil spectroscopy. Precise measurements of 2s-2p transition energies in simple (few-electron) atomic systems provide stringent tests of several classes of current atomic- structure calculations. Analyses of measurements in helium-like Ar{sup 16+} have been completed, and the results submitted for publication. A current goal is to measure the 1s2s{sup 3}S{sub 1} - 1s2p{sup 3}P{sub 0} transition wavelength in helium-like Ni{sup 26+}. Measurements of the 1s2s{sup 2}S{sub 1/2} - 1s2p{sup 2}P{sub 1/2,3/2} transition wavelengths in lithium-like Kr{sup 33+} is planned. Wavelength and lifetime measurements in copper-like U{sup 63+} are also expected to be initiated. The group is also participating in measurements of forbidden transitions in helium-like ions. A measurement of the lifetime of the 1s2s{sup 3}S{sub 1} state in Kr{sup 34+} was published recently. In a collaboration including P. Mokler of GSI, Darmstadt, measurements have been made of the spectral distribution of the 2E1 decay continuum in helium-like Kr{sup 34+}. Initial results have been reported and further measurements are planned.

  16. Dhenggung Asmarandana dan Dhegung Banten: Sebuah Komparasi

    Directory of Open Access Journals (Sweden)

    Teguh -

    2013-11-01

    Full Text Available The Comparation of Dhenggung Asmarandana and Dhegung Banten. Penelitian ini membahas perbandinganantara gending Dhenggung Asmaradana gaya Surakarta dengan gending Dhegung Banten gaya Yogyakarta.Berdasarkan penelitian dapat disimpulkan bahwa kedua gending memiliki persamaan dan perbedaan. Persamaankeduanya terletak pada laras, pathet, bentuk gendhing, struktur gendhing, serta balungan gending. Sedangkanperbedaannya hanya pada nama dan garap tabuhan bonang.

  17. BOREAS HYD-8 DEM Data Over the NSA-MSA and SSA-MSA in the UTM Projection

    Science.gov (United States)

    Wang, Xue-Wen; Hall, Forrest G. (Editor); Knapp, David E. (Editor); Band, L. E.; Smith, David E. (Technical Monitor)

    2000-01-01

    The BOREAS HYD-8 team focused on describing the scaling behavior of water and carbon flux processes at local and regional scales. These DEMs were produced from digitized contours at a cell resolution of 100 meters. Vector contours of the area were used as input to a software package that interpolates between contours to create a DEM representing the terrain surface. The vector contours had a contour interval of 25 feet. The data cover the BOREAS MSAs of the SSA and NSA and are given in a UTM map projection. Most of the elevation data from which the DEM was produced were collected in the 1970s or 1980s. The data are stored in binary, image format files. The data files are available on a CD-ROM (see document number 20010000884) or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).

  18. [Laboratory-based evaluation of "INOVA/QUANTA Lite" to determine antinuclear antibodies (ANA) and autoantibodies to double-stranded DNA, SS-A and SS-B].

    Science.gov (United States)

    Yamauchi, Megumi S; Shingaki, Naohiko; Yamane, Nobuhisa

    2012-05-01

    We evaluated QUANTA Lite reagent series (INOVA Diagnostics, CA, USA) to determine antinuclear antibodies (ANA) and autoantibodies to double-stranded (ds) DNA, SS-A and SS-B, in parallel with MESACUP (Medical & Biological Laboratories, Nagoya). Overall agreements between two reagents for qualitative interpretation ranged from 77.5% (ANA) to 99.0%(anti-SS-B antibodies). When we compared to the results by indirect fluorescent antibody (IFA) test on HEp-2 cells, QUANTA Lite ANA demonstrated better sensitivity and specificity; 92.2% versus 76.5% in sensitivity and 92.1% versus 86.8% in specificity. Also, determining anti-chromatin antibodies and IFA test onto Chrithidia luciliae demonstrated greater interpretive correlation to detect anti-ds DNA by QUANTA Lite than by MESACUP. All the discrepant sera to which QUANTA Lite SS-A gave positive interpretations were confirmed to contain the antibodies specific to SS-A 52kDa antigen, which is supplemented to QUANTA Lite capture-probes. With these results, we can conclude that QUANTA Lite has superiorities over MESACUP; (1) to detect a variety of autoantibodies consisting of ANA, (2) to have a better correlation with confirmatory tests to detect anti-ds DNA antibodies, (3)to detect additional autoantibodies specific to SS-A 52kDa antigen, and (4) to have an enough compatibility in determining anti-SS-B antibodies.

  19. 75 FR 30839 - Privacy Act of 1974; CMS Computer Match No. 2010-03, HHS Computer Match No. 1003, SSA Computer...

    Science.gov (United States)

    2010-06-02

    ...'' at 61 FR 6428-6435 (February 20, 1996), and OMB guidelines pertaining to computer matching at 54 FR..., published at 73 FR 13304 (March 12, 2008), and maintained at the Martinsburg Computing Center in Martinsburg... Beneficiary Record (MBR), SSA/OSR 60-0090, published at 71 FR. 1826 (January 11, 2006) and maintained at...

  20. TiSSA pleenum "Sotsiaaltöö kriisi ajal" : mida on sotsiaaltööl pakkuda ja kes saab sellest kasu? / Regina Lind

    Index Scriptorium Estoniae

    Lind, Regina

    2010-01-01

    22.-27. aug. 2010 toimus Tallinna Ülikoolis TiSSA doktorantide eelkonverents ja pleenum. Pleenumil peetud sotsiaalteadlaste ettekannetest. Esinesid: Holger Ziegler, Karin Böllert, Catrin Heite, Hans van Ewijk, Walter Lorenz, Mikko Mäntysaari, Heinz Sünker, Synnöve Karvinen-Niinikoski, Olga Borodkina

  1. From the ideas of «Caterpillar»-SSA and Box-Jenkins methods to decomposition method of forecasting and decomposition ANN

    OpenAIRE

    Щелкалин, Виталий Николаевич

    2011-01-01

    This paper presents an overview of the rapidly developing in recent years by the author in various fields of science and technology of modern mathematical models and methods based on joint usage of ideas of the “Caterpillar”-SSA and Box-Jenkins methods. The proposed by author models are a priority at present probabilistic and deterministic nonlinear decomposition models

  2. The mapping of the human 52-kD Ro/SSA autoantigen gene to human chromosome II, and its polymorphisms

    Energy Technology Data Exchange (ETDEWEB)

    Frank, M.B.; Itoh, Kazuko (Oklahoma Medical Research Foundation, Oklahoma City (United States)); Fujisaku, Atsushi (Hokkaido Univ., Sapporo (Japan)); Pontarotti, P. (Centre de Recherches sur le Polymorphisme Genetique des Populations Humaines, Toulouse (France)); Mattei, M.G. (INSERM U 242, Marseille (France)); Neas, B.R. (Oklahoma Medical Research Foundation, Oklahoma City (United States) Univ. of Oklahoma, Oklahoma City (United States))

    1993-01-01

    Autoantibodies to the ribonucleoprotein Ro/SSA occur in nearly half of the patients with systemic lupus erythematosus and are associated with lymphopenia, photosensitive dermatitis, and pulmonary and renal disease, which suggests that they have an immunopathologic role. The majority of Ro/SSA precipitin-positive patients produce serum antibodies that bind to the 60-kD and 52-kD Ro/SSA proteins. The authors previously isolated and determined the nucleotide sequence of a cDNA clone that encodes the 52-kD form of the human Ro/SSA protein. In the present study, they have determined the chromosomal location of the gene by in situ hybridization to the end of the short arm of chromosome 11. Hybridization of portions of the cDNA probe to restriction enzyme-digested DNA indicated the gene is composed of at least three exons. The exon encoding the putative zinc fingers of this protein was found to be distinct from that which encodes the leucine zipper. An RFLP of this gene was identified and is associated with the presence of lupus, primarily in black Americans. 60 refs., 3 figs., 3 tabs.

  3. PERUBAHAN, KEBUDAYAAN, DAN AGAMA: PERSPEKTIF ANTROPOLOGI KEKUASAAN

    Directory of Open Access Journals (Sweden)

    Wa Ode Sifatu

    2015-06-01

    Full Text Available Perubahan, kebudayaan, dan agama, merupakan temayang menarik untuk dikaji secara antropologis mengingatmasyarakat Negara Kesatuan Republik Indonesia (NKRImerupakan masyarakat majemuk dalam segala aspekkehidupan. Bagaimana perubahan, kebudayaan, dan agamamenjadi sumber konflik dalam kehidupan berasyarakat diIndonesia. Tulisan ini menelusuri kedudukan perubahan,kekuasaan, dan agama melalui penelusuran kepustakaanuntuk memahami nilai analitis yang bersifat heuristikdalam konteks antropologi kekuasaan.Sejak keberadaan manusia di muka bumi,manusia selalu bertanya tentang asal-usul keberadaannya,kehidupannya, dan keberadaannya nanti setelah kematian.Manusia berupaya menjawab pertanyaan tersebutmelalui berbagai cara di antaranya melalui agama danilmu pengetahuan. Namun agama menyediakan surgadan neraka, serta ilmu pengetahuan melahirkan berbagaikemudahan dan efek samping yang menimbulkan kerugianbagi manusia sehingga manusia selalu diselimuti olehperasaan takut. Dalam kondisi seperti itu, banyak pihakyang karena kekuasaannya mengklaim kelompoknyasebagai ahli surga sedangkan kelompok lain adalah ahlineraka.

  4. Transfection, overexpression and clinical application of human 60 kDa Ro/SSA autoantigens in HEp-2 cells

    Institute of Scientific and Technical Information of China (English)

    吕良敬; 陈顺乐; 顾越英; 沈南; 鲍春德; 王元; 薛峰; 叶萍; 俞翀曌

    2003-01-01

    Objective To develop an improved substrate for indirect immunofluorescence test (IIF) for detecting anti-Ro60/Sjogren's syndrome A (Ro/SSA) autoantibodies.Methods 60-kDa Ro/SSA autoantigens (Ro60) cDNAs were obtained from human placental cDNA library using polymerase chain reaction (PCR) and were cloned into the mammalian expression vector-pEGFP-C1. Then, the recombinant plasmids were transfected into HEp-2 cells. We confirmed the overexpression, localization and antigenicity of fusion proteins in transfected cells by means of immunoblotting, confocal fluorescence microscopy and IIF. HEp-2 and HEp-Ro60 were analyzed by IIF using a panel of 10 precipitin-positive anti-Ro human sera simultaneously.Results Stable expression of Ro60-green fluorescent protein (Ro60-GFP) fusion proteins were maintained ten more generations. Ro60-GFP kept the antigenicity of Ro while demonstrating its own characteristic immunofluorescent pattern in HEp-Ro60 cells. The transfectants dramatically increased the sensitivity of IIF testing (a mean increase of 6.7-fold in endpoint titer). Eight overten (8/10) positive anti-Ro sera showed characteristic immunofluorescent patterns for HEp-Ro60, including two sera that were anti-nuclear antibodies (ANA) negative for untransfected HEp-2. IIF-ANA in all healthy sera was negative for HEp-Ro60. Conclusions As a new substrate for IIF, the Ro60 transfectants can be used to detect anti-Ro antibodies. In addition, transfected HEp-2 cells keep the immunofluorescent properties of HEp-2 cells in IIF-ANA tests and can be employed as a substrate for routine IIF-ANA detection.

  5. DETERMINAN TRUE DISCOUNT DAN MARKET REACTIONS PENAWARAN SAHAM

    OpenAIRE

    Muniya Alteza

    2013-01-01

    Abstrak: Determinan True Discount dan Market Reactions Penawaran Saham. Penelitian ini bertujuan menguji beberapa variabel sebagai determinan initial return penawaran saham perdana. Initial return dihitung dalam dua komponen, true discount dan market reaction. Determinan true discount dan market reactions dipilih berdasarkan hipotesis asimetri informasi dan hipotesis aftermarket liquidity. Total sampel yang dikumpulkan mencakup 40 penawaran saham perdana periode 2005-2008. Teknik analisis dat...

  6. PERSEPSI NEGATIF PASIEN KANKER PAYUDARA DAN KOLOREKTAL TERHADAP KEMOTERAPI DAN RADIOTERAPI DI RUMAH SAKIT DI KOTA DENPASAR, BALI

    Directory of Open Access Journals (Sweden)

    Gede Wara Samsarga Samsarga

    2015-01-01

    Full Text Available Terapi adjuvan yang biasanya diberikan pada pasien kanker payudara dan kanker kolorektal adalah kemoterapi dan radioterapi. Terapi adjuvan biasanya diberikan setelah terapi primer untuk meningkatkan angka kesembuhan penyakit, mencegah rekurensi, dan membunuh sel-sel kanker yang tersisa ataupun yang telah bermetastasis (terutama mikrometastasis. Terapi adjuvan juga berfungsi sebagai terapi paliatif untuk meningkatkan harapan hidup pasien kanker. Dalam kenyataannya banyak pasien kanker, khususnya kanker payudara dan kolorektal yang menghindari tindakan kemoterapi dan radioterapi. Dari 38 orang pasien kanker payudara dan kolorektal, didapatkan bahwa 26,3% takut gagal, 39,5% takut efek samping, 7,9% biaya yang mahal, 10,5% karena berlangsung dalam jangka waktu yang lama, dan 15,8% tidak takut terhadap kemoterapi dan radioterapi. Hasil penelitian ini menunjukkan bahwa tingkat pemahaman pasien kanker payudara dan kanker kolorektal terhadap tindakan kemoterapi dan radioterapi masih cukup rendah dimana 68,4% sampel tidak tahu dan tidak mengerti tentang tindakan kemoterapi dan radioterapi. Pemahaman yang kurang tentang tindakan kemoterapi dan radioterapi ini nantinya dapat mengakibatkan timbulnya persepsi negatif terhadap tindakan kemoterapi dan radioterapi. Maka dari itu sangat diperlukan adanya suatu edukasi yang baik bagi setiap pasien tentang penyakit dan modalitas terapi yang akan diberikan. Dokter diharapkan mampu untuk mengubah persepsi negatif pasien terkait tindakan kemoterapi dan radioterapi.  

  7. Desain Dan Analisis Perhitungan Roda Pendaratan Pesawat Tanpa Awak

    OpenAIRE

    Aulia, T. Muhammad Rinaldi

    2015-01-01

    Landing gear merupakan struktur pesawat yang berfungsi menahan beban statis pesawat dan juga beban dinamis ketika pesawat melakukan pendaratan. Dalam mendesain landing gear dilakukan pemilihan jenis landing gear dan dilakukan analisis perhitungan pada tiap komponen landing gear yang meliputi pusat gravitasi, tinggi pesawat, wheel base, wheel track, dan roda. Desain dan analisis perhitungan dilakukan dengan metode studi pustaka dimana setiap desain dan perhitungan didasarkan pada literatur pu...

  8. PENGARUH RELIGIUSITAS DAN ETIKA KERJA ISLAMI TERHADAP MOTIVASI KERJA

    OpenAIRE

    Fauzan Fauzan; Irma Tyasari

    2015-01-01

    Penelitian ini bertujuan untuk mengetahui apakah ada pengaruh antara religiustas dan etika kerja islami terhadap motivasi kerja. Dugaan awal, religiustas dan etika kerja islami berpengaruh terhadap motivasi kerja. Subjek penelitian ini adalah para guru di SMP yang dikelola oleh LP Ma’arif Kota Malang. Penelitian ini menggunakan kuesioner adaptasi dan modifikasi skala Islamic Work Ethics yang dkembangkan oleh Abbas Ali ( 1987) dan skala religiusitas yang dikembangkan oleh Glock dan Stark (1996...

  9. UJI POTENSI Gliocladium sp TERHADAP PERTUMBUHAN DAN PRODUKSI TANAMAN TOMAT

    OpenAIRE

    Lina Herlina

    2013-01-01

    AbstrakMikroorganisme tanah seperti Gliocladium sp dapat bertindak sebagai dekomposer dan juga sebagai agen pengendali hayati patogen tanaman hal ini memberikan harapan untuk mengurangi penggunaan pupuk dan fungisida sintetik. Tujuan penelitian untuk menguji potensi biofertililzer Gliocladium sp terhadap pertumbuhan dan produksi buah tomat. Variabel bebas yaitu bioferlizer Gliocladium sp  dengan dosis (g/tanaman) 0,50, 100, 150, dan 200 .Variabel tergantung adalah pertumbuhan dan produksi tan...

  10. Preparation and characterization of PVA/SSA membranes with Al{sub 2}O{sub 3} nanoparticles for fuel cell applications; Preparacao de caracterizacao de membranas de PVAL/SSA na presenca de nanoparticulas de Al{sub 2}O{sub 3} para aplicacao em celulas de combustivel

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Paula N.; Pires, Alfredo T.N. [Grupo de Estudo em Materiais Polimericos - POLIMAT - UFSC, Florianopolis, SC (Brazil); Catarino, Margarida; Brandao, Lucia; Tanaka, Alfredo; Mendes, Adelio [Faculdade de Engenharia da Universidade do Porto, Porto (Portugal)

    2011-07-01

    In the present study, PVA/SSA membranes were prepared with and without the addition of Al{sub 2}O{sub 3} nanoparticles. Sulfosuccinic acid (SSA) was used as the crosslinking agent. Membranes were prepared with different amounts of SSA (26, 43 and 55 wt.%) and with 5 and 10 wt.% of nanoparticles. Crosslinking was performed at 90 degree C during 1.5 h. Membranes were analyzed by infrared spectroscopy, thermal analysis, water absorption, ion exchange capacity (IEC) and proton conductivity. The results showed that control of the crosslinking conditions, IEC value, water absorption and polymer structure are of significant importance to obtain a set of properties suitable for application in proton exchange membrane fuel cells. (author)

  11. Atom Skimmers and Atom Lasers Utilizing Them

    Science.gov (United States)

    Hulet, Randall; Tollett, Jeff; Franke, Kurt; Moss, Steve; Sackett, Charles; Gerton, Jordan; Ghaffari, Bita; McAlexander, W.; Strecker, K.; Homan, D.

    2005-01-01

    Atom skimmers are devices that act as low-pass velocity filters for atoms in thermal atomic beams. An atom skimmer operating in conjunction with a suitable thermal atomic-beam source (e.g., an oven in which cesium is heated) can serve as a source of slow atoms for a magneto-optical trap or other apparatus in an atomic-physics experiment. Phenomena that are studied in such apparatuses include Bose-Einstein condensation of atomic gases, spectra of trapped atoms, and collisions of slowly moving atoms. An atom skimmer includes a curved, low-thermal-conduction tube that leads from the outlet of a thermal atomic-beam source to the inlet of a magneto-optical trap or other device in which the selected low-velocity atoms are to be used. Permanent rare-earth magnets are placed around the tube in a yoke of high-magnetic-permeability material to establish a quadrupole or octupole magnetic field leading from the source to the trap. The atoms are attracted to the locus of minimum magnetic-field intensity in the middle of the tube, and the gradient of the magnetic field provides centripetal force that guides the atoms around the curve along the axis of the tube. The threshold velocity for guiding is dictated by the gradient of the magnetic field and the radius of curvature of the tube. Atoms moving at lesser velocities are successfully guided; faster atoms strike the tube wall and are lost from the beam.

  12. Sistem Komputerisasi Pengolahan Buku Induk Pegawai Pada UPT Dinas Pendidikan Pemuda Dan Olahraga Kecamatan Banjarmangu Berbasis PHP Dan MYSQL

    Directory of Open Access Journals (Sweden)

    Elisa Usada

    2011-11-01

    Full Text Available Permasalahan yang akan dibahas adalah bagaimana membuat sistem pengolahan buku induk pegawai di UPT Dinas Pendidikan Pemuda dan Olahraga Kecamatan Banjarmangu berbasis PHP dan MySQL. Sistem pengolahan buku induk pegawai  berbasis PHP dan MySQL ini dirancang komputerisasi menggunakan PHP dan database MySQL dengan tujuan agar pengolahan data pegawai di UPT Dinas Pendidikan Pemuda dan Olahraga Kecamatan Banjarmangu dapat terpusat. Metode penelitian yang digunakan adalah menggunakan metode waterfall. Sistem pengolahan buku induk pegawai ini menggunakan jaringan client server dan dapat diakses oleh administrator dan Kepala UPT dan Pegawai. Kelebihan dari sistem pengolahan ini adalah dilindungi password dan hak akses yang berbeda untuk setiap user sehingga keamanan data dapat terjamin, sedangkan kekurangannya adalah program yang dihasilkan belum maksimal karena mengkhususkan data pegawai pada buku induk saja. Saran dari sistem pengolahan ini yaitu pengembangan dari segi keamanan data, kelengkapan data, dan ketelitian sistem dalam input data untuk mengurangi kesalahan.

  13. HASIL ANALISIS VITAMIN A DAN β-KAROTEN BAHAN MAKANAN SUMBER VITAMIN A DAN KAROTEN DENGAN METODE HPLC

    Directory of Open Access Journals (Sweden)

    Yuniar Rosmalina

    2012-11-01

    Full Text Available Telah dilakukan analisis vitamin A DAN β-Karoten terhadap beberapa jenis pangan dengan menggunakan metode HPLC. Analisis dilakukan terhadap 9 jenis serealia dan umbi-umbian, 3 jenis kacang-kacangan, 40 jenis sayuran, 11 jenis daging dan hasilnya, 7 jenis telur dan hasilnya, 8 jenis ikan, 12 jenis buah-buahaan, dan 7 jenis kelompok lain-lain. Hasilnya menunjukkan sumber β-Karoten yang tinggi pada kelompok serealia dan umbi-umbian adalah umbi jalar, pada kelompok sayuran adalah daun katuk, daun pepaya, daun singkong, daun melinjo, daun talas dan daun sintrong, pada kelompok telur adalah telur bebek, pada kelompok buah-buahan adalah mangga golek dan mangga gedong. Sedangkan kelompok kacang-kacangan dan kelompok daging kandungan β-Karotennya rendah. Hati ayam, hati bebek, dan hati kambing merupakan sumber vitamin A yang tinggi, sedangkan pada kelompok ikan didapati ikan lele mempunyai kandungan vitamin A yang lebih tinggi dibandingkan jenis ikan lainnya.

  14. TINJAUAN UMUM TENTANG HELPDESK DAN FRAMEWORK TERKAIT

    Directory of Open Access Journals (Sweden)

    Ali Tarmuji

    2013-04-01

    Full Text Available Penggunaan teknologi informasi dan komunikasi (TIK di suatu instansi sangat banyak dampaknya, baik positif maupun negatif. Seiring perkembangan teknologi semakin banyak pemanfaatan media TIK ini untuk membantu pelaksanaan suatu pekerjaan bahkan hampir seluruh bidang di suatu instansi. Dalam perjalanan penggunaan TIK sering muncul permasalahan-permasalahan yang jika tidak ditangani akan mengakibatkan adanya kemunduran kinerja dari bagian/seseorang yang menggunakan peralatan TIK untuk menunjang kerja mereka. Suatu instansi yang sudah sedemikian kompleksnya dalam penggunaan peralatan TIK di instansinya maka diperlukan suatu mekanisme dan unit khusus yang menangani penggunaan dan permasalahan dalam hal penggunaan TIK tersebut. Mekanisme dan unit khusus tersebut sering dinamakan tim helpdesk yang tujuan utamanya adalah menangani penyelesaian terhadap permasalahan yang muncul dari penggunaan suatu peralatan TIK tersebut sehingga mampu memperlancar kerja yang terkait. Suatu instansi dalam hal penerapan tim helpdesk memerlukan suatu perencanaan yang matang dan terorganisir. Langkah-langkah yang perlu dilakukan oleh instansi dalam implementasi tim helpdesknya antara lain, (1 membentuk tim khusus untuk menganalisis organisasinya terkait kebutuhan implementasi helpdesk tersebut, (2 membentuk organisasi helpdesk sesuai kebutuhan, (3 memilih workflow helpdesk yang disesuaikan dengan kondisi instansi, (4 memilih framework yang tepat untuk mendasari jalannya implementasi helpdesk di instansi terkait, dan (5 menuangkan aturan-aturan dasar (standard operation procedur-SOP untuk menguatkan kiprah tim helpdesk di instansi terkait.Terbentuknya tim helpdesk diharapkan dapat mengatasi permasalahan dan memberikan layanan terhadap seluruh permasalahan bidang TIK baik yang bersifat internal (pengembang aplikasi maupun seluruh permasalahan operasional aplikasi ataupun hal-hal yang berhubungan dengan sistem dan teknologi informasi dan komunikasi.

  15. PENGARUH PROSES PENGERINGAN DAN IMOBILISASI TERHADAP AKTIVITAS DAN KESTABILAN ENZIM BROMELAIN DARI BUAH NENAS (Ananas comosus (L) Merr)

    OpenAIRE

    ISHAK, MEILTY CHRISTY

    2012-01-01

    Meilty Christy Ishak (G61108260). Pengaruh Proses Pengeringan dan Imobilisasi Terhadap Aktivitas dan Kestabilan Enzim Bromelain dari Buah Nenas (Ananas comosus (L) Merr) (Di Bawah Bimbingan Februadi Bastian dan Amran Laga). RINGKASAN Enzim bromelain merupakan enzim protease dari buah nenas, enzim ini memiliki sifat seperti enzim rennin (renat), papain, dan fisin. Tujuan dari penelitian ini adalah untuk mengetahui pengaruh proses pengeringan enzim terhadap aktivitas enzim, dan untuk men...

  16. Tanggap Pertumbuhan Dan Produksi Tanaman Jagung Manis (Zea mays Saccharata Sturt.) Terhadap Pemberian Pupuk Anorganik Cair Dan Umur Pemangkasan Daun

    OpenAIRE

    Sianipar, Rimna Regina

    2012-01-01

    Tanaman jagung yang masuk ke Indonesia belum dapat dipastikan, tetapi pendapat umum menyatakan bahwa tanaman ini masuk ke Indonesia sekitar 3-4 abad yang lalu oleh orang-orang Portugis dan Spanyol melalui India dan Tiongkok. Pertanaman jagung di Indonesia terutama terdapat di Jawa, Madura dan Sulawesi. Hingga saat ini tanaman jagung merupakan tanaman makanan yang penting di daerah tropis dan subtropis. Luas pertanaman jagung di dunia menempati urutan ke-3 setelah tanaman gandum dan padi ...

  17. PENGARUH SEKAM PADI, KOMPOS DAN PUPUK KANDANG SAPI TERHADAP BEBERAPA SIFAT KIMIA, FISIKA DAN BIOLOGI ENDAPAN LUMPUR SIDOARJO

    OpenAIRE

    santoso, Slamet

    2014-01-01

    Endapan lumpur Sidoarjo terbentuk dari lumpur yang keluar dari bekas pengeboran minyak PT. Lapindo Brantas. Endapan lumpur Sidoarjo mengandung unsur hara, liat yang tinggi dan beberapa populasi mikroba. Sekam padi, kompos dan pupuk kandang sapi diketahui dapat meningkatkan hara, memperbaiki porositas dan menambah keragaman mikroba. Penelitian ini bertujuan untuk mengetahui pengaruh sekam padi, kompos dan pupuk kandang sapi terhadap beberapa sifat kimia, fisika dan biologi endapan lumpur ...

  18. Penskalaan Butir Format Respons Pilihan dan Respons Bebas Berdasarkan Model Rasch dan Partial Credit

    Directory of Open Access Journals (Sweden)

    Eko Hariadi

    2007-06-01

    Full Text Available Penelitian melihat pengaruh jumlah parameter butir, kategori respons bebas (RB, pengaruh sampel terhadap akurasi estimasi parameter kemampuan untuk menghasilkan estimasi yang stabil dan pengaruh pembobotan butir RP dan butir RB terhadap kesalahan baku. Penelitian dalam dua tahap, simulasi menggunakan 30 kondisi dengan replikasi 50 dengan variabel panjang tes, jumlah kategori, dan jumlah parameter butir, dan analisis deskriptif, dilanjutkan penerapan penskalaan gabungan butir tipe respons pilihan (rp dan butir respons bebas (rb pada konstruksi tes elektronika yang terdiri 40 butir pilihan ganda dan 4 butir jawaban tersusun, 3 butir memiliki lima kategori jawaban dan 1 butir dengan 4 kategori jawaban, melibatkan 355 siswa. Hasil penelitian menunjukkan: ukuran sampel kurang berpengaruh pada root mean square error atau (RSME> dan korelasi antara 9 dengan 0, namun berpengaruh terhadap akurasi estimasi parameter butir pilihan ganda (/>/y,dan parameter butir respons tersusun (3^- Jumlah parameter butir berpengaruh terhadap parameter kemampuan, tetapi tidak berpengaruh terhadap akurasi dari b^, dan S„,. Estimasi dari parameter tingkat kesulitan butir jawaban tersusun tiga kategori lebih akurat daripada butir jawaban tersusun lima kategori. Estimasi tahan {robust untuk parameter kesulitan butir jawaban tersusun 5 kategori memerlukan sampel minimal 250 responden, sedangkan untuk butir respons tersusun 3 kategori memerlukan sampel minimal 100 responden. Estimasi parameter kemampuan dari skor total (0^^ tidak sama dengan rata-rata jumlah tbeta dari masing-masing subtes (0^ + 0CR. Theta dari tes yang dikalibrasi bersama-sama berbeda dengan theta dari total subtes yang dikalibrasi secara terpisah. Korelasi kemampuan yang mengunakan pembobotan dan kemampuan tanpa pembobotan mempunyai suatu rentang dari 0,988 sampai 0,948. Kata kunci: penyekaiaan, model rash dan partial credit.

  19. Perbedaan Kadar Malondialdehide dan Tromboksan B2 pada Remaja dengan Dismenore dan Tanpa Dismenore

    OpenAIRE

    Berliana Irianti; Ermawati .; Arni Amir

    2015-01-01

    Abstrak Penyebab dismenore belum semuanya diketahui, ada dugaan peningkatan proses peroksida lipid yang akan mengaktivasi mediator inflamasi pada endometrium yang menimbulkan rasa nyeri haid (dismenore). Tujuan penelitian ini adalah menentukan perbedaan kadar malondialdehide dan tromboksan B 2  pada dismenore dan tanpa dismenore. Studi observasional ini menggunakan desain potong lintang komparatif. Subjek penelitian terdiri dari dua kelompok yaitu 23 remaja dismenore dan 23 remaja tanpa disme...

  20. Application of SSA analysis technique in biaxially oriented polypropylene specialty resin production%SSA 分析技术在双向拉伸聚丙烯专用料生产过程中的应用

    Institute of Scientific and Technical Information of China (English)

    刘兴旺; 朱宝兴; 赵爱利

    2012-01-01

    The isotacticity and its sequence distribution of several biaxially oriented polypropylene (BOPP) specialty resins were characterizated by successive self - nucleation annealing ( SSA ) method , and the relationship between crystallization and film forming performance was researched. On the basis of this,the cause for film breaking of BOPP resin manufactured in a 300 kt/a polypropylene unit of Lanzhou Petrochemical Company occurred during its extruding was analyzed, and the process parameters of the polymerization were optimized. The results showed that the film forming stability of BOPP resin was dependent on the isotacticity sequence distribution , that was the content of high isotacticity molecules needed to be decreased, and the content of low isotacticity molecules needed to be increased. The IPeakl/Peak2 ratio should be less than 1. With increasing the mass ratio of catalyst to external electron do-nor(T/D) ,the content of high isotacticity molecules decreased,the content of low and medium isotacticity molecules inceased,the lamellar became thinner, the isotacticity sequence distribution became broader , and the performance of film forming was improved.%采用连续自成核退火法(SSA)对几种不同双向拉伸聚丙烯(BOPP)树脂进行了等规度及等规序列分布表征,研究了其结晶行为与成膜稳定性之间的关系,据此分析了中国石油兰州石化公司30万t/a聚丙烯装置初期所产BOPP产品在使用过程中存在易破膜问题的原因,并进行了装置聚合工艺参数的优化.结果表明,BOPP树脂的成膜稳定性取决于其等规度分布情况,即高等规度组分含量应较低,低等规度组分含量应较高,峰高比值(Ipeak1/Ipeak2)以小于1为宜;随着催化剂与外给电子体质量比(T/D)的增大,BOPP树脂的高等规度组分含量逐渐降低,中、低等规度组分含量相对上升,晶片厚度变薄,分布加宽,成膜性能得以改善.

  1. Livres et lecture dans le monde ottoman

    OpenAIRE

    Anastassiadou, Meropi; Arnaud, Jean-Luc; Balta, Evangelia; Bilici, Faruk; Bounfour, Abdallah; Clayer, Nathalie; Denoix, Sylvie; Depaule, Jean-Charles; Dévényid, Kinga; Establet, Colette; Guichard, Pierre; Henry, Jean-Robert; Heyberger, Bernard; Hitzel, Frédéric; Kenderova, Stoyanka

    2004-01-01

    Au cours de ces dernières années, l'histoire du livre et de la lecture s'est affirmée comme l'un des domaines majeurs de l'histoire culturelle. Dans l'Empire ottoman, cette histoire prend une forme particulière car non seulement l'imprimerie en caractères arabes ne fait officiellement son apparition à Istanbul qu'en 1729, mais encore parce que, dans cet empire, cohabitent dans une civilisation commune, des langues et des religions différentes. Les études ici réunies dressent un premier bilan ...

  2. Être dans la musique

    OpenAIRE

    Legrain, Laurent

    2011-01-01

    “Être dans la musique”… cette expression maintes fois entendue dans le cadre d’interviews ou de discussions informelles menées avec des amateurs de jazz montre toute l’importance de ces moments musicaux particuliers dans les trajectoires des amateurs. Mais comment approcher analytiquement cet état fugace et, à la manière des amateurs, le placer au centre de nos préoccupations ? En dénouant le corset kantien qui enserre l’esthétique, de nombreux auteurs ont esquissé les contours d’une notion, ...

  3. EFIKASI DAN KEAMANAN DIHIDROARTEMISININ-PIPERAKUIN PADA PENDERITA PLASMODIUM VIVAX DI KALIMANTAN DAN SULAWESI

    Directory of Open Access Journals (Sweden)

    Armedy Ronny Hasugian

    2012-11-01

    Full Text Available Penelitian ini merupakan bagian dari penelitian “Monitoring drug resistance in subject with P.falciparum and  P.vivax malaria in Kalimantan and Sulawesi, Indonesia” yang bertujuan untuk menilai efikasi dan keamanan Dihydroartemisinin – Piperaquine (DHP pada penderita malaria vivaks di Kalimantan dan Sulawesi. Disain penelitian adalah potong lintang dengan prospektif evaluasi terhadap 87 subyek penderita P. vivax. Efikasi dan keamanan DHP dinilai berdasarkan kriteria WHO. Hasil analisis menunjukkan bahwa efikasi DHP secara Intention To Treat (ITT pada Hari 28 (H28 setelah pengobatan DHP adalah 94,3% (95%CI: 87,2 – 97,5 dan H42 adalah 92% (95%CI: 87,2 – 97,5. Efikasi DHP secara Per Protokol (PP pada H28 adalah 100% dan H42 adalah 97,6% (95%CI:91,5 – 99,3. Bebas parasit 100% terjadi pada H2. Bebas gametosit 100% terjadi pada H7. Bebas demam 100% terjadi pada H7. Bebas gejala klinis tidak pernah mencapai 100% pasca pengobatan DHP. Kejadian sampingan yang ditemukan adalah berkeringat, tidak nafsu makan dan diare,  tetapi ringan dan dapat ditolerir.  Oleh karena itu dapat disimpulkan efikasi dan keamanan DHP sesuai dengan kriteria WHO dan dapat direkomendasikan untuk penggunaan secara luas.   Kata Kunci: Malaria, Efikasi, dihidroartemisinin, piperaquine, Kalimantan, Sulawesi 

  4. PENGARUH PENYIMPANAN BEKU SANTAN DAN KELAPA PARUT TERHADAP CITA RASA SANTAN DAN MUTU MINYAK YANG DIHASILKAN

    Directory of Open Access Journals (Sweden)

    Uken S. Soetrisno

    2012-11-01

    Full Text Available Santan dan kelapa parut yang disimpan beku selama 1 sampai dengan 4 minggu telah diuji cita rasa santan dan mutu kimiawi dari minyak yang dihasilkannya. Data yang diperoleh menunjukkan bahwa asam lemak bebas dan bilangan peroksida, yang dipakai sebagai petunjuk kerusakan minyak mengalami kenaikan yang cukup tinggi dan sangat bermakna secara statistik setelah penyimpanan satu minggu, meskipun dengan percepatan yang berbeda. Angka-angka tersebut masih di bawah batas yang ditentukan dalam standar Industri Indonesia. Uji cita rasa menunjukkan bahwa lamanya penyimpanan serta bentuk bahan sangat berpengaruh terhadap tingkat kesukaan panelis. Santan yang berasal dari kelapa parut beku masih disukai sampai dengan penyimpanan dua minggu.

  5. Sintesa dan Karakteristik Sifat Mekanik Karet Nanokomposit

    Directory of Open Access Journals (Sweden)

    Pocut Nurul Alam

    2007-06-01

    Full Text Available Peningkatan sifat mekanik karet alam dengan penambahan tanah liat nanokomposit pada kosentrasi berbeda yaitu 1, 3 dan 5 % berat sudah berhasil diteliti. Pada percobaan ini pengujian dilakukan dengan X-Ray Difraction (X-RD untuk analisa morphologi dan Instron untuk analisa uji tarik. Penambahan tanah liat nanokomposit kedalam matrik polimer adalah untuk meningkatkan sifat mekanik dari material asli dan juga untuk menghasilkan suatu produk polimer yang lebih murah. Hasil yang diperoleh adalah terjadinya peningkatan yang drastis terhadap basal spacing dari matrik polimer dan menunjukkan intercalasi diantara polimer dengan pengisinya. Uji tarik juga menununjukkan peningkatan yang sangat signifikan yaitu 14.983 MPa pada karet alam menjadi 40.178 MPa pada karet alam-tanah liat nanokomposit 5% berat. Kata kunci: karet alam, sifat mekanik, tanah liat nanokomposit

  6. The DanTIN project

    DEFF Research Database (Denmark)

    Steensig, Jakob; Brøcker, Karen Kiil; Grønkjær, Caroline;

    2013-01-01

    The article introduces a new website, samtalegrammatik.dk ('grammar of talk-in-interaction'), it describes the methods used for constructing the website, and it provides descriptions of three new grammatical phenomena in Danish talk-in-interaction. The website is a result of investigations carried...... out by the research group DanTIN ('Danish talk-in-interaction') since 2009. Until 2013, the group has published analyses of quite diverse phenomena, such as different versions of the word "hvad" 'what' that seem to be-ong to different word classes and have different functions in talk-in- interaction...... grammar of Danish talk-in-interaction. It offers a template for a description of all aspects of the grammar of Danish talk-in-interaction, even though at the time of the launching only a little part of the entries will be filled in. The idea is that the investigations will be continued in many years...

  7. BY PRODUCT TERNAK. Teknologi dan Aplikasinya

    OpenAIRE

    Said, Muhammad Irfan

    2014-01-01

    DAFTAR PUSTAKA Adventini, N., Muhayatun, D. D. Lestiani dan W.Y.N. Syahfitri. 2012. Analisis Mikronutrien dalam Daging, Limpa, dan Hati Sapi. Jurnal Medika. 38 (8), 580???586. Angelidaki, I., and B. K. Ahring. 2000. Methods for increasing the biogas potential from the recalcitrant organic matter contained in manure. Water Science Technology. 41 (3), 189-194. Anonim. 1974. Gelita-Instant-Gelatins Type 800 A Type 800 B. Gelatine-Information-Service. Deutsche Gelatine-Febrike...

  8. Strategi Pembelajaran Biologi Berbasis Kompetensi dan Konservasi

    Directory of Open Access Journals (Sweden)

    Saiful Ridlo

    2013-09-01

    Full Text Available AbstrakPembelajaran melibatkan interaksi dosen, mahasiswa, dan sumber belajar. Interaksi antara ketiganya membutuhkan strategi pembelajaran. Penelitian ini bertujuan menghasilkan strategi pembelajaran biologi di Jurusan Biologi Unnes yang telah berkomitmen mengaplikasikan kurikulum berbasis kompetensi dan konservasi dengan ciri pendekatan jelajah alam sekitar (JAS. Metodologi penelitian menggunakan pendekatan kualitatif. Informannya dosen dan mahasiswa yang mengajar dan belajar biologi umum, mikrobiologi, dan taksonomi hewan. Data yang diperoleh berupa deskripsi kegiatan belajar mengajar dan lesson study.  Data-data dianalisis kemudian dinarasikan. Hasil penelitian menunjukkan pembelajaran biologi dengan pendekatan berpusat pada siswa yang dikhususkan pada kegiatan penjelajahan alam sekitar dapat dilakukan menggunakan strategi yang berbasis pada cara belajar siswa aktif dan kooperatif. Strategi-strategi tersebut adalah pembelajaran kontekstual, pembelajaran partisipatif, dan pembelajaran inkuiri. AbstractLearning involves the interaction of lecturer, students, and learning resources. The interaction between them requires a learning strategy. This research aims to generate learning strategies of biology in the Department of Biology Unnes which has committed to apply the competence- and conservation-based curriculum of features the environmental exploration (JAS approach. The research methodology uses a qualitative approach. The informants are the faculty members and the students who, respectively, teach and learn biology, microbiology, and animal taxonomy subjects. The data obtained were in the form of description of learning activities and lesson studies. The data were then analyzed narratively. The results showed that the student-centered learning of environmental exploration may be conducted using active- and cooperative-based strategies. Examples of these strategies are contextual learning, participatory learning, and inquiry learning.

  9. Mobil SUV Tangguh dan Sporty Terbaik

    OpenAIRE

    rozi,ys

    2016-01-01

    Nissan X-Trail yang  mempunyai perfomance yang sangat baik, contohnya : Ada beberapa Tipe transmisi yang mudah dikendarai dan tidak membuat pengendara cepat lelah saat menyetir. Untuk jok Dapat disesuaikan dengan kondisi jalanan di perkotaan, sekaligus dengan sensasi akselerasi yang halus dan nyaman. Pada bagian Transmisi manual 5-percepatan di Nissan March membantu mendapatkan hasil maksimal dari kekuatan mesin. Baca selengkapnya hanya di: http://rozidotnet.blogspot.com/2016/...

  10. Pembuatan dan Karakteristik Komposit Polimer Berpenguat Bagasse

    Directory of Open Access Journals (Sweden)

    Eqitha Dea Clareyna

    2013-09-01

    Full Text Available Bagasse memiliki kandungan serat yang cukup besar dan berpotensi digunakan sebagai bahan penguat dalam pembuatan komposit karena sifatnya yang kuat dan ringan. Dalam penelitian tugas akhir ini telah dibuat bahan komposit berpenguat bagasse dengan empat macam ukuran penguat yaitu serat chopped serta partikel berukuran 100 mesh, 140 mesh, dan 200 mesh. Pembuatan komposit menggunakan metode hand lay-up dan fraksi volume penguat divariasi dari 2,5% hingga 15%. Hasil karakterisasi yang telah dilakukan, menunjukkan bahwa kekuatan tarik dan densitas terbaik dimiliki oleh sampel komposit dengan penguat berukuran 200 mesh sebanyak 7,5% volume. Kekuatan tarik sampel tersebut adalah  28,83  MPa dan densitasnya adalah 1,15 gr/cm3. Adapun kekuatan impak terbesar dimiliki oleh sampel komposit dengan 2,5% volume sebesar 0,00271 J/mm2. Dengan demikian sampel komposit yang telah dibuat dapat digunakan sebagai alternatif bahan baku industri menggantikan tiang penyangga (scantlings pada struktur kayu (timber structure sesuai standar AS 1720.1.

  11. GOOD CORPORATE GOVERNANCE DAN PENERAPANNYA DI INDONESIA

    Directory of Open Access Journals (Sweden)

    Thomas S. Kaihatu

    2006-01-01

    Full Text Available Recent experience indicate that it isn`t sufficient for management just to rely on how efficient is the process of managing. It needs a new instrument, Good Cooperate Governance (GCG, to prove that the management is going well. This concept emphasize on two important things, that is : first, the right of shareholder to be provided of right and just on time information, and second, the obligation of company to disclose accurately, just on time, and transparently all information of company`s performance, shareholders, and stakeholders. Various studies by national and international researchers proved the lack of understanding the importance and strategic implication of applying GCG principles by Indonesian entrepreneur. Besides, organization culture also influencing GCG application in Indonesia. Abstract in Bahasa Indonesia : Perkembangan terbaru membuktikan bahwa manajemen tidak cukup hanya memastikan bahwa proses pengelolaan manajemen berjalan dengan efisien. Diperlukan instrumen baru, Good Corporate Governance (GCG untuk memastikan bahwa manajemen berjalan dengan baik. Ada dua hal yang ditekankan dalam konsep ini, pertama, pentingnya hak pemegang saham untuk memperoleh informasi dengan benar dan tepat pada waktunya dan, kedua, kewajiban perusahaan untuk melakukan pengungkapan (disclosure secara akurat, tepat waktu, dan transparan terhadap semua informasi kinerja perusahaan, kepemilikan, dan stakeholder. Dari berbagai hasil pengkajian yang dilakukan oleh berbagai lembaga riset independen nasional dan internasional, menunjukkan rendahnya pemahaman terhadap arti penting dan strategisnya penerapan prinsip-prinsip GCG oleh pelaku bisnis di Indonesia. Selain itu, budaya organisasi turut mempengaruhi penerapan GCG di Indonesia. Kata kunci: GCG, prinsip-prinsip GCG, budaya organisasi, penerapan di Indonesia.

  12. Al-Farabi dan Filsafat Kenabian

    Directory of Open Access Journals (Sweden)

    Qosim Nursheha Dzulhadi

    2014-03-01

    Full Text Available Artikel ini mengulas pemikiran al-Farabi tentang konsep kenabian dalam Islam. Masalah berawal dari adanya pemikiran yang menolak konsep kenabian pada umumnya dan kenabian Nabi Muhammad SAW khususnya. Sebagaimana yang dilontarkan oleh Muhammad Ahmad ibn al-Ruwandi. Ia mengatakan bahwa nabi sebenarnya tidak diperlukan manusia karena Tuhan telah mengaruniakan akal kepada manusia tanpa terkecuali. Dengan akal ini, manusia dapat mengetahui Tuhan beserta segala nikmat Nya dan dapat pula mengetahui perbuatan baik dan buruk, menerima suruhan dan larangan-Nya. Dengan demikian, nabi dengan segala fungsinya tidak diperlukan lagi. Bahkan, kitab suci pun tidak berguna untuk dibaca. Lebih berguna membaca buku filsafat Epicurus, Plato, Aristoteles, dan buku astronomi, logika, serta obat-obatan. Hal ini tentunya bertolak belakang dengan yang diajarkan dalam Islam. Beriman kepada nabi nabi merupakan hal inti dalam ajaran agama ini. Atas dasar itu al-Farabi bereaksi keras. Baginya, pandangan Ibn al-Ruwandi di atas tidak dapat dibenarkan, khususnya dari sisi akidah Islam. Sebagai al-Mu‘allim al-Tsani (Guru Kedua, karena prestasinya dalam menjelaskan dan mengulas-ulang filsafat Aristoteles, al-Farabi mengkritik secara sistematik pandangan menyimpang al-Ruwandi di atas.

  13. Lightning potential forecast over Nanjing with denoised sounding-derived indices based on SSA and CS-BP neural network

    Science.gov (United States)

    Wang, Jun; Sheng, Zheng; Zhou, Bihua; Zhou, Shudao

    2014-02-01

    The method of using the back propagation neural network improved by cuckoo search algorithm (hereafter CS-BP neural network) to forecast lightning occurrence from sounding-derived indices over Nanjing is presented. The general distribution features of lightning activities over Nanjing area are summarized and analyzed first. The sounding data of 156 thunderstorm days and 164 fair-weather days during the years 2007-2012 are used to calculate the values of sounding-derived indices. The indices are pre-filtered using singular spectrum analysis (hereafter SSA) as preprocessing technique and 4 most pertinent indices (namely CAPE, K, JI and SWEAT) are determined as inputs of CS-BP network by a linear bivariate analysis and selection algorithm. The cases of 2007-2010 are used to train CS-BP network and the cases of 2011-2012 are used as an independent sample to test the forecast performance. Some statistical skill score parameters (namely POD, SAR, CSI, et.al.) indicate that the CS-BP model excels in lightning forecasting and has a better performance compared with the traditional BP neural network and linear multiregression method.

  14. ALMA Deep Field in SSA22: A concentration of dusty starbursts in a z=3.09 protocluster core

    CERN Document Server

    Umehata, H; Kohno, K; Ivison, R J; Alexander, D M; Geach, J; Hatsukade, B; Hughes, D H; Ikarashi, S; Kato, Y; Izumi, T; Kawabe, R; Kubo, M; Lee, M; Lehmer, B; Makiya, R; Matsuda, Y; Nakanishi, K; Saito, T; Smail, I; Yamada, T; Yamaguchi, Y; Yun, M

    2015-01-01

    We report the results of $1^{\\prime}.5 \\times3^{\\prime}$ mapping at 1.1~mm with the Atacama Large Millimeter/submillimeter Array (ALMA) toward the central region of the $z=3.09$ SSA22 protocluster. By combining our source catalog with archival spectroscopic redshifts, we find that eight submillimeter galaxies (SMGs) with flux densities, $S_{\\rm 1.1~mm}=0.7-6.4$~mJy ($L_{\\rm IR}\\sim10^{12.1}-10^{13.1}L_\\odot$) are at $z=3.08-3.10$. Not only are these SMGs members of the protocluster but they in fact reside within the node at the junction of the 50 Mpc-scale filamentary three-dimensional structure traced by Lyman-$\\alpha$ emitters (LAEs) in this field. The eight SMGs account for a star formation rate density (SFRD) $\\sim$10 $M_\\odot$ yr$^{-1}$ Mpc$^{-3}$ in the node, which is two orders of magnitudes higher than the global SFRD at this redshift. We find that four of the eight SMGs host a X-ray luminous active galactic nuclei (AGN). Our results suggest that the vigorous star formation activity and the growth of ...

  15. Effects of the Extraterrestrial Environment on Plants: Recommendations for Future Space Experiments for the MELiSSA Higher Plant Compartment

    Directory of Open Access Journals (Sweden)

    Silje A. Wolff

    2014-05-01

    Full Text Available Due to logistical challenges, long-term human space exploration missions require a life support system capable of regenerating all the essentials for survival. Higher plants can be utilized to provide a continuous supply of fresh food, atmosphere revitalization, and clean water for humans. Plants can adapt to extreme environments on Earth, and model plants have been shown to grow and develop through a full life cycle in microgravity. However, more knowledge about the long term effects of the extraterrestrial environment on plant growth and development is necessary. The European Space Agency (ESA has developed the Micro-Ecological Life Support System Alternative (MELiSSA program to develop a closed regenerative life support system, based on micro-organisms and higher plant processes, with continuous recycling of resources. In this context, a literature review to analyze the impact of the space environments on higher plants, with focus on gravity levels, magnetic fields and radiation, has been performed. This communication presents a roadmap giving directions for future scientific activities within space plant cultivation. The roadmap aims to identify the research activities required before higher plants can be included in regenerative life support systems in space.

  16. Effects of the Extraterrestrial Environment on Plants: Recommendations for Future Space Experiments for the MELiSSA Higher Plant Compartment.

    Science.gov (United States)

    Wolff, Silje A; Coelho, Liz H; Karoliussen, Irene; Jost, Ann-Iren Kittang

    2014-01-01

    Due to logistical challenges, long-term human space exploration missions require a life support system capable of regenerating all the essentials for survival. Higher plants can be utilized to provide a continuous supply of fresh food, atmosphere revitalization, and clean water for humans. Plants can adapt to extreme environments on Earth, and model plants have been shown to grow and develop through a full life cycle in microgravity. However, more knowledge about the long term effects of the extraterrestrial environment on plant growth and development is necessary. The European Space Agency (ESA) has developed the Micro-Ecological Life Support System Alternative (MELiSSA) program to develop a closed regenerative life support system, based on micro-organisms and higher plant processes, with continuous recycling of resources. In this context, a literature review to analyze the impact of the space environments on higher plants, with focus on gravity levels, magnetic fields and radiation, has been performed. This communication presents a roadmap giving directions for future scientific activities within space plant cultivation. The roadmap aims to identify the research activities required before higher plants can be included in regenerative life support systems in space. PMID:25370192

  17. Function of SSA subfamily of Hsp70 within and across species varies widely in complementing Saccharomyces cerevisiae cell growth and prion propagation.

    Directory of Open Access Journals (Sweden)

    Deepak Sharma

    Full Text Available BACKGROUND: The cytosol of most eukaryotic cells contains multiple highly conserved Hsp70 orthologs that differ mainly by their spatio-temporal expression patterns. Hsp70s play essential roles in protein folding, transport or degradation, and are major players of cellular quality control processes. However, while several reports suggest that specialized functions of Hsp70 orthologs were selected through evolution, few studies addressed systematically this issue. METHODOLOGY/PRINCIPAL FINDINGS: We compared the ability of Ssa1p-Ssa4p from Saccharomyces cerevisiae and Ssa5p-Ssa8p from the evolutionary distant yeast Yarrowia lipolytica to perform Hsp70-dependent tasks when expressed as the sole Hsp70 for S. cerevisiae in vivo. We show that Hsp70 isoforms (i supported yeast viability yet with markedly different growth rates, (ii influenced the propagation and stability of the [PSI(+] and [URE3] prions, but iii did not significantly affect the proteasomal degradation rate of CFTR. Additionally, we show that individual Hsp70 orthologs did not induce the formation of different prion strains, but rather influenced the aggregation properties of Sup35 in vivo. Finally, we show that [URE3] curing by the overexpression of Ydj1p is Hsp70-isoform dependent. CONCLUSION/SIGNIFICANCE: Despite very high homology and overlapping functions, the different Hsp70 orthologs have evolved to possess distinct activities that are required to cope with different types of substrates or stress situations. Yeast prions provide a very sensitive model to uncover this functional specialization and to explore the intricate network of chaperone/co-chaperone/substrates interactions.

  18. Detection and significance of anti-SSA/Ro-52kD autoantibody using recombinant antigen%利用重组抗原检测抗SSA/Ro-52kD自身抗体及其临床意义

    Institute of Scientific and Technical Information of China (English)

    邓安梅; 仲人前; 陈孙孝; 施笑梅; 孔宪涛

    2000-01-01

    目的重组表达SSA/Ro-52kD融合蛋白,并用于检测自身抗体. 方法应用DNA重组技术构建SSA/Ro-52kD工程菌,并表达SSA/Ro-52kD融合蛋白.经谷胱甘肽巯基转移酶(GST)柱层析纯化后,作为抗原,分别用免疫印迹法(IBT)和酶联免疫吸附试验(ELISA)检测20份SS患者血清、60份SLE患者血清和30份正常人血清. 结果重组抗原检测抗SSA/Ro-52kD自身抗体敏感性较高,而且抗体滴度与病程相关. 结论利用重组抗原对自身抗体进行定性、定量分析有助于自身免疫病的诊断和监控.

  19. Study on the Effect of the Side Secondary Air Velocity on the Aerodynamic Field in a Tangentially Fired Furnace with HBC—SSA Burner

    Institute of Scientific and Technical Information of China (English)

    ZhuTong; SunShaozeng; 等

    1999-01-01

    The present paper has compared a group of furnace aerodynamic fields at different velocities of side secondary air(SSA) in a test model of 420t/h utility boiler,applying Horizontal Bias Conbustion Pulverized Coal Burner with Side Secondary AIr(HBC-SSA Burner).Experimental results show that,when the ram pressure ratio of side secondary air(SSA) to primary air(PA) ρ2sv232/ρ1v12)is between 1.0-2.4,the furnace aerodynamic field only varies slightly.The relative rotational diameters(φ/L)in the burner domain are moderate and the furnace is in good fullness.Whenρ2s v232/ρ1v12 is beyond4,φ/L is so large that the stream sweeps water-cooled wall and rotateds strongly in the furnace.Therefore,slagging and high temperature corrosion of tube metal will be formed on the water-cooled wall in actual operation.This investigation provides the basis for the application of this new type burner.In addition,numerical simulations are conducted,and some defects in the numerical simulation are also pointed out and analyzed in this paper.

  20. "Bohr's Atomic Model."

    Science.gov (United States)

    Willden, Jeff

    2001-01-01

    "Bohr's Atomic Model" is a small interactive multimedia program that introduces the viewer to a simplified model of the atom. This interactive simulation lets students build an atom using an atomic construction set. The underlying design methodology for "Bohr's Atomic Model" is model-centered instruction, which means the central model of the…

  1. HASIL ANALISIS VITAMIN A DAN β-KAROTEN BAHAN MAKANAN SUMBER VITAMIN A DAN KAROTEN DENGAN METODE HPLC

    OpenAIRE

    Yuniar Rosmalina; Dewi Permaesih

    2012-01-01

    Telah dilakukan analisis vitamin A DAN β-Karoten terhadap beberapa jenis pangan dengan menggunakan metode HPLC. Analisis dilakukan terhadap 9 jenis serealia dan umbi-umbian, 3 jenis kacang-kacangan, 40 jenis sayuran, 11 jenis daging dan hasilnya, 7 jenis telur dan hasilnya, 8 jenis ikan, 12 jenis buah-buahaan, dan 7 jenis kelompok lain-lain. Hasilnya menunjukkan sumber β-Karoten yang tinggi pada kelompok serealia dan umbi-umbian adalah umbi jalar, pada kelompok sayuran adalah daun katuk, daun...

  2. KEPEMIMPINAN, SISTEM DAN STRUKTUR ORGANISASI, LINGKUNGAN FISIK, DAN KEEFEKTIFAN ORGANISASI SEKOLAH

    Directory of Open Access Journals (Sweden)

    Connie Chairunnisa

    2013-05-01

    Full Text Available Abstract: The Effects of Leadership, System and Structure, and Physical Environment on the Ef­fectiveness of School Organization. The study aims at obtaining information of the effects of leadership, system and structure, and physical environment on the effectiveness of organization. This causal study was conducted in one hundred schools in Jakarta. Survey method with causal approach and  path analysis was employed. The population consisted of288 teachers in junior high schools in DKI Province of Jakarta. The sample of 100 teachers was selected by applying simple random sampling technique. The results show di­rect effects of (1 system and structure on physical environment,  (2  leadership  on the effectiveness, (3 system and structure on physical environment as well as the effectiveness of organization, (4 physical en­vironment on the effectiveness of organization. In addition, system and structure show indirect effect on the effectiveness of organization through the physical environment. The research concludes that any change or variation in organizational effectiveness can be influenced by leadership, system and structure, and physical environment. Abstrak: Kepemimpinan, Sistem dan Struktur Organisasi, Lingkungan Fisik, dan Keefektifan Orga­nisasi. Penelitian ini bertujuan untuk mendeskripsikan pengaruh kepemimpinan, sistem dan struktur organi­sasi, dan lingkungan fisik terhadap keefektifan organisasi. Penelitian diselenggarakan di seratus sekolah di Jakarta, dengan menggunakan metode survei melalui pendekatan kausal dan analisis jalur. Sampel sebanyak 100 guru SMP Negeri Provinsi DKI Jakarta diambil dengan teknik penyampelan acak sederhana. Hasil penelitian menunjukkan bahwa terdapat pengaruh langsung dari (1 sistem dan struktur organisasi terhadap lingkungan fisik; (2 kepemimpinan kepala sekolah terhadap keefektifan organisasi; (3 sistem dan struktur terhadap lingkungan fisik juga terhadap keefektifan organisasi; (4 lingkungan fisik

  3. Atomic Energy Basics, Understanding the Atom Series.

    Science.gov (United States)

    Atomic Energy Commission, Oak Ridge, TN. Div. of Technical Information.

    This booklet is part of the "Understanding the Atom Series," though it is a later edition and not included in the original set of 51 booklets. A basic survey of the principles of nuclear energy and most important applications are provided. These major topics are examined: matter has molecules and atoms, the atom has electrons, the nucleus,…

  4. PENINGKATAN MINAT DAN KEPUTUSAN BERPARTISIPASI AKSEPTOR KB

    Directory of Open Access Journals (Sweden)

    Ken Sudarti

    2011-09-01

    Full Text Available Tujuan dari studi ini adalah untuk menemukan dampak dari kualitas layanan dan konseling yang disediakan oleh PLKB dan persepsi pengguna kontrasepsi pada budaya lingkungan yang berkontribusi terhadap ketertarikan dan keputusan para pengguna alat kotrasepsi. Populasi penelitian ini adalah 98 wanita yang melakukan program keluarga berencana dalam jangka waktu lama dengan menggunakan sample convenience. Penelitian ini menunjukkan mayoritas pengguna kontrasepsi adalah usia rawan untuk melahirkan, memiliki lebih dari dua anak, dan relatif memiliki latar belakang pendidikan rendah. Kualitas layanan program konseling dan budaya lingkungan dalam program keluarga berencana mempunyai dampak positif terhadap ketertarikan dan keputusan untuk berpartisipasi terhadap program keluarga berencana. Kualitas layanan ditemukan sebagai kontribusi terbesar terhadap peningkatan ketertarikan dan partisipasi dalam program keluarga berencana.The aim of this study was to find out the effect of the service quality and counceling provided by the family planning field workers (PLKB and the perception of the contraception users on the environmental culture that contribute to the interest and decision of the contraception users.The population of this study was the contraception users in Demak District. The traditional statistical model of yamae was applied to recruit the 98 women who were long-term users of birth control within the government-sponsored family planning program using the convenience sampling method.The study showed that the majority of the contraception users were in the age at risk of giving birth , with more than two children and relatively had low education background. The service quality, councelling program and environmental culture had a possitive effect on the interest and the decision of participating in the family planning program . Service quality was found to give the biggest contribution for the improved interest and partisipation in the family

  5. Pola Manajemen Keuangan Berbasis Sekolah dan Hubungan dengan Kinerja Sekolah (studi kasus di SMP negeri 1, 5, dan 8 yogyakarta

    Directory of Open Access Journals (Sweden)

    Muhamad Jaeni

    2005-06-01

    Full Text Available Penelitian ini bertujuan mengungkapkan perencanaan, prosedur pengesahan, pelaksanaan, mekanisme dan bentuk laporan, serta evaluasi anggaran berbasis sekolah, pengaruh pola manajemen keuangan terhadap kinerja sekolahj dan upaya sekolah menumbuhkan kesadaran masyarakat dalam membantu dan mengawasi penyelenggaraan pendidikan di sekolah. Penelitian ini menggunakan pendekatan deskriptif kualitatif. Data dikumpulkan melalui wawancara, observasi, dan analisis dokumen sekolah. Informan adalah kepala sekolah, wakil kepala sekolah, bendahara, guru, staf administrasi, anggota OSIS, komite sekolah, dewan pendidikan, dinas pendidikan, Badan Pemeriksa Keuangan Daerah (BPKD, dan Lembaga Pengawasan Internal (LPI. Hasil penelitian menunjukkan bahwa: Pertama, RAPBS selalu mengalami kenaikan sekitar 20% tiap tahun. Dalam konteks MBS, pendekatan perencanaan keuangan yang dipakai tidak lagi menggunakan line item budget, tetapi didasarkan kepada kebutuhan program dan kinerja sekolah. Dalam rapat RAPBS, seringkali kepala sekolah dan bendahara hanya membahas dana dari pemerintah dan orang tua. Kedua, laporan, pengesahan, dan evaluasi keuangan sekolah disampaikan dan dilakukan oleh Dinas Pendidikan dan Tim Monitoring Block Grant, yang terdiri dari dinas P&P, Dewan Pendidikan, Bappeda, BPKD, dan LPI. Ketiga, Sekitar 85% anggaran sekolah dipergunakan untuk gaji dan kesejahteraan, sementara sisanya untuk KBM menggunakan dana block grant dari pemerintah. Kinerja evaluator belum maksimal. Keempat, upaya kepala sekolah serta stakeholders untuk menumbuhkan kesadaran masyarakat dalam membantu penyelenggaraan pendidikan di sekolah. Kata kunci: manajemen keuangan berbasis sekolab, kinerja sekolab

  6. Gene transcript analysis blood values correlate with {sup 68}Ga-DOTA-somatostatin analog (SSA) PET/CT imaging in neuroendocrine tumors and can define disease status

    Energy Technology Data Exchange (ETDEWEB)

    Bodei, L. [European Institute of Oncology, Division of Nuclear Medicine, Milan (Italy); Kidd, M.; Modlin, I.M.; Drozdov, I. [Wren Laboratories, Branford, CT (United States); Prasad, V. [Charite University Hospital, Department of Nuclear Medicine, Berlin (Germany); Severi, S.; Paganelli, G. [Istituto Scientifico Romagnolo per lo Studio e la Cura dei Tumori (IRST) IRCCS, Nuclear Medicine and Radiometabolic Units, Meldola (Italy); Ambrosini, V. [S. Orsola-Malpighi University Hospital, Nuclear Medicine, Bologna (Italy); Kwekkeboom, D.J.; Krenning, E.P. [Erasmus Medical Center Rotterdam, Nuclear Medicine Department, Rotterdam (Netherlands); Baum, R.P. [Zentralklinik Bad Berka, THERANOSTICS Center for Molecular Radiotherapy and Imaging, Bad Berka (Germany)

    2015-08-15

    Precise determination of neuroendocrine tumor (NET) disease status and response to therapy remains a rate-limiting concern for disease management. This reflects limitations in biomarker specificity and resolution capacity of imaging. In order to evaluate biomarker precision and identify if combinatorial blood molecular markers and imaging could provide added diagnostic value, we assessed the concordance between {sup 68}Ga-somatostatin analog (SSA) positron emission tomography (PET), circulating NET gene transcripts (NETest), chromogranin A (CgA), and Ki-67 in NETs. We utilized two independent patient groups with positive {sup 68}Ga-SSA PET: data set 1 ({sup 68}Ga-SSA PETs undertaken for peptide receptor radionuclide therapy (PRRT), as primary or salvage treatment, n = 27) and data set 2 ({sup 68}Ga-SSA PETs performed in patients referred for initial disease staging or restaging after various therapies, n = 22). We examined the maximum standardized uptake value (SUV{sub max}), circulating gene transcripts, CgA levels, and baseline Ki-67. Regression analyses, generalized linear modeling, and receiver-operating characteristic (ROC) analyses were undertaken to determine the strength of the relationships. SUV{sub max} measured in two centers were mathematically evaluated (regression modeling) and determined to be comparable. Of 49 patients, 47 (96 %) exhibited a positive NETest. Twenty-six (54 %) had elevated CgA (χ{sup 2} = 20.1, p < 2.5 x 10{sup -6}). The majority (78 %) had Ki-67 < 20 %. Gene transcript scores were predictive of imaging with >95 % concordance and significantly correlated with SUV{sub max} (R {sup 2} = 0.31, root-mean-square error = 9.4). The genes MORF4L2 and somatostatin receptors SSTR1, 3, and 5 exhibited the highest correlation with SUV{sub max}. Progressive disease was identified by elevated levels of a quotient of MORF4L2 expression and SUV{sub max} [ROC-derived AUC (R {sup 2} = 0.7, p < 0.05)]. No statistical relationship was identified

  7. Gene transcript analysis blood values correlate with 68Ga-DOTA-somatostatin analog (SSA) PET/CT imaging in neuroendocrine tumors and can define disease status

    International Nuclear Information System (INIS)

    Precise determination of neuroendocrine tumor (NET) disease status and response to therapy remains a rate-limiting concern for disease management. This reflects limitations in biomarker specificity and resolution capacity of imaging. In order to evaluate biomarker precision and identify if combinatorial blood molecular markers and imaging could provide added diagnostic value, we assessed the concordance between 68Ga-somatostatin analog (SSA) positron emission tomography (PET), circulating NET gene transcripts (NETest), chromogranin A (CgA), and Ki-67 in NETs. We utilized two independent patient groups with positive 68Ga-SSA PET: data set 1 (68Ga-SSA PETs undertaken for peptide receptor radionuclide therapy (PRRT), as primary or salvage treatment, n = 27) and data set 2 (68Ga-SSA PETs performed in patients referred for initial disease staging or restaging after various therapies, n = 22). We examined the maximum standardized uptake value (SUVmax), circulating gene transcripts, CgA levels, and baseline Ki-67. Regression analyses, generalized linear modeling, and receiver-operating characteristic (ROC) analyses were undertaken to determine the strength of the relationships. SUVmax measured in two centers were mathematically evaluated (regression modeling) and determined to be comparable. Of 49 patients, 47 (96 %) exhibited a positive NETest. Twenty-six (54 %) had elevated CgA (χ2 = 20.1, p < 2.5 x 10-6). The majority (78 %) had Ki-67 < 20 %. Gene transcript scores were predictive of imaging with >95 % concordance and significantly correlated with SUVmax (R 2 = 0.31, root-mean-square error = 9.4). The genes MORF4L2 and somatostatin receptors SSTR1, 3, and 5 exhibited the highest correlation with SUVmax. Progressive disease was identified by elevated levels of a quotient of MORF4L2 expression and SUVmax [ROC-derived AUC (R 2 = 0.7, p < 0.05)]. No statistical relationship was identified between CgA and Ki-67 and no relationship with imaging parameters was evident. 68Ga-SSA

  8. STUDI TEORITIS ISO 9000 DAN TQM: SUBSTITUSI ATAU KOMPLEMETER?

    Directory of Open Access Journals (Sweden)

    Harianto Respati

    2007-09-01

    Full Text Available Banyak pertentangan pendapat tentang dampak ISO 9000 dan TQM dalam kaitannya dengan tujuannya yakni kepuasan pelanggan. Selain itu peran ISO 9000 dan TQM dipandang masih membingungkan. Penjelasan pada jurnal ini, diuraikan secara konseptual baik dari pernyataan para pakar maupun hasil-hasil penelitian terdahulu tentang peran ISO 9000 dan TQM. Hasil menujukkan bahwa secara umum ISO 9000 dan TQM mempunyai tujuan yang sama yakni kepuasan pelanggan. Peran implementasi sertifikasi ISO 9000 dan praktek TQM adalah komplementer artinya ISO 9000 dan TQM merupakan sistem yang terpadu serta bekerja sama untuk mencapai sasaran yakni kepuasan pelanggan. Kajian teoritis tentang peran ISO 9000 dan TQM bertujuan untuk mempertegas keberadaan ISO 9000 dan TQM untuk kepentingan para peneliti, akademik maupun para praktisi

  9. POTENSI DAN KARAKTERISTIK PRODUKSI Lemna minor PADA BERBAGAI MEDIA TANAM

    Directory of Open Access Journals (Sweden)

    Iwan Prihantoro

    2015-06-01

    Full Text Available Lemna minor merupakan jenis tanaman yang hidup dominan pada perairan dengan kualitas nutrisi tinggi dan potensial sebagai sumber hijauan pakan bagi ternak. Penelitian ini bertujuan untuk mengukur potensi Lemna minor dan karakteristiknya pada berbagai media tanam untuk mendapatkan teknik produksi yang optimal. Penelitian dilakukan pada bak plastik dengan ukuran 36.5×27×10 cm3 selama dua minggu. Rancangan yang digunakan adalah Acak Lengkap (RAL dengan lima perlakuan media dan lima ulangan. Jenis media yang digunakan adalah kontrol, hoagland, hyponex, kompos dan NPK. Parameter yang diukur meliputi serapan nitrogen, pH media, cover area, penyusutan media, dan produksi biomassa. Hasil penelitian menunjukkan bahwa lemna minor efektif dalam memanfaatkan nitrogen dengan nilai serapan > 98 %, media kompos memberikan status pH media yang stabil/netral dan pertambahan luas cover area (LCA tercepat dan tingkat produksi biomassa Lemna minor terbaik pada media kompos dan Hoagland.

  10. Teach us atom structure

    International Nuclear Information System (INIS)

    This book is written to teach atom structure in very easy way. It is divided into nine chapters, which indicates what is the components of matter? when we divide matter continuously, it becomes atom, what did atom look like? particles comprised of matter is not only atom, discover of particles comprised of atom, symbol of element, various radiation, form alchemy to nuclear transmutation, shape of atom is evolving. It also has various pictures in each chapters to explain easily.

  11. Teach us atom structure

    Energy Technology Data Exchange (ETDEWEB)

    Lim, Suh Yeon

    2006-08-15

    This book is written to teach atom structure in very easy way. It is divided into nine chapters, which indicates what is the components of matter? when we divide matter continuously, it becomes atom, what did atom look like? particles comprised of matter is not only atom, discover of particles comprised of atom, symbol of element, various radiation, form alchemy to nuclear transmutation, shape of atom is evolving. It also has various pictures in each chapters to explain easily.

  12. Atomic phase diagram

    Institute of Scientific and Technical Information of China (English)

    LI Shichun

    2004-01-01

    Based on the Thomas-Fermi-Dirac-Cheng model, atomic phase diagram or electron density versus atomic radius diagram describing the interaction properties of atoms of different kinds in equilibrium state is developed. Atomic phase diagram is established based on the two-atoms model. Besides atomic radius, electron density and continuity condition for electron density on interfaces between atoms, the lever law of atomic phase diagram involving other physical parameters is taken into account, such as the binding energy, for the sake of simplicity.

  13. PROFIL KEADAAN GIZI USILA DI DKI JAKARTA DAN YOGYAKARTA

    OpenAIRE

    Heryudarini Harahap; Anies Irawati; Dyah Santi Puspitasari; Sihadi Sihadi; Husaini, M.A.

    2012-01-01

    Telah dilakukan penelitian tentang profil keadaan gizi usila di DKI Jakarta dan DIY. DKI Jakarta menggambarkan daerah perkotaan dengan etnik yang beragam; DIY menggambarkan daerah pedesaan dengan etnik Jawa yang kebudayaannya masih kuat dalam kehidupan sehari-hari. Penelitian dilakukan pada 90 orang usila di DKI Jakarta dan 180 usila di DIY dengan tingkat sosial ekonomi rendah. Hasil penelitian menunjukkan 82.8% dan 58.3% usila masing-masing untuk DKI Jakarta dan DIY adalah perempuan. Usila p...

  14. KERJASAMA INDIA DAN PAKISTAN DALAM PENGELOLAAN SUNGAI INDUS

    OpenAIRE

    ANUGRAH, RARA

    2015-01-01

    Rara Anugrah E131 11 261, Kerjasama India dan Pakistan Dalam Pengelolaan Sungai Indus, dibawah bimbingan Bapak Muh.Nasir Badu, Ph.D sebagai pembimbing I dan Ibu Nur Isdah, S.IP, MA sebagai pembimbing II, Jurusan Ilmu Hubungan Internasional, Fakultas Ilmu Sosial dan Ilmu Politik, Universitas Hasanuddin. Penelitian ini bertujuan untuk mengetahui kerjasama India dan Pakistan dalam mengelola Sungai Indus berdasarkan pada per...

  15. Motivasi dan Kinerja Karyawan di Hotel Madani Medan

    OpenAIRE

    Ramadan, Chaidir

    2016-01-01

    Menurut Kusmayadi (2004: 102) Kinerja merupakan suatu hasil kerja yang dicapai seseorang dalam melaksanakan tugas-tugas yang dibebankan kepadanya yang didasarkan atas kecakapan, pengalaman dan kesungguhan serta waktu. Kinerja karyawan ini adalah “Gabungan dari tiga faktor penting yaitu kemampuan dan minat seseorang pekerja, kemampuan dan penerimaan atas penjelasan delegasi tugas dan peran serta tingkat motivasi seorang pekerja”. Semakin tinggi ketiga faktor di atas, maka semakin besarlah kine...

  16. Insight, obsession et verification dans le trouble obsessionnel-compulsif

    OpenAIRE

    Jaafari, N.; Daniel, M.-L.; Lacoste, J.; Bacconnier, M.; Belin, D; Rotge, J.Y.

    2011-01-01

    Resume Introduction ? L?insight a une place centrale dans le trouble obsessionnel compulsif (TOC), il conditionne la prise en charge diagnostique et therapeutique du patient. Cependant, le role de l?insight dans l?emergence des symptomes obsessionnels compulsifs demeure controverse. Dans le but de clarifier le role de l?insight dans le TOC, nous avons evalue la relation entre le degre d?insight et certaines alterations cognitives qui font le lit de l?expression symptomatique. Pour ...

  17. MODEL TES DAN ANALISIS PRESTASI BELAJAR MATEMATIK SISWA SEKOLAH DASAR

    OpenAIRE

    Zamsir Zamsir

    2013-01-01

    Penelitian ini bertujuan untuk menemukan model tes dan analisis prestasi belajar siswa yang dapat dipakai untuk melakukan identifikasi level kemampuan dan menyusun profil pencapaian kompetensi siswa, khususnya di sekolah dasar. Penelitian ini merupakan penelitian pengembangan model yang dikembangkan menyangkut dua hal, yaitu: (1) prosedur dan langkah-langkah penyusunan tes serta teknik identifikasi level kemampuan siswa, dan (2) pelaporan hasil tes. Identifikasi dilakukan dengan cara menempat...

  18. PENGOLAHAN LINDI DENGAN OZON DAN PROSES OKSIDASI LANJUT BERBASIS OZON

    OpenAIRE

    Mohamad Rangga Sururi; Siti Ainun Saleh; Amalia Krisna

    2014-01-01

    Limbah industri tekstil di area pinggir kota Surabaya mempunyai karakteristik perbandingan COD dan BOD = 5.57. Limbah jenis ini sulit untuk dibiodegradasi. Studi ini mempelajari tekonologi elektrokoagulasi untuk mengolah limbah tekstil dengan menurunkan intensitas warna, Total Suspended Solid (TSS) dan Chemical Oxygen Demand (COD). Percobaan batch pada suhu kamar dilakukan untuk mempelajari pengaruh pH, jarak elektroda terhadap penurunan warna,TSS dan COD dan membandingkan biaya operasinya ji...

  19. KORELASI ANTARA BIMBINGAN KONSELING ISLAM DAN DAKWAH

    Directory of Open Access Journals (Sweden)

    Marzuki Agung Prasetya

    2015-11-01

    Full Text Available Dakwah merupakan kegiatan untuk menyeru, memanggil dan mengajak orang lain menuju jalan yang diridhai Allah. Bimbingan dan Konseling Islam merupakan cabang dalam rumpun ilmu-ilmu sosial yang mulai dikembangkan sebagai disiplin ilmu yang mandiri. Keberadaan aktifitas bimbingan dan konseling Islam tersebut didasarkan pada kenyataan bahwa dalam menghadapi dan menyelesaikan masalah, ada individu yang mampu menyelesaikan sendiri, namun ada juga yang membutuhkan bantuan pihak lain. Dalam prakteknya bimbingan konseling akan mengacu pada beberapa pendekatan, diantaranya: pendekatan behavioristik, psikodinamika, eklektik, psikoanalisa dan eksistensial humanistik. Pendekatan tersebut dipilih berdasarkan kondisi klien, masalah yang dihadapi, kemampuan konselor selaku pihak yang memberikan bimbingan maupun kondisi dan situasi pada saat bimbingan konseling berlangsung. Menurut Hamdan Bakran ad-Dzaky, bimbingan konseling Islam merupakan suatu aktifitas memberikan bimbingan, pelajaran,dan pedoman kepada individu yang meminta bimbingan (klien dalam hal bagaimana seharusnya dirinya dapat mengembangkan akal dan pikirannya, jiwanya, keimanannya dan keyakinannya, serta dapat menanggulangi problematika hidup dengan baik dan benar sacara mandiri, yang berparadigma kepada Al-Quran dan as-Sunnah Rasulullah saw. Proses pelaksanaan bimbingan konseling Islam mengacu pada prinsip- prinsip etika berdakwah dalam Islam, yakni bi al-hikmah, al-mauidhah hasanah, dan al-mujadalah bi al-lati hiya ahsan. Tulisan ini melihat relasi antara bimbingan konseling Islam dan dakwah, sehingga dapat diketahui bagaimana hubungan yang terjalin antara keduanya. Kata Kunci: Dakwah, Bimbingan, Konseling Islam. THE CORRELATION BETWEEN ISLAMIC COUNSELING GUIDANCE AND DAWA. Dawa is an activity to call and invite others towards the path of Allah. Islamic Guidance and Counselling is a branch of social sciences which began to be developed as an independent discipline. The existence of the Islamic

  20. Cold Matter Assembled Atom-by-Atom

    CERN Document Server

    Endres, Manuel; Keesling, Alexander; Levine, Harry; Anschuetz, Eric R; Krajenbrink, Alexandre; Senko, Crystal; Vuletic, Vladan; Greiner, Markus; Lukin, Mikhail D

    2016-01-01

    The realization of large-scale fully controllable quantum systems is an exciting frontier in modern physical science. We use atom-by-atom assembly to implement a novel platform for the deterministic preparation of regular arrays of individually controlled cold atoms. In our approach, a measurement and feedback procedure eliminates the entropy associated with probabilistic trap occupation and results in defect-free arrays of over 50 atoms in less than 400 ms. The technique is based on fast, real-time control of 100 optical tweezers, which we use to arrange atoms in desired geometric patterns and to maintain these configurations by replacing lost atoms with surplus atoms from a reservoir. This bottom-up approach enables controlled engineering of scalable many-body systems for quantum information processing, quantum simulations, and precision measurements.

  1. LEMAK TUBUH DAN KESEGARAN JASMANI PEKERJA INDONESIA

    Directory of Open Access Journals (Sweden)

    Y. Krisdinamurtirin

    2012-11-01

    Full Text Available Penelitian mengenai Lemak Tubuh dan Kesegaran Jasmani telah dilakukan terhadap 62 orang karyawan gemuk, 73 orang karyawan sedang dan 86 orang karyawan kurus. Mereka terdiri atas kelompok Gemuk Aktif (GPA: 33 orang; Gemuk Sendentary (GPSD: 29 orang; Sedang Aktif (SPA: 33 orang; Sedang Sendentary (SPSD: 40 orang; Kurus Aktif (KPA: 35 orang; Kurus Sendentary (KPSD: 51 orang. Umur mereka adalah antara 20 tahun dan 40 tahun. Uji Kesegaran jasmani menggunakan cara Harvard Step Test (HST menunjukkan bahwa skor list kelompok Gemuk cenderung kurang bila dibandingkan dengan kelompok Sedang maupun Kurus. Uji kemaknaan perbedaan secara statistik menggunakan Student test, ternyata perbedaan terdapat pada tingkat Kegemukan, sedangkan pada tingkat jenis kegiatan (aktif/sendentary tidak menunjukkan perbedaan skor. Demikian pula clengan menggunakan Analisis Variance, menunjukkan bahwu ada kailan antaru Kegemuknn dengan skor HST (P:0,002, sedangkan antara jenis kegiatan dengan skor HST tidak ada kaitan (P:0,9049. Garis regresi memberikan gambaran bahwa makin tinggi presentase lemak tubuh, tingkat kesegaran jasmani yang dinyatakan dalam skor HST makin menurun. Garis regresi antara% 88/TB dengan kesegaran jasmani, memberikan gambaran pula ada kecenderungan bahwa pada % 88/TB 100%, kesegaran jasmani menurun. Sedangkan regresi antara kesegaran jasmani dengan tinggi duduk tidak menunjukkan kaitan yang jelas. Tetapi antara urnur dan kesegaran jasmani, menunjukkan ada kecenderungan makin tinggi urnur, kesegaran jasmani menurun. Kesimpulan dari penelitlan inl ialah bahwa ada kaitan antara kesegaran jasmani yang dinyatakan dalam skor Uji HST dengan (a kegemukan dan (b umur.

  2. ANALISIS PERBANDINGAN SPAP, IAS DAN SPKN

    Directory of Open Access Journals (Sweden)

    Maylia Pramono Sari

    2012-03-01

    Full Text Available Dalam mewujudkan Good Goveronance  akan dilakukan analisis perbandingan mengenai standar pemeriksaan nasional yaitu SPAP, ISA, dan SPKN untuk menemukan standar yang lebih tepat dan lebih lengkap untuk pemeriksaan sektor publik. Persamaan SPKN dan ISS  adalah tanggungjawab manajemen dan tanggungjawab auditor sedangkan perbedaannya adalah badan yang menerbitkannya. Perbedaan yang mendasar terletak pada karakter pemeriksaan BPK. Karakter tersebut adalah keharusan pemeriksa BPK untuk merancang prosedur pemeriksaan terhadap kepatuhan yang terkait dengan pemeriksaan yang dilakukan dan waspada atas penyimpangan lainnya. Abstract To realize Good Governance, it needs a comparative analysis for finding out the national standardization of SPAP, ISA, and SPKN . It is used for auditing public sector. SPKN and ISA have similarities and difference. Both SPKN and ISA have the same responsibility of management and audit. SPKN and ISA  have different characteristics in auditing. The compliance of audit procedure is obligatory for  BPK. Moreover, it becomes the strength of BPK RI and the one that make BPK and KAP different.Keywords: SPAP; ISA; SPKN

  3. Dans le grand collisionneur du CERN

    CERN Document Server

    Campanelli, Mario

    2014-01-01

    Ce livre fait pénétrer le lecteur non initié dans l’instrument scientifique le plus grand du monde. D’ailleurs, le web fut précisément inventé à Genève en vue d’une collaboration aussi gigantesque. Résultat de vingt ans de recherche, le LHC, Grand collisionneur de hadrons, est l’anneau de 26,7 km creusé sous la frontière francosuisse, où sont accélérés, en sens opposés, des paquets de particules jusqu’à des vitesses et des énergies extrêmes. Ainsi la physique s’est-elle engagée dans une étape nouvelle de nos connaissances. Après les grandes découvertes de l’univers et de la réalité microscopique du siècle dernier, le collisionneur nous fait progresser aujourd’hui dans un «nuage de probabilités» aux frontières de l’antimatière. Dans une bousculade de particules, voici le champ convoité du boson de Higgs. Mario Campanelli, professeur associé à l’Université de Londres et collaborateur au projet ATLAS du LHC, propose, dans cet ouvrage, de s’introduire pas �...

  4. Dans le tourbillon des particules

    CERN Document Server

    Zito, Marco

    2015-01-01

    Accélérateurs géants, détecteurs complexes, particules énigmatiques... La physique subatomique peut sembler bien intimidante pour le novice. Et pourtant, qui n a jamais entendu parler du boson de Higgs et du CERN, le laboratoire européen où il a été découvert en 2012 ? Nul besoin d être un spécialiste pour comprendre de quoi il s agit. Aujourd hui, une théorie extraordinairement élégante, le Modèle Standard, décrit tous les résultats des expériences dans le domaine. Trente-sept particules élémentaires et quatre forces fondamentales : c est tout ce dont nous avons besoin pour expliquer la matière et l Univers ! Ce livre, destiné à un large public, raconte sans équations le long parcours qui a abouti au Modèle Standard. Ce parcours, parfois sinueux, a été entamé lorsque les Grecs anciens, et peut-être d autres avant eux, ont imaginé que la matière est composée de petites « billes ». Il faudra attendre plusieurs siècles pour qu on réalise que la matière, à l échelle micros...

  5. HUBUNGAN ANTARA JUDGMENT AUDIT DENGAN RESIKO DAN MATERIALITAS

    OpenAIRE

    Eko Madyo Sutanto

    2014-01-01

    Laporan audit auditor harus mempertimbangkan masalah materialitas, risiko dan penilaian. Pertimbangan Materialitas termasuk kualitatif dan kuantitatif pertimbangan. Pertimbangan kuantitatif berhubungan dengan kesalahan yang menjadi penentu dalam laporan keuangan. Sementara faktor kualitatif berhubungan dengan penyebab kesalahan tersebut. Untuk menghindari atau meminimalkan risiko audit, menurut Standar Audit seksi 312 menekankan “Risiko audit dan Materialitas dalam Pelaksanaan audit”, maka au...

  6. PENGARUH KEPUASAN KERJA DAN KOMITMEN ORGANISASI TERHADAP ORGANIZATIONAL CITIZENSHIP BEHAVIOR

    OpenAIRE

    Arum Darmwati; Lina Nur Hayati; Dyna Herlina S.

    2013-01-01

    Abstrak: Pengaruh Kepuasan Kerja dan Komitmen Organisasi Terhadap Organizational Citizenship Behavior. Penelitian ini bertujuan untuk mengetahui pengaruh kepuasan kerja dan komitmen organisasi terhadap organizational citizenship behavior. Penelitian ini merupakan penelitian korelasional dengan mengambil sampel karyawan bagian Tata Usaha FISE UNY. Metode pengumpulan datanya menggunakan metode survey dan analisis datanya menggunakan analisis regresi berganda. Penelitian ini menemukan bahwa vari...

  7. Legenda Penciptaan Teater Boneka Tiongkok dan Persebarannya di Nusantara

    OpenAIRE

    Hirwan Kuardhani; C. Bakdi Soemanto; Lono Lastoro Simatupang; Timbul Haryono

    2013-01-01

    Wayang Cina berkembang pesat di Indonesia. Beberapa legenda Cina berkembang mengikuti berkembangnyawayang tersebut, misalnya: Legenda Madame Li, legenda Chen Ping, dan legenda Yan. Beberapa lagenda tersebutdibawa oleh imigran Cina ke wilayah Indonesia, seperti Marionette, yang dikenal sebagai wayang gantung , yangdikembangkan di sekitar Pontianak dan Singkawang. Marionette disajikan dalam dialek Hakka dan menyajikanlegenda Cina. Sementara boneka sarung tangan yang dikenal adalah wayang Potehi...

  8. ALMA DEEP FIELD IN SSA22: A CONCENTRATION OF DUSTY STARBURSTS IN A z = 3.09 PROTOCLUSTER CORE

    Energy Technology Data Exchange (ETDEWEB)

    Umehata, H.; Ivison, R. J. [European Southern Observatory, Karl-Schwarzschild-Str. 2, D-85748 Garching (Germany); Tamura, Y.; Kohno, K.; Izumi, T.; Makiya, R. [Institute of Astronomy, School of Science, The University of Tokyo, 2-21-1 Osawa, Mitaka, Tokyo 181-0015 (Japan); Alexander, D. M.; Smail, I. [Centre for Extragalactic Astronomy, Department of Physics, Durham University, South Road, Durham DH1 3LE (United Kingdom); Geach, J. E. [Centre for Astrophysics Research, Science and Technology Research Institute, University of Hertfordshire, Hatfield AL10 9AB (United Kingdom); Hatsukade, B.; Kato, Y.; Kawabe, R.; Lee, M.; Matsuda, Y.; Nakanishi, K.; Saito, T. [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan); Hughes, D. H. [Department of astronomy, University of Massachusetts, Amherst, MA 01003 (United States); Ikarashi, S. [Kapteyn Astronomical Institute, University of Groningen, P.O. Box 800, 9700AV Groningen (Netherlands); Kubo, M. [Institute for Cosmic Ray Research, University of Tokyo, 5-1-5 Kashiwa-no-Ha, Kashiwa City, Chiba 277-8582 (Japan); Lehmer, B., E-mail: humehata@eso.org [Department of Physics, University of Arkansas, 226 Physics Building, 835 West Dickson Street, Fayetteville, AR 72701 (United States); and others

    2015-12-10

    We report the results of 1.′5 × 3′ mapping at 1.1 mm with the Atacama Large Millimeter/submillimeter Array toward the central region of the z = 3.09 SSA22 protocluster. By combining our source catalog with archival spectroscopic redshifts, we find that eight submillimeter galaxies (SMGs) with flux densities, S{sub 1.1} {sub mm} = 0.7–6.4 mJy (L{sub IR} ∼ 10{sup 12.1}–10{sup 13.1} L{sub ⊙}) are at z = 3.08–3.10. Not only are these SMGs members of the protocluster, but they in fact reside within the node at the junction of the 50 Mpc scale filamentary three-dimensional structure traced by Lyα emitters in this field. The eight SMGs account for a star formation rate density (SFRD) ∼10 M{sub ⊙} yr{sup −1} Mpc{sup −3} in the node, which is two orders of magnitudes higher than the global SFRD at this redshift. We find that four of the eight SMGs host an X-ray-luminous active galactic nucleus. Our results suggest that the vigorous star formation activity and the growth of supermassive black holes (SMBHs) occurred simultaneously in the densest regions at z ∼ 3, which may correspond to the most active historical phase of the massive galaxy population found in the core of the clusters in the present universe. Two SMGs are associated with Lyα blobs, implying that the two populations coexist in high-density environments for a few cases.

  9. PERGESERAN KARIR TRADISIONAL MENJADI KARIR PROTEAN: DAMPAK DAN IMPLIKASINYA PADA INDIVIDU DAN PERUSAHAAN

    Directory of Open Access Journals (Sweden)

    Christofera Marliana Junaedi

    2003-01-01

    Full Text Available It was started by The Great Depression in America that so many changes happened on the organization internally and externally, and the change of career development from career job to protean career as well. Some researchers prove it and state that the job esspecially for career nowadays is different from it was few decades ago. The effect of this changes occur on the system and value that employees have and career development management conducted by the company. This article will discuss the change factor of company internally and externally, its effects,the subtitution of the new paradigm from the old one, and also its implications on the individu and the company. Abstract in Bahasa Indonesia : Berawal dari terjadinya depresi yang besar (The Great Depression di Amerika yang menyebabkan perubahan organisasi secara internal dan eksternal, perubahan pengembangan karir pun bergeser dari karir tradisional menjadi karir protean. Banyak peneliti yang membuktikannya dan menyatakan bahwa karir saat ini berbeda dengan beberapa decade sebelumnya. Dampak dari perubahan ini tentu saja menimbulkan sistem dan nilai yang dimiliki karyawan dan juga manajemen pengembangan karir perusahaan. Artikel ini akan membahas tentang perubahan factor internal dan eksternal organisasi, dampaknya pada perubahan paradigma dari paradigma lama menjadi baru, dan juga implikasinya pada individu dan perusahaan. Kata kunci: karir tradisional, karir protean, paradigma lama, paradigma baru, manajemen karir.

  10. EFEKTIVITAS MODEL BLENDED LEARNING TERHADAP MOTIVASI DAN TINGKAT PEMAHAMAN MAHASISWA MATA KULIAH ALGORITMA DAN PEMROGRAMAN

    Directory of Open Access Journals (Sweden)

    Sarah Bibi

    2015-02-01

    Full Text Available Penelitian ini bertujuan untuk (1 mengetahui perbedaan motivasi dan tingkat pemahaman mahasiswa antara pembelajaran model blended learning dengan pembelajaran konvensional, dan (2 mengetahui peningkatan motivasi dan tingkat pemahaman mahasiswa akibat penerapan pembelajaran model blended learning. Jenis penelitian ini adalah quasi experimental. Populasi penelitian adalah mahasiswa semester 2 tahun ajaran 2013/2014 Program Studi Pendidikan Teknologi Informasi dan Komputer STKIP PGRI Pontianak yang berjumlah sebanyak 270 mahasiswa. Penentuan sampel menggunakan teknik purposive sampling berjumlah 156 mahasiswa. Pengumpulan data menggunakan tes soal berbentuk pilihan ganda dan angket, teknik analisis data yang digunakan adalah statistik parametrik uji-t dengan taraf signifikansi 0,05. Hasil penelitian ini menunjukkan bahwa (1 terdapat perbedaan motivasi belajar mahasiswa antara pembelajaran model blended learning dengan pembelajaran konvensional sebesar 5,782 dan terdapat perbedaan tingkat pemahaman sebesar 9,935 serta (2 ada peningkatan motivasi belajar mahasiswa akibat penerapan pembelajaran model blended learning rata-rata peningkatan 11,705 dan ada peningkatan pemahaman mahasiswa rata-rata peningkatan 30,288.

  11. Implementasi dan Evaluasi Kinerja Modulasi dan Demodulasi GMSK dengan menggunakan WARP

    Directory of Open Access Journals (Sweden)

    Dwi Putri Kusumadewi

    2015-03-01

    Full Text Available Modulasi GMSK ( Gaussian Minimum Shift Keying adalah teknik modulasi yang mengurangi spectrum sidelobe pada modulasi Minimum Shift Keying (MSK dengan cara melewatkan sinyal NRZ ke filter LPF Gaussian. Pada Tugas Akhir ini dilakukan proses perancangan dan implementasi modulasi dan demodulasi GMSK pada platform WARP. Proses perancangan modulasi GMSK dilakukan melalui pemrograman pada software MATLAB 2012. Sistem diimplementasi pada modul WARPLab7. Jumlah bit yang dibangkitkan adalah 106800 bit. Sebelum sistem diimplementasikan pada modul WARP, sinyal hasil ditambahkan dengan bit pilot dan preamble yang nantinya berguna untuk mendeteksi data informasi di penerima. Setelah penambahan pilot dan preamble, data di upsample terlebih dahulu kemudian dilakukan proses upconvert agar dapat dikirimkan melalui WARP. Pengujian implementasi sistem dilakukan dengan cara pengukuran nilai BER (Bit Error Rate secara real pada beberapa kondisi, diantaranya perbedaan nilai BT, perbedaan jarak antara node pengirim dan node penerima dan kondisi LOS (Line of Sight dan NLOS (No Line of Sight.  Berdasarkan hasil pengujian didapatkan pada lingkungan indoor nilai BER terkecil diperoleh pada jarak 4 meter kondisi LOS dengan TxRF sebesar -22.97 dBm dengan BER 6x10-6, sedangkan untuk lingkungan outdoor nilai BER terkecil diperoleh pada jarak 6 meter kondisi LOS dengan TxRF sebesar -22.97 dBm dengan BER 6.9x10-5

  12. Pengaruh Variasi Kadar Zn Dan Temperatur Hydrotermal Terhadap Struktur Dan Nilai Konduktivitas Elektrik Material Graphene

    Directory of Open Access Journals (Sweden)

    Lita Nur Azizah

    2014-09-01

    Full Text Available Graphene adalah bentuk 2D dari karbon dengan sifat-sifat unggul yang menarik untuk dikembangkan. Permasalahan yang kemudian muncul adalah proses sintesis massal yang masih menjadi kendala. Penelitian ini bertujuan untuk mensintesis material graphene secara kimiawi dengan menggunakan reduktor zinc dan metode hydrothermal dan menganalisa pengaruh varaiasi penambahan massa sebesar 0,8 gram, 1,6 gram, dan 2,4 gram zinc serta variasi temperatur hydrthermal 160ᵒC, 180ᵒC, 200ᵒC. Proses karakterisasi material graphene dilakukan dengan pengujian Scanning Electron Microscope (SEM, X-Ray Diffraction (XRD, Fourier Transform Infrared spectroscopy, Uji Iodine number, dan Four Point Probe digunakan untuk mengetahui nilai konduktivitas elektrik material. Morfologi dari graphene yang dihasilkan berbentuk lembaran-lembaran transparan dan disertai dengan kerutan pada permukaannya. Nilai konduktivitas elektrik terbesar dihasilkan dari variasi panambahan serbuk zinc sebesar 0,8 gram dan temperatur hydrothermal sebesar 200ᵒC dengan nilai sebesar 0,10281 S/cm dan bilangan iodine 11384,64.

  13. STUDI KANDUNGAN DAN DISTRIBUSI SPASIAL LOGAM BERAT TIMBAL (Pb) PADA SEDIMEN DAN KERANG (Anadara Sp) DI WILAYAH PESISIR KOTA MAKASSAR

    OpenAIRE

    Payung, Febrianti Lolo; Ruslan; Birawida, Agus Bintara

    2013-01-01

    Wilayah pesisir Kota Makassar cukup pesat dengan aktifitas industri dan Kegiatan rumah tangga, serta adanya kegiatan di hulu sungai yang dapat memberikan sumbangsi terbesar bagi pencemaran laut yang berbahaya baik terhadap kehidupan kerang (Anadara sp) dan kesehatan manusia.Penelitian ini bertujuan mengetahui kandungan dan distribusi spasial logam berat timbal (Pb) pada sedimen dan kerang di wilayah pesisir Kota Makassar.Jenis penelitian ini adalah penelitian observasional dengan desain deskr...

  14. KESESUAIAN BERAT BADAN DAN TINGGI BADAN TERHADAP ESTIMASI BERAT BADAN DAN TINGGI BADAN PADA USIA DEWASA ETNIS BUGIS KABUPATEN WAJO

    OpenAIRE

    Marhayati; Citrakesumasari; Salam, Abdul

    2015-01-01

    Penilaian status gizi pasien rawat inap di rumah sakit saat ini masih sulit dilakukan karena kondisi pasien yang harus berbaring ditempat tidur. Pengukuran antropometri menjadi bagian dari penilaian status gizi sebagai dasar perhitungan kebutuhan gizi pasien dan untuk menentukan risiko timbulnya masalah gizi. Tujuan penelitian untuk mengetahui kesesuaian antara berat badan dan tinggi badan dengan estimasi berat badan dan tinggi badan berdasarkan LiLA, TILUT dan RL usia dewasa Bugis. Jenis pen...

  15. KESESUAIAN BERAT BADAN DAN TINGGI BADAN TERHADAP ESTIMASI BERAT BADAN DAN TINGGI BADAN PADA USIA DEWASA ETNIS MAKASSAR KABUPATEN JENEPONTO

    OpenAIRE

    Hamid, Nursiami; Jafar, Nurhaedar; Citrakesumasari

    2015-01-01

    Data berat badan dan tinggi badan sangat diperlukan dalam penilaian status gizi, penentuan kebutuhan zat gizi pasien dan pemberian terapi seperti obat atau obat terapi lainnya. Penelitian ini bertujuan untuk mengetahui kesesuaian (kofesien korelasi) antara BB dengan estimasi BB berdasarkan LiLA dan TBA dengan estimasi TB berdasarkan TILUT dan RL pada usia dewasa etnis Makassar. Jenis penelitian ini adalah penelitian deskriptif numeric dengan desain penelitian cross sectional.Teknik sampling m...

  16. Stres dan Koping Mahasiswa Kepribadian Tipe A dan Tipe B dalam Menyusun Skripsi di Fakultas Keperawatan Universitas Sumatera Utara

    OpenAIRE

    Hasibuan, Masnun Dewani

    2012-01-01

    Stres merupakan gangguan pada tubuh dan pikiran yang disebabkan oleh perubahan dan tuntutan kehidupan. Stres bisa terjadi pada siapa saja mulai dari anak-anak, remaja, dewasa dan lansia. Sumber- sumber stres salah satunya adalah tipe kepribadian. Sedangkan koping merupakan cara yang dilakukan individu dalam menyelesaikan masalah, menyesuaikan diri dengan perubahan atau respons terhadap situasi yang mengancam. Penelitian ini bertujuan untuk mengetahui perbedaan stres dan koping mahasiswa kepri...

  17. Calcul de haute précision d'énergies de transitions dans les atomes exotiques et les lithiumoïdes : corrections relativistes, corrections radiatives, structure hyperfine et interaction avec le cortège électronique résiduel

    OpenAIRE

    Boucard, Stéphane

    1998-01-01

    In this work we present the calculations of transition energies inlithiumlike and in exotics atoms : 1) With the use of new ions beamsource, it is now possible to produce highly charged ions. We thushave studied li-like ions hyperfine structure to obtain information onrelativistic many-body corrections and the magnetic sector of strongfield QED. In heavy ions these are of the order of a few percent ofthe total transition energy. We also evaluated the Bohr-Weisskopfcorrection, which depends on...

  18. Transfert de rayonnement hors ETL pour l'étude des photosphères et des chromosphères stellaires : applications aux atomes du magnésium, du calcium et du fer dans les étoiles tardives.

    OpenAIRE

    Merle, Thibault

    2012-01-01

    The stellar abundance analysis frequently relies on the local thermodynamic equilibrium (LTE) assumption for spectral line formation. This assumption is not always appropriate, in particular, for metal-poor and/or evolved stars. To better understand these stars and contrain their impacts in the chemical enrichment of the Galaxy, it is necessary to use a non-LTE (NLTE) description more realistic but also more complex to built up. My thesis work consisted in constructing model atoms from the mo...

  19. Customer Services Dan Kepuasan Nasabah (Study Korelasional Antara Aktivitas Customer Service Dan Kepuasaan Nasabah di Bank Syariah Bank Mandiri Medan)

    OpenAIRE

    Wulandari, Ratih

    2010-01-01

    Penelitian ini berjudul COSTUMER SERVICE DAN KEPUASAN NASABAH sebuah studi korelasional tentang hubungan antara aktivitas customer service dan kepuasan nasabah di PT. Bank Syariah Mandiri. Masalah dalam penelitian ini adalah Sejauhmanakah pengaruh Customer Service PT. Bank Syariah Mandiri dapat memberi kepuasan kepada nasabah ?”. Tujuan penelitian adalah untuk mengetahui bagaimana kepuasan yang dirasakan nasabah Bank Syariah Mandiri Medan dan untuk mengetahui sejauhmana peng...

  20. Intrication de deux atomes en utilisant le blocage de Rydberg

    Science.gov (United States)

    Gaëtan, A.

    2010-12-01

    Considérons un système quantique constitué de deux sous-systèmes : on dit qu'il est dans un état intriqué s'il existe des corrélations quantiques entre les états de ces derniers. La compréhension et la mise en œuvre d'états intriqués ont de nombreuses applications (métrologie quantique, étude des systèmes fortement corrélés, traitement quantique de l'information, etc.) et constituent le contexte général de ce travail de thèse. Plus en détail, nous démontrons la réalisation d'un état intriqué de deux atomes neutres piégés indépendamment. Pour cela, nous exploitons le phénomène de blocage de Rydberg : lorsqu'on essaie d'exciter simultanément deux atomes séparés de quelques micromètres vers un état de Rydberg donné, la forte interaction entre atomes de Rydberg peut empêcher cette excitation simultanée. Dans ce cas, seul un des deux atomes est excité et l'on génère ainsi des corrélations quantiques entre les états des deux atomes, c'est-à-dire de l'intrication. Dans notre expérience, deux atomes de 87Rb dans l'état fondamental 5S1/2 sont piégés chacun dans une pince optique microscopique, à une distance relative de 4 micromètres. En réalisant des transitions entre l'état 5S1/2 et l'état de Rydberg 58D3/2 par des transitions à deux photons, nous obtenons un état intriqué des deux atomes dans les sous-niveaux |5S1/2, f = 1, mf = 1> et |5S1/2, f = 2, mf = 2>. Afin de quantifier l'intrication, nous mesurons la fidélité par rapport à l'état-cible en réalisant des transitions Raman entre ces deux sous-niveaux. La fidélité des paires d'atomes présentes à la fin de l'expérience est supérieure à la valeur seuil de 0,5, ce qui prouve la création d'un état intriqué.

  1. Quel 'partage' dans un voyage en covoiturage ?

    OpenAIRE

    Mani, Zied

    2016-01-01

    Notre recherche s'intéresse au principe de partage dans la consommation collaborative à travers l'exemple du covoiturage. Une étude qualitative basée sur une triangulation des méthodes de collecte nous a permis d'identifier trois dimensions de partage: le partage économique, le partage social et le partage d'espace privé. Ainsi, le partage dans le covoiturage apparaît comme un concept ambivalent. Il est à l’origine d’une pratique qui bénéficie économiquement à tous les participants. Cependant...

  2. Le corps dans l'Antiquité

    Directory of Open Access Journals (Sweden)

    Sophie Lalanne

    2008-06-01

    Full Text Available Ouvrages générauxLaqueur Thomas, La fabrique du sexe. Essai sur le corps et le genre en Occident, trad. fr., Paris, Gallimard, 1992.Feher Michel, Naddaff Ramona, Tazi Nadia, Fragments for a History of the Human Body, 3 volumes, New York, Zone Books, 1989.Le Corps dans l’AntiquitéBodiou Lydie, Frère Dominique, Mehl Véronique dir., L’expression des corps. Gestes, attitudes, regards dans l’iconographie antique, Rennes, Presses Universitaires de Rennes, 2006.Bonnard Jean-Baptiste, Le complexe de ...

  3. Procrastination et projection mentale dans le futur

    OpenAIRE

    Zuber, Sascha

    2014-01-01

    La procrastination ou la tendance à remettre les choses au lendemain est un phénomène complexe car plusieurs facteurs y sont associés. Le but ici est d’examiner le lien entre la procrastination et la projection mentale dans le futur. Mais également d'explorer différents facteurs qui pourraient moduler ce lien tels que la perspective temporelle, le niveau d’identification de l’action et la régulation émotionnelle. Nous avons donc administré une tâche de projection mentale dans le futur, ainsi ...

  4. PENGEMBANGAN MODEL TRACKING DAN TRACING DALAM DISTRIBUSI KOMODITI PERTANIAN

    Directory of Open Access Journals (Sweden)

    Yandra Rahadian Perdana

    2011-06-01

    Full Text Available Kegagalan distribusi komoditi pertanian dapat berdampak pada penurunan dan kehilangan nilai baik secara kualitas dan kuantitas karena suatu perubahan dimensi waktu-jarak atau suhu serta sarana pengangkutan dalam setiap mata rantai aktivitas distribusi. Model tracking dan tracing system dapat menjadi strategi untuk menjamin keberhasilan distribusi komoditi pertanian secara tepat baik kuantitas maupun kualitas. Model tracking dan tracing komoditi pertanian adalah sebuah sistem proaktif yang real time yang dilengkapi dengan komponen pendukung proses distribusi dengan data yang akurat, terpercaya, berguna, dan cepat dengan memberikan informasi posisi barang atau sarana moda transportasinya.

  5. Aspek Legal dan Komitmen Etikal dalam Mu’amalah Maliyah

    Directory of Open Access Journals (Sweden)

    Lalu Fahmi Zainul Arifin

    2015-11-01

    Full Text Available Legalitas dalam mu’amalah maliyah bukanlah sekedar formalitas yang apriori ataupun pesimistik terhadap relativisme moral, karena aspek etikal yang diartikulasikan dalam berbagai prinsip mu’amalah adalah salah satu konsideran yang mendasar dan pokok dalam proses memahami dan inheren dengan “halal haram”, sehingga terkadang sukar untuk menarik garis tegas antara normativitas dan positivitas. Artikel ini menjelaskan bagaimana prinsip-prinsip moral keislaman sebagai aspek pokok dan karakteristik mendasr mu’amalah maliyah, sehingga komitmen moral di dalam mu’amalah maliyah dapat diukur melalui sistem pengawasan internal, yaitu tanggungjawab personal hamba kepada Tuhan dan pengawasan eksternal melalui otoritas pemerintah atau lembaga berwenang.

  6. Les AOC dans la mondialisation

    Directory of Open Access Journals (Sweden)

    Jean-Claude Hinnewinkel

    2004-12-01

    Full Text Available Fruit du conflit plusieurs fois séculaire entre les producteurs et le négoce, le terroir vitivinicole est né de phénomènes de « distinction » qui en Bordelais donnent les « crus ». Ces terroirs de production identifiés, il fallut les faire durer, face à conjoncture, face au négoce. Les réussites les plus nettes sont le résultat d’un projet collectif dont l’AOC à la française est l’une des plus spectaculaires. Renforcer le terroir, compris comme un espace de production géré par les producteurs, devient alors une des conditions essentielles de la durabilité du système. L’avenir des AOC réside sans doute dans une meilleure gestion du conflit négoce/production par l’interprofession mais aussi (surtout ! dans un renforcement de la gestion de la production au sein de l’aire de production qu’est le terroir. L’avenir du terroir relève de la gouvernance de cette aire de production avec trois partenaires : la puissance publique (INAO, l’interprofession et le syndicat des producteurs. Se pose dès lors la question du partage des compétences et la durabilité des AOC paraît liée en grande partie à une définition claire du rôle et donc du statut des syndicats de producteurs, à une véritable gouvernance locale, seule capable de donner du sens à l’ancrage géographique des vins dits de « terroir ». Mais alors ne faut-il pas impliquer un troisième partenaire, la société locale toute entière à travers ses représentations démocratique et associative ?Resulting from century-long conflicts between producers and merchants, vineyards have developped out of "distinction" phenomenons which in the Bordeaux region gave birth to "crus" (vintages. Such identified terroirs had to be defended: the French collective AOC (Denomination of Origin project is one of the most spectacular success. The terroir, as production territory organized by producers, is one of the essential conditions for sustainability

  7. MULTIPHOTON IONIZATION OF ATOMS

    OpenAIRE

    Mainfray, G.

    1985-01-01

    Multiphoton ionization of one-electron atoms, such as atomic hydrogen and alkaline atoms, is well understood and correctly described by rigorous theoretical models. The present paper will be devoted to collisionless multiphoton ionization of many-electron atoms as rare gases. It induces removal of several electrons and the production of multiply charged ions. Up to Xe5+ ions are produced in Xe atoms. Doubly charged ions can be produced, either by simultaneous excitation of two electrons, or b...

  8. Stable atomic hydrogen: Polarized atomic beam source

    International Nuclear Information System (INIS)

    We have carried out experiments with stable atomic hydrogen with a view to possible applications in polarized targets or polarized atomic beam sources. Recent results from the stabilization apparatus are described. The first stable atomic hydrogen beam source based on the microwave extraction method (which is being tested ) is presented. The effect of the stabilized hydrogen gas density on the properties of the source is discussed. (orig.)

  9. EFEKTIVITAS DAN EFEK TOKSIK EKSTRAK STEROID TERIPANG DAN 17α METILTESTOSTERON PADA MANIPULASI KELAMIN UDANG GALAH

    Directory of Open Access Journals (Sweden)

    Apri Arisandi

    2012-10-01

    Full Text Available Testosteron selain dapat dimanfaatkan sebagai obat, juga dimanfaatkan untuk sex reversal pada udang galah (Macrobrachium rosenbergii de Man.  Hormon yang umum dipakai untuk sex reversal jantan adalah 17α metiltestosteron, merupakan hormon sintetis.  Bioassay pada ayam, diketahui bahwa hormon sintetis memberikan efek samping toksik pada hati, limpa dan bursa fabricius.  Agar tidak memberikan efek toksik, salah satu cara dengan menggunakan sumber hormon testosteron alami dari teripang.  Pemberian hormon menggunakan metode dipping, lima perlakuan dan tiga ulangan.  Dosis ekstrak steroid teripang 1, 2 dan 3mg/l, serta 17α metiltestosteron 2mg/l dapat menghasilkan populasi jantan lebih tinggi dari kontrol negatif (tanpa hormon, yaitu 44,15%, 49,65%, 49,72% dan 50,45%.   Kata kunci: ekstrak steroid teripang, 17α metiltestosteron, udang galah

  10. MENDORONG PASAR MODAL EFISIEN DAN BERDAYA SAING GLOBAL

    Directory of Open Access Journals (Sweden)

    Satia Nur Maharani

    2006-01-01

    Full Text Available Globalisasi semakin memperpendek jarak dan waktu. Kemampuannya mampu  merubah wajah planet bumi menjadi” just a small village “ melalui peningkatan ilmu pengetahuan dan teknologi. Perubahan tersebut bertransformasi pula pada  sistem ekonomi. Modal berdiri sendiri tanpa identitas dan siapa saja berhak untuk berinvestasi tanpa batas melalui sebuah mekanisme antar negara dan benua. Salah satu lintasan modal untuk meraih keuntungan adalah melalui mekanisme pasar modal. Pasar modal manakah yang diminati oleh arus modal masuk adalah pasar modal yang mampu memberikan jamuan terbaik berupa keuntungan yang tinggi dengan resiko yang optimal. Maka untuk mencapai pelayan yang maksimal bagi masyarakat pemodal , pasar modal harus efisien dan berdaya saing global. Maka keterbukaan informasi, peningkatan teknologi, efisiensi biaya penegakan hukum, partisipasi masyarakat dan pemerintah, inovasi produk mutlak untuk dievaluasi dan ditingkatkan

  11. CARA MENGHILANGKAN RASA DAN BAU PADA PENGOLAHAN AIR MINUM

    Directory of Open Access Journals (Sweden)

    Sri Soewasti Soesanto

    2012-12-01

    Full Text Available Salah satu syarat kualitas air minum adalah tidak berwarna, tidak ada rasa, dan tidak berbau. Kebanyakan konsumen air minum menilai baik tidaknya kualitas air minum hanya secara visual, keruh atau jernih, berwarna atau tidak dan dengan indera pengecap apakah ada rasa atau tidak serta dengan indera pencium; berbau atau tidak. Tulisan ini hanya akan membahas dua aspek yaitu rasa dan bau yang sering dikeluhkan oleh konsumen.Sumber kontaminasi yang menimbulkan rasa dan bau dalam air dapat bersifat alami maupun anthropogenik.Untuk menghilangkan rasa dan bau karena sebab alami ada beberapa pilihan cara pengolahan yaitu sedimentasi konvensional secara gaya berat (Conventional Gravity Sedimentatin = CGS dan pengembangan udara terlarut (Dissolved Air Flotation = DAF, ozonisasi dan filtrasi dengan karbon aktif granular (Granular Activated Carbon = GAC. 

  12. Modernitas dan Tragedi: Kritik dalam Sosiologi Humanistis Zygmunt Bauman

    Directory of Open Access Journals (Sweden)

    Robertus Robet

    2016-06-01

    Full Text Available Bauman berpandangan bahwa modernitas memiliki dua gejala pokok yakni modernitas padat dan modernitas cair. Dalam modernitas padat masyarakat tumbuh dalam bimbingan ide dan tatanan, sementara dalam modernitas cair masyarakat dan manusia secara paradoksal didikte oleh ilusi mengenai kecepatan dan perubahan yang terus menerus hingga akhirnya kehilangan pendasaran. Dalam membentuk tatanan, modernitas mensyaratkan praktik kategorisasi dan pengadministrasian. Dengan itu modernitas memastikan siapa yang bagian tatanan dan siapa yang bukan bavian dari tatanan. Kategorisasi berimplikasi pada ambivalansi yakni munculnya aktor yang tak terdefinisikan sebagai bagian atau bukan bagian dari kategorisasi dan administrasi itu. Dalam sejarah, mereka yang didefinisikan sebagai bukan bagian adalah mereka yang rentan untuk diekslusikan. Ambivalensi modernitas inilah yang kemudian berujung pada holocaust. Berdasar pengalaman itu, Bauman kemudian mengajak kita untuk bukan hanya memahami sosiologi sebagai ilmu yang memiliki komitmen terhadap kebenaran , tetapi juga ilmu yang menghargai kekayaan dalam pengalaman manusia yang beragam.

  13. Pengemabnagn dan Validasi Skala Pengukuran Kualitas Layanan Tridarma Perguruan Tinggi

    Directory of Open Access Journals (Sweden)

    Hisyam Ihsan

    2010-06-01

    Full Text Available Paper ini mengemukakan hasil penelitian yang mengembangkan dan memvalidasi skala pengukuran kualitas layanan pendidikan tinggi, yang merupakan penjabaran dari tridarma perguruan tinggi. Berdasarkan adaptasi model Service Quality 5-dimensi sebagaimana dalam Parasuraman, Zeithaml dan Barry (1993, instrumen 16-butir kualitas layanan pengajaran (teacbqnal, 14-butir kualitas layanan penelitian (resqual, dan 11-butir kualitas layanan pengabdian masyarakat (p/tbqual dibuat untuk menilai kualitas layanan pendidikan. Masing-masing istrumen menggambarkan sikap dan perilaku mahasiswa mengenai kinerja layanan perguruan tinggi. Instrumen tersebut menilai kualitas secara fungsional (process maupun teknikal (output-outcome. Tiga ratus sebelas mahasiswa program sarjana tahun terakhir sebagai responden intsrumen. Unidimensional, reliabilitas, validitas isi, validitas terkait-kriterion, validitas konvergen, validitas diskriminan, dan validitas nomologikal diperiksa dengan menggunakan Structural Equation Modeling. Instrumen KLTPT telah dikembangkan dan berpotensi aplikasi untuk ekplorasi bagi para praktisi dan peneliti. Kata kunci: pengukuran kualitas layanan tridharma perguruan tinggi

  14. PENYAKIT MENULAR SEKSUAL AKIBAT JAMUR, PROTOZOA, DAN PARASIT

    Directory of Open Access Journals (Sweden)

    Max Joseph Herman

    2012-09-01

    Full Text Available Berbagai penyakit akibat hubungan seksual (PHS selain yang disebabkan oleh bakteri, klamidia, virus, dan mikroplasma, juga mungkin disebabkan oleh jamur, protozoa dan parasit, antara lain kandidiasis, trikomoniasis, giardiasis, amebiasis, kudis, dan kutu pubis. Diagnosis PHS yang tepat dan pasti sangat penting karena mcmiliki konotasi sosial dan biasanya diperoleh melalui pemeriksaan mikroskopik, pembenihan bakteriologis atau virologis. Sedangkan penatalaksanaan PHS bergantung pada infeksi masing-masing individu, tetapi secara umum apabila PHS sendiri tidak/kurang serius seperti trikomoniasis atau ektoparasit maka tidak perlu pengamatan pasangan seksual meskipun harus diobati juga karena hampir pasti ia juga terinfeksi. Sebagian besar PHS lain demikian berat (dalam kasus gonore resistensi terhadap antibiotika merupakan masalah sehingga semua kontak seksual harus ditelusuri dan diobati, khususnya pada gonore, sifilis dan AIDS.

  15. Frequency shift due to blackbody radiation in a cesium atomic fountain and improvement of the clock performances; Deplacement de frequence du au rayonnement du corps noir dans une fontaine atomique a cesium et amelioration des performances de l'horloge

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, S

    2004-07-01

    FO1 was the first caesium fountain primary frequency standard in the world. The most recent evaluation in 2002 before improvement reached an accuracy of 1*10{sup -15} when operated with optical molasses. Working as an extremely precise and stable instrument, FO1 has contributed to fundamental physics and technical measurements: - Frequency comparison between Cs and Rb fountains over an interval of 5 years sets an upper limit for a possible variation of the fine structure constant as |alpha/alpha| < 2*10{sup -15}/y. The resolution is about 5 times better than the previous test in our laboratory. The projected accuracy of the space clock PHARAO is 1*10{sup -16}. We confirmed its Ramsey cavity performance by testing the phase difference between the two interaction zones in FO1. The measured temperature T dependent frequency shift of the Cs clock induced by the blackbody radiation field is given as nu(T)=154(6)*10{sup -6}*(T/300){sup 4}[1+{epsilon}(T/300){sup 2}] Hz with the theoretical value {epsilon} = 0,014. The obtained accuracy represents a 3 times improvement over the previous measurement by the PTB group. Some improvements have been carried out on FO1. The new FO1 version works directly with optical molasses loaded by a laser slowed atomic beam. The application of the adiabatic passage method to perform the state selection allows us to determine the atom number dependent frequency shifts due to the cold collision and cavity pulling effects at a level of of 10{sup -16}. Recently, the obtained frequency stability is 2,8*10{sup -14}*{tau}{sup -1/2} for about 4*10{sup 6} detected atoms. The accuracy is currently under evaluation, the expected value is a few times 10{sup -16}. (author)

  16. Semiotika Kemasan Produk Susu Rasa Coklat Dan Stroberi pada Merek Indomilk Kids Dan Boneeto

    OpenAIRE

    Mukaromah Mukaromah

    2016-01-01

    Abstrak Kemasan adalah salah satu penentu keberhasilan dalam penjualan produk terkait dengan informasi pesan yang ingin disampaikan,untuk itu visualisasi dibuat semenarik mungkin agar dapat menyasar segmen yang ingin diraih. Demikian halnya dengan susu kemasan kotak untuk anak-anak yang terpapar di meja elalase di pusat- pusat perbelanjaan. Dalam penelitian ini penulis melihat bagaimana susu kemasan kotak merek Indomilk Kids dan Boneeto rasa coklat dan rasa stroberi yang dikonstruksikan sed...

  17. Diagnosis dan Penatalaksanaan Tragus Asesorius dan Stenosis Liang Telinga pada Hemifasial Mikrosomia

    Directory of Open Access Journals (Sweden)

    Al Hafiz .

    2016-01-01

    Full Text Available Abstrak           Hemifasial mikrosomia (HFM adalah diagnosis paling sering pada lesi wajah asimmetris dan merupakan kelainan kongenital wajah terbanyak kedua. HFM merupakan malformasi kongenital dimana terdapat defisiensi jaringan lunak dan tulang pada satu sisi wajah dan gangguan perkembangan telinga, terutama telinga luar. Diagnosis ditegakkan berdasarkan pada anamnesis, pemeriksaan fisik, dan pemeriksaan radiologis. HFM memiliki manifestasi klinis yang beragam, dan dipertimbangkan mendapatkan penatalaksanaan komprehensif yang melibatkan rekontruksi medik luas.               .           Sebuah kasus hemifasial mikrosomia dengan tragus asesorius dan stenosis liang telinga kanan dilaporkan pada perempuan berusia 13 tahun dan telah dilakukan rekonstruksi tragus dan kanaloplasti. Kata kunci: hemifasial mikrosomia, lesi wajah asimmetris, rekontruksi tragus, kanaloplasti. AbstractHemifacial microsomia (HFM is the most frequent diagnosis in asymmetry facial lesions and the top second facial congenital lesion. HFM is a congenital malformation in which there is a deficiency of soft tissue and bone on one side of the face and malformation of the ear, especially outer ear. The diagnosis is based on history, physical examination, and radiological finding. HFM had various clinical manifestation and considered to comprehensive management involving extensive medical reconstruction. A hemifacial microsomia case with right tragal assesoria and ear canal stenosis has been reported in girl aged 13 years old and have performed tragus reconstruction and canaloplasty. Keywords:  hemifacial microsomia, asymmetrical facial lession, tragus reconstruction, canaloplasty

  18. ASUPAN ZAT GIZI DAN STATUS GIZI PADA REMAJA PUTRI YANG SUDAH DAN BELUM MENSTRUASI

    Directory of Open Access Journals (Sweden)

    Dyan Fajar Christianti

    2013-11-01

    Full Text Available ABSTRACTThe objective of this study was to analyze nutrient intake and nutritional status of menstruating and non-menstruating girls. This survey was conducted from April to September 2012 in elementary schools and junior high schools in Bogor. Total subjects consisted of 35 menstruating and 35 non-menstruating girls who were chosen through screening. The results showed that the percentage of menstruating girls in urban (28.0% were more than in rural (25.1%. About 57.1% of subjects had menarche at 10 years old. The average of nutrient intake on menstruating and non-menstruating girls were under DRI (Keywords: BMI/age, girls, menstruation, nutrient intake, percent body fatABSTRAKTujuan penelitian ini adalah untuk menganalisis asupan zat gizi dan status gizi pada remaja putri yang sudah dan belum menstruasi. Survei ini dilaksanakan pada April—September 2012 di Sekolah Dasar (SD dan Sekolah Menengah Pertama (SMP di Bogor. Jumlah subjek terdiri dari 35 orang yang sudah menstruasi dan 35 orang yang belum menstruasi dan dipilih melalui screening. Hasil penelitian menunjukkan bahwa persentase terjadinya menstruasi pada siswi di sekolah kota lebih besar (28.0% dibandingkan dengan di kabupaten (25.1%. Sebanyak 57.1% subjek mengalami menarche pada usia 10 tahun. Rata-rata asupan zat gizi subjek yang sudah dan belum menstruasi masih berada di bawah AKG (Kata kunci: asupan zat gizi, IMT/U, menstruasi, persen lemak tubuh, remaja putri*

  19. Advances in atomic spectroscopy

    CERN Document Server

    Sneddon, J

    2000-01-01

    This fifth volume of the successful series Advances in Atomic Spectroscopy continues to discuss and investigate the area of atomic spectroscopy.It begins with a description of the use of various atomic spectroscopic methods and applications of speciation studies in atomic spectroscopy. The emphasis is on combining atomic spectroscopy with gas and liquid chromatography. In chapter two the authors describe new developments in tunable lasers and the impact they will have on atomic spectroscopy. The traditional methods of detection, such as photography and the photomultiplier, and how they are being replaced by new detectors is discussed in chapter three. The very active area of glow discharge atomic spectrometry is presented in chapter four where, after a brief introduction and historical review, the use of glow discharge lamps for atomic spectroscopy and mass spectrometry are discussed. Included in this discussion is geometry and radiofrequency power. The future of this source in atomic spectroscopy is also dis...

  20. Atomic and molecular manipulation

    CERN Document Server

    Mayne, Andrew J

    2011-01-01

    Work with individual atoms and molecules aims to demonstrate that miniaturized electronic, optical, magnetic, and mechanical devices can operate ultimately even at the level of a single atom or molecule. As such, atomic and molecular manipulation has played an emblematic role in the development of the field of nanoscience. New methods based on the use of the scanning tunnelling microscope (STM) have been developed to characterize and manipulate all the degrees of freedom of individual atoms and molecules with an unprecedented precision. In the meantime, new concepts have emerged to design molecules and substrates having specific optical, mechanical and electronic functions, thus opening the way to the fabrication of real nano-machines. Manipulation of individual atoms and molecules has also opened up completely new areas of research and knowledge, raising fundamental questions of "Optics at the atomic scale", "Mechanics at the atomic scale", Electronics at the atomic scale", "Quantum physics at the atomic sca...

  1. Pengaruh Penambahan Ni, Cu, dan Al dan Waktu Milling pada Mechanical Alloying Terhadap Sifat Absorpsi dan Desorpsi Mg sebagai Material Penyimpan Hidrogen

    Directory of Open Access Journals (Sweden)

    Febrian Budi Pratama

    2012-09-01

    Full Text Available Mg merupakan salah satu material yang digunakan sebagai material penyimpan hidrogen dengan membentuk MgH2. Sifat absorpsi dan desorpsi hidrogen dari suatu metal hidrida salah satunya tergantung  pada bahan, unsur penambah, dan metode pembuatannya. Pada penelitian kali ini Mg sebagai material penyimpan hidrogen dihasilkan melalui metode mechanical alloying dengan unsur penambah Ni, Cu, dan Al dan variasi waktu milling 10, 20, 30 jam. Selanjutnya sampel dilakukan pengujian SEM, XRD, DSC, dan Uji hidrogenisasi. Dari data uji diperoleh bahwa meningkatnya waktu milling menurunkan ukuran partikel sehingga meningkatkan wt% hidrogen terabsorb dan menurunkan temperatur onset desorpsi. Namun efek aglomerasi dan coldwelding yang berlebih pada proses mechanical alloying mengakibatkan ukuran partikel menjadi lebih besar. Unsur pemadu Al dan Cu berfungsi sebagai katalis, sedangkan Ni berfungsi sebagai pemadu yang ikut bereaksi dengan hidrogen. Mg10wt%Al dengan waktu milling 20 jam mempunyai nilai weight percent terbaik H2 yaitu 0.38% dalam temperatur hidrogenisasi 2500C, tekanan 3 atm, dan waktu tahan 1 jam. Sedangkan Mg10wt%Al dengan waktu milling 30 jam memiliki temperatur onset paling rendah yaitu 341.490C Kata Kunci— Absorpsi, Desorpsi, Material Penyimpan Hidrogen, Mechanical Alloying, Mg

  2. KEEFEKTIFAN TEAM TEACHING PENDIDIK PROGRAM PENDIDIKAN DAN PENGEMBANGAN ANAK USIA DINI (PPAUD) DI KABUPATEN KULON PROGO

    OpenAIRE

    Benny Erifiani; Puji Yanti Fauziah

    2014-01-01

    Penelitian ini bertujuan untuk mengetahui keefektifan: (1) Pemahaman, perencanaan, pelaksanaan, dan evaluasi pendidik program PPAUD tentang team teaching (2) hasil team teaching, dan (3) faktor pendukung dan penghambat keefektifan team teaching. Penelitian ini merupakan penelitian evaluasi dengan logic models menggunakan pendekatan kualitatif dan kuantitatif. Subjek penelitian 65 orang pendidik. Instrumen pengumpulan data yang digunakan adalah kuesioner, lembar observasi, dan pedoman wawancar...

  3. Peranan Departemen Sumber Daya Manusia Dalam Meningkatkan Efesiensi Dan Kinerja Karyawan Di Hotel JW Marriott Medan

    OpenAIRE

    Kemal, M. Arya

    2013-01-01

    Kemajuan ilmu pengetahuan dan tekhnologi di negara maju maupun negara berkembang sangat ditentukan oleh peranan dan perkembangan Departemen Sumberdaya Manusia. Fungsi utama Departemen Sumberdaya Manusia adalah melatih dan menyediakan karyawan yang kompeten dan professional yang berorientasi kepada kepuasan pelanggan atau tamu. Kompetensi adalah sebuah persaingan terhadap apa yang seseorang harus lakukan ditempat dimana ia bekerja untuk menunjukkan pengetahuan, kualitas, dan keterampilan yang ...

  4. Fungsi Metabolisme Dan Sintesis Pada Jaringan Kambium

    OpenAIRE

    Utomo, Budi

    2008-01-01

    Hutan merupakan areal penghasil energi yang paling produktif di dunia. Hutan mampu menghasilkan dan mengumpulkan energi setiap tahunnya (Lehninger, 1965; Whittaker, 1975). Proses pembentukan energi diawali dengan pengubahan energi dari cahaya matahari menjadi energi kimia dalam bentuk ikatan kimia yang stabil melalui proses fotosintesis. Banyak orang menganggap agregat berguna tersebut sebagai ikatan kimia kayu yang stabil.

  5. TRADISIONALITAS DAN MODERNITAS TIPOLOGI ARSITEKTUR MASJID

    Directory of Open Access Journals (Sweden)

    M. Syaom Barliana Iskandar

    2004-01-01

    Full Text Available This research want to present what the religious doctrine of the mosque community included the way and mind orientation could be supposed influence in the architecture typhology of mosque. Qualitative descriptive research method is used based on syncronic and diacronic approach with three steps: generic typhology, genetic morphology, and holistic comparison. The result of research shown that Nahdlatul Ulama mosques typhology is reflecting the traditionality of architecture, and vise verse Muhammadiyah mosques typhology is reflecting the modernity of architecture. Finally the study concludes that the specific differences of the mosque architecture typhology due to the religious doctrine differences. Abstract in Bahasa Indonesia : Penelitian ini bermaksud mendeskripsikan apakah faham keagamaan masyarakat pendukung masjid yang didalamnya menyangkut pula cara dan orientasi berfikir, turut mempengaruhi bentukan tipologi arsitektur masjid. Metode penelitian deskriptif kualitatif digunakan dengan pendekatan penelitian sinkronik-diakronik; dalam tiga langkah generik tipologi, generik morfologi, dan holistik komparasi. Hasil penelitian pada kasus masjid yang diteliti dan tidak dapat digeneralisasi pada kasus lain, menunjukkan bahwa tipologi masjid Nahdlatul Ulama mencerminkan tradisionalitas arsitektur masjid, dan sebaliknya tipologi masjid Muhammadiyah menampilkan modernitas arsitektur masjid. Artinya terdapat perbedaan yang khas dari tipologi arsitektur masjid, yang disebabkan oleh perbedaan dalam doktrin keagamaan. Kata kunci: faham/doktrin keagamaan, tradisionalitas, modernitas tipologi arsitektur masjid.

  6. Sosiologi Desa: Revolusi Senyap dan Tarian Kompleksitas

    OpenAIRE

    Salman, Darmawan

    2012-01-01

    Revolusi sebagai perubahan sosial tidaklah selalu melibatkan konflik kelas, apalagi yang berdarah-darah, seperti ketika perubahan itu meniscayakan sebuah rezim ditumbangkan, ataupun ketika pemodal borjuis disingkirkan. Revolusi sebagai perubahan sosial dapat berlangsung senyap dan bukan selalu karena konflik kelas ataupun gerakan sosial Buku ini membahas jagad desa Indonesia berikut dinamikanya. Desa menjadi entitas yang eksis dalam paradoks independensi. Karena terkait kenyataan akademik ...

  7. Des Taiwanais dans Ie sud du Fujian

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Se trouvant dans le sud-est de la Chine au bord dela mer, la province du Fujian s’appelle aussi toutsimplement "Min". Les anc(?)tres d’une grande partie de lapopulation de Taiwan sont venus du Fujian (Min). Les deux

  8. Innovation and optimization of a method of pump-probe polarimetry with pulsed laser beams in view of a precise measurement of parity violation in atomic cesium; Innovation et optimisation d'une methode de polarimetrie pompe-sonde avec des faisceaux laser impulsionnels en vue d'une mesure precise de violation de la parite dans l'atome de cesium

    Energy Technology Data Exchange (ETDEWEB)

    Chauvat, D

    1997-10-15

    While Parity Violation (PV) experiments on highly forbidden transitions have been using detection of fluorescence signals; our experiment uses a pump-probe scheme to detect the PV signal directly on a transmitted probe beam. A pulsed laser beam of linear polarisation {epsilon}{sub 1} excites the atoms on the 6S-7S cesium transition in a colinear electric field E || k(ex). The probe beam (k(pr) || k(ex)) of linear polarisation {epsilon}{sub 2} tuned to the transition 7S-6P(3/2) is amplified. The small asymmetry ({approx} 10{sup -6}) in the gain that depends on the handedness of the tri-hedron (E, {epsilon}{sub 1}, {epsilon}{sub 2}) is the manifestation of the PV effect. This is measured as an E-odd apparent rotation of the plane of polarization of the probe beam; using balanced mode polarimetry. New criteria of selection have been devised, that allow us to distinguish the true PV-signal against fake rotations due to electromagnetic interferences, geometrical effects, polarization imperfections, or stray transverse electric and magnetic fields. These selection criteria exploit the symmetry of the PV-rotation - linear dichroism - and the revolution symmetry of the experiment. Using these criteria it is not only possible to reject fake signals, but also to elucidate the underlying physical mechanisms and to measure the relevant defects of the apparatus. The present signal-to-noise ratio allows embarking in PV measurements to reach the 10% statistical accuracy. A 1% measurement still requires improvements. Two methods have been demonstrated. The first one exploits the amplification of the asymmetry at high gain - one major advantage provided by our detection method based on stimulated emission. The second method uses both a much higher incident intensity and a special dichroic component which magnifies tiny polarization rotations. (author)

  9. PENGARUH KETEBALAN IRISAN DAN LAMA PEREBUSAN (BLANCHING TERHADAP GAMBARAN MAKROSKOPIS DAN KADAR MINYAK ATSIRI SIMPLISIA DRINGO (Acorus calamus L.

    Directory of Open Access Journals (Sweden)

    Heru Sudrajad

    2012-10-01

    Full Text Available Beberapa simplisia perlu mengalami proses seperti perajangan dan blanching. Perajangan dilakukan untuk mempermudah proses pengeringan, pengepakan dan penggilingan. Semakin tipis bahan yang dikeringkan, semakin cepat penguapan air yang dikandung, sehingga mempercepat waktu pengeringan. Namun irisan yang terlalu tipis menyebabkan zat yang mudah menguap seperti minyak atsiri akan berkurang kadarnya, sehingga mempengaruhi komposisi, bau dan rasa terutama pada simplisia seperti temu lawak, temu giring, jahe, kencur dan bahan sejenis lainnya. Perebusan (blanching adalah suatu proses pemanasan yang diberikan kepada bahan mentah selama beberapa menit  pada  suhu  air  mendidih yang bertujuan untuk memperbaiki kualitas produk yang diolah. Rimpang tanaman ini secara empiris digunakan sebagai insektisida, demam nifas, karminatif. disentri dan limpa bengkak. Penelitian ini bertujuan untuk melihat pengaruh ketebalan irisan dan lama perebusan (blanching terhadap gambaran makroskopis dan kadar minyak atsiri simplisia dringo (Acorus calamus L. Sebagai model digunakan Acorus calamus L. Penelitian disusun dalam rancangan acak lengkap menggunakan 2 faktor perlakuan, yaitu faktor pertama ketebalan irisan (K. yaitu K1 =2 mm, K2 =4 mm. K3 = 6 mm dan lama blanching (B yaitu BO = tanpa blanching, B 1 = 5 menit dan B2 = 10 menit. Pengamatan dilakukan terhadap kualitas (warna, bentuk permukaan dan tekstur simplisia dan kadar minyak atsiri rimpang dringo. Simplisia dengan ketebalan irisan 2 mm tanpa perlakuan blanching menghasilkan minyak atsiri lebih tinggi (4,5% dengan kualitas simplisia yang lebih baik (warna putih kekuningan, permukaan rata dan tekstur liat, mudah dipatahkan sedangkan yang hasil terendah diperoleh pada perlakuan ketebalan irisan 2 mm dengan perlakuan lama blanching 10 menit yaitu  warna simplisia coklat, keadaan fisik irisan bergelombang, permukaan keras, sukar dipatahkan dengan kadar minyak atsiri (2%. Hasil percobaan menunjukkan bahwa tebal

  10. Analisis Kandungan Kalsium, Kalium, dan Magnesium pada Daun Kelor (Moringa oleifera Lam.) Segar dan Direbus Secara Spektrofotometri Serapan Atom

    OpenAIRE

    Wahyuni, Sri

    2015-01-01

    Moringa oleifera Lam that we know as Moringa is the best-known species of the thirteen species of the genus Moringacae. Minerals contained in Moringa are calcium, copper, iron, manganese, magnesium, phosphorus, potassium, sodium, sulphur, and zinc. Moringa leaves as a source of vitamins and minerals can be consumed in a way cooked, or eaten raw or dried into powder. One of the cooking method is boiling in the water. Vitamins and minerals are easily soluble in water is a nutrient that is quick...

  11. Karakterisasi Simplisia Daun Dan Biji Kelor (Moringa Oleifera Lam.) Serta Analisis Magnesium Dan Besi Secara Spektrofotometri Serapan Atom

    OpenAIRE

    Ramahdani

    2016-01-01

    Moringa leaves was used as vegetable by most of the villagers and also used as a medicinal plant efficacious. Nowaday people are starting to utilize parts of the moringa plant in the form of fresh are then processed into simplicia of moringa leaves, tea of moringa and simplicia of moringa seeds. Monograph of characterization simplicia of moringa leaves and seeds have not been listed in the Indonesian Herbal Pharmacapoeia. Minerals are nutrients needed to maintain health. This study aims to in...

  12. THE ORNL ATOM PROBE

    OpenAIRE

    Miller, M

    1986-01-01

    The ORNL Atom Probe is a microanalytical tool for studies in materials science. The instrument is a combination of a customized version of the vacuum system of the VG FIM-100 atom probe, an ORNL-designed microcomputer-controlled digital timing system, and a double curved CEMA Imaging Atom Probe detector. The atom probe combines four instruments into one - namely a field ion microscope, an energy compensated time-of-flight mass spectrometer, an imaging atom probe, and a pulsed laser atom probe.

  13. Diagnosis dan Penatalaksanaan Tumor Ganas Laring

    Directory of Open Access Journals (Sweden)

    Dolly Irfandy

    2015-05-01

    Full Text Available Abstrak Laring berperan dalam koordinasi fungsi saluran aerodigestif atas seperti bernafas, berbicara dan menelan.Laring terbagi tiga yaitu supraglotis, glotis dan subglotis. Laring merupakan daerah tersering kedua untuk kasuskarsinoma sel skuamosa kepala-leher, biasanya berhubungan dengan tembakau dan alkohol. Lebih dari 95% kasustumor ganas laring adalah karsinoma sel skuamosa. Pasien tumor ganas laring datang dengan berbagai keluhanseperti disfonia, obstruksi jalan napas, disfagia, odinofagi dan hemoptisis. Diagnosis tumor ganas laring ditegakkanberdasarkan anamnesis, pemeriksaan klinis menggunakan endoskopi kaku, serat optik dan biopsi. Penatalaksanaantumor ganas laring tergantung stadium dengan modalitas berupa operasi, kemoterapi, radiasi atau terapi kombinasi.Dilaporkan kasus laki-laki 53 tahun dengan karsinoma glotis stadium III (T3N0M0 squamous cell ca keratinized welldifferentiated. Penatalaksanaan pada pasien ini dengan melakukan laringektomi total.Kata kunci: Tumor ganas laring, karsinoma, laringektomi, tembakau Abstract Larynx plays a certain role in coordinating functions of the upper aerodigestive tract, such as respiration,speech, and swallowing. The larynx is divided into three region; supraglottic, glottic, and subglottic. Larynx is thesecond most common site for squamous cell carcinoma in the head and neck and usually related to tobacco andalcohol exposure. Primary malignant tumors of the larynx are squamous cell carcinomas can found more than 95% ofcases. Patients with laryngeal tumors usually present with complaints of hoarseness, respiratory obstruction,dysphagia, odynophagia and hemoptysis. Diagnosis of laryngeal cancer is made by medical history, clinicalexamination using a rigid or fiberoptic endoscope and biopsy. Management of laryngeal tumour depends on stadiumwith various modality included surgery, chemotheraphy, radiotheraphy or combined therapy. Reported case of 53years old male with Glottic carcinoma of the larynx

  14. KEMAMPUAN DOSIS PUPUK ZA DAN WAKTU PEWIWILAN TUNAS LATERAL TERHADAP HASIL DAN KUALITAS CABAI BESAR

    Directory of Open Access Journals (Sweden)

    Imam Taufik

    2013-08-01

    Full Text Available [ENGLISH]Chili is one of the horticultural commodities which have high economic value and have a large export opportunities. The development of technology makes great chili farming business will be more profitable. The purpose of research to determine the interaction between fertilizer dosing ZA and pruning time of lateral shoots that are most influential to the outcome and quality of hot pepper. Factorial (3 x 3 research carried out using Random Design Group. The first factor is the fertilizer doses studied with 3 threshold ZA covers: N1, N2, and N3, respectively 14, 28, and 42 grams per plant. The second factor is the time of pruning with 3 degrees include: W1, W2, and W3, each for 0, 15, and 25 days after planting. The results showed that the combination treatment of ZA 28 gram per plant and prunning of lateral shoots in 15 dat tend to the best result on the yield and quality of chilli. Keywords: Chilli; ZA Fertilizer Dose; Nitrogen; Pruning.  [INDONESIAN] Cabai merupakan salah satu komoditas hortikultura yang memiliki nilai ekonomi tinggi serta memiliki peluang eksport yang besar. Perkembangan teknologi menjadikan usaha pertanian cabai besar akan semakin menguntungkan. Tujuan penelitian untuk mengetahui interaksi antara pemberian dosis pupuk ZA dan waktu pewiwilan tunas lateral yang berpengaruh paling baik terhadap hasil dan kualitas cabai besar. Penelitian faktorial (3x3 dilaksanakan menggunakan Rancangan Acak Kelompok. Faktor pertama yang diteliti adalah dosis pupuk ZA dengan 3 taraf yang meliputi: N1, N2, dan N3 ,masing-masing 14, 28, dan 42 gram per tanaman. Faktor kedua adalah waktu pewiwilan dengan 3 taraf meliputi: W1, W2, dan W3, masing- masing untuk 0, 15, dan 25 hari setelah tanam. Hasil penelitian menunjukkan bahwa kombinasi perlakuan ZA 28g/tanaman dan pewiwilan tunas lateral umur 15 hari setelah tanam cenderung memberikan hasil terbaik terhadap hasil dan kualitas cabai besar. Kata Kunci: Cabai Besar; Dosis Pupuk ZA; Nitrogen

  15. Interaction de l'atome d'hydrogene avec un champ laser intense et bref a derive de frequence

    Science.gov (United States)

    Ba, Harouna Sileye

    Nous presentons dans ce document une etude theorique de l'interaction entre l'atome d'hydrogene et un champ laser intense et bref a derive de frequence. Dans un premier temps, nous etablissons une methode basee sur les fonctions B-splines qui permet de decrire avec precision l'ensemble de la structure energetique du systeme atomique. Dans le second temps, nous developpons une approche non perturbative de type spectrale, basee sur la resolution exacte de l'equation de Schrodinger dependante du temps, pour decrire l'atome d'hydrogene en interaction avec un champ laser. Nous proposons particulierement une representation realiste d'une impulsion laser a derive de frequence. Finalement, nous etudions le processus d'ionisation au dessus du seuil de l'atome d'hydrogene soumis a une impulsion a derive de frequence. Nos resultats montrent que la derive de frequence laser permet de controler et d'optimiser le transfert de population de l'etat fondamental vers les etats electroniques intermediaires impliques dans le processus d'ionisation. Mots-cles : Atome d'hydrogene Fonctions B-splines Methode non perturbative spectrale Impulsion laser intense et breve Parametre de derive de frequence laser lonisation multiphotonique

  16. MEKANISME ERUPSI DAN MODEL KANTONG MAGMA GUNUNGAPI IJEN

    Directory of Open Access Journals (Sweden)

    Hena Dian Ayu

    2014-05-01

    Full Text Available Mekanisme erupsi suatu gunungapi dapat dilihat berdasarkan karakteristik dan bagaimana model kantong magma gunungapi tersebut.  Karakteristik dan posisi kantong magma dapat diestimasi dengan mengunakan metode seismik yaitu dengan menganalisa rekaman sinyal seismik dari suatu gempa vulkanik maupun tektonik. Analisis terhadap rekaman sinyal gempa vulkanik (tipe A dan tipe B dan tremor harmonik yang didapatkan dari 3 stasiun seismik yaitu Ijen (Ijen, Terowongan Ijen (TRWI dan Kawah Utara Ijen (KWUI dilakukan dengan cara menyeleksi sinyal  berdasarkan waveform dan dilihat pola spektralnya untuk mendapatkan kandungan frekuensinya. Analisis hiposenter dilakukan untuk mengetahui kedalaman gempa vulkanik dan mengestmasi dimanakah dan bagaimana model kantong magmanya. Dari perhitungan diperoleh sebaran posisi hiposenter berada pada kedalaman berkisar 0–2.500 meter dibawah Kawah Ijen untuk Gempa VB, 2.000–2.500 meter dibawah Kawah Ijen untuk Gempa VA dan 5.000–50.000 meter dibawah permukaan laut untuk Gempa Tektonik Lokal.  Hasil penelitian menunjukkan daerah aseismik berada pada kedalaman lebih dari 4000 meter dibawah permukaan laut, yang diindikasikan sebagai kantung magma. Adapun proses internal yang terjadi adalah lebih disebabkan oleh adanya pergeseran patahan karena terjadi peningkatan aktivitas magma. Dan didapatkan pula bahwa model kantong magmanya bersistem ganda. Pada model ini, Letusan dapat dipandang sebagai terjadinya proses pengosongan kantong magma dangkal. Gaya eksternal F(t dianalogikan tekanan magma yang mengandung gas Pm(t, gaya pegas (-ky analog dengan tekanan hidrotermal dari air danau kawah. Diasumsikan bahwa ketika gaya eksternal yang mendorong massa sudah melebihi gaya pegas dan redamannya yang menahan massa, maka gaya eksternal akan keluar pada panjang pegas dan massa akan memantul kembali. Keadaan tersebut dianalogikan dengan terjadinya erupsi, yaitu ketika tekanan magma (Pm sudah melebih tekanan hidrotermal (Ph, maka

  17. KELUHAN DAN KEPATUHAN PENDERITA MALARIA TERHADAP PENGOBATAN MALARIA ARTESUNAT-AMODIAKUIN DI KALIMANTAN DAN SULAWESI

    Directory of Open Access Journals (Sweden)

    Mariana Raini

    2012-07-01

    . Sejak tahun 2004, Program Pemberantasan Malaria menggunakan Artemisinin-based Combination Therapy (ACT yaitu kombinasi Artesunat dan Amodiakuin (AS+AQ untuk pengobatan malaria falciparum dan vivax tanpa komplikasi sebagai pengganti obat malaria klorokuin yang telah resisten. Sejak itu implementasi AS+AQ belum pernah dievaluasi. Telah dilaporkan bahwa cakupan AS+AQ adalah 33,7% kemungkinan karena ketidakpatuhan pasien  akibat keluhan yang ditimbulkan dan formula obat yang tidak tunggal (fixed dose. Penelitian ini bertujuan untuk menilai dan mengevaluasi keluhan dan kepatuhan subyek yang mendapatkan pengobatan AS+AQ pada penderita malaria falciparum, vivax dan campuran falciparum-vivax di puskesmas sentinel di Kalimantan dan Sulawesi. Desain penelitian adalah potong lintang  melibatkan 99 subyek malaria dewasa (usia ≥15 tahun yang diobati dengan AS+AQ (Artesunat-Amodiakuin selama 3 hari sesuai dengan pedoman. Upaya tindak lanjut (follow up kepada subyek dilakukan pada hari ke 3 (H3, hari ke 7 (H7 dan hari ke 28 (H28 setelah minum AS+AQ. Di samping itu, dilakukan wawancara mendalam (kualitatif pada sejumlah subyek dan tenaga kesehatan untuk menilai Pengetahuan Sikap dan Perilaku (PSP terhadap kepatuhan pengobatan AS+AQ.Hasil penelitian : Sebagian besar subyek (92,9 % menyelesaikan terapi dan 7,1% drop out dari penelitian;  dua subyek diantaranya mengalami Serious Adverse Events (SAE, empat subyek mengalami keluhan yang tidak dapat ditolerir dan dua subyek tidak datang pada kunjungan ulang yang telah ditetapkan jadwalnya. Meskipun 84,1% mengalami keluhan setelah minum AS+AQ, namun keluhan bersifat ringan-sedang, masih dapat ditolerir dan jauh berkurang setelah 1 minggu pengobatan. Kesimpulan : pengobatan AS+AQ selama 3 hari relatif masih dapat ditoleransi dan kepatuhan subyek minum obat  masih cukup baik.

  18. Presenting the Bohr Atom.

    Science.gov (United States)

    Haendler, Blanca L.

    1982-01-01

    Discusses the importance of teaching the Bohr atom at both freshman and advanced levels. Focuses on the development of Bohr's ideas, derivation of the energies of the stationary states, and the Bohr atom in the chemistry curriculum. (SK)

  19. An extremely dense group of massive galaxies at the centre of the protocluster at z = 3.09 in the SSA22 field

    CERN Document Server

    Kubo, M; Ichikawa, T; Kajisawa, M; Matsuda, Y; Tanaka, I; Umehata, H

    2015-01-01

    We report the discovery of an extremely dense group of massive galaxies at the centre of the protocluster at $z=3.09$ in the SSA22 field from near-infrared spectroscopy conducted with the Multi-Object InfraRed Camera and Spectrograph (MOIRCS) equipped on the Subaru Telecope. The newly discovered group comprises seven galaxies confirmed at $z_{\\rm spec}\\approx3.09$ within 180 kpc including five massive objects with the stellar masses larger than $10^{10.5}~M_{\\odot}$ and is associated with a bright sub-mm source SSA22-AzTEC14. The dynamical mass of the group estimated from the line-of-sight velocity dispersion of the members is $M_{\\rm dyn}\\sim1.6\\pm0.3\\times10^{13}~M_{\\odot}$. Such a dense group is expected to be very rare at high redshift as we found only a few comparable systems in large-volume cosmological simulations. Such rare groups in the simulations are hosted in collapsed halos with $M_{\\rm vir}=10^{13.4}-10^{14.0}~M_{\\odot}$ and evolve into the brightest cluster galaxies (BCGs) of the most massive c...

  20. The virtual observatory service TheoSSA: Establishing a database of synthetic stellar flux standards. II. NLTE spectral analysis of the OB-type subdwarf Feige 110

    CERN Document Server

    Rauch, T; Kampka, D; Werner, K; Kruk, J W; Moehler, S

    2014-01-01

    In the framework of the Virtual Observatory (VO), the German Astrophysical Virtual Observatory (GAVO) developed the registered service TheoSSA (Theoretical Stellar Spectra Access). It provides easy access to stellar spectral energy distributions (SEDs) and is intended to ingest SEDs calculated by any model-atmosphere code, generally for all effective temperature, surface gravities, and elemental compositions. We will establish a database of SEDs of flux standards that are easily accessible via TheoSSA's web interface. The OB-type subdwarf Feige 110 is a standard star for flux calibration. State-of-the-art non-local thermodynamic equilibrium (NLTE) stellar-atmosphere models that consider opacities of species up to trans-iron elements will be used to provide a reliable synthetic spectrum to compare with observations. In case of Feige 110, we demonstrate that the model reproduces not only its overall continuum shape from the far-ultraviolet (FUV) to the optical wavelength range but also the numerous metal lines ...

  1. Pengaruh Faktor Internal dan Eksternal Perusahaan Terhadap Audit Delay dan Timeliness

    Directory of Open Access Journals (Sweden)

    Sistya Rachmawati

    2008-01-01

    Full Text Available The objective of this research is to investigate the influence of the firm size, the profitability, the solvability, the public accountant size and the existence of internal auditor division toward the Audit Delay and Timeliness on manufacture companies that listed in Jakarta Stock Exchange.The Research sample was taken from Fifty-nine listed companies in Jakarta Stock Exchange. These samples were selected by using Purposive sampling method. Analysis hypothesis is using Multiple Regression, before hypothesis test, normality data test using P-Plot test.The result of Multiple Regression model shows that Audit Delay influenced by firm size and public accountant size, and Timeliness influenced by firm size and solvability. This result is recommended for auditor to increase effectiveness and efficiency of his audit performance and for all existing studies to contribute towards the current literature on Auditing. Abstract in Bahasa Indonesia: Penelitian ini bertujuan untuk mengukur pengaruh faktor internal yaitu: profitabilitas, solva¬bili¬tas, internal auditor dan size perusahaan dan faktor eksternal, yaitu ukuran KAP terhadap audit delay dan Timeliness pada perusahaan manufaktur yang terdaftar pada Jakarta Stock Exchange. Pemilihan sampel menggunakan metode Purposive Sampling. Dari hasil pengolahan Regresi Berganda pada Audit Delay diketahui bahwa koefisien determi¬nasi Adjusted R2 = 0,123. Artinya seluruh variabel independen (Profitabilitas, Solvabilitas, Internal Auditor, Size Perusahaan, dan KAP hanya mampu menjelaskan variasi dari variabel depen¬den (Audit Delay adalah sebesar 12,3%. Sedang¬kan pada Timeliness, seluruh variabel independen (Profitabilitas, Solvabilitas, Internal Auditor, Size Perusahaan, dan KAP dapat men¬jelaskan variasi pada variabel dependennya (Timeliness adalah sebesar 7,9%. Hasil dari penelitian ini dapat membantu profesi akuntan publik dalam upaya meningkatkan efisiensi dan efektivitas proses audit dengan

  2. Antiprotonic Helium Atoms

    OpenAIRE

    Kartavtsev, O. I.

    1995-01-01

    Metastable antiprotonic helium atoms $^{3,4}\\! H\\! e\\bar pe$ have been discovered recently in experiments of the delayed annihilation of antiprotons in helium media. These exotic atoms survive for an enormous time (about tens of microseconds) and carry the extremely large total angular momentum $L\\sim 30-40$. The theoretical treatment of the intrinsic properties of antiprotonic helium atoms, their formation and collisions with atoms and molecules is discussed.

  3. Atomic Scale Plasmonic Switch

    OpenAIRE

    Emboras, A.; Niegemann, J.; Ma, P; Haffner, C; Pedersen, A.; Luisier, M.; Hafner, C; Schimmel, T.; Leuthold, J.

    2016-01-01

    The atom sets an ultimate scaling limit to Moore’s law in the electronics industry. While electronics research already explores atomic scales devices, photonics research still deals with devices at the micrometer scale. Here we demonstrate that photonic scaling, similar to electronics, is only limited by the atom. More precisely, we introduce an electrically controlled plasmonic switch operating at the atomic scale. The switch allows for fast and reproducible switching by means of the relocat...

  4. Atomizing nozzle and process

    Science.gov (United States)

    Anderson, Iver E.; Figliola, Richard S.; Molnar, Holly M.

    1992-06-30

    High pressure atomizing nozzle includes a high pressure gas manifold having a divergent expansion chamber between a gas inlet and arcuate manifold segment to minimize standing shock wave patterns in the manifold and thereby improve filling of the manifold with high pressure gas for improved melt atomization. The atomizing nozzle is especially useful in atomizing rare earth-transition metal alloys to form fine powder particles wherein a majority of the powder particles exhibit particle sizes having near-optimum magnetic properties.

  5. Atoms Talking to SQUIDs

    CERN Document Server

    Hoffman, J E; Kim, Z; Wood, A K; Anderson, J R; Dragt, A J; Hafezi, M; Lobb, C J; Orozco, L A; Rolston, S L; Taylor, J M; Vlahacos, C P; Wellstood, F C

    2011-01-01

    We present a scheme to couple trapped $^{87}$Rb atoms to a superconducting flux qubit through a magnetic dipole transition. We plan to trap atoms on the evanescent wave outside an ultrathin fiber to bring the atoms to less than 10 $\\mu$m above the surface of the superconductor. This hybrid setup lends itself to probing sources of decoherence in superconducting qubits. Our current plan has the intermediate goal of coupling the atoms to a superconducting LC resonator.

  6. Atomic Spectra Database (ASD)

    Science.gov (United States)

    SRD 78 NIST Atomic Spectra Database (ASD) (Web, free access)   This database provides access and search capability for NIST critically evaluated data on atomic energy levels, wavelengths, and transition probabilities that are reasonably up-to-date. The NIST Atomic Spectroscopy Data Center has carried out these critical compilations.

  7. KARAKTERISASI FILM KOMPOSIT ALGINAT DAN KITOSAN

    Directory of Open Access Journals (Sweden)

    Nur Rokhati

    2012-11-01

    Full Text Available CHARACTERIZATION OF ALGINATE AND CHITOSAN COMPOSITE FILM. Due to the specific characteristics of (thin films, the use of polymer films in various aplications has singnificantly increased. Alginate and chitosan are natural polymers, which have potential as a raw material for the manufacture of composite films. This paper presents the preparation and characterization of alginate, chitosan and chitosan-alginate composite films. The film characterization included permeability test, degree of swelling, mechanical property, morphology (by SEM, and surface chemistry (by FTIR. The results showed that alginate films have a higher permeability ​​and degree of swelling (DS than chitosan films. Both permeability and DS decreased with increasing concentration for both alginate and chitosan films. DS experiments showed that the films have the highest DS in water followed by ethanol 95% and ethanol >99.9%, respectively. The mechanical strength of chitosan films was larger than alginate films. Alginate-chitosan composite films prepared by layer by layer method showed better characteristics than the composite films prepared by blending of alginate and chitosan solutions. Meningkatnya aplikasi film polimer di berbagai industri tidak terlepas dari keunggulan yang dimiliki. Alginat dan kitosan merupakan polimer alam yang mempunyai potensi sebagai bahan dasar pembuatan film komposit. Pada penelitian ini dilakukan pembuatan dan karakterisasi film komposit berbasis alginat dan kitosan. Karakterisasi film yang dilakukan meliputi uji: permeabilitas, derajat swelling, mekanik, morfologi (dengan SEM, dan struktur kimia permukaan (dengan FTIR. Hasil penelitian menunjukkan bahwa film alginat mempunyai nilai permeabilitas maupun derajat swelling yang lebih tinggi dibanding dengan film kitosan. Baik pada kitosan maupun alginat memberikan fenomena bahwa semakin besar konsentrasi larutan maka semakin kecil nilai permeabilitas maupun derajat swelling, dengan derajat

  8. Analisis Perbedaan Prestasi Kerja dan Kepuasan Kerja Ditinjau dari Tingkat Pendidikan Karyawan Divisi Umum dan Sumber Daya Manusia PT Inalum, Kuala Tanjung.

    OpenAIRE

    Sagala, Leonard

    2011-01-01

    Penelitian ini betujuan untuk mengetahui Perbedaan Prestasi Kerja dan Perbedaan Kepuasan Kerja ditinjau dari Tingkat Pendidikan Karyawan Divisi Umum dan Sumber Daya Manusia PT Inalum Kuala Tanjung. Variabel yang digunakan adalah Prestasi Kerja, Kepuasan Kerja, dan Tingkat Pendidikan Karyawan. Penelitian ini dilakukan pada Karyawan Divisi Umum dan Sumber Daya Manusia PT Inalum dengan menggunakan metode Proportionate Stratified Random Sampling. Data primer dalam penelitian ...

  9. Svetislav Basara, Perdu dans un supermarché

    Directory of Open Access Journals (Sweden)

    Katia Vandenborre

    2008-10-01

    Full Text Available Tomber amoureux dans le jazz de la nature quand on est pris d’élancements dans le bras. Souffrir d’un incurable serpent dans le sein après que sa mère ait été enlevée par des esclavagistes. Se dégonfler à la brûlure de cigarette lors d’une boum fatale. Discuter avec Dieu par téléphone dans un supermarché. Telles sont les aventures plus loufoques les unes que les autres dont Svetislav Basara nous tisse le décousu dans Perdu dans un supermarché. Ce recueil réunit une vingtaine de nouvelles liée...

  10. Mempelajari Pengaruh Lama Fermentasi Dan Penyangraian Biji Kakao (Theobroma cacao L.) Terhadap Mutu Bubuk Kakao

    OpenAIRE

    Situmorang, Janner P

    2010-01-01

    Penelitian ini dilakukan untuk mengetahui pengaruh lama fermentasi dan penyangraian biji kakao (Theobroma cacao L.) terhadap mutu bubuk kakao. Penelitian ini menggunakan metode rancangan acak lengkap dengan dua faktor yakni lama fermentasi (0, 2, 4 dan 6 hari) dan lama penyangraian (0, 25, 50 dan 75 menit). Parameter analisa adalah kadar air, kadar abu, kadar lemak, daya larut dalam air dan nilai organoleptik (aroma, warna dan rasa). Hasil penelitian menunjukkan bahwa lama f...

  11. Pengaruh Model Blended Learning terhadap Motivasi Dan Prestasi Belajar Siswa SMK

    OpenAIRE

    Izuddin Syarif

    2013-01-01

    Abstrak: Pengaruh Model Blended Learning terhadap Motivasi Dan Prestasi Belajar Siswa SMK. Penelitian ini bertujuan untuk mengetahui perbedaan motivasi dan prestasi belajar siswa dalam mata pelajaran KKPI antara siswa yang menggunakan model face-to-face learning dan siswa yang menggunakan model blended learning, peningkatan motivasi dan prestasi belajar siswa dalam mata pelajaran KKPI akibat penerapan model blended learning, dan interaksi pengaruh penerapan model pembelajaran dan motivasi ter...

  12. PENGEMBANGAN DAN IMPLEMENTASI E-LEARNING MENGGUNAKAN MOODLE DAN VICON UNTUK PELAJARAN PEMROGRAMAN WEB DI SMK

    Directory of Open Access Journals (Sweden)

    R. Hafid Hardyanto

    2016-03-01

    Full Text Available Tujuan penelitian ini adalah untuk: (1 mengembangkan produk portal e-learning menggunakan LMS Moodle dengan vicon di SMK Muhammadiyah 1 Bambanglipuro, (2 mengetahui kelayakan portal e-learning yang dikembangkan di SMK Muhammadiyah 1 Bambanglipuro, (3 mengetahui hasil belajar peserta didik dalam pembelajaran menggunakan portal e-learning di SMK Muhammadiyah 1 Bambanglipuro, dan (4 mengetahui motivasi belajar peserta didik dalam pembelajaran menggunakan portal e-learning di SMK Muhammadiyah 1 Bambanglipuro. Penelitian ini merupakan penelitian pengembangan yang diadaptasi dari model pengembangan dan desain multimedia yang dikembangkan oleh Alessi & Trollip. Subyek penelitian ini adalah siswa kelas X kompetensi keahlian Rekayasa Perangkat Lunak, teknik pengambilan sampel dilakukan secara acak. Ujicoba produk pengembangan meliputi tes alfa, tes beta, dan implementasi uji lapangan. Hasil penelitian menghasilkan: (1 produk portal e-learning yang dikembangkan di SMK Muhammadiyah 1 Bambanglipuro menggunakan LMS Moodle terintegrasi dengan BigBlueButton, sehingga memungkinkan pengguna untuk melakukan video conference, (2 kelayakan portal e-learning menggunakan LMS Moodle dengan vicon di SMK Muhammadiyah 1 Bambanglipuro, validasi alfa didapatkan skor rerata 4,05 dengan kategori baik. Uji beta didapatkan skor rerata 3,87 dengan kategori baik. Validasi ahli materi didapatkan skor rerata 3,53 dengan kategori baik. (3 Hasil belajar peserta didik dalam pembelajaran menggunakan portal e-learning, kelas kontrol dan kelas eksperimen sama, hasil uji t bernilai 0,212. (4 Motivasi peserta didik dalam pembelajaran menggunakan portal e-learning, kelas kontrol dan kelas eksperimen sama, hasil uji t 0,143.

  13. Artikula Takrif dan Taktakrif dalam Bahasa Inggris (Kajian Sintaksis dan Semantik

    Directory of Open Access Journals (Sweden)

    Iis Kurnia Nurhayati

    2013-05-01

    Full Text Available The research is to discuss definiteness in English. The method used is analytical descriptive. For the analysis, substitution technique as one of the distributional methods is used. The data sources are non-fiction papers in English magazines and newspapers. The results show that the noun phrase having an article and followed by a post-modification can be formed in various constructions based on the type of nouns as the head of NP and the type of post-modifications that complete the phrase. In addition, some factors determining the choice of the articles in NP are based on the type and the number of the noun, and the knowledge of speakers and hearers about the noun.   Penelitian ini untuk membahas ketakrifan dalam bahasa Inggris. Metode yang digunakan adalah deskriptif analitis. Untuk menganalisis, teknik substitusi sebagai salah satu metode distribusional digunakan. Sumber data adalah tulisan nonfiksi yang terdapat dalam majalah dan surat kabar berbahasa Inggris. Hasilnya menunjukkan bahwa frase nomina yang memiliki artikula dan diikuti oleh post modification dapat dibentuk dalam konstruksi yang berbeda tergantung pada jenis nomina yang menjadi frasa benda ini dan jenis postmodifikator yang melengkapi frasa itu. Di samping itu, beberapa faktor yang menentukan pilihan artikula dalam frase nomina didasarkan pada jenis dan jumlah nomina, serta pengetahuan penutur dan mitra tuturnya tentang nomina itu.

  14. IMPLEMENTASI E-POSYANDU UNTUK MONITORING PERKEMBANGAN KESEHATAN DAN GIZI IBU DAN ANAK

    Directory of Open Access Journals (Sweden)

    - Sumardi

    2012-11-01

    Full Text Available Salah satu kegiatan Posyandu adalah untuk memonitoring gizi anak pada daerah sekitarnya. Memonitoring dilakukan oleh Kader Posyandu dengan mencatat dan melaporkan sesuai dengan format yang diberikan oleh puskesmas. Informasi yang dihasilkan berupa status gizi anak, daftar anak pengikut penimbangan, daftar anak yang melakukan imunisasi, dan data kematian anak. Selama ini penyampaian informasi belum menghasilkan lengkap, akurat, jelas, dan tepat waktu. Hal ini tentunya menjadi masalah dalam memonitoring gizi anak pada suatu Posyandu. Sistem dikembangkan dengan bahasa pemrograman PHP dan database dengan PHPMyAdmin. Desain sistem meliputi form login admin, form pengolahan daftar anak, form pengolahan layanan anak, form pengolahan catatan imunisasi, form data kematian, form daftar imunisasi. Untuk menghasilkan laporan pengolahan data dibuat dalam bentuk pdf agar tidak terjadi manipulasi informasi. Sistem ini diharapkan mampu mengatasi permasalahan yang berhubungan dengan kualitas informasi, berupa : ketersedian informasi saat dibutuhkan secara cepat, sudah dalam bentuk komputerisasi, tidak ada keterlambatan pelaporan hasil pengolahan data, dan hasil pengolahan data sesuai dengan keadaan yang ada. Pada tahap akhir pembuatan produk akan dilakukan evaluasi untuk memaksimalkan fungsinya. Kata kunci: E-Posyandu, monitoring, gizi anak, web report, Puskesmas

  15. INFEKSI VIRUS HEPATITIS B DAN HEPATITIS C PADA PENDERITA HEPATITIS KRONIS DAN HEMODIALISIS DI JAKARTA

    Directory of Open Access Journals (Sweden)

    Djoko Yuwono

    2012-10-01

    Full Text Available Virus Hepatitis C dan Hepatitis B merupakan penyebab hepatitis kronik aktif yang dapat berkembang menjadi hepatoselular karsinoma. Untuk mengetahui peranan kedua jenis virus tersebut sebagai penyebab hepatoselular karsinoma, telah dilakukan pemeriksaan HbsAg, anti-VHC dan RNA-VHC pada 17 penderita hepatitis kronis. 19 Pasien hemodialisis dan 198 donor darah PMI. Pemeriksaan HbsAg dilakukan dengan RPHA Cell: pemeriksaan anti-VHC dengan dipstik anti-VHC kit diagnotik produksi NTB Mataram, Lombok. Deteksi RNA-VHC dilakukan dengan teknik RT-PCR, menggunakan primer spesifik untuk daerah 5'NCR. Hasil pemeriksaan menunjukkan bahwa pada penderita hepatitis kronis ditemukan 5 orang (23,5% positif HbsAg dan 1 orang (5,8% anti-VHC. Pada penderita hemodialisis ditemukan 14 orang (73,6% positif anti-VHC, persentase anti-VHC meningkat sesuai dengan meningkatnya frekuensi hemodialisis. Pada donor darah PMI ditemukan 5 orang (2,2% positif HbsAg dan tidak satupun ditemukan anti-VHC positif.

  16. METODE ANUITAS DAN PROPORSIONAL MURABAHAH SEBAGAI BENTUK TRANSPARANSI DAN PUBLIKASI LAPORAN BANK

    Directory of Open Access Journals (Sweden)

    Mr Faisal

    2015-02-01

    Full Text Available Proportional and annuity methods are based on PBI 14/14/PBI/2012 on Transparency and Publication Reports of Islamic Banking and SEBI No. 15/26/DPbs/2013 on Implementation of Accounting Guidelines of Islamic Banking in Indonesia. These methods are forms of commitment to bring transparency in the Islamic banks and recognition on financial statement of profit on murabaha. The Annuity method is referred to PSAK 50, PSAK 55 and PSAK 60 because the substance is classified as a form of financing. Proportional method is referred to PSAK 102 because the substance is classified as trading activities. Metode anuitas dan proporsional didasarkan pada PBI No. 14/14/PBI/2012 tentang Transparansi dan Publikasi Laporan Bank Syariah dan SEBI No. 15/26/DPbs/2013 tentang Pelaksanaan Pedoman Akuntansi Perbankan Syariah Indonesia. Metode tersebut merupakan bentuk komitmen bank syariah dalam mewujudkan transparansi dan laporan keuangan pada pengakuan keuntungan murabahah. Metode anuitas mengacu pada PSAK 50, PSAK 55, dan PSAK 60 karena secara substansi dikategorikan sebagai bentuk pembiayaan. Metode proporsional mengacu pada PSAK 102 karena secara substansi dikategorikan sebagai bentuk kegiatan jual beli.

  17. STRUKTUR META TEORI AKUNTANSI KEUANGAN (Sebuah Telaah dan Perbandingan antara FASB dan IASC

    Directory of Open Access Journals (Sweden)

    I Made Narsa

    2007-01-01

    Full Text Available The objectives of this paper is to analyses the structure of meta-theoretical of financial accounting that was used by FASB and IASC to develop the conceptual framework for financial accounting reporting. The discussion of conceptual framework conducted by comparison of the basic different between the FASB and IASC framework, then analyses the constraints to implement IFRS and identify the way out of the constraints faced by the body. Abstract in Bahasa Indonesia : Penelitian ini bertujuan untuk membahas struktur meta teori yang dipergunakan oleh FASB dan IASC dalam mengembangkan rerangka konseptual, menelaah perbedaan-perbedaan mendasar, menganalisis hambatan-hambatan yang dialami serta mengidentifikasi upaya-upaya yang harus dilakukan agar IFRS diterapkan oleh negara-negara anggota. Penelitian ini dilakukan dengan cara membandingkan rerangka dasar yang diatur dalam FASB dan IASC dan kemudian menganalisa hambatan yang timbul dengan adanya penerapan IFRS dan mengidentifikasi bagaimana hambatan tersebut dapat diselesaikan. Kata kunci: globalisasi, harmonisasi, meta teori, FASB dan IASC, kerangka dasar, akuntansi keuangan

  18. Tradisi Puako Pada Masyarakat Melayu Batubara Kajian: Fungsi Dan Makna

    OpenAIRE

    Fakhri, Fakhrizal

    2016-01-01

    Skripsi ini menjelaskan bagaimana menganalisis mantra pada tradisi puako dan juga mendeskripsikan dari pada tradisi puako pada masyakat melayu di Kabupaten Batubara dengan kajian fungsi dan makna. Tradisi puako adalah sebuah tradisi yang dilakukan secara turun-temurun dan bentuk kepercayaan mereka terhadap hal-hal gaib yang mereka percayai dapat menjaga mereka dari kekuatan-kekuatan gaib lainnya. Tradisi ini dilakukan dengan mengadakan upacara pemujaan untuk penyembuhan penyakit, penjaga bada...

  19. Penentuan Bobot Jenis Dan Indeks Bias Pada Minyak Akar Wangi

    OpenAIRE

    Damanik, Ayu Sri Wahyuni

    2015-01-01

    Minyak atsiri merupakan minyak yang sudah lama digunakan oleh masyarakat, terutama dipedesaan untuk mengobati penyakit. Minyak atsiri mempunyai bau khas dari tanaman aslinya dan mudah menguap. Sejak zaman dahulu penggunaan minyak atsiri di Indonesia masih sangat terbatas dan sangat tradisional. Nenek moyang kita memperkenalkan berbagai macam tanaman aromatik seperti bunga mawar, melati, kenanga, dan daun pandan untuk berbagai kegiatan ritual keagamaan, maupun ritual adat. Setelah diketahui me...

  20. Penggunaan Dan Sifat-Sifat Aloi Emas Tipe III

    OpenAIRE

    Rini Wahyuni

    2008-01-01

    Menurut American Dental Association (ADA) specification no. 5 aloi emas diklasifikasikan berdasarkan kekuatan dan kandungan emasnya ke dalam 4 ripe. Tipe I (lunak) digunakan pada daerah yang tidak terdapat beban yang besar, seperti pada pembuatan inlay tambalan kavitas klas III dan klas IV. Tipe II (sedang) digunakan untuk segala tipe inlay. Tipe III (keras) digunakan untuk keperluan mahkota dan jembatan biasanya dipakai pada keadaan dimana dapat menerima beban yang sangat besar. Tipe IV (san...

  1. PENSKALAAN TEORI KLASIK INSTRUMEN MULTIPLE INTELLIGENCES TIPE THURSTONE DAN LIKERT

    OpenAIRE

    Farida Agus Setiawati; Djemari Mardapi; Saifuddin Azwar

    2013-01-01

    Penelitian ini bertujuan untuk: 1) mengetahui hasil penskalaan instrumen multiple intelligences (MI) pada tipe Thurstone dan Likert dengan pendekatan klasik, 2) mengetahui karakteristik instrument MI pada tipe Thurstone dan Likert pada data asli dan data yang diskalakan, 3) membandingkan karakteristik psikometrik pada kedua tipe data yang sudah diskalakan. Penelitian ini menggunakan pendekatan kuantitatif  yang pelaksanaannya terdiri dari empat bagian yang saling terkait, yaitu penelitian pen...

  2. Redesain Meja dan Kursi Kelas Berdasarkan Antropometri Siswa SDN 060796

    OpenAIRE

    Silvia

    2015-01-01

    Perabot kelas, yang terdiri dari meja dan kursi, merupakan fasilitas fisik yang penting karena aktivitas belajar siswa, seperti membaca, menggambar, menulis dan kegiatan lainnya, banyak dihabiskan di dalam kelas. Antropometri merupakan faktor penting yang harus dipertimbangkan dalam perancangan perabot kelas guna menentukan dimensi perabot kelas yang tepat dan dapat memfasilitasi pengguna dengan sikap duduk yang baik. Penelitian ini berlokasi di Sekolah Dasar Negeri 060796 Kecamatan Medan Are...

  3. KECUKUPAN ENERGI DAN POLA KEGIATAN REMAJA LAKI-LAKI

    OpenAIRE

    Y. Krisdinamurtirin

    2012-01-01

    Penelitian mengenai kecukupan energi dan pola kegiatan remaja laki-laki telah dilakukan pada sejumlah siswa laki-laki di salah satu Sekolah Lanjutan Tingkat Atas (SLTA) di Kotamadya Bogor. Jumlah subyek ada 34 orang dengan keadaan gizi baik berdasarkan antropometri (% BB/TB > 90% dari baku); mereka terpilih dari sejumlah 135 siswa yang terdaftar. Umur mereka berkisar antara 16 dan 19 tahun. Pengukuran antropometri yang dilakukan yaitu penimbangan berat badan, tinggi badan dan lapisan lemak...

  4. INDEPENDENSI DAN KOMPETENSI AUDITOR PADA OPINI AUDIT (Studi BPKP Jateng)

    OpenAIRE

    Surroh Zu'amah

    2012-01-01

    Tujuan dari penelitian ini adalah mengetahui bukti empiris pengaruh independensi dan kompetensi auditor secara parsial dan simultan terhadap hasil opini auditor. Populasi dalam penelitian ini adalah auditor pada Badan Pemeriksa Keuangan Republik Indonesia (BPK RI) perwakilan Provinsi Jawa Tengah yang berjumlah 135 orang, dengan proporsional random sampling. Berdasarkan hasil penelitian ini dapat disimpulkan bahwa independensi dan kompetensi auditor mempunyai pe-ngaruh yang signifikan terhadap...

  5. Aplikasi Pengenalan Kata pada Huruf Braille dan Pelafalannya

    OpenAIRE

    Agung Mega Iswara; Mauridhi Hery Purnomo; Surya Sumpeno

    2013-01-01

    Penelitian dan karya dalam bidang optical character recognition terutama pengenalan karakter Braille, hingga saat ini masih jarang dilakukan dan pada umumnya penelitian yang telah ada untuk pengenalan huruf Braille masih berorientasi pada citra statis yang menggunakan scanner. Untuk mengubah lembaran Braille menjadi citra untuk dikenali sebagai karakter alphabet harus menggunakan alat scanner yang mahal, tidak portable, dan tidak praktis. Untuk menyederhanakan proses pengenalan huruf Braille ...

  6. Rasa Takut Terhadap Perawatan Gigi (Dental Fobia) Dan Penanggulangannya

    OpenAIRE

    Yohana Rose Linda Manurung

    2008-01-01

    Dental fobia adalah suatu bentuk ketakutan yang berlebihan dan timbul pada setiap kunjungan ke dokter gigi. Fobia tersebut menyebabkan seseorang menghindar dari situasi atau keadaan yang menimbulkan ketakutan, dalam hal ini adalah dokter gigi dan prosedur perawatannya. Tentu saja ini merupakan hambatan bagi dokter gigi dalam usaha peningkatan kesehatan gigi masyarakat dan kesehatan tubuh secara menyeluruh. Dental fobia ini dapat dipengaruhi oleh beberapa faktor diantaranya perawatan gigi ...

  7. STUDI PENGELOLAN SAMPAH HOTEL DAN PROSPEK PENGEMBANGANNYA DI KOTA MAKASSAR

    OpenAIRE

    Sofyan, Lusviminda

    2014-01-01

    ABSTRAK STUDI PENGELOLAAN SAMPAH HOTEL DAN PROSPEK PENGEMBANGANNYA DI KOTA MAKASSAR (Studi Kasus Hotel Grand Clarion, Hotel Sahid Jaya dan Hotel Imperial Aryaduta di Kota Makassar) Lusviminda Sofyan 1), Mary Selintung2), dan Achmad Zubair2) 1) Mahasiswi Teknik Lingkungan Jurusan Teknik Sipil Universitas Hasanuddin Makassar 90245 Indonesia 2) Dosen Jurusan Teknik Sipil Universitas Hasanuddin Makassar 90245 Indonesia Abstrak Makassar sebagai salah satu destinasi tujuan ...

  8. KARAKTERISASI DAN UJI ANTIOSTEOPOROSIS EKSTRAK KAYU SECANG (Caesalpinia sappan)

    OpenAIRE

    Rifai, Yusnita; Subehan; Mufidah

    2008-01-01

    Abstrak, Standarisasi dan karakterisasi bahan obat dari bahan alam sangat penting untuk mendapatkan obat yang berkhasiat secara berkelanjutan dengan mutu yang terjamin. Salah satu bahan obat tradisional yang banyak digunakan adalah Secang (Caesalpinia sappan L.). Karakterisasi dilakukan terhadap tiga jenis ekstrak yang diperoleh dengan penyari n-heksan, metanol dan etanol 70%. Metode karakterisasi yang digunakan adalah secara spektrofotometer UV-Vis, FT-IR, TLC Scanner, dan KCKT. Analisis ren...

  9. La construction relative dans Chrétien de Troyes

    NARCIS (Netherlands)

    Fabriek, Pieter

    1924-01-01

    1. On peut reléguer à la syntaxe figée la construction relative avec la pronom neutre que dans feire que sages, que je sache, (au) plus tost qu'il pot, je n'ai que feire; avec le pronom adjectif qui dans il n'i a celui (nul, un seul) qui, com cil qui; en outre qui vive dans riens (om) qui vive (Char

  10. Single Atom Plasmonic Switch

    CERN Document Server

    Emboras, Alexandros; Ma, Ping; Haffner, Christian; Luisier, Mathieu; Hafner, Christian; Schimmel, Thomas; Leuthold, Juerg

    2015-01-01

    The atom sets an ultimate scaling limit to Moores law in the electronics industry. And while electronics research already explores atomic scales devices, photonics research still deals with devices at the micrometer scale. Here we demonstrate that photonic scaling-similar to electronics-is only limited by the atom. More precisely, we introduce an electrically controlled single atom plasmonic switch. The switch allows for fast and reproducible switching by means of the relocation of an individual or at most - a few atoms in a plasmonic cavity. Depending on the location of the atom either of two distinct plasmonic cavity resonance states are supported. Experimental results show reversible digital optical switching with an extinction ration of 10 dB and operation at room temperature with femtojoule (fJ) power consumption for a single switch operation. This demonstration of a CMOS compatible, integrated quantum device allowing to control photons at the single-atom level opens intriguing perspectives for a fully i...

  11. Interferometry with atoms

    International Nuclear Information System (INIS)

    Optics and interferometry with matter waves is the art of coherently manipulating the translational motion of particles like neutrons, atoms and molecules. Coherent atom optics is an extension of techniques that were developed for manipulating internal quantum states. Applying these ideas to translational motion required the development of techniques to localize atoms and transfer population coherently between distant localities. In this view position and momentum are (continuous) quantum mechanical degrees of freedom analogous to discrete internal quantum states. In our contribution we start with an introduction into matter wave optics in sect. 1, discuss coherent atom optics and atom interferometry techniques for molecular beams in sect. 2 and for trapped atoms in sect. 3. In sect. 4 we then describe tools and experiments that allow to probe the evolution of quantum states of many-body systems by atom interference.

  12. SEBARAN KANDUNGAN LOGAM BERAT Cd PADA SEDIMEN DI MUARA SUNGAI WAY KUALA BANDAR LAMPUNG

    OpenAIRE

    Diky Hidayat; Ni Putu Inda Novita

    2012-01-01

    Penelitian penentuan penyebaran konsentrasi logam berat Cd pada sedimen di muara sungai Way Kuala telah dilakukan. Tujuan penelitian ini adalah untuk melihat penyebaran konsentrasi logam berat pada sedimen di muara tersebut. Konsentrasi Cd ditentukan dengan menggunakan spektrofotometer serapan atom (SSA), dengan menggunakan empat validasi metode yaitu batas deteksi, presisi, akurasi, dan linieritas. Hasil menunjukkan bahwa konsentrasi logam berat Cd dalam sampel sedimen di hulu, badan, dan hi...

  13. LIMBAH CAIR INDUSTRI KECIL DAN PENCEMARAN

    Directory of Open Access Journals (Sweden)

    Kumoro Palupi

    2012-10-01

    Full Text Available Beberapa jenis industri kecil yang banyak tersebar, antara lain adalah pabrik tempe, tabu, kecap, dan sirup. Kualitas limbah yang dihasilkan industri-industri tersebut sangat jauh dari memenuhi syarat. Selain itu, limbah cair tersebut dibuang langsung ke saluran terbuka/tertutup yang bermuara di badan-badan air terdekat.Untuk mengurangi besamya beban pencemaran, sejak tahun 1989 pemerintah DKI Jakarta mengadakan Program Kali Bersih  (Prokasih. Sasaran progam adalah penurunan beban pencemaran dari sumbemya secara bertahap sehingga kualitas air sungai akan menjadi lebih baik. Sumber pencemaran yang menjadi sasaran dalam Prokasih adalah industri-industri skala besar dan menengah, sedangkan industri-industri kecil belum termasuk sasaran Prokasih untuk sementara waktu ini. 

  14. RADIKALISME ISLAM DAN UPAYA DERADIKALISASI PAHAM RADIKAL

    Directory of Open Access Journals (Sweden)

    Abu Rokhmad

    2012-05-01

    Lembaga-lembaga pendidikan diduga tidak kebal terhadap pengaruh ideologi radikal. Penelitian ini menyimpulkan bahwa: (1 Beberapa guru mengakui ada­nya konsep Islam radikal yang mungkin menyebar di kalangan siswa karena kurangnya pengetahuan keagamaan; (2 Unit-unit kajian Islam di sekolah-sekolah berkembang baik namun tidak ada jaminan adanya kekebalan dari radikalisme karena proses belajarnya diserahkan kepada pihak ketiga; (3 Di dalam buku rujukan dan kertas kerja terdapat beberapa pernyataan yang dapat mendorong siswa untuk membenci agama atau bangsa lain. Dapat disimpulkan  bahwa ada beberapa strategi deradikalisasi yang dapat diimplementasikan  yaitu deradikalisasi preventif, deradikalisasi preservatif terhadap Islam mo­derat, dan deradikalisasi kuratif.

  15. Migrer dans les Amériques

    OpenAIRE

    Lestage, Françoise; Schor, Paul

    2015-01-01

    Consacré à la migration dans les Amériques, ce dossier est dédié à la mémoire d’Aristide Zolberg (1931-2013), dont les travaux de déconstruction du mythe des Etats-Unis, terre de migrants, ont constitué un apport important à l’étude des migrations et de la construction nationale, et qui participa au colloque « La migration en héritage » à Paris en juin 2012 où plusieurs textes inclus dans ce dossier avaient été discutés. Si la migration est un phénomène global, les Amériques entretiennent une...

  16. Pandangan Kristen Tentang Dosa: Asal Muasal dan Cara Menebusnya

    Directory of Open Access Journals (Sweden)

    Tarpin Tarpin

    2010-11-01

    Full Text Available Agama Kristen memiliki konsep tersendiri tentang dosa. Dosa yang secara umum adalah tindakan manusia melanggar perintah dan norma serta aturan Tuhan, secara dogmatis, merupakan kesalahan krusial, dimana manusia dianggap melanggar rencana-rencana Tuhan. Keserakahan Adam dan Hawa melanggar perintah Tuhan dengan memakan buah pohon pengetahuan, telah menyebabkan putusnya Rahmat Tuhan kepada manusia. Adam dan Hawa telah menjerumuskan dirinya dan anak cucunya dalam dosa warisan. Kehadiran Yesus Kristus, sebagai oknum Tuhan, yang menebus dosa manusia dengan kematiannya di tiang salib, adalah bentuk Kasih Tuhan kepada hambahamba- Nya yang berdosa.

  17. PENGARUH RELIGIUSITAS DAN ETIKA KERJA ISLAMI TERHADAP MOTIVASI KERJA

    Directory of Open Access Journals (Sweden)

    Fauzan Fauzan

    2015-08-01

    Full Text Available Penelitian ini bertujuan untuk mengetahui apakah ada pengaruh antara religiustas dan etika kerja islami terhadap motivasi kerja. Dugaan awal, religiustas dan etika kerja islami berpengaruh terhadap motivasi kerja. Subjek penelitian ini adalah para guru di SMP yang dikelola oleh LP Ma’arif Kota Malang. Penelitian ini menggunakan kuesioner adaptasi dan modifikasi skala Islamic Work Ethics yang dkembangkan oleh Abbas Ali ( 1987 dan skala religiusitas yang dikembangkan oleh Glock dan Stark (1996. Hasil dari penelitian mengindikasikan bahwa, (1 Religiusitas atau rasa keberagamaan, cukup mewarnai Motivasi Kerja seorang guru dalam melaksanakan aktivitasnya. Karena diakui atau tidak para guru mayoritas adalah pemeluk agama Islam. Sehingga muatan-muatan ajaran Islam cukup mewarnai aktifitas mengajarnya. Religiusitas memberikan suatu dorongan kepada seseorang (guru untuk bekerja lebih baik, meningkatkan kualitas kerjanya, serta bertanggung jawab terhadap pekerjaannya. Religiusitas sangat panting dalam menciptakan etika kerja yang baik yang bertanggung jawab secara horizontal kepada sesama manusia dan secara vertikal kepada Tuhan Yang Maha Esa. Dengan demikian kita memiliki sumber daya manusia yang jujur dan berdedikasi baik. (2 Etika Kerja Islami belum mampu memotivasi kerja guru. Artinya, selama ini etika masih dipahami secara normative saja, tapi belum menjadi suatu praktek dalam berkehidupan serta belum terinternalisasi dalam setiap aktivas. (3 secara bersama-sama Religiusitas dan Etika Kerja Islami berpengaruh secara positif dan signifikan terhadap Motivasi Kerja guru SMP Islam LP Ma’arif Kota Malang

  18. Misi Kristen di Indonesia: Bahaya dan Pengaruhnya Terhadap Umat Islam

    Directory of Open Access Journals (Sweden)

    Tarpin Tarpin

    2011-06-01

    Full Text Available Misi merupakan bagian yang integral dengan agama Kristen. Terlebih sejak masuknya Paulus,yang kemudian mengklaim bahwa agama ini telah mengamanatkan pemeluknya untuk bertebaran ke seluruh penjuru dunia guna mengabarkan Injil kepada bangsa-bangsa yang belum mengimani Yesus sebagai Tuhan penyelamat manusia. Dalam konteks keindonesiaan, kegiatan misi berkait erat dengan kolonialisme, dan orientalisme, serta kristenisasi. Dalam era pasca reformasi, kegiatan misi tidak hanya sebatas kristenisasi umat Islam. Dengan berbagai metode dan sarana yang disusun sistematis dan terorganisir, kegiatan ini bertendensi untuk menjauhkan umat Islam dari ajaran agamanya, serta memecah belah kesatuan dan persatuan umat.

  19. Perlindungan Hak Cipta, Hak Terkait, dan Desain Industri

    Directory of Open Access Journals (Sweden)

    Dina Widyaputri Kariodimedjo

    2012-02-01

    Full Text Available This writing is intended to disseminate the concept of copyright, related right, and industrial design to researchers and professors at universities. It also discusses the recent development on the protection of those rights according to international convention and Indonesian law, as well as explains the procedures to admit the rights.  Tulisan ini merupakan bahan dalam rangka sosialisasi hak cipta, hak terkait, dan desain industri kepada peneliti dan dosen di perguruan tinggi. Tulisan ini membahas perkembangan seputar perlindungan hak-hak tersebut berdasarkan konvensi internasional dan hukum Indonesia, serta menjelaskan prosedur dan persyaratan permohonan pendaftaran hak.

  20. Dan Brown: Morphology of a Bestsellersaurus

    OpenAIRE

    Stefano Calabrese; Roberto Rossi

    2015-01-01

    Dan Brown’s success finds reasons in multiple factors, social, morphological, cognitive and commercial: the cross-medial restructuring of aesthetic communication on a global scale; the use of zero-sum homeostatic mechanisms in shaping themes, characters and meanings; the mixing of history and fiction; the disappearance of naturalistic elements; the time structuring of plots in «packs», cognitively easy to comprehend; the presence of urban settings, recognizable and meaningful for the global t...

  1. Imunopatogenesis Treponema pallidum dan Pemeriksaan Serologi

    Directory of Open Access Journals (Sweden)

    Efrida .

    2014-09-01

    Full Text Available AbstrakSifilis adalah penyakit menular seksual yang sangat infeksius, disebabkan oleh bakteri berbentuk spiral, Treponema pallidum subspesies pallidum. Penyebaran sifilis di dunia telah menjadi masalah kesehatan yang besar dengan jumlah kasus 12 juta pertahun. Infeksi sifilis dibagi menjadi sifilis stadium dini dan lanjut. Sifilis stadium dini terbagi menjadi sifilis primer, sekunder, dan laten dini. Sifilis stadium lanjut termasuk sifilis tersier (gumatous, sifilis kardiovaskular dan neurosifilis serta sifilis laten lanjut. Sifilis primer didiagnosis berdasarkan gejala klinis ditemukannya satu atau lebih chancre (ulser. Sifilis sekunder ditandai dengan ditemukannya lesi mukokutaneus yang terlokalisir atau difus dengan limfadenopati. Sifilis laten tanpa gejala klinis sifilis dengan pemeriksaan nontreponemal dan treponemal reaktif, riwayat terapi sifilis dengan titer uji nontreponemal yang meningkat dibandingkan dengan hasil titer nontreponemal sebelumnya. Sifilis tersier ditemukan guma dengan pemeriksaan treponemal reaktif, sekitar 30% dengan uji nontreponemal yang tidak reaktifKata kunci: sifilis, Treponema pallidum, serologiAbstractSyphilis is a sexually transmitted disease that is highly infectious, caused by a spiral -shaped bacterium, Treponema pallidum subspecies pallidum. The spread of syphilis in the world has become a major health problem and the common, the number of 12 million cases per year. Infectious syphilis is divided into early and late-stage syphilis. Early-stage syphilis is divided into primary, secondary, and early latent. Advanced stage of syphilis include tertiary syphilis (gumatous, cardiovascular syphilis, and neurosyphilis and late latent syphilis. Primary syphilis is diagnosed by clinical symptoms of the discovery of one or more chancre (ulcer. Secondary syphilis is characterized by the finding of localized mucocutaneous lesions or with diffuse lymphadenopathy. Latent syphilis without clinical symptoms of syphilis with

  2. Perbandingan pH Saliva Sebelum dan Sesudah Menyikat Gigi dengan Pasta Gigi yang Mengandung Sorbitol dan Xylitol pada Mahasiswa FKG USU Angkatan 2007/2008

    OpenAIRE

    Purba, Merina Rentaini Cesaria

    2010-01-01

    Derajat keasaman atau pH saliva sangatlah dipengaruhi oleh irama cirkandian, diet dan stimulasi sekresi saliva. Salah satu cara untuk tetap dapat mempertahankan oral hygiene dan menjaga keseimbangan pH saliva adalah menyikat gigi dengan pasta gigi yang mengandung sorbitol dan xylitol. Sorbitol dan xylitol merupakan salah satu komposisi pasta gigi yang banyak tersedia di pasaran. Sorbitol dan xylitol merupakan salah satu jenis pengganti gula yang termasuk kedalam golongan gula alkohol, sorbito...

  3. Kegiatan Employee Relations Dan Kepuasan Kerja (Studi Korelasional Tentang Kegiatan Employee Relations dan Kepuasan Kerja Karyawan di PT. CIMB NIAGA Tbk Jl. Pemuda No. 14 Medan)

    OpenAIRE

    Akbari, M. Forrizawan

    2010-01-01

    Penelitian ini berjudul Employee Relations dan Kepuasan Kerja (Studi korelasional tentang kegiatan employee relations dan kepuasan kerja karyawan di PT. CIMB NIAGA Tbk. Jl. Pemuda No.14 Medan) Adapun permasalahan dalam penelitian ini adalah bagaimanakah hubungan antara kegiatan employee relations dan kepuasan kerja karyawan PT CIMB NIAGA Tbk jalan pemuda No.14 Medan. Dan tujuan penelitian ini adalah untuk mengetahui hubungan kegiatan employee relations dan kepuasan kerja karyawan di PT. CIMB ...

  4. Ketersediaan Hara-P Dan Respon Tanaman Jagung (Zea Mays L) Pada Tanah Ultisol Tambunan-A Akibat Pemberian Guano Dan Mikroorganisme Pelarut Fosfat (MPF)

    OpenAIRE

    Wahid Ramadan S. Nasution

    2009-01-01

    Ketersediaan Hara P dan Respon Tanaman Jagung (Zea mays L) pada Tanah Ultisol Tambunan A akibat Pemberian Guano dan Mikroorganisme Pelarut Fosfat (MPF). Penelitian ini dilaksanakan di Laboratorium Biologi Tanah, Laboratorium Sentral, Rumah Kaca Fakultas Pertanian, USU Medan dan bulan Juni sampai September 2005. Penelitian ini bertujuan untuk mengetahui pengaruh pemberian guano dan mikroorganisme pelarut Fosfat (MPF) terhadap ketersediaan hara P dan respon tanaman jagung pada ultisol Tambunan ...

  5. Pengaruh Penerapan Prinsip-Prinsip Good Corporate Governance terhadap Pelaksanaan Pemungutan Bea Keluar pada Kantor Pengawasan dan Pelayanan Bea dan Cukai (KPPBC) Tipe Madya Makassar

    OpenAIRE

    JERRE, FITRIA JAMAL

    2012-01-01

    FITRIA JAMAL JERRE, A311 07 718, Pengaruh Penerapan Prinsip-Prinsip Good Corporate Governance terhadap Pelaksanaan Pemungutan Bea Keluar pada Kantor Pengawasan dan Pelayanan Bea dan Cukai (KPPBC) Tipe Madya Makassar , dibimbing oleh Drs. H. Muallimin, M. Si (Pembimbing I) dan Drs. Syarifuddin Rasyid, M.Si (Pembimbing II). Kata kunci: Good Corporate Governance dan Pemungutan Bea Keluar Penelitian ini bertujuan untuk mengetahui dan menganalisi...

  6. Pengembangan Media Poster dan Strategi Edukasi Gizi untuk Pengguna Posyandu dan Calon Pengantin

    Directory of Open Access Journals (Sweden)

    Hermina Hermina

    2015-11-01

    Full Text Available AbstractThe results of study Nutrition Awareness Family (Kadarzi in six provinces showed that nutrition knowledge and behavior of adults group is still low. The study of Kadarzi focused on the development of nutrition education strategies which was adjusted to the problems found in the community. The goal is to develop a media strategy posters and nutrition education for mothers of posyandu users and the future brides in an effort to achieve Kadarzi. The type of study was operational research. The study design wascross-sectional, with qualitative and quantitative methods. The study was conducted in three provinces: West Java, West Sumatra and East Kalimantan. The Samples taken for messenger is posyandu cadres andmarriage-guidance counsellors. The Samples taken for nutritional education is the mothers of posyandu users and the bride. Educational messages developed were advice to eat vegetables and fruits, weighingfor children under five, pregnant women anemia, exclusive breastfeeding and malnutrition. The results from the test of implementation nutrition education using posters media Kadarzi showing >70 % of targeted education increased their nutrition knowledge better than before, and generally the posyandu cadres were able to convey the message properly as well as the marriage-guidance counsellors in the Office of Religious Affairs. This study concluded that nutrition education posters which were made fairly simple, easy to understand, universal and also effective were able to improve the nutritional knowledge of mothers of posyandu users and future brides.Keywords : Nutrition Education, poster, aware family nutrition, posyandu users, future brides.AbstrakHasil Studi Keluarga Sadar Gizi (Kadarzi di enam provinsi menunjukkan bahwa pengetahuan dan perilaku gizi kelompok usia dewasa masih rendah. Penelitian ini memfokuskan pada pengembangan strategi edukasi gizi yang disesuaikan dengan permasalahan yang ditemukan di masyarakat. Tujuannya

  7. Perbandingan Kadar IL-5 dan Jumlah Eosinofil Antara Anak dan Orang Dewasa yang Terinfeksi Ascaris Lumbricoides

    Directory of Open Access Journals (Sweden)

    Darmadi ,

    2015-09-01

    Full Text Available Abstrak Ascaris lumbricoides pada umumnya menginfeksi anak, tetapi juga dapat terjadi pada orang dewasa. Respon imun hospes terhadap infeksi cacing dimulai dengan teraktifasinya Th2 dengan peningkatan yang signifikan dari IL-4, IL-5, IL-9, IL-10 dan IL-13. IL-5 yang terbentuk merangsang perkembangan dan aktivasi eosinofil. Tujuan penelitian ini adalah mengetahui perbandingan kadar IL-5 dan jumlah eosinofil antara anak dan orang dewasa yang terinfeksi oleh Ascaris lumbricoides. Telah dilakukan penelitian secara cross sectional terhadap 16 orang anak dan 16 orang dewasa yang terinfeksi Ascaris lumbricoides. Spesimen darah dan serum anak dan orang dewasa diperiksa IL-5 metode ELISA dan jumlah eosinofil metode mikroskopis. Data dianalisis dengan uji t independent dengan hasil statistik bermakna bila p<0,05. Didapatkan rerata kadar IL-5 anak 5,90±3,61 pg/ml dan 4,10±1,98 pg/ml rerata kadar IL-5 pada orang dewasa dengan nilai p=0,092 (p>0,05, sedangkan rerata jumlah eosinofil anak 14,56±7,77% dan 8,81±4,65% rerata jumlah eosinofil orang dewasa dengan nilai p=0,018 (p<0,05. Kadar IL-5 tidak berbeda signifikan antara anak dan orang dewasa, sebaliknya jumlah eosinofil terdapat perbedaan yang signifikan antara anak dan orang dewasa. Kesimpulan hasil penelitian ini ialah jumlah eosinofil anak lebih tinggi dari pada jumlah eosinofil orang dewasa yang terinfeksi Ascaris lumbricoides. Kata kunci: IL-5, jumlah eosinofil, anak, orang dewasa, infeksi Ascaris lumbricoides Abstract The infection of Ascaris lumbricides common infect children, but it also can be occurred to adult. The immune’s host respond to the worm infection begin from the activation of Th2 by the significant increasing from IL-4, IL-5, IL-9 and IL-13. IL-5 which formed stimulate the development and eosinofil’s activation. The objective of this study was to know the comparison IL-5 degree with the total of eosinofil between the child and adult who is infected by Ascaris lumbricides. The

  8. PENENTUAN KANDUNGAN LOGAM Pb DAN Cr PADA AIR DAN SEDIMEN DI SUNGAI AO DESA SAM SAM KABUPATEN TABANAN

    Directory of Open Access Journals (Sweden)

    NI PUTU DIANTARIANI

    2012-11-01

    Full Text Available Research on the heavy metal content, Pb and Cr in water and sediment of Ao River in Sam SamVillage, Tabanan Regency have been carried out. Sample of water taken at 8 location per week during 4weeks, while sample of sediment only taken once at 8 location. Determination of metal content of Pb and Crconducted using destruction method with mixture of HNO3 dan HCl (3:1 and analysed with AbsorptionAtomic Spectrophotometer.The result showed that mean metal content of Pb and Cr in water of Ao river at the location aftertextile industry (location 5 until 8 from four times intake of samples have passed enabled boundarythreshold that is 0,03 mg/L for Pb and 0,05 mg/L for Cr. Mean Pb content in sediment at location 1, 2, 3, 4and 5 still under natural content while location 6, 7 and 8 over the natural boundary threshold. Meanwhile forthe Cr metal only at location 8 over the natural boundary threshold. The highest metal content of Pb and Cr insediment and water found at location 8 that is each of 0,496 mg/L and 0,213 mg/L for Pb and Cr in water and141,844 mg/Kg and 33,489 mg/Kg for Pb and Cr in sediment respectively.

  9. KELUHAN SUBJEKTIF PADA OPERATOR KOMPUTER DI UNIT PELAKSANA TEKNIS – PENGEMBANGAN SENI DAN TEKNOLOGI KERAMIK DAN PORSELIN BALI

    Directory of Open Access Journals (Sweden)

    Komang Nelly Sundari

    2011-12-01

    Full Text Available Di UPT – PSTKP (Unit Pelaksana Teknis – Pengembangan Seni dan Teknologi Keramik dan Porselin Bali hampir setiap ruangan dilengkapi sebuah komputer, kecuali dalam ruangan rapat, ruangan laboratorium, dan ruangan produksi. Para operator komputer tersebut biasanya melaksanakan tugas sehari-harinya di depan komputer tidak lebih dari dua jam, lalu beralih ke pekerjaan lain yang tidak menggunakan komputer dan selanjutnya melanjutkan lagi pekerjaannya dengan komputer. Hal ini dilakukan untuk mengurangi rasa jenuh, penat, dan kelelahan di mata selama bekerja di depan komputer. Bila dilihat dari sisi keefektivitan tenaga operator, cara kerja seperti ini sudah jelas tidak menguntungkan bagi lembaga karena waktu kerja terbuang dan sudah pasti kaitannya pada produktivitas yang tidak optimal. Kondisi tersebut tentu tidak sesuai dengan konsep ergonomi. Salah satunya adalah tidak tercapainya peningkatan produktivitas. Dalam ergonomi dikenal istilah keluhan subjektif, yaitu tanda-tanda yang menyatakan adanya kelelahan yang dialami orang akibat beban kerja yang membebaninya oleh karena interaksi pekerja dengan jenis pekerjaannya, rancangan tempat kerja, peralatan kerja, dan lingkungan kerja. Kelelahan dibedakan dalam tiga kategori yaitu menurunnya aktivitas, menurunnya motivasi, dan adanya kelelahan fisik akibat keadaan umum. Jenis penelitian ini adalah cross-sectional dengan rancangan pre and post test group design, melibatkan sepuluh orang operator sebagai subjek penelitian. Instrumen yang digunakan adalah kuesioner kelelahan 30 items of rating scale. Pendataan dilakukan sebelum dan setelah 2 jam kerja. Data yang diperoleh dianalisis dengan uji t-paired pada tingkat kemaknaan α = 0,05. Hasilnya adalah operator komputer yang bekerja selama 2 jam mengalami peningkatan kelelahan secara umum sebesar 37,29%; pelemahan aktivitas kerja sebesar 39,08%; pelemahan motivasi kerja sebesar 28,64% dan meningkatnya kelelahan fisik sebesar 42,15%. Saran yang dapat

  10. ARSITEKTUR "GUNA DAN CITRA" SANG ROMO MANGUN

    Directory of Open Access Journals (Sweden)

    IN MEMORIAM : YUSUF BILYARTA MANGUNWIJAYA

    1999-01-01

    Full Text Available Yusuf Bilyarta Mangunwijaya is not only recognized as a pastor but also as a cultural observer, writer and architect. The architectural works he produced even touch the marginal people. The work does not only result in the physical building but also the total work of human development, "use" and "image". World Architecture never escapes from Vitruvius trilogy saying : Firmitas, Utilitas and Venustas. In his amazing writing, Mangunwijaya offered a distillation of trilogy (three categories into two categories, 'use' and 'image'. This writing is going to impart how the distillation of three categories becomes a 'two-categories. Abstract in Bahasa Indonesia : Yusuf Bilyarta Mangunwijaya tidak saja dikenal sebagai seorang Pastor, tetapi dia juga seorang budayawan, sastrawan, bahkan arsitek. Karya arsitekturnya menyentuh bahkan sampai ke mereka-mereka yang dipinggirkan (kaum marjinal. Karya arsitekturnya tidak saja sebuah sosok bangunan, tetapi sekaligus karya total dengan pembangunan manusianya, "Guna" dan "Citra". Arsitektur dunia tidak dapat melepaskan diri dari Trilogi Vitruvius: Firmitas, utilitas dan venustas. Dalam karya tulisnya yang luarbiasa, Romo Mangunwijaya menyingkatnya hanya dwilogi saja, Guna dan Citra. Tulisan ini akan membahas bagaimana perasan trilogi itu menjadi dwilogi saja. Kata kunci: Mangunwijaya, Vitruvius, guna, citra.

  11. KARAKTERISASI DAN AKTIVITAS KATALITIK BERBAGAI VARIASI KOMPOSISI KATALIS Ni DAN ZnBr2 DALAM Γ-Al2O3 UNTUK ISOMERISASI DAN HIDROGENASI (R-(+-SITRONELAL

    Directory of Open Access Journals (Sweden)

    ED Iftitah

    2014-06-01

    Full Text Available Pengaruh sifat dan karakter berbagai variasi komposisi katalis Ni dan ZnBr2 yang terimpregnasi dalam γ-Al2O3 terhadap aktivitas dan selektivitasnya untuk reaksi isomerisasi dan hidrogenasi (R-(+-Sitronelal telah dilakukan. Dalam penelitian ini, terdapat tiga jenis variasi komposisi Ni dan ZnBr2 dalam γ-Al2O3, yaitu: A1=Ni/ZnBr2/γ-Al2O3 (3:2, A2=Ni/ZnBr2/γ-Al2O3 (1:1 dan A3=Ni/ZnBr2/γ-Al2O3 (2:3. Katalis dikarakterisasi menggunakan X-ray diffraction (XRD, Brunauer-Emmett-Teller (BET surface area, dan SEM-EELS. Luas area permukaan spesifik dan porositasnya ditentukan berdasarkan adsorption-desorption gas nitrogen pada 77 K. Distribusi dan volume pori ditentukan dengan desorption isotherm pada P/Po ≥ 0,3. Hasil yang didapat menunjukkan bahwa terdapat hubungan antara karakter dan sifat katalis dengan aktivitas katalitiknya terhadap produk isomerisasi dan hidrogenasi (R-(+-Sitronelal. Uji aktivitas dilakukan dalam sebuah reaktor mini dengan 0,5 g katalis dan 3 mL (R-(+-Sitronelal menggunakan atmosfir gas N2 dan/atau H2 dalam waktu 5 dan 24 jam masing-masing pada suhu 90 dan 120 °C. Komposisi katalis, pemilihan jenis atmosfir gas dan suhu sangat berpengaruh terhadap aktivitas dan selektivitas pembentukan produk isomerisasi dan hidrogenasi. Konversi (R-(+-Sitronelal tertinggi ditunjukkan oleh katalis A3=Ni/ZnBr2/γ-Al2O3 (2:3 dengan kondisi reaksi selama 5 jam (4 jam N2 + 1 jam H2 pada suhu 90 °C dan 24 jam (4 jam N2 + 20 jam H2 pada suhu 120 °C. The influence of catalyst properties and characteristics of Ni and ZnBr2 catalysts impregnated in γ-Al2O3 on the activity and selectivity of (R-(+-Citronellal isomerisation and hydrogenation has been done. In this study, there were three sets of Ni and ZnBr2 in γ-Al2O3 with various composition, they were A1=Ni/ZnBr2/γ-Al2O3 (3:2, A2=Ni/ZnBr2/γ-Al2O3 (1:1, A3=Ni/ZnBr2/γ-Al2O3 (2:3. The catalysts were characterized using X-ray diffraction (XRD, Brunauer-Emmett-Teller (BET surface area and SEM

  12. Pengaruh Ketebalan Media dan Rate filtrasi pada Sand Filter dalam Menurunkan Kekeruhan dan Total Coliform

    Directory of Open Access Journals (Sweden)

    Deni Maryani

    2014-09-01

    Full Text Available Pada penelitian ini dilakukan proses filtrasi dengan menggunakan sand filter sebagai salah satu metode dalam pengolahan air bersih. Pada sand filter proses penyaringan terjadi pada media filter yang sangat halus, seperti media filter pada unit slow sand filter. Kecepatan penyaringan yang diinginkan pada sand filter ini adalah kecepatan seperti pada unit rapid sand filter. Sehingga sand filter ini adalah penggabungan antara kelebihan yang dimiliki slow sand filter dan rapid sand filter. Variasi pada penelitian ini yaitu: tebal media pasir 80 cm dengan rate filtrasi 5 m3/m2.jam, tebal media pasir 80 cm dengan rate filtrasi 7,5 m3/m2.jam, tebal media pasir 100 cm dengan rate filtrasi 5 m3/m2.jam, tebal media pasir 100 cm dengan rate filtrasi 7,5 m3/m2.jam, tebal media pasir 120 cm dengan rate filtrasi 5 m3/m2.jam dan tebal media pasir 120 cm dengan rate filtrasi 7,5 m3/m2.jam. Pada penelitian ini digunakan air baku yaitu air Kali Surabaya dengan nilai rata-rata total coliform 90.000 per 100 ml sampel dan nilai rata-rata kekeruhan 87,4 NTU. Dihasilkan bahwa penyisihan total coliform pada variasi tebal media 120 cm dan rate filtrasi 5 m3/m2/jam dengan nilai efisiensi sebesar 99% dan kekeruhan paling baik terjadi pada variasi panjang variasi tebal media 100 cm dan rate filtrasi 5 m3/m2/jam dengan nilai efisiensi sebesar 98,27%.

  13. Constraints on deformation of Hekla volcano, Iceland, 2011-2014, from time-series interferometric analysis of COSMO-SkyMed SAR data and Singular Spectrum Analysis (SSA)

    Science.gov (United States)

    Dumont, Stéphanie; Sigmundsson, Freysteinn; Parks, Michelle; Ófeigsson, Benedikt; Bagnardi, Marco; Hooper, Andy; Einarsson, Páll; Wittmann, Werner

    2015-04-01

    Hekla volcano is one of the most active volcanoes in Iceland with 18 summit eruptions during the last 1100 years. Since 1970, the volcano has erupted approximatively every 10 years: in 1980-1981, 1991 and 2000. A special feature of Hekla volcano is its aseismic behavior except within 2 hours before these eruptions. However, in 2013 and 2014, some seismic swarms were detected within a 5km radius centered on the volcano, which is unusual for any time period between eruptions. No change in the ground deformation (continuous borehole strainmeter and ground-based GPS), was observed during these events. This year, will be the fifteenth year without an eruption at Hekla, the extended period (since the last eruption) raises the following question: Has the magma plumbing system or the rate of melt supply changed since the last eruption? What is the state of the volcano? What does it imply for its eruptive cycle? To address these questions, we study ground deformation around Hekla volcano using time-series analysis. We analyzed COSMO-SkyMed SAR data acquired between 2011 and 2014 using the Persistent Scatterer Interferometric Synthetic Aperture Radar (PS-InSAR) approach for both ascending and descending configurations. As highlighted by previous studies of ground deformation around Hekla, the small deformation rate distributed over a large area increases the importance of the noise reduction process. Once the signal to noise ratio is improved, both time-series display a dominant subsidence signal. The subsiding areas correlate with lava flows extruded during the 2000 eruption. A small inflation signal is more difficult to substantiate from the SAR data alone. For this reason further investigation of source characteristics using a Singular Spectrum Analysis (SSA) is required. SSA is an empirical based decomposition of the signal. This decomposition is applied on a trajectory matrix, called a Hankel matrix (similar to a cross-lag correlation matrix). This method enables the

  14. The virtual observatory service TheoSSA: Establishing a database of synthetic stellar flux standards . II. NLTE spectral analysis of the OB-type subdwarf Feige 110

    Science.gov (United States)

    Rauch, T.; Rudkowski, A.; Kampka, D.; Werner, K.; Kruk, J. W.; Moehler, S.

    2014-06-01

    Context. In the framework of the Virtual Observatory (VO), the German Astrophysical VO (GAVO) developed the registered service TheoSSA (Theoretical Stellar Spectra Access). It provides easy access to stellar spectral energy distributions (SEDs) and is intended to ingest SEDs calculated by any model-atmosphere code, generally for all effective temperatures, surface gravities, and elemental compositions. We will establish a database of SEDs of flux standards that are easily accessible via TheoSSA's web interface. Aims: The OB-type subdwarf Feige 110 is a standard star for flux calibration. State-of-the-art non-local thermodynamic equilibrium stellar-atmosphere models that consider opacities of species up to trans-iron elements will be used to provide a reliable synthetic spectrum to compare with observations. Methods: In case of Feige 110, we demonstrate that the model reproduces not only its overall continuum shape from the far-ultraviolet (FUV) to the optical wavelength range but also the numerous metal lines exhibited in its FUV spectrum. Results: We present a state-of-the-art spectral analysis of Feige 110. We determined , log g = 6.00 ± 0.20, and the abundances of He, N, P, S, Ti, V, Cr, Mn, Fe, Co, Ni, Zn, and Ge. Ti, V, Mn, Co, Zn, and Ge were identified for the first time in this star. Upper abundance limits were derived for C, O, Si, Ca, and Sc. Conclusions: The TheoSSA database of theoretical SEDs of stellar flux standards guarantees that the flux calibration of astronomical data and cross-calibration between different instruments can be based on models and SEDs calculated with state-of-the-art model-atmosphere codes. Based on observations with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS5-26666. Based on observations made with the NASA-CNES-CSA Far Ultraviolet Spectroscopic Explorer. Table 2, Figs. 3 and

  15. Perancangan dan Implementasi Modul Praktikum - Pengenalan Tata Letak dan Port I/O pada Mother board berbasis Teknologi Augmented Reality

    Directory of Open Access Journals (Sweden)

    Gita Indah Hapsari

    2015-07-01

    Full Text Available Kemajuan teknologi berbasis komputer berkembang dengan sangat pesat. Seiring dengan perkembangan jaman, kemajuan  tersebut memberikan pengaruh  terhadap  perubahan cara penyampaian pengajaran yang mengarah pada penggunaan jenis media penyampaian. Praktikum merupakan salah satu bentuk pengajaran yang memberikan pengalaman belajar secara nyata terhadap kondisi sebenarnya di lapangan mengenai penggunaan dan implementasi alat praktek yang berhubungan dengan berbagai materi yang dipelajari oleh mahasiswa dan memiliki tujuan untuk memberikan keterampilan dan pengenalan terhadap mahasiswa/peserta didik. Penelitian ini melakukan implementasi teknologi augmented reality terhadap salah satu modul praktikum yaitu pengenalan tata letak hardware dan Port I/O pada motherboard dan bertujuan sebagai alat bantu penyampaian pengajaran praktikum. Pengimplementasian teknologi augmented reality melibatkan aksi oleh user terhadap media penangkapan gambar motherboard menggunakan web camera dan tampilan pemetaan tata letak hardware dan port i/o pada motherboard. Penelitian telah diimplementasikan dan diujicoba terhadap 3 kelas dengan 97 responder. Adapun hasil dari penelitiannya adalah 83% responder menyukai aplikasi, 77% memahami materi, 84,5% menginginkan aplikasi ini menjadi alat bantu ajar, 65,98% meminta materi untuk dilengkapi dan diperbanyak, 77,3% dapat belajar mandiri menggunakan aplikasi ini, tanpa bantuan dari dosen ataupun asisten.

  16. Pemetaan Sebaran Dan Karakter Populasi Tanaman Buah Di Sepanjang Koridor Jalur Wisatadesa Kemiren, Tamansuruh, Dan Kampunganyar, Kabupaten Banyuwangi

    Directory of Open Access Journals (Sweden)

    Zakiyah Zakiyah

    2013-09-01

    Full Text Available Penelitian ini bertujuan untuk mengetahui peta persebaran tanaman buah, karakter populasi tanaman buah, serta persepsi masyarakat pemilik tanaman buah di sepanjang jalur wisata Desa Kemiren, Tamansuruh, dan Kampunganyar, Kabupaten Banyuwangi. Metode yang dilakukan meliputi survei pemetaan tanaman buah (mangga, rambutan, manggis, durian, jambu air dan jambu biji dengan merekam titik koordinat dari GPS untuk setiap tanaman buah. Penentuan karakter populasi tanaman buah dilakukan dengan mengamati morfologi tanaman terkait vitalitas dan periodisitas. Persepsi masyarakat dilakukan dengan wawancara dan kuisioner. Analisis data dilakukan dengan mengolah data koordinat dan data pengamatan karakter populasi tanaman buah ke dalam peta dasar melalui aplikasi GIS. Pemetaan persepsi masyarakat diperoleh dengan wawancara dan kuisioner yang dihitung dengan skala Likert kemudian dipetakan sebaran spasialnya dengan aplikasi GIS. Hasil penelitian menunjukkan bahwa persebaran tanaman buah yang ada di pekarangan rumah banyak tersebar di sepanjang jalur desa wisata dengan perbandingan jumlah buah yang ditemukan di Desa Kemiren 76 pohon, Tamansuruh 53 pohon, dan Kampunganyar 40 pohon. Kondisi tanaman buah dalam keadaan tumbuh dengan baik, bertunas, berbunga dan berbuah, hal ini dikarenakan pada saat penelitian waktunya tanaman buah memasuki masa berbuah dan masa panen. Antusiasme masyarakat tinggi untuk menjadikan tanaman buah yang ada di sepanjang jalur desa wisata sebagai daya tarik wisatawan. Kata Kunci: jalur wisata, karakter populasi, pemetaan, persepsi, tanaman buah

  17. Long range intermolecular forces in triatomic systems: connecting the atom-diatom and atom-atom-atom representations

    OpenAIRE

    Cvitas, Marko T.; Soldan, Pavel; Hutson, Jeremy M.

    2005-01-01

    The long-range forces that act between three atoms are analysed in both atom-diatom and atom-atom-atom representations. Expressions for atom-diatom dispersion coefficients are obtained in terms of 3-body nonadditive coefficients. The anisotropy of atom-diatom C_6 dispersion coefficients arises primarily from nonadditive triple-dipole and quadruple-dipole forces, while pairwise-additive forces and nonadditive triple-dipole and dipole-dipole-quadrupole forces contribute significantly to atom-di...

  18. Semiotika Kemasan Produk Susu Rasa Coklat Dan Stroberi pada Merek Indomilk Kids Dan Boneeto

    Directory of Open Access Journals (Sweden)

    Mukaromah Mukaromah

    2016-02-01

    Full Text Available Abstrak Kemasan adalah salah satu penentu keberhasilan dalam penjualan produk terkait dengan informasi pesan yang ingin disampaikan,untuk itu visualisasi dibuat semenarik mungkin agar dapat menyasar segmen yang ingin diraih. Demikian halnya dengan susu kemasan kotak untuk anak-anak yang terpapar di meja elalase di pusat- pusat perbelanjaan. Dalam penelitian ini penulis melihat bagaimana susu kemasan kotak merek Indomilk Kids dan Boneeto rasa coklat dan rasa stroberi yang dikonstruksikan sedemikian rupa sehingga rasa coklat mewakili susu untuk anak laki-laki dan rasa stroberi untuk anak perempuan. Tujuan penelitian ini untuk mengetahui bagaimana konstruksi identitas perempuan dan laki-laki divisualisasikan pada kemasan produk susu rasa coklat dan stroberi melalui penggunaan tanda pada aspek visualnya. Metode yang digunakan dalam penelitian ini adalah semiotika menurut Roland Barthes dengan melihat pada aspek penggunaan warna dan ilustrasi gambar kemasan dengan menggunakan analisa teori konstruksi sosial. Hasil dari analisa ini adalah kemasan susu rasa coklat dengan visualisasi  warna dan ilustrasi gambarnya mewakili identitas anak laki-laki sementara kemasan rasa stroberi, visualisasi warna, ilustrasi gambar mewakili konstruksi anak perempuan yang feminin dan lembut. Kata kunci: kemasan, susu, semiotika, identitas Abstract Packaging is one of the determinants of success in the sales. The package contains an informational message that is delivered to the consumer, then the visualization of packaging made as attractive as possible in order to target the segment to be achieved. Likewise with the packaging of milk for children exposed in elalase shopping centers. In this study the authors look at how the packaging of brand Indomilk Kids and Boneeto taste of chocolate and strawberry flavors are constructed, that the chocolate-flavored milk represents for boys and  strawberry flavor for girls. The purpose of this study to find out how the

  19. Peranan Faktor Imun dan Profil Protein dalam Penelitian dan Pengembangan Vaksin Malaria Iradiasi

    Directory of Open Access Journals (Sweden)

    Mukh Syaifudin

    2014-03-01

    Full Text Available Pengembangan vaksin terhadap malaria yang merupakan penyakit yang mematikan tetap menjadi satu prioritas kesehatan masyarakat global, termasuk pemanfaatan parasit iradiasi sebagai bahan vaksin. Imunisasi dengan sporozoit iradiasi mampu memberikan imunitas protektif pada hewan coba dan sukarelawan. Mekanisme sistem kekebalan tubuh ini banyak dipelajari karena merupakan faktor penting dalam pengembangan vaksin, demikian halnya profil dan/atau ekspresi protein pasca iradiasi yang terkait erat dengan keamanan dan aspek lain dari bahan vaksin. Meskipun telah melalui penelitian yang ekstensif, vaksin yang aman dan protektif belum dapat diperoleh karena masih diperlukan pengetahuan yang lebih mendalam mengenai mekanisme imunitas dan protein dalam litbang malaria. Hasil penelitian menunjukkan bahwa sel limfosit T berperan penting dalam pengaturan respon imun dan pembentukan memori imunologik yang mengontrol dan mengeliminasi infeksi. Sitokin proinflamasi seperti interleukin-12 (IL-12, interferon-gamma (IFN-γ, dan tumor necrosis factor alpha (TNF-α juga merupakan mediator esensial dari imunitas protektif pada malaria eritrositik. Berbagai pendekatan lain terkait respon imun seperti genetika molekuler saat ini sedang dilakukan. Studi juga menunjukkan bahwa profil protein bergantung pada beberapa faktor yang akan dibahas lebih lanjut dalam makalah. The development of vaccine against malaria as the deadly disease remains the global public health priority; and it includes the use of irradiated parasites as vaccine materials. Immunization with irradiated sporozoites could provide protective immunity in animals and volunteers. The mechanism of this body immunity system has been studied widely due to its important role in the development of vaccines and profiles and/or protein expression post-irradiation which are closely related to safety and other aspects of vaccine materials. Even though extensive research has been done, a safe and protective vaccine

  20. TANTANGAN DAKWAH DI ERA TEKNOLOGI DAN INFORMASI: Formulasi Karakteristik, Popularitas, dan Materi di Jalan Dakwah

    Directory of Open Access Journals (Sweden)

    nur Ahmad

    2015-11-01

    Full Text Available Teknologi di era globalisasi telah mengalami kemajuan yang begitu pesat. Berbagai macam media komunikasi bersaing dalam memberikan informasi tanpa batas. Fasilitas internet merupakan yang terlengkap dan efisien, dimana segala bentuk dan macam informasi dapat diakses dengan mudah dan murah termasuk dalam hal ini adalah dakwah di era teknologi didukung dengan semakin menjamurnya warung internet yang memasang tarif murah, kemana dan dengan siapapun. Sekarang kita bisa melakukan dakwah dengan mengunakan fasilitas digital, diantaranya bisa melalui radio, televisi, telepon seluler, media internet, facebook, atau twiter. Berdakwah melalui media internet merupakan salah satu media komunikasi yang fenomenal dan canggih yang lahir di era 60-an. Namun, kemajuan teknologi dan informasi, khususnya media televisi, memungkinkan seorang dai untuk berimprovisasi dengan selingan humor dan hal-hal lain, agar materi ceramahnya tetap menarik untuk disimak. Dampaknya, orientasi dakwah yang diperankan para dai, juga semakin berkembang, bahkan cenderung menjadi bias. Pola berdakwah melalui media sebagai wujud kemajuan teknologi menjadi tantangan bagi diri sendiri bagi seseorang dai. Pengaruh media memungkinkan seorang dai memperoleh popularitas di mata pemirsanya seperti layaknya seorang selebriti (publik figur dan tidak menutup kemungkinan pula setiap kegiatan dakwahnya sering dinilai dengan materi. Kata Kunci: Karakteristik, Popularitas, Materi, Tantangan Dakwah. THE CHALLENGES OF DAWA IN THE ERA OF TECHNOLOGY AND INFORMATION: THE FORMULATION CHARACTERISTICS, POPULARITY, AND MATERIAL IN THE PATH OF DAWA. Technology in the era of globalization has experienced a rapid progress. A wide range of communication media compete in providing information without limits. The internet is the most comprehensive and efficient, where all shapes and kinds of information can be accessed easily and inexpensively included in this is the dawa in the era of technology supported by the