WorldWideScience

Sample records for atom ssa dan

  1. SSA Disability Claim Data

    Data.gov (United States)

    Social Security Administration — The dataset includes fiscal year data for initial claims for SSA disability benefits that were referred to a state agency for a disability determination. Specific...

  2. PERANCANGAN DAN PEMBUATAB ALAT UKUR KADAR KROM DALAM AIR DENGAN MENGGUNAKAN PRINSIP SPEKTROSKOPI SERAPAN ATOM

    Directory of Open Access Journals (Sweden)

    Tin Yunis Mahfudloh, Mohammad Tirono

    2012-04-01

    Full Text Available Air adalah bahan yang berperan penting dalam berbagai aspek kehidupan manusia. Air steril dengan kandungan mineral yang cukup dan tidak terpolusi dapat berperan sebagai cairan yang menata keseimbangan tubuh. Apabila air yang dikosumsi manusia telah tercemar oleh sampah dan limbah industri yang mengandung zat-zat kimia/logam berat yang bersifat racun akan berbahaya Seperti kromium/krom dengan kode kimiawi Cr. Penelitian dilakukan untuk membuat alat ukur kadar krom dalam air dengan metode absorpsi dengan instrumen fotometri. Alat ukur kadar krom dalam air menggunakan prinsip spektroskopi serapan atom terdiri dari 2 sistem, yaitu sistem optik dan sistem elektronik. Sistem optik terdiri dari lampu halogen, filter cahaya dengan panjang gelombang 520.4, kuvet dan sensor photodioda. Sedangkan sistem elektronik terdiri dari ADC 0804, MCU AT89S51 dan LCD.  Prinsip keja alat ini adalah cahaya polikromatis yang dipancarkan oleh lampu halogen akan melewati filter sehingga cahaya polikromatis akan bersifat monokromatis. Cahaya akan melewati air dengan kadar krom 0% untuk mereset reagen dan pelarut kemudian dideteksi oleh sensor sehingga menghasilkan data I0. Setelah dideteksi air  akan bergeser ke atas dan sensor bergeser kebelakang untuk mendeteksi sampel yang mempunyai kadar krom tertentu dan menghasilkan data I1. Di dalam sampel ini terjadi penyerapan intensitas cahaya oleh atom krom. Kemudian data I0 dan I1 akan diolah oleh MCU AT89S51 dan ditampilkan pada LCD. Sampel yang digunakan adalah larutan H2O dengan K2Cr2O7 sebanyak 10 sampel dengan variasi kadar 0%, 1%, 1.5%, 2%, 2.5%, 3%, 3.5%, 4%, 4.5%, dan 5%. Larutan krom diperoleh dengan cara mengencerkan 10gr K2Cr2O7 dalam 100ml H2O sehingga didapatkan K2Cr2O7 10% sebagai larutan stok, selanjutnya untuk mendapatkan K2Cr2O7 dengan kadar tertentu, maka diambil dari larutan stok kemudian diencerkan sampai volume 25 ml sesuai dengan rumus M1 V1 =M 2 V2 Hasil pegujian pada sistem elektronik menunjukkan

  3. SSA State Agency Workload Data

    Data.gov (United States)

    Social Security Administration — The dataset is revised and expanded from 4 to 71 data fields. It includes monthly data from October 2000 onwards for SSA disability cases that were referred to the...

  4. Lupus systémique et atteinte rénale: Apport des anticorps anti-SSA ...

    African Journals Online (AJOL)

    -SSA dans 12 cas (40%).Cinq patients (62.5%) ayant une atteinte rénale avaient des anticorps anti DNA négatifs. Parmi ces patients avec atteinte rénale, 37.5% avaient des anticorps anti SSA sans anticorps anti DNA. La moitié des patients ...

  5. Digitalisation in atomic pile control (1962); La digitalisation dans le controle des piles atomiques (1962)

    Energy Technology Data Exchange (ETDEWEB)

    Furet, J [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1962-07-01

    A brief survey is first given of the general theorems of Boodle's algebra and of sequence systems using D.A. Huffmans theory. Some indications are then given concerning the setting-up and the operation of digital computers and also of the principal codes used in digital techniques. It is then shown how digitalisation in atomic pile control makes it possible to use new techniques having the following advantages in particular: greater working safety, a higher degree of centralisation, and suppression of the linear elements. A few examples are given of the application of these techniques to control, particularly with respect to the measurement of the neutronic power and of the period and also of course, to the treatment of the data and the sequence automatisms. The advantage of using digital techniques in the shutdown channels is also examined. Finally a review is given of the technology and the viability of the control devices used. (author) [French] On rappelle d'abord ici les theoremes generaux de l'algebre de Boole et des systemes a sequences en s'appuyant sur la theorie de D.A. Huffmann. On donne ensuite quelques indications sur l'agencement et le fonctionnement des calculateurs digitaux ainsi que les principaux codes utilises dans les techniques digitales. On montre alors comment la digitalisation dans le controle des piles atomiques permet d'utiliser de nouvelles techniques presentant principalement les avantages suivants: securite de fonctionnement plus grande, centralisation plus elevee et suppression des elements lineaires. Un certain nombre d'exemples sont donnes sur l'application de ces techniques au controle, particulierement en ce qui concerne la mesure de la puissance neutronique, de la periode et aussi bien entendu du traitement des informations et des automatismes a sequences. On analyse aussi l'avantage de l'utilisation des techniques digitales dans les chaines de securite. Enfin, un apercu est donne sur la technologie et la fiabilite des dispositifs

  6. Safety precautions in atomic pile control (1962); Securite dans le controle des piles atomiques (1962)

    Energy Technology Data Exchange (ETDEWEB)

    Furet, J. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1962-07-01

    We have been led to study the problem of safety in atomic pile control as a result of our participation on the one hand in the planning of C.E.A. atomic piles, and on the other hand in the pile safety sub omission considering atomic pile safety of operational or planned C.E.A. piles. We have thus had to consider the wishes occurring in piles during their operation and also their behaviour in the dynamic state The present work deals mainly with the importance of intrinsic safety devices, with the influence of reactivity variations on the power fluctuations during accidental operation, and with the development of robust and reliable safety appliances. The starting p accident has been especially studied both for low-flux piles where a compromise is necessary between the response time of the safety appliances and the statistical fluctuations and for high lux piles where xenon poisoning has an effect on the lower limit of the velocity of reactivity liberation. The desirability has been stressed of automation as a safety factor in atomic pile control. The details required for an understanding of the diagrams of the apparatus are given. (author) [French] Nous avons aborde le probleme de la securite dans le controle des piles atomiques a la suite de notre participation d'une part aux avant rojets de piles atomiques du CE.A. et d'autre part a l'examen au sein de la sous ommission de surete des piles, de la securite des piles du CE.A. en fonctionnement ou en projet. Nous avons ete amenes a nous interesser alors aux risques encourus par les piles pendant leur fonctionnement et par la meme a leur comportement en regime dynamique. Ce travail traite principalement de l'importance des securites intrinseques, de l'influence des variations de reactivite sur les evolutions de puissance en regime d'accident et du developpement d'appareillages de securite robustes et de fonctionnement tres sur. L'accident de demarrage a ete particulierement

  7. Safety precautions in atomic pile control (1962); Securite dans le controle des piles atomiques (1962)

    Energy Technology Data Exchange (ETDEWEB)

    Furet, J [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1962-07-01

    We have been led to study the problem of safety in atomic pile control as a result of our participation on the one hand in the planning of C.E.A. atomic piles, and on the other hand in the pile safety sub omission considering atomic pile safety of operational or planned C.E.A. piles. We have thus had to consider the wishes occurring in piles during their operation and also their behaviour in the dynamic state The present work deals mainly with the importance of intrinsic safety devices, with the influence of reactivity variations on the power fluctuations during accidental operation, and with the development of robust and reliable safety appliances. The starting p accident has been especially studied both for low-flux piles where a compromise is necessary between the response time of the safety appliances and the statistical fluctuations and for high lux piles where xenon poisoning has an effect on the lower limit of the velocity of reactivity liberation. The desirability has been stressed of automation as a safety factor in atomic pile control. The details required for an understanding of the diagrams of the apparatus are given. (author) [French] Nous avons aborde le probleme de la securite dans le controle des piles atomiques a la suite de notre participation d'une part aux avant rojets de piles atomiques du CE.A. et d'autre part a l'examen au sein de la sous ommission de surete des piles, de la securite des piles du CE.A. en fonctionnement ou en projet. Nous avons ete amenes a nous interesser alors aux risques encourus par les piles pendant leur fonctionnement et par la meme a leur comportement en regime dynamique. Ce travail traite principalement de l'importance des securites intrinseques, de l'influence des variations de reactivite sur les evolutions de puissance en regime d'accident et du developpement d'appareillages de securite robustes et de fonctionnement tres sur. L'accident de demarrage a ete particulierement developpe aussi bien pour les piles a bas

  8. Pompage optique et violation de parité dans l'atome

    Science.gov (United States)

    Bouchiat, M.-A.

    , polarized and unpolarized, produced by mirror symmetries with respect to three orthogonal planes. In this way, it is possible to disentangle the different interference terms and to discriminate the one involving parity violation. In practice, this is done by reversing various parameters of the experiment. The control of the quality of these reversals is obviously the crucial part of the whole experimental procedure. Moreover consistency tests and various cross-checks have to be devised and carefully carried out. They contribute to reliability of the result. In the Cesium experiment, the uncertainty associated with possible systematic effects is estimated to 8 % and the eqm statistical uncertainty, after combination of two independent measurements which satisfactorily crosscheck one another, is 11%. The parity violation can be readily interpreted in terms of the short range electronnucleon interaction associated with the exchange of the neutral vector boson Z0 recently observed with the CERN p-p collider. This new type of interaction, also known under the generic name of « neutral currents » was one of the most important predictions of electroweak theory which unifies, within the frame of gauge field theories, electromagnetic and weak interactions. This experiment, originally designed as a test of electroweak theory, gives information on the structure of neutral currents which complement those obtained by high energy experiments. First, the explored energy range is obviously very different. Secondly, the quarks acting coherently in Atomic Physics experiment but incoherently in accelerator experiments, the basic electroweak parameters extracted from the two kinds of experiments are different. Entre les travaux initiaux de Kastler sur la polarisation de la lumière de fluorescence émise par une vapeur de mercure (1936) et la violation de la parité dans le césium (1982), il existe un lien de parenté dans les méthodes d'investigation et dans la nature des probl

  9. The Case for GEO Hosted SSA Payloads

    Science.gov (United States)

    Welsch, C.; Armand, B.; Repp, M.; Robinson, A.

    2014-09-01

    Space situational awareness (SSA) in the geosynchronous earth orbit (GEO) belt presents unique challenges, and given the national importance and high value of GEO satellites, is increasingly critical as space becomes more congested and contested. Space situational awareness capabilities can serve as an effective deterrent against potential adversaries if they provide accurate, timely, and persistent information and are resilient to the threat environment. This paper will demonstrate how simple optical SSA payloads hosted on GEO commercial and government satellites can complement the SSA mission and data provided by Space-Based Space Surveillance (SBSS) and the Geosynchronous Space Situational Awareness Program (GSSAP). GSSAP is built by Orbital Sciences Corporation and launched on July 28, 2014. Analysis performed for this paper will show how GEO hosted SSA payloads, working in combination with SBSS and GSSAP, can increase persistence and timely coverage of high value assets in the GEO belt. The potential to further increase GEO object identification and tracking accuracy by integrating SSA data from multiple sources across different viewing angles including GEO hosted SSA sources will be addressed. Hosting SSA payloads on GEO platforms also increases SSA mission architecture resiliency as the sensors are by distributed across multiple platforms including commercial platforms. This distributed architecture presents a challenging target for an adversary to attempt to degrade or disable. We will present a viable concept of operations to show how data from hosted SSA sensors could be integrated with SBSS and GSSAP data to present a comprehensive and more accurate data set to users. Lastly, we will present an acquisition approach using commercial practices and building on lessons learned from the Commercially Hosted Infra Red Payload CHIRP to demonstrate the affordability of GEO hosted SSA payloads.

  10. BOREAS TE-01 SSA Soil Lab Data

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set provides a set of soil properties for the SSA. The soil samples were collected at sets of soil pits. Major soil properties include soil horizon; dry...

  11. BOREAS TE-01 SSA Soil Lab Data

    Data.gov (United States)

    National Aeronautics and Space Administration — ABSTRACT: This data set provides a set of soil properties for the SSA. The soil samples were collected at sets of soil pits. Major soil properties include soil...

  12. Etude de la fixation d'atomes de brome dans les traces latentes d'ions

    Science.gov (United States)

    Vareille, J. C.; Moliton, J. P.; Decossas, J. L.; Teyssier, J. L.; Delaunay, B.

    1981-09-01

    We show that the branching of bromide atoms is possible on chemically active sites produced by Kr 8+, Cl 6+ and He 2+ ion irradiation on cellulose triacetate. The number of fixed atoms increases with ion fluence and atomic number. These results are in good agreement with those concerning radical yield around the ions' path.

  13. Dicty_cDB: SSA423 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA423 (Link to dictyBase) - - - - SSA423F (Link to Original s...ite) SSA423F 443 - - - - - - Show SSA423 Library SS (Link to library) Clone ID SSA423 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...FIIGFFLCLTVFLTFVNSSEIDHQYSLTSSINGSSSGVSNSTDNTGCGEYTSCGDCREDK GCVWCGSEGICTEGTFYGTKPLNINGACKDFMWMQCKIQGRWAILIA...VSNSTDNTGCGEYTSCGDCREDK GCVWCGSEGICTEGTFYGTKPLNINGACKDFMWMQCKIQGRWAILIAAGGAFLIIVFFFI CLCCCCCRRKKDKHYHNIQDDET

  14. Dicty_cDB: SSA581 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA581 (Link to dictyBase) - - - Contig-U12576-1 SSA581Z (Link... to Original site) - - SSA581Z 504 - - - - Show SSA581 Library SS (Link to library) Clone ID SSA581 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12576-1 Original site URL http://dict...SARPLGVAMILIGIDDELGPQLFKVDPAGVFTGYKATAAGEK EQESTNFLEKKFKSNPQLSKDETIQMAISTLQSVLGADLKSSDLEIGICTMDNRKFVIMT DEDI...QHASARPLGVAMILIGIDDELGPQLFKVDPAGVFTGYKATAAGEK EQESTNFLEKKFKSNPQLSKDETIQMAISTLQSVLGADLKSSDLEIGICTMDNRKFVIMT D

  15. Delivering SSA Capabilities to the Warfighter

    Science.gov (United States)

    van Weezendonk, J.; Sherk, J.; Ryan, T.; McGuire, R.

    The Space Superiority Systems Wing at the Space and Missile Center (SMC/SY) equips US forces with Offensive Counterspace (OCS), Defensive Counterspace (DCS), and Space Situation Awareness (SSA) systems that further enhance space superiority. The Technology Division (SYT) mission is to identify, develop, and transition cutting-edge technologies to the warfighter. SYT invests in the most relevant technologies for SSA, DCS and OCS that enhance SMC/SY's portfolio. This presentation will provide an overview of the SMC/SY SSA Technology being worked and highlights several key programs. The presentation will also highlight how the SMC/SY SSA efforts fit into to a Space Superiority Architecture. SYT executes its own Space Control Technology program line and leverages technologies from various DoD and national laboratories, Federally Funded Research and Development Companies, national agencies, industry and academia to accomplish their mission. The portions of the SY FY06 SSA portfolio that will be discussed are: Precision Metrics, Star Sensor Studies, Multi-mission Deployable Optical System, Intelligent Agent Data Fusion efforts, ESSA ACTD and the GReAT tech demo.

  16. The colour potentials of SSA-containing mortar

    DEFF Research Database (Denmark)

    Kappel, Annemette; Ottosen, Lisbeth M.; Kirkelund, Gunvor Marie

    2015-01-01

    This paper reports an experimental study of aesthetical qualities of mortar containing sewage sludgeash (SSA). SSA is the residue produced at water treatment plants where incineration of the sludge is applied in order to decrease volume and to prevent pathogens from spreading. Today SSA is with a......This paper reports an experimental study of aesthetical qualities of mortar containing sewage sludgeash (SSA). SSA is the residue produced at water treatment plants where incineration of the sludge is applied in order to decrease volume and to prevent pathogens from spreading. Today SSA...

  17. Evolution of ESA's SSA Conjunction Prediction Service

    Science.gov (United States)

    Escobar, D.; Sancho, A. Tirado, J.; Agueda, A.; Martin, L.; Luque, F.; Fletcher, E.; Navarro, V.

    2013-08-01

    This paper presents the recent evolution of ESA's SSA Conjunction Prediction Service (CPS) as a result of an on-going activity in the Space Surveillance and Tracking (SST) Segment of ESA's Space Situational Awareness (SSA) Programme. The CPS is one of a number of precursor services being developed as part of the SST segment. It has been implemented as a service to provide external users with web-based access to conjunction information and designed with a service-oriented architecture. The paper encompasses the following topics: service functionality enhancements, integration with a live objects catalogue, all vs. all analyses supporting an operational concept based on low and high fidelity screenings, and finally conjunction detection and probability algorithms.

  18. Atoms

    International Nuclear Information System (INIS)

    Fuchs, Alain; Villani, Cedric; Guthleben, Denis; Leduc, Michele; Brenner, Anastasios; Pouthas, Joel; Perrin, Jean

    2014-01-01

    Completed by recent contributions on various topics (atoms and the Brownian motion, the career of Jean Perrin, the evolution of atomic physics since Jean Perrin, relationship between scientific atomism and philosophical atomism), this book is a reprint of a book published at the beginning of the twentieth century in which the author addressed the relationship between atomic theory and chemistry (molecules, atoms, the Avogadro hypothesis, molecule structures, solutes, upper limits of molecular quantities), molecular agitation (molecule velocity, molecule rotation or vibration, molecular free range), the Brownian motion and emulsions (history and general features, statistical equilibrium of emulsions), the laws of the Brownian motion (Einstein's theory, experimental control), fluctuations (the theory of Smoluchowski), light and quanta (black body, extension of quantum theory), the electricity atom, the atom genesis and destruction (transmutations, atom counting)

  19. Dicty_cDB: SSA564 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA564 (Link to dictyBase) - - - - SSA564F (Link to Original s...ite) SSA564F 653 - - - - - - Show SSA564 Library SS (Link to library) Clone ID SSA564 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...NNTLKPKQTTKGFNIGGQPGNPTN*l--- Frame C: tlkfvmplvmkictslvlvlkrstk*rklfmmenshqtldgl...bits) Value N M77492 |M77492.1 Dictyostelium discoideum glycoprotein phosphorylase 2 (glpD) gene, complete c

  20. The Josephson effect in atomic contacts; Effect Josephson dans les contacts atomiques

    Energy Technology Data Exchange (ETDEWEB)

    Chauvin, M

    2005-11-15

    The Josephson effect appears when a weak-link establishes phase coherence between two superconductors. A unifying theory of this effect emerged in the 90's within the framework of mesoscopic physics. Based on two cornerstone concepts, conduction channels and Andreev reflection, it predicts the current-phase relation for the most basic weak-link: a single conduction channel of arbitrary transmission. This thesis illustrates this mesoscopic point of view with experiments on superconducting atomic size contacts. In particular, we have focused on the supercurrent peak around zero voltage, put into evidence the ac Josephson currents in a contact under constant bias voltage (Shapiro resonances and photon assisted multiple Andreev reflections), and performed direct measurements of the current-phase relation. (author)

  1. Événement et trauma dans Doctor Atomic de John Adams

    Directory of Open Access Journals (Sweden)

    Mathieu Duplay

    2011-04-01

    Full Text Available This article is based on the hypothesis that, by investigating the question of trauma, psychoanalysis has made an innovative contribution to the debate surrounding the concept of event, not so much because of the points explicitly made by Freud and his successors as because the ambiguities, contradictions, and aporias which characterize their discourse reveal some of the previously unseen difficulties inherent in such a discussion. Thus, the writer argues that a theory and/or poetics of event, however alien to the Freudian tradition, would benefit greatly by paying close attention to the lessons it teaches in this respect. John Adams’s 2005 opera Doctor Atomic, written in collaboration with Peter Sellars, is a case in point, not only because it deals with one of the most violent traumas in 20th‑century history—namely the nuclear test conducted at Los Alamos prior to the bombing of Hiroshima and Nagasaki—but also because, in addition to offering a potent meditation on the unthinkable, it reveals that all events, be they historical or aesthetic, call for new and as yet unformulated modes of thought ; as psychoanalysis suggests (sometimes in spite of itself, this is a clear sign of their traumatic nature.Cet article s’appuie sur l’hypothèse que le travail mené par la psychanalyse sur la notion de trauma jette un éclairage novateur sur la question de l’événement, et cela moins en raison des thèses tour à tour avancées que parce que les ambiguïtés, les revirements et les apories qui caractérisent le discours de Freud et de ses successeurs révèlent quelques‑unes des difficultés jusque-là inaperçues que cette problématique soulève ; c’est pourquoi, suppose‑t‑on, toute pensée et toute esthétique de l’événement, si étrangères soient‑elles à la tradition freudienne, ne peuvent aujourd’hui que gagner à méditer les enseignements dont elle est porteuse sur ce point. L’exemple de Doctor Atomic (2005

  2. Atom

    International Nuclear Information System (INIS)

    Auffray, J.P.

    1997-01-01

    The atom through centuries, has been imagined, described, explored, then accelerated, combined...But what happens truly inside the atom? And what are mechanisms who allow its stability? Physicist and historian of sciences, Jean-Paul Auffray explains that these questions are to the heart of the modern physics and it brings them a new lighting. (N.C.)

  3. The Aesthetical quality of SSA-containing mortar and concrete

    DEFF Research Database (Denmark)

    Kappel, Annemette; Kirkelund, Gunvor Marie; Ottosen, Lisbeth M.

    2014-01-01

    that gives a characteristic red colour. The process of grinding SSA has shown to improve the compressive strength of SSA- containing mortar (Donatello et al. 2010). Thus, in this study SSA was grinded in 6 different intervals ranging from 0 – 10 min, and then added to the mortar mix replacing 20% of cement....... The experiment revealed that the colour of the SSA-containing mortar intensified as the time interval of the grinding process increased. Each of the 6 steps within the time interval provided an additional colour tone and generated a colour scale consisting of mortar samples ranging from greyish to a more...

  4. 76 FR 41685 - Electronic Substitutions for Form SSA-538

    Science.gov (United States)

    2011-07-15

    ... visit our Internet site, Social Security Online, at http://www.socialsecurity.gov . SUPPLEMENTARY... SOCIAL SECURITY ADMINISTRATION 20 CFR Part 416 [Docket No. SSA-2009-0027] RIN 0960-AH02 Electronic Substitutions for Form SSA-538 AGENCY: Social Security Administration. ACTION: Final rule with request for...

  5. 77 FR 38880 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Railroad Retirement Board (SSA...

    Science.gov (United States)

    2012-06-29

    ... Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching program that... regarding protections for such persons. The Privacy Act, as amended, regulates the use of computer matching... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0002] Privacy Act of 1974, as Amended...

  6. BOREAS TF-01 SSA-OA Soil Characteristics Data

    Data.gov (United States)

    National Aeronautics and Space Administration — Data collected in support of the effort to characterize and interpret soil information at the SSA-OA tower site in 1994. Data collected include soil respiration,...

  7. TiSSA eelkonverents doktorantidele Tallinnas / Koidu Saame

    Index Scriptorium Estoniae

    Saame, Koidu

    2010-01-01

    Tallinna Ülikoolis toimunud TiSSA doktorantide eelkonverentsist 22.-24. aug. 2010.a. Doktorantide ettekannetest. Esinesid: Hans-Uwe Otto, Andriy Yuryev, Tiina Naarits, Ivar Tröner, Koidu Saame, Maija Jäppinen, Janissa Miettinen

  8. BOREAS TF-01 SSA-OA Soil Characteristics Data

    Data.gov (United States)

    National Aeronautics and Space Administration — ABSTRACT: Data collected in support of the effort to characterize and interpret soil information at the SSA-OA tower site in 1994. Data collected include soil...

  9. Clinical and Pathological Roles of Ro/SSA Autoantibody System

    Directory of Open Access Journals (Sweden)

    Ryusuke Yoshimi

    2012-01-01

    Full Text Available Anti-Ro/SSA antibodies are among the most frequently detected autoantibodies against extractable nuclear antigens and have been associated with systemic lupus erythematosus (SLE and Sjögren's syndrome (SS. Although the presence of these autoantibodies is one of the criteria for the diagnosis and classification of SS, they are also sometimes seen in other systemic autoimmune diseases. In the last few decades, the knowledge of the prevalence of anti-Ro/SSA antibodies in various autoimmune diseases and symptoms has been expanded, and the clinical importance of these antibodies is increasing. Nonetheless, the pathological role of the antibodies is still poorly understood. In this paper, we summarize the milestones of the anti-Ro/SSA autoantibody system and provide new insights into the association between the autoantibodies and the pathogenesis of autoimmune diseases.

  10. Atomes une exploration visuelle de tous les éléments connus dans l'univers

    CERN Document Server

    Gray, Theodore

    2013-01-01

    Quelle est leur température critique ? Qu'est-ce que la masse atomique, la densité d'un matériau, l'ordre de remplissage des électrons ? Cet ouvrage invite avec pédagogie et humour à un passionnant voyage au pays des éléments, à partir de leur tableau périodique universel. Soutenue par une exploration visuelle qui montre l'élément à l'état pur mais aussi ses composés et ses applications les plus caractéristiques dans la vie quotidienne, cette approche pratique offre une combinaison parfaite de science chimique et de photographies, qui séduira les lecteurs les plus avertis comme tous les autres habitants sensibles de l'univers.

  11. Preliminary approach of the MELiSSA loop energy balance

    Science.gov (United States)

    Poulet, Lucie; Lamaze, Brigitte; Lebrun, Jean

    Long duration missions, such as the establishment of permanent bases on the lunar surface or the travel to Mars, require a huge amount of life support consumables (e.g. food, water and oxygen). Current rockets are at the moment unable to launch such a mass from Earth. Consequently Regenerative Life Support Systems are necessary to sustain long-term manned space mission to increase recycling rates and so reduce the launched mass. Thus the European and Canadian research has been concentrating on the MELiSSA (Micro-Ecological Life Support System Alternative) project over the last 20 years. MELiSSA is an Environmental Controlled Life Support System (ECLSS), i.e. a closed regenerative loop inspired of a lake ecosystem. Using light as a source of energy, MELiSSA's goal is the recovery of food, water and oxygen from CO2 and organic wastes, using microorganisms and higher plants. The architecture of a ECLSS depends widely on the mission scenario. To compare several ECLSS architectures and in order to be able to evaluate them, ESA is developing a multi criteria evaluation tool: ALISSE (Advanced LIfe Support System Evaluator). One of these criteria is the energy needed to operate the ECLSS. Unlike other criteria like the physical mass, the energy criterion has not been investigated yet and needs hence a detailed analysis. It will consequently be the focus of this study. The main objective of the work presented here is to develop a dynamic tool able to estimate the energy balance for several configurations of the MELiSSA loop. The first step consists in establishing the energy balance using concrete figures from the MELiSSA Pilot Plant (MPP). This facility located at the Universitat Autonoma de Barcelona (UAB) is aimed at the ground demonstration of the MELiSSA loop. The MELiSSA loop is structured on several subsystems; each of them is characterized by supplies, exhausts and process reactions. For the purpose of this study (i.e. a generic tool) the solver EES (Engineering

  12. Arctic Region Space Weather Customers and SSA Services

    DEFF Research Database (Denmark)

    Høeg, Per; Kauristi, Kirsti; Wintoft, Peter

    Arctic inhabitants, authorities, and companies rely strongly on precise localization information and communication covering vast areas with low infrastructure and population density. Thus modern technology is crucial for establishing knowledge that can lead to growth in the region. At the same time...... and communication can be established without errors resulting from Space Weather effects. An ESA project have identified and clarified, how the products of the four ESA Space Weather Expert Service Centres (SWE) in the ESA Space Situational Awareness Programme (SSA), can contribute to the requirements of SSA...

  13. Theoretical White Dwarf Spectra on Demand: TheoSSA

    Science.gov (United States)

    Ringat, E.; Rauch, T.

    2010-11-01

    In the last decades, a lot of progress was made in spectral analysis. The quality (e.g. resolution, S/N ratio) of observed spectra has improved much and several model-atmosphere codes were developed. One of these is the ``Tübingen NLTE Model-Atmosphere Package'' (TMAP), that is a highly developed program for the calculation of model atmospheres of hot, compact objects. In the framework of the German Astrophysical Virtual Observatory (GAVO), theoretical spectral energy distributions (SEDs) can be downloaded via TheoSSA. In a pilot phase, TheoSSA is based on TMAP model atmospheres. We present the current state of this VO service.

  14. Dosage du mercure dans le gaz naturel par absorption atomique sans flammes Mercury Titration in Natural Gas by Flameless Atomic Absorption

    Directory of Open Access Journals (Sweden)

    La Villa F.

    2006-11-01

    Full Text Available Cet article présente la méthode mise au point par l'Institut Français du Pétrole pour déterminer par absorption atomique sans flamme, les traces de mercure métallique contenu dans un gaz naturel. La méthode d'analyse nécessite une extraction du mercure soit sous forme d'ion mercurique en faisant passer le gaz dans une solution oxydante, soit sous forme d'amalgame avec de l'or ou de l'argent. Le premier mode opératoire s'applique aux échantillons dont la concentration en mercure est supérieure à I ttg/Nm3, le second pour des concentrations inférieures à 5 pg/Nm3. Les seuils de détection sont respectivement 10 ng (en solution et 0,3 ng (en amalgame. La répétabilité pour 100 ng de mercure (en amalgame est de ± 7% pour une probabilité de.95 %. En conclusion, dans un échantillon de gaz naturel, compte tenu du volume des prélèvements effectués, il est possible de détecter des concentrations de l'ordre du nanogramme de mercure par mètre cube de gaz. This article describes the method developed by IFP using flameless atomic absorption to determine metallic mercury traces in a natural gas. The analyst method requires a mercury extraction either in the form of mercuric ions by making the gas pass through an oxidizing solution or in the form of an amalgam with gold or silver. The former operating method applies ta samples having a mercury concentration greater than I !ag/Nm3, and the latter for concentrations smaller than 5 (-Lg/Nm3. Detection thresholds are respectively 10 ng (in solution and 0.3 ng (in amalgam. The repeatability for 100 ng of mercury (in amalgam is ± 7 % with a probability of 95%. To conclude, in a sample of natural gas, considering the volume of the samples taken, it is possible ta detect concentrations in the vicinity of one nanogrom of mercury per cubic meter of gas.

  15. UJI KEMURNIAN BENSIN DI SPBU DAN PENGECER SE-KOTA PADANG MENGGUNAKAN METODE SPEKTROSKOPI SERAPAN ATOM MERKURI

    OpenAIRE

    Mohammad Ali Shafii; Harmadi Harmadi; Khairatul Ihksan; Seni Herlina; J. Tongkukut

    2016-01-01

    The gasoline purity test has been carried out in several retailers inPadangcity using Mercury atomic absorption spectroscopy method. As an object of study was taken 10 samples of gasoline were sold in stalls scattered retailers in the city ofPadang, for subsequent comparison with standard samples that taken from Pertamina Teluk Kabung Padang. Spectrum produced by each sample was analyzed based percentage difference between the spectrum peak, the angle position and the sample wavelength. To de...

  16. Study of atomic jumps in quasi-crystals; Etude des sauts atomiques dans les quasi-cristaux

    Energy Technology Data Exchange (ETDEWEB)

    Lyonnard, S

    1997-05-07

    The terminology phason used in quasicrystals to refer to atomic jumps. The study of the hopping process is important for the understanding of many basic issues in quasi-crystallography: structure, stability, diffusion, phase transitions between quasicrystals and approximants, mechanical properties. Quasi-elastic neutron scattering allows to find the characteristics of each elementary jump: chemical species involves, relaxation times, activation energies, jump distances and orientations. We performed a series of experiments in the perfect icosahedral phases AlFeCu and AlMnPd, on both powders and single domain samples, using time-of-flight, backscattering and triple axis spectrometers. We evidenced the existence of very fast phason hopping, and studied about ten different atomic jumps. An unusual temperature dependence has been found systematically: each process is assisted by a thermally activated mechanism. The assistance process has to be determined case by case, but the more plausible explanation invokes assistance by phonons or phason clouds. Moreover, the dependence of the quasi elastic signal as a function of the momentum transfer shows that the jumps are local and do not give rise to any long-range diffusion. Phason hopping mainly corresponds to the atom moving forwards and backwards between two energetically equivalent sites. Finally, we have been able to show that the jumps occur along the various quasi-crystalline symmetry axes. (author) 91 refs.

  17. Evaluating Options for Civil Space Situational Awareness (SSA)

    Science.gov (United States)

    Lal, B.; Carioscia, S. A.

    In recent years, the number of active satellites and human-made orbital space debris has increased dramatically. An expansion of activities in space, as is currently being proposed by many commercial and international entities, is expected to further exacerbate this challenge. The 18th Space Control Squadron under the Department of Defense (DOD) United States Strategic Command provides space situational awareness (SSA) services to users outside the national security community at no cost. International and commercial users demand better SSA service than is currently feasible, and the demand comes at a time when DOD is under pressure to better prepare for and respond to growing space-based threats to national security. Concerned about the possibility of overextending across conflicting missions in a fiscally constrained environment, some DOD officials have publicly noted a desire to move SSA services not related to national security out of DOD purview. Responding to a request from the Federal Aviation Administration (FAA) Office of Commercial Space Transportation (AST), researchers at the Science and Technology Policy Institute (STPI) identified and evaluated potential approaches for providing SSA services for civil and commercial operations in space. In this paper, we summarize the report [1] and present the pros and cons of four approaches to the provision of civil SSA services in the United States: (1) maintaining status quo through continued provision by DOD; (2) provision by a civil government entity; (3) industry self-provision; and (4) provision by an international organization. Within the second approach, assuming the provision of SSA by a civil agency, STPI further identified and discussed four options: (1) civil agency service capability embedded within DOD; (2) independent civil service capability, using DOD software and systems; (3) independent civil service capability, using commercial software and systems; and (4) the government certifies non

  18. Sessile serrated adenoma (SSA) vs. traditional serrated adenoma (TSA).

    Science.gov (United States)

    Torlakovic, Emina Emilia; Gomez, Jose D; Driman, David K; Parfitt, Jeremy R; Wang, Chang; Benerjee, Tama; Snover, Dale C

    2008-01-01

    The morphologic distinction between various serrated polyps of the colorectum may be challenging. The distinction between sessile serrated adenoma (SSA) and traditional serrated adenoma (TSA) may be difficult using currently available criteria mostly based on cytologic characteristics. We have evaluated 66 serrated polyps including 29 SSA, 18 TSA, and 19 hyperplastic polyps for overall shape of the polyps, architectural features of individual crypts, the presence of eosinophilic cytoplasm, size and distribution of the proliferation and maturation zones, as well as Ki-67 and CK20 expression. The extent of the expression of CK20 and Ki-67 could not distinguish between the 3 types of serrated polyps, but the distribution of their expression was very helpful and differences were statistically significant. The distribution of Ki-67+ cells was the single most helpful distinguishing feature of the serrated polyp type (PTSA had low Ki-67 expression, which was limited to "ectopic crypts" and admixed tubular adenomalike areas. In serrated polyps, ectopic crypt formation (ECF) defined by the presence of ectopic crypts with their bases not seated adjacent to the muscularis mucosae was nearly exclusive to TSA and was found in all cases, while the presence of cytologic atypia and eosinophilia of the cytoplasm were characteristic, but not limited to TSA. No evidence of ECF, but nevertheless abnormal distribution of proliferation zone was characteristic of SSA, whereas HP had neither. The presence of the ECF defines TSA in a more rigorous fashion than previous diagnostic criteria and also explains the biologic basis of exuberant protuberant growth associated with TSA and the lack of such growth in SSA. Recognition of this phenomenon may also help in exploring the genetic and molecular basis for differences between SSA and TSA, because these architectural abnormalities may well be a reflection of abnormalities in genetically programmed mucosal development.

  19. Non-traditional Sensor Tasking for SSA: A Case Study

    Science.gov (United States)

    Herz, A.; Herz, E.; Center, K.; Martinez, I.; Favero, N.; Clark, C.; Therien, W.; Jeffries, M.

    Industry has recognized that maintaining SSA of the orbital environment going forward is too challenging for the government alone. Consequently there are a significant number of commercial activities in various stages of development standing-up novel sensors and sensor networks to assist in SSA gathering and dissemination. Use of these systems will allow government and military operators to focus on the most sensitive space control issues while allocating routine or lower priority data gathering responsibility to the commercial side. The fact that there will be multiple (perhaps many) commercial sensor capabilities available in this new operational model begets a common access solution. Absent a central access point to assert data needs, optimized use of all commercial sensor resources is not possible and the opportunity for coordinated collections satisfying overarching SSA-elevating objectives is lost. Orbit Logic is maturing its Heimdall Web system - an architecture facilitating “data requestor” perspectives (allowing government operations centers to assert SSA data gathering objectives) and “sensor operator” perspectives (through which multiple sensors of varying phenomenology and capability are integrated via machine -machine interfaces). When requestors submit their needs, Heimdall’s planning engine determines tasking schedules across all sensors, optimizing their use via an SSA-specific figure-of-merit. ExoAnalytic was a key partner in refining the sensor operator interfaces, working with Orbit Logic through specific details of sensor tasking schedule delivery and the return of observation data. Scant preparation on both sides preceded several integration exercises (walk-then-run style), which culminated in successful demonstration of the ability to supply optimized schedules for routine public catalog data collection – then adapt sensor tasking schedules in real-time upon receipt of urgent data collection requests. This paper will provide a

  20. Pengaruh Konsentrasi H2so4 Dan Berat Dari Bentonit Alam Teraktivasi Dan Komersil Terhadap Adsorpsi Logam Kadmium (Cd) Dan Tembaga (Cu) Dalam Larutan Standar Dalam Metode Spektrofotometri Serapan Atom

    OpenAIRE

    Ramadani, Eko

    2011-01-01

    The various concentration effect’s of H2SO4 and weight of activated bleaching earth and commercial to adsoption of cadmium metal (Cd) and copper (Cu) in standard solution using Atomic Absorption Spectrophotometric method has been studied. Bleaching earth activation process assessed various concentration of H2SO4 which is 0,4; 0,8; 1,2; 1,6; and 2,0 M. 1, 2, 3, 4, and 5 g activated bleaching earth and commercial added into cadmium standard solution (Cd) and copper (Cu) , stirred up to 6 hours,...

  1. A hybrid intermediate language between SSA and CPS

    DEFF Research Database (Denmark)

    Torrens, Paulo; Vasconcellos, Cristiano; Gonçalves, Ju

    2017-01-01

    passing style (CPS) lambda calculus has been used as intermediate language for functional language compilers, they are (almost) equivalent and it is possible to draw syntactic translations between them. This short paper aims to present an untyped intermediate language which may be interpreted as both SSA...... and CPS, in order to provide a common language for both imperative and functional compilers, as well to take advantage of optimizations designed for either one of the approaches. Finally, potential variants and research opportunities are discussed....

  2. Systematic Sustainability Assessment (SSA) Tool for Hydroelectric Project in Malaysia

    Science.gov (United States)

    Turan, Faiz Mohd; Johan, Kartina

    2017-08-01

    Sustainably developed and managed hydropower has enormous potential to contribute to global sustainability goals. It is known that hydroelectricity contributing small amounts to greenhouse gas emissions and other atmospheric pollutants. However, developing the remaining hydroelectric potential offers many challenges, and public pressure and expectations on the environmental and social performance of hydroelectric tend to increase over time. This paper aims to develop Systematic Sustainability Assessment (SSA) Tool that promotes and guides more sustainable hydroelectric projects in the context of Malaysia. The proposed SSA tool which not only provide a quality and quantitative report of sustainability performance but also act as Self-Assessment Report (SAR) to provide roadmap to achieve greater level of sustainability in project management for continuous improvement. It is expected to provide a common language that allow government, civil society, financial institutions and the hydroelectric sector to talk about and evaluate sustainability issues. The advantage of SSA tool is it can be used at any stage of hydroelectric development, from the earliest planning stages right through to operation.

  3. Study of total ionization by {alpha} particles, in pure gases and gaseous mixtures containing metastable atoms, as a function of temperature; Etude de l'ionisation totale par les paricules {alpha}, dans les gaz purs et les melanges gazeux contenant des atomes metastables, en fonction de la temperature

    Energy Technology Data Exchange (ETDEWEB)

    Bristeau, P [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1969-07-01

    Experiments have been carried out on the total ionization by alpha particles, in pure gases and gaseous mixtures containing metastable atoms, as a function of temperature. Using a different experimental method, the results for the mean ionization energy at 300 K given by Jesse in 1953 have been confirmed to within 1 per cent. It is established that in pure gases the mean energy W required to form a pair of ions remains constant as the temperature varies from 77 to 300 K. It is shown that there is a temperature effect for W in binary gas mixtures of the type A-B containing meta-stable atoms A{sup *} and an 'impurity' B. A systematic study is made of the change {delta}W in W as a function of the temperature and of the B 'impurity' concentration in the mixtures Ne - Ar, Ne - Kr, Ne - H{sub 2}, Ne - N{sub 2}, Ne - CH{sub 4} and He - Ar. Experiments have been carried out on a ternary gas mixture of the type A - B - C, where C is a second ionizable 'impurity' added to the binary mixture A - B; they show the existence of excited atoms B{sup *} formed from the 'impurity' B. Finally, it is shown that the amount of metastable atoms formed in a pure gas must be very close to the number N{sub 0} of ion pairs, and that there must exist a correlation between the number N{sub 0} of ion pairs and the number {approx_equal} N{sub 0} of metastable atoms created in the pure rare gases. (author) [French] On realise des experiences sur l'ionisation totale par les particules alpha, dans les gaz purs et les melanges gazeux contenant des atomes metastables, en fonction de la temperature. Avec une methode experimentale differente, on retrouve a mieux que 1 pour cent pres les valeurs de l'energie moyenne d'ionisation que JESSE a obtenues en 1953 et a 300 K. On etablit que dans les gaz purs, l'energie moyenne W pour creer une paire d'ions demeure constante, quand la temperature varie entre 77 et 300 K. On met en evidence un effet de temperature sur W, dans les melanges gazeux binaires du type

  4. Study of the Dissociative Processes in O{sub 2} Discharges. Development of an Atomic Oxygen Beam Source; Etude de la dissociation de O{sub 2} dans les decharges d'oxygene. Application a la realisation de sources d'atomes

    Energy Technology Data Exchange (ETDEWEB)

    Pagnon, Daniel

    1992-09-24

    The first part of this work is devoted to the study of dissociative processes in an oxygen glow discharge at low pressure (0,1-5 Torr, 1-80 mA). The kinetics of oxygen atoms has been determined supported by the measurements of atomic concentrations by VUV absorption spectroscopy and actinometry. The reaction coefficients for dissociative excitation and direct excitation of oxygen atoms have been calculated using the cross sections of the literature and a previously calculated EEDF. It has been demonstrated that dissociative excitation is negligible in respect with direct excitation for dissociation rates smaller than 2,5 %. An upper limit of 20 % for dissociative rates is observed. This limit has been explained by the increase of the atomic recombination at the discharge wall with increasing wall temperature. Using all these results, we have designed and optimized a source of oxygen atoms which has then been adapted on a MBE device. The spatial distribution of the atomic density has been measured in molecular jet by laser induced fluorescence (LIF) and Resonant Multi-Photon Ionization (RMPI). A stimulated emission has been evidenced and the coefficient for this process evaluated. A model for the effusion of atoms has been developed from which the flow of atoms on the sample can be predicted. This source has already been used in industrial MBE devices for in-situ oxidation of copper films, superconductors, and substrates for VLSI high speed applications. The methodology of this work and the diagnostics developed can be applied to other kinds of discharges, of other molecular gases, to design sources of atoms for the treatment of large area samples. (author) [French] Ce travail debute par l'etude de la dissociation dans une decharge luminescente d'oxygene a basse pression (0,1-5 torr, 1-80 ma). La cinetique des atomes d'oxygene a ete etablie a partir de la mesure des concentrations atomiques par spectroscopie d'absorption vuv et par actinometrie. Les coefficients de

  5. Neutron detection in an atomic reactor core using semi-conductors; Detection des neutrons par semi-conducteur dans un coeur de reacteur atomique

    Energy Technology Data Exchange (ETDEWEB)

    Divoux, F [Commissariat a l' Energie Atomique, Grenoble (France). Centre d' Etudes Nucleaires

    1968-07-01

    In this paper, the first part describes the principle of nuclear particle detection by means of semiconductor diodes and the general application of these. The second part describes fabrication of the device used to estimate thermic neutron fluxes in core of a swimming pool type reactor. The useful volume (2.9 mm thickness) is in the light water moderator, between combustible elements plates. The results, principally obtained in the core of Siloette reactor at the 'Centre d'Etudes Nucleaires de Grenoble' at low power, are mentioned in the third part. Flux maps have been set and comparison between converter's products: Bore 10, Lithium 6, Uranium 235 is made. (author) [French] Dans ce rapport, une premiere partie porte sur la description du principe de detection des particules nucleaires par diodes a semi-conducteur et sur l'application generale de celles-ci. Une deuxieme partie s'attache a decrire la fabrication du materiel utilise pour evaluer les flux de neutrons thermiques dans un coeur de reacteur type pile piscine. L'espace de mesure (2,9 mm d'epaisseur) se situe entre les plaques des elements combustibles, dans le moderateur eau legere. Les resultats, obtenus principalement dans le coeur du reacteur Siloette du Centre d'Etudes Nucleaires de Grenoble aux basses puissances de fonctionnement, sont rapportes dans la troisieme partie. Des cartes de flux ont ete dressees et une comparaison est faite entre les produits 'convertisseurs' suivants: Bore 10, Lithium 6, Uranium 235. (auteur)

  6. Human Decision Processes: Implications for SSA Support Tools

    Science.gov (United States)

    Picciano, P.

    2013-09-01

    Despite significant advances in computing power and artificial intelligence (AI), few critical decisions are made without a human decision maker in the loop. Space Situational Awareness (SSA) missions are both critical and complex, typically adhering to the human-in-the-loop (HITL) model. The collection of human operators injects a needed diversity of expert knowledge, experience, and authority required to successfully fulfill SSA tasking. A wealth of literature on human decision making exists citing myriad empirical studies and offering a varied set of prescriptive and descriptive models of judgment and decision making (Hastie & Dawes, 2001; Baron, 2000). Many findings have been proven sufficiently robust to allow information architects or system/interface designers to take action to improve decision processes. For the purpose of discussion, these concepts are bifurcated in two groups: 1) vulnerabilities to mitigate, and 2) capabilities to augment. These vulnerabilities and capabilities refer specifically to the decision process and should not be confused with a shortcoming or skill of a specific human operator. Thus the framing of questions and orders, the automated tools with which to collaborate, priming and contextual data, and the delivery of information all play a critical role in human judgment and choice. Evaluating the merits of any decision can be elusive; in order to constrain this discussion, ‘rational choice' will tend toward the economic model characteristics such as maximizing utility and selection consistency (e.g., if A preferred to B, and B preferred to C, than A should be preferred to C). Simple decision models often encourage one to list the pros and cons of a decision, perhaps use a weighting schema, but one way or another weigh the future benefit (or harm) of making a selection. The result (sought by the rationalist models) should drive toward higher utility. Despite notable differences in researchers' theses (to be discussed in the full

  7. MELiSSA Food Characterization general approach and current status

    Science.gov (United States)

    Weihreter, Martin; Chaerle, Laury; Secco, Benjamin; Molders, Katrien; van der Straeten, Dominique; Duliere, Eric; Pieters, Serge; Maclean, Heather; Dochain, Denis; Quinet, Muriel; Lutts, Stanley; Graham, Thomas; Stasiak, Michael; Rondeau Vuk, Theresa; Zheng, Youbin; Dixon, Mike; Laniau, Martine; Larreture, Alain; Timsit, Michel; Aronne, Giovanna; Barbieri, Giancarlo; Buonomo, Roberta; Veronica; Paradiso, Roberta; de Pascale, Stafania; Galbiati, Massimo; Troia, A. R.; Nobili, Matteo; Bucchieri, Lorenzo; Page, Valérie; Feller, Urs; Lasseur, Christophe

    Higher plants play an important role in closed ecological life support systems as oxygen pro-ducers, carbon dioxide and water recyclers, and as a food source. For an integration of higher plant chambers into the MELiSSA (Micro Ecological Life Support System Alternative) loop, a detailed characterization and optimization of the full food production and preparation chain is needed. This implies the prediction and control of the nutritional quality of the final products consumed by the crew, the prediction of the wastes quality and quantity produced along the chain for further waste treatment (MELiSSA waste treatment) and the optimization of overall efficiencies. To reach this goal several issues have to be studied in an integrated manner: the physiological responses of crops to a range of environmental parameters, crop yield efficiencies and respective ratio and composition of edible and inedible biomass, the processability and storability of the produced food and last but not least composition of wastes in view of further degradation (fiber content). Within the Food Characterization (FC) project several compar-ative plant growth bench tests were carried out to obtain preliminary data regarding these aspects. Four pre-selected cultivars of each of the four energy-rich crops with worldwide usage -wheat, durum wheat, potato and soybean -were grown under well-characterized environmental conditions. The different cultivars of each species are screened for their performance in view of a closed loop application by parameter ranking. This comprises the characterization of edi-ble/inedible biomass ratio, nutritional quality, processability and overall performance under the specific conditions of hydroponic cultivation and artificial illumination. A second closely linked goal of the FC project is to develop a mechanistic physiological plant model, which will ease the integration of higher plants compartments in the MELiSSA concept by virtue of its predictive abilities

  8. 77 FR 43639 - Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA...

    Science.gov (United States)

    2012-07-25

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2011-0090] Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA)/Department of Veterans Affairs (VA.... SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L. 100-503...

  9. 77 FR 54943 - Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA...

    Science.gov (United States)

    2012-09-06

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0016] Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA)/Department of Veterans Affairs (VA.... SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L. 100-503...

  10. The organic fraction of bubble-generated, accumulation mode Sea Spray Aerosol (SSA

    Directory of Open Access Journals (Sweden)

    R. L. Modini

    2010-03-01

    Full Text Available Recent studies have detected a dominant accumulation mode (~100 nm in the Sea Spray Aerosol (SSA number distribution. There is evidence to suggest that particles in this mode are composed primarily of organics. To investigate this hypothesis we conducted experiments on NaCl, artificial SSA and natural SSA particles with a Volatility-Hygroscopicity-Tandem-Differential-Mobility-Analyser (VH-TDMA. NaCl particles were atomiser generated and a bubble generator was constructed to produce artificial and natural SSA particles. Natural seawater samples for use in the bubble generator were collected from biologically active, terrestrially-affected coastal water in Moreton Bay, Australia. Differences in the VH-TDMA-measured volatility curves of artificial and natural SSA particles were used to investigate and quantify the organic fraction of natural SSA particles. Hygroscopic Growth Factor (HGF data, also obtained by the VH-TDMA, were used to confirm the conclusions drawn from the volatility data. Both datasets indicated that the organic fraction of our natural SSA particles evaporated in the VH-TDMA over the temperature range 170–200 °C. The organic volume fraction for 71–77 nm natural SSA particles was 8±6%. Organic volume fraction did not vary significantly with varying water residence time (40 s to 24 h in the bubble generator or SSA particle diameter in the range 38–173 nm. At room temperature we measured shape- and Kelvin-corrected HGF at 90% RH of 2.46±0.02 for NaCl, 2.35±0.02 for artifical SSA and 2.26±0.02 for natural SSA particles. Overall, these results suggest that the natural accumulation mode SSA particles produced in these experiments contained only a minor organic fraction, which had little effect on hygroscopic growth. Our measurement of 8±6% is an order of magnitude below two previous measurements of the organic fraction in SSA particles of comparable sizes. We stress that our results were obtained using coastal seawater and

  11. Preliminary study of the space adaptation of the MELiSSA life support system

    Science.gov (United States)

    Mas-Albaigès, Joan L.; Duatis, Jordi; Podhajsky, Sandra; Guirado, Víctor; Poughon, Laurent

    MELiSSA (Micro-Ecological Life Support System Alternative) is an European Space Agency (ESA) project focused on the development of a closed regenerative life support system to aid the development of technologies for future life support systems for long term manned planetary missions, e.g. a lunar base or missions to Mars. In order to understand the potential evolution of the MELiSSA concept towards its future use in the referred manned planetary mission context the MELiSSA Space Adaptation (MSA) activity has been undertaken. MSA's main objective is to model the different MELiSSA compartments using EcosimPro R , a specialized simulation tool for life support applications, in order to define a preliminary MELiSSA implementation for service in a man-tended lunar base scenario, with a four-member crew rotating in six-month increments, and performing the basic LSS functions of air revitalization, food production, and waste and water recycling. The MELiSSA EcosimPro R Model features a dedicated library for the different MELiSSA elements (bioreactors, greenhouse, crew, interconnecting elements, etc.). It is used to dimension the MELiSSA system in terms of major parameters like mass, volume and energy needs, evaluate the accuracy of the results and define the strategy for a progressive loop closure from the initial required performance (approx.100 The MELiSSA configuration(s) obtained through the EcosimPro R simulation are further analysed using the Advanced Life Support System Evaluation (ALISSE) metric, relying on mass, energy, efficiency, human risk, system reliability and crew time, for trade-off and optimization of results. The outcome of the MSA activity is, thus, a potential Life Support System architecture description, based on combined MELiSSA and other physico-chemical technologies, defining its expected performance, associated operational conditions and logistic needs.

  12. Lethal Effect on Bacterium of Decay of Incorporated Radioactive Atoms ({sup 3}H, {sup 14}C, {sup 32}P); Effet Letal de la Desintegration d'Atomes Radioactifs ({sup 3}H, {sup 14}C, {sup 32}P) Incorpores dans une Bacterie

    Energy Technology Data Exchange (ETDEWEB)

    Apelgot, Sonia [Laboratoire Curie, Institut du Radium, Paris (France)

    1968-06-15

    The biological effect of decay of {sup 3}H, {sup 14}C and {sup 32}P incorporated into a bacterium depends on the nature of the organic molecule labelled, on the position of the isotope within it and on the isotope itself. In sum, results obtained to date show that: The decay of {sup 3}H atoms incorporated into certain macromolecules of a bacterium causes sterilization through ionization by the ss{sup -} particle emitted; transmutation is of negligible importance. This self-irradiation is comparable in effect with X-rays and is affected in a similar manner by the same factors: temperature, presence of a radioprotector, radiosensitivity of the strain. Decay of {sup 14}C or {sup 32}P atoms incorporated into bacterial DNA is lethal because of the transmutation effect; ionizations produced by emitted ss{sup -} particles may be disregarded. Survival curves for {sup 32}P transmutations depend on the experimental conditions. Some of the results obtained with {sup 32}P are similar to those obtained with X-rays, e.g. effects of temperature, radical capture and oxygen, while others are similar to those of u.v. light, e.g., effect of growth conditions. Comparative tests made with {sup 32}P indicate that the recoil energy of transmutation is not the phenomenon responsible for the lethal effect observed. Comparison of the results obtained after X-irradiation or decay of {sup 3}H or {sup 32}P incorporated into the DNA of bacteria of the same strain of E. coli shows that the efficiency of a {sup 32}P transmutation is about four times greater than that of an ionization produced at random within the same DNA. (author) [French] L'effet biologique de la desintegration de {sup 3}H, {sup 14}C et {sup 32}P incorpores dans une bacterie depend de la nature de la molecule organique marquee, de l'emplacement de l'isotope sur celle-ci et de la nature de l'isotope lui-meme. L'ensemble des resultats obtenus a ce jour montre que la desintegration des atomes de {sup 3}H incorpores dans certaines

  13. VBA SSA Acc To Fed Rec Online (SAFRO) - Also known as Veterans Benefit Administration Query (VBAQ).

    Data.gov (United States)

    Social Security Administration — The purpose of this query is to provide SSA field office personnel with real-time access to military discharge data from the VA BIRLS database. This information is...

  14. Shock Hazard Prevention through Self-Healing Insulative Coating on SSA Metallic Bearings, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — The space suit assembly (SSA) contains metallic bearings at the wrist, neck, and waist, which are exposed to space environment, and pose a potential shock hazard....

  15. BOREAS TF-06 SSA-YA Surface Energy Flux and Meteorological Data

    Data.gov (United States)

    National Aeronautics and Space Administration — ABSTRACT: Contains meteorology data collected at the SSA-YA tower flux site by the TF6 group. These data were reported at 10 minute intervals. The flux and ancillary...

  16. BOREAS TF-02 SSA-OA Tethersonde Meteorological and Ozone Data

    Data.gov (United States)

    National Aeronautics and Space Administration — ABSTRACT: The BOREAS TF-02 team collected various trace gas and energy flux data along with meteorological parameters at the SSA-OA site. This data set contains...

  17. BOREAS TF-02 SSA-OA Tethersonde Meteorological and Ozone Data

    Data.gov (United States)

    National Aeronautics and Space Administration — The BOREAS TF-02 team collected various trace gas and energy flux data along with meteorological parameters at the SSA-OA site. This data set contains meteorological...

  18. A New Trend-Following Indicator: Using SSA to Design Trading Rules

    Science.gov (United States)

    Leles, Michel Carlo Rodrigues; Mozelli, Leonardo Amaral; Guimarães, Homero Nogueira

    Singular Spectrum Analysis (SSA) is a non-parametric approach that can be used to decompose a time-series as trends, oscillations and noise. Trend-following strategies rely on the principle that financial markets move in trends for an extended period of time. Moving Averages (MAs) are the standard indicator to design such strategies. In this study, SSA is used as an alternative method to enhance trend resolution in comparison with the traditional MA. New trading rules using SSA as indicator are proposed. This paper shows that for the Down Jones Industrial Average (DJIA) and Shangai Securities Composite Index (SSCI) time-series the SSA trading rules provided, in general, better results in comparison to MA trading rules.

  19. Possible role of anti-SSA/Ro antibodies in the pathogenesis of pulmonary hypertension

    Directory of Open Access Journals (Sweden)

    Kelsey Guerreso

    2016-01-01

    Conclusion: It is known that pulmonary hypertension has association with autoimmune diseases, however no clear markers yet exist. Anti-SSA/Ro antibodies have been rarely described in cases of pulmonary disease, and less so in pulmonary hypertension. This case describes a unique association between isolated pulmonary hypertension and anti-SSA/Ro antibody, thereby illustrating the need to investigate this autoantibody and others in the pathogenesis of autoimmune pulmonary hypertension.

  20. Hydraulic and mechanical behavior of landfill clay liner containing SSA in contact with leachate.

    Science.gov (United States)

    Zhang, Qian; Lu, Haijun; Liu, Junzhu; Wang, Weiwei; Zhang, Xiong

    2018-05-01

    Sewage sludge ash (SSA) produced by municipal sludge can be used as a modified additive for clay liner, and improves the working performance of landfill clay liner in contact with leachate. Under the action of landfill leachate, the permeability, shear strength, phase composition, and pore structure of the modified clay are investigated through the flexible wall permeability test, triaxial shear test, thermal gravimetric and differential thermal analysis, and low-temperature nitrogen adsorption test, respectively. The hydraulic conductivity of the modified clay containing 0-5% SSA is in the range of 3.94 × 10 -8 -1.16 × 10 -7  cm/s, and the pollutant concentration of the sample without SSA was higher than others. The shear strength of the modified clay is more than that of the traditional clay liner, the cohesion rate of modified clay increases from 32.5 to 199.91 kPa, and the internal friction angle decreases from 32.5° to 15.6°. Furthermore, the weight loss rates of the samples are 15.69%, 17.92%, 18.06%, and 20.68%, respectively, when the SSA content increases from 0% to 5%. The total pore volume and average pore diameter of the modified clay decrease with the increase in the SSA content, respectively. However, the specific area of the modified clay increases with the increase in the SSA content.

  1. GillespieSSA: Implementing the Gillespie Stochastic Simulation Algorithm in R

    Directory of Open Access Journals (Sweden)

    Mario Pineda-Krch

    2008-02-01

    Full Text Available The deterministic dynamics of populations in continuous time are traditionally described using coupled, first-order ordinary differential equations. While this approach is accurate for large systems, it is often inadequate for small systems where key species may be present in small numbers or where key reactions occur at a low rate. The Gillespie stochastic simulation algorithm (SSA is a procedure for generating time-evolution trajectories of finite populations in continuous time and has become the standard algorithm for these types of stochastic models. This article presents a simple-to-use and flexible framework for implementing the SSA using the high-level statistical computing language R and the package GillespieSSA. Using three ecological models as examples (logistic growth, Rosenzweig-MacArthur predator-prey model, and Kermack-McKendrick SIRS metapopulation model, this paper shows how a deterministic model can be formulated as a finite-population stochastic model within the framework of SSA theory and how it can be implemented in R. Simulations of the stochastic models are performed using four different SSA Monte Carlo methods: one exact method (Gillespie's direct method; and three approximate methods (explicit, binomial, and optimized tau-leap methods. Comparison of simulation results confirms that while the time-evolution trajectories obtained from the different SSA methods are indistinguishable, the approximate methods are up to four orders of magnitude faster than the exact methods.

  2. Automatic Satellite Telemetry Analysis for SSA using Artificial Intelligence Techniques

    Science.gov (United States)

    Stottler, R.; Mao, J.

    In April 2016, General Hyten, commander of Air Force Space Command, announced the Space Enterprise Vision (SEV) (http://www.af.mil/News/Article-Display/Article/719941/hyten-announces-space-enterprise-vision/). The SEV addresses increasing threats to space-related systems. The vision includes an integrated approach across all mission areas (communications, positioning, navigation and timing, missile warning, and weather data) and emphasizes improved access to data across the entire enterprise and the ability to protect space-related assets and capabilities. "The future space enterprise will maintain our nation's ability to deliver critical space effects throughout all phases of conflict," Hyten said. Satellite telemetry is going to become available to a new audience. While that telemetry information should be valuable for achieving Space Situational Awareness (SSA), these new satellite telemetry data consumers will not know how to utilize it. We were tasked with applying AI techniques to build an infrastructure to process satellite telemetry into higher abstraction level symbolic space situational awareness and to initially populate that infrastructure with useful data analysis methods. We are working with two organizations, Montana State University (MSU) and the Air Force Academy, both of whom control satellites and therefore currently analyze satellite telemetry to assess the health and circumstances of their satellites. The design which has resulted from our knowledge elicitation and cognitive task analysis is a hybrid approach which combines symbolic processing techniques of Case-Based Reasoning (CBR) and Behavior Transition Networks (BTNs) with current Machine Learning approaches. BTNs are used to represent the process and associated formulas to check telemetry values against anticipated problems and issues. CBR is used to represent and retrieve BTNs that represent an investigative process that should be applied to the telemetry in certain circumstances

  3. Phase separation in Al-Zr-Sc alloys: from atomic jumps to ordered precipitates growth; Separation de phase dans les alliages Al-Zr-Sc: du saut des atomes a la croissance de precipites ordonnes

    Energy Technology Data Exchange (ETDEWEB)

    Clouet, E

    2004-07-01

    Zirconium and scandium addition to aluminium alloys leads to the formation of ordered precipitates. This study aims to a better understanding of precipitation kinetics thanks to an approach combining atomic and mesoscopic models. An experimental work has been undertaken too so as to characterize by transmission electron microscopy Al{sub 3}Zr kinetics of precipitation. We mainly focus on the nucleation stage and, in this purpose, an atomic model lying on a rigid lattice has been built for Al-Zr-Sc system allowing us to study precipitation with kinetic Monte Carlo simulations. While keeping the vacancy exchange mechanism for diffusion, we introduce multi-site interactions going thus beyond a simple pair interaction model, and test the influence of these interactions on kinetics of precipitation. The comparison between Monte Carlo simulations and classical nucleation theory shows that mesoscopic models can lead to a good description of the nucleation stage of Al{sub 3}Zr and Al{sub 3}Sc as long as the order tendency of the system has been taken into account to calculate input parameters of these models. For the ternary Al-Zr-Sc system, atomic simulations allow a better understanding of the precipitation kinetic path. It is then possible to extend the field of classical nucleation theory so as to model nucleation in a ternary alloy where the stoichiometry of the precipitates is unknown. (author)

  4. Model-Atmosphere Spectra of Central Stars of Planetary Nebulae - Access via the Virtual Observatory Service TheoSSA

    Science.gov (United States)

    Rauch, T.; Reindl, N.

    2014-04-01

    In the framework of the Virtual Observatory (VO), the German Astrophysical Virtual Observatory GAVO project provides easy access to theoretical spectral energy distributions (SEDs) within the registered GAVO service TheoSSA (http://dc.g-vo.org/theossa). TheoSSA is based on the well established Tübingen NLTE Model-Atmosphere Package (TMAP) for hot, compact stars. This includes central stars of planetary nebulae. We show examples of TheoSSA in operation.

  5. Synthesis and crystal structures of a novel layered silicate SSA-1 and its microporous derivatives by topotactic transformation.

    Science.gov (United States)

    Takahashi, S; Kurita, Y; Ikeda, T; Miyamoto, M; Uemiya, S; Oumi, Y

    2016-10-18

    The synthesis of a novel layered silicate SSA-1 (SSA: silicate synthesized with a quaternary amine) was achieved in the SiO 2 -H 2 O-TEAOH (TEAOH: tetraethylammonium hydroxide - as an organic structural directing agent) system. The crystal structure of SSA-1 involved two silicate layers composed of bre [10T]-type CBU (Composite Building Unit) and TEAOH in interlayers. The topotactic transformation of SSA-1 by calcination was examined, resulting in a porous material (PML-1: porous material transformed from a layered silicate) with a 108 m 2 g -1 BET surface area and 0.035 cm 3 g -1 pore volume. PML-1 is a siliceous microporous material with silanols in the framework and possesses unique properties, such as hydrophilicity, in spite of all its silica composition. The most reasonable crystal structure of PML-1 was successfully determined on the basis of the crystal structure of SSA-1 by a combination of manual modelling, PXRD pattern simulation, DFT optimization and Rietveld analysis. Additionally, an interlayer expanded siliceous zeolite SSA-1 (IEZ-SSA-1) was also successfully prepared by silylation using trichloro(methyl)silane under acidic conditions. IEZ-SSA-1 showed hydrophilicity or hydrophobicity properties by changing the functional group of the pillar part in the interlayer. Additionally, IEZ-SSA-1 showed a large gas adsorption property (537 m 2 g -1 and 0.21 cm 3 g -1 ).

  6. Penyerapan Logam Zinkum (Zn) dalam Air Limbah Pabrik Benang Karet Menggunakan Batubara yang Diaktifasi dan Analisisnya dengan Metode Spektrofotometri Serapan Atom

    OpenAIRE

    Susilawati

    2015-01-01

    In the industrial production ofrubber thread, zinkum use das filler material to improve the highelasticityof rubber thread before the clotting process.A study of metal absorption zinkum (Zn) using actived coal in the waste water plant the rubber thread manufactory and analysis by atomic absorption spectrophotometry method. Adsorbent were taken from lumps of coal. Do adsorption process of the variation of the activation solution using HCl with a concentration of 0.3 N, 0.5 N and 0.7 N. While t...

  7. MELiSSA celebrates 25 years of research into life support

    International Nuclear Information System (INIS)

    2015-01-01

    MELiSSA (Micro-Ecological Life Support System Alternative) is a collaborative project with the European Space Agency ESA and various other scientific partners. The objective of MELiSSA is to develop a system that is able to provide manned space missions with food, drinking water and oxygen autonomously in space. Drinkable water and oxygen are currently being made in the international space station ISS by filtering waste water and by electrolysing water. However, such physiochemical technologies do not offer a solution for food. The MELiSSA project intends to reuse waste products, which include CO2, water, stools and urine from the astronauts, and even the perspiration moisture in the cabin and to transfer these into food through the use of micro-organisms.

  8. Point defects and irradiation in oxides: simulations at the atomic scale; Defauts ponctuels et irradiation dans les oxydes: simulation a l'echelle atomique

    Energy Technology Data Exchange (ETDEWEB)

    Crocombette, J.P

    2005-12-15

    The studies done by Jean-Paul Crocombette between 1996 and 2005 in the Service de Recherches de Metallurgie Physique of the Direction de l'Energie Nucleaire in Saclay are presented in this Habilitation thesis. These works were part of the material science researches on the ageing, especially under irradiation, of oxides of interest for the nuclear industry. In this context simulation studies at the atomic scale were performed on two elementary components of ageing under irradiation : point defects and displacement cascades ; using two complementary simulation techniques : ab initio electronic structure calculations and empirical potential molecular dynamics. The first part deals with point defects : self defects (vacancies or interstitials) or hetero-atomic dopants. One first recalls the energetics of such defects in oxides, the specific features of defects calculations and the expected accuracy of these calculations. Then one presents the results obtained on uranium dioxide, oxygen in silver and amorphous silica. The second part tackles the modelling of disintegration recoil nuclei in various?displacement cascades created by crystalline matrices for actinide waste disposal. Cascade calculations give access to the amorphization mechanisms under irradiation of these materials. One thus predicts that the amorphization in zircon takes place directly in the tracks whereas in lanthanum zirconate, the amorphization proceeds through the accumulation of point defects. Finally the prospects of these studies are discussed. (author)

  9. Do the Asian Drivers undermine the export-oriented industrialisation in SSA?

    OpenAIRE

    Kaplinsky, Raphael; Morris, Mike

    2008-01-01

    An increase in outward orientation in general, and in export-oriented manufacturing in particular is widely indicated as a suitable developmental path for SSA. The logic for this is drawn both from the demonstration effect of China and the earlier generation of Asian NICs, and from theory. However, the entry of China (and to a lesser extent India) into the global economy as a significant exporter of manufactures poses severe problems for export-oriented growth in SSA. This can be seen from SS...

  10. Spectral Analysis within the Virtual Observatory: The GAVO Service TheoSSA

    Science.gov (United States)

    Ringat, E.

    2012-03-01

    In the last decade, numerous Virtual Observatory organizations were established. One of these is the German Astrophysical Virtual Observatory (GAVO) that e.g. provides access to spectral energy distributions via the service TheoSSA. In a pilot phase, these are based on the Tübingen NLTE Model-Atmosphere Package (TMAP) and suitable for hot, compact stars. We demonstrate the power of TheoSSA in an application to the sdOB primary of AA Doradus by comparison with a “classical” spectral analysis.

  11. Ultracold lithium-6 atoms in the BEC-BCS crossover: experiments and the construction of a new apparatus; Atomes de lithium-6 ultra froids dans la transition BEC-BCS: experiences et construction d'un montage experimental

    Energy Technology Data Exchange (ETDEWEB)

    Teichmann, M

    2007-09-15

    We use a fermionic gas of Lithium-6 as a model system to study superfluidity. The limiting cases of superfluidity are Bose-Einstein condensation (BEC) and superconductivity, described by the theory by Bardeen, Cooper and Schrieffer (BCS). In Lithium-6 gases, we can explore the whole range between the two cases, known as the BEC-BCS crossover, using a Feshbach resonance. We study the change of the momentum distribution of the gas in this cross-over and compare to theoretical models. We also investigate the hydrodynamic expansion, characteristic for a superfluid gas. We observe a sudden change of the ellipticity of the gas close to the transition to the superfluid phase. Moreover, we localized heteronuclear Feshbach resonances between {sup 6}Li and {sup 7}Li. We are currently constructing a second generation of the experimental setup. An new laser system, based on high power laser diodes, was developed. Changes in the vacuum chamber, including a complete reconstruction of the Zeeman slower, have increased the atomic flux, allowing us to increase the repetition rate of our experiment. Modifications of the geometry of the magnetic traps lead to a higher number of trapped atoms. (author)

  12. Ultracold lithium-6 atoms in the BEC-BCS crossover: experiments and the construction of a new apparatus; Atomes de lithium-6 ultra froids dans la transition BEC-BCS: experiences et construction d'un montage experimental

    Energy Technology Data Exchange (ETDEWEB)

    Teichmann, M

    2007-09-15

    We use a fermionic gas of Lithium-6 as a model system to study superfluidity. The limiting cases of superfluidity are Bose-Einstein condensation (BEC) and superconductivity, described by the theory by Bardeen, Cooper and Schrieffer (BCS). In Lithium-6 gases, we can explore the whole range between the two cases, known as the BEC-BCS crossover, using a Feshbach resonance. We study the change of the momentum distribution of the gas in this cross-over and compare to theoretical models. We also investigate the hydrodynamic expansion, characteristic for a superfluid gas. We observe a sudden change of the ellipticity of the gas close to the transition to the superfluid phase. Moreover, we localized heteronuclear Feshbach resonances between {sup 6}Li and {sup 7}Li. We are currently constructing a second generation of the experimental setup. An new laser system, based on high power laser diodes, was developed. Changes in the vacuum chamber, including a complete reconstruction of the Zeeman slower, have increased the atomic flux, allowing us to increase the repetition rate of our experiment. Modifications of the geometry of the magnetic traps lead to a higher number of trapped atoms. (author)

  13. 75 FR 62623 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Internal Revenue Service (IRS...

    Science.gov (United States)

    2010-10-12

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0015] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Internal Revenue Service (IRS))--Match Number 1016 AGENCY: Social Security... regarding protections for such persons. The Privacy Act, as amended, regulates the use of computer matching...

  14. 77 FR 33547 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Centers for Medicare and Medicaid...

    Science.gov (United States)

    2012-06-06

    ...: Social Security Administration (SSA). ACTION: Notice of a new computer matching program that will expire... protections for such persons. The Privacy Act, as amended, regulates the use of computer matching by Federal... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0015] Privacy Act of 1974, as Amended...

  15. 77 FR 24757 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of Labor (DOL))-Match...

    Science.gov (United States)

    2012-04-25

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2011-0083] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Department of Labor (DOL))--Match Number 1015 AGENCY: Social Security... regarding protections for such persons. The Privacy Act, as amended, regulates the use of computer matching...

  16. 77 FR 27108 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Office of Child Support...

    Science.gov (United States)

    2012-05-08

    ...: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching... protections for such persons. The Privacy Act, as amended, regulates the use of computer matching by Federal... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0010] Privacy Act of 1974, as Amended...

  17. 20 CFR 411.597 - Will SSA periodically review the outcome payment system and the outcome-milestone payment system...

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Will SSA periodically review the outcome payment system and the outcome-milestone payment system for possible modifications? 411.597 Section 411... Employment Network Payment Systems § 411.597 Will SSA periodically review the outcome payment system and the...

  18. The relationship of the lipoprotein SsaB, manganese and superoxide dismutase in Streptococcus sanguinis virulence for endocarditis.

    Science.gov (United States)

    Crump, Katie E; Bainbridge, Brian; Brusko, Sarah; Turner, Lauren S; Ge, Xiuchun; Stone, Victoria; Xu, Ping; Kitten, Todd

    2014-06-01

    Streptococcus sanguinis colonizes teeth and is an important cause of infective endocarditis. Our prior work showed that the lipoprotein SsaB is critical for S. sanguinis virulence for endocarditis and belongs to the LraI family of conserved metal transporters. In this study, we demonstrated that an ssaB mutant accumulates less manganese and iron than its parent. A mutant lacking the manganese-dependent superoxide dismutase, SodA, was significantly less virulent than wild-type in a rabbit model of endocarditis, but significantly more virulent than the ssaB mutant. Neither the ssaB nor the sodA mutation affected sensitivity to phagocytic killing or efficiency of heart valve colonization. Animal virulence results for all strains could be reproduced by growing bacteria in serum under physiological levels of O(2). SodA activity was reduced, but not eliminated in the ssaB mutant in serum and in rabbits. Growth of the ssaB mutant in serum was restored upon addition of Mn(2+) or removal of O(2). Antioxidant supplementation experiments suggested that superoxide and hydroxyl radicals were together responsible for the ssaB mutant's growth defect. We conclude that manganese accumulation mediated by the SsaB transport system imparts virulence by enabling cell growth in oxygen through SodA-dependent and independent mechanisms. © 2014 John Wiley & Sons Ltd.

  19. 76 FR 55690 - Submission for OMB Review; Comment Request; The SSA-NIH Collaboration To Improve the Disability...

    Science.gov (United States)

    2011-09-08

    ...; Comment Request; The SSA-NIH Collaboration To Improve the Disability Determination Process: Validation of... Collection: Title: The SSA-NIH Collaboration to Improve the Disability Determination Process: Validation of IRT-CAT tools. Type of Information Collection Request: NEW. Need and Use of Information Collection...

  20. 76 FR 77238 - Submission for OMB Review; Comment Request; The SSA-NIH Collaboration to Improve the Disability...

    Science.gov (United States)

    2011-12-12

    ... Collaboration to Improve the Disability Determination Process: Validation of IRT-CAT tools. Type of Information...; Comment Request; The SSA-NIH Collaboration to Improve the Disability Determination Process: Validation of... being developed to assist in the SSA disability determination process. The utilization of CAT technology...

  1. 76 FR 12398 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Bureau of the Public Debt (BPD...

    Science.gov (United States)

    2011-03-07

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0034] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Bureau of the Public Debt (BPD))--Match Number 1304 AGENCY: Social Security... as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection...

  2. 75 FR 9012 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/U.S. Department of Health and...

    Science.gov (United States)

    2010-02-26

    ... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L. 100-503), amended... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA-2009-0052] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ U.S. Department of Health and Human Services (HHS), Administration for...

  3. 77 FR 32709 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of Homeland Security...

    Science.gov (United States)

    2012-06-01

    ...; Computer Matching Program (SSA/ Department of Homeland Security (DHS))--Match Number 1010 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching program that... amended by the Computer Matching and Privacy Protection Act of 1988, as amended, and the regulations and...

  4. 78 FR 12128 - Privacy Act of 1974; Computer Matching Program (SSA/Department of the Treasury, Internal Revenue...

    Science.gov (United States)

    2013-02-21

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0067] Privacy Act of 1974; Computer Matching... Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching program... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503...

  5. 78 FR 12127 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of the Treasury...

    Science.gov (United States)

    2013-02-21

    ... 1310 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer..., as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2013-0007] Privacy Act of 1974, as Amended...

  6. 75 FR 51154 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of the Treasury...

    Science.gov (United States)

    2010-08-18

    ... 1310 AGENCY: Social Security Administration (SSA) ACTION: Notice of a renewal of an existing computer..., as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0035] Privacy Act of 1974, as Amended...

  7. 77 FR 6620 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/the States); Match 6000 and 6003

    Science.gov (United States)

    2012-02-08

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2011-0102] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ the States); Match 6000 and 6003 AGENCY: Social Security Administration..., as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection...

  8. 77 FR 49849 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Office of Child Support...

    Science.gov (United States)

    2012-08-17

    ...: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer-matching... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0021] Privacy Act of 1974, as Amended...

  9. 78 FR 51264 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of the Treasury...

    Science.gov (United States)

    2013-08-20

    ... 1016 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer... above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2013-0022] Privacy Act of 1974, as Amended...

  10. 75 FR 68396 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of Labor (DOL))-Match...

    Science.gov (United States)

    2010-11-05

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0052] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Department of Labor (DOL))--Match Number 1003 AGENCY: Social Security... as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection...

  11. 78 FR 69926 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Centers for Medicare & Medicaid...

    Science.gov (United States)

    2013-11-21

    ...: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L 100-503), amended the... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2013-0059] Privacy Act of 1974, as Amended...

  12. 75 FR 18251 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Internal Revenue Service (IRS...

    Science.gov (United States)

    2010-04-09

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA-2009-0066] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Internal Revenue Service (IRS))--Match 1305 AGENCY: Social Security... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503...

  13. 75 FR 7648 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of Veterans Affairs...

    Science.gov (United States)

    2010-02-22

    ... Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503), amended the Privacy... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0006] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Department of Veterans Affairs/Veterans Benefits Administration (VA/ VBA...

  14. 78 FR 16564 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Office of Personnel Management...

    Science.gov (United States)

    2013-03-15

    ... 1021 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of existing computer... above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0073] Privacy Act of 1974, as Amended...

  15. 75 FR 32833 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Office of Personnel Management...

    Science.gov (United States)

    2010-06-09

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA-2009-0077] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Office of Personnel Management (OPM))--Match 1307 AGENCY: Social Security... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503...

  16. 75 FR 59780 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Railroad Retirement Board (RRB...

    Science.gov (United States)

    2010-09-28

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0040] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Railroad Retirement Board (RRB))--Match Number 1006 AGENCY: Social Security...: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L.) 100-503), amended the...

  17. 77 FR 24756 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of Labor (DOL))-Match...

    Science.gov (United States)

    2012-04-25

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2011-0084] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Department of Labor (DOL))--Match Number 1003 AGENCY: Social Security... above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988...

  18. 20 CFR 403.100 - When can an SSA employee testify or produce information or records in legal proceedings?

    Science.gov (United States)

    2010-04-01

    ... information or records in legal proceedings? 403.100 Section 403.100 Employees' Benefits SOCIAL SECURITY ADMINISTRATION TESTIMONY BY EMPLOYEES AND THE PRODUCTION OF RECORDS AND INFORMATION IN LEGAL PROCEEDINGS § 403.100 When can an SSA employee testify or produce information or records in legal proceedings? An SSA...

  19. 77 FR 74913 - Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA...

    Science.gov (United States)

    2012-12-18

    ...; Computer Matching Program (Social Security Administration (SSA)/Office of Personnel Management (OPM.... SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub... computer matching involving the Federal government could be performed and adding certain protections for...

  20. Exchange of charges between fast ions and neutral atoms; Change de charges entre ions rapides et atomes neutres

    Energy Technology Data Exchange (ETDEWEB)

    Geller, R [Commissariat a l' Energie Atomique, Saclay(France). Centre d' Etudes Nucleaires

    1955-07-01

    In this paper, we summarize the most significant theoretical and experimental results obtained so far on the exchange of charges between fast ions and neutral atoms. (author) [French] Dans l'expose qui suit, nous resumons les resultats theoriques et experimentaux interessants obtenus jusqu'a nos jours dans le domaine de l'echange de charges entre ions rapides et atomes neutres. (auteur)

  1. Adsorpsi Pb2+ dan Zn2+ pada Biomassa Imperata cylindrica

    Directory of Open Access Journals (Sweden)

    Noer Komari

    2017-03-01

    Full Text Available Metode alternatif untuk mengatasi pencemaran logam berat adalah biosorpsi menggunakan biomassa sebagai adsorben. Telah dilakukan penelitian kajian adsorpsi campuran Pb2+ dan Zn2+ pada biomassa Imperata cylindrica sebagai adsorben. Tujuan penelitian adalah mengetahui kemampuan biomassa mengadsorpsi Pb2+ dan Zn2+. Preparasi biomassa dilakukan dengan aktivasi menggunakan asam nitrat dan amonium hidroksida. Adsorpsi dilakukan dengan sistem batch. Parameter yang diukur adalah pH optimum, waktu kontak optimum, kapasitas adsorpsi dan recovery ion logam. Analisis kadar logam dilakukan dengan menggunakan Spektrofotometer Serapan Atom (AAS. Hasil penelitian menunjukkan pH optimum adsorpsi Pb2+ dan Zn2+ masing-masing pada pH 5 dan pH 6. Waktu kontak optimum adsorpsi Pb2+ dan Zn2+ masing masing pada 40 menit dan 30 pertama. Kapasitas adsorpsi Pb2+ dan Zn2+ pada konsentrasi awal 10 ppm masing-masing adalah 90,95% dan 43,60%. Recovery Pb2+ dan Zn2+ masing-masing 84,45% dan 57,13%.

  2. Understanding Large-scale Structure in the SSA22 Protocluster Region Using Cosmological Simulations

    Science.gov (United States)

    Topping, Michael W.; Shapley, Alice E.; Steidel, Charles C.; Naoz, Smadar; Primack, Joel R.

    2018-01-01

    We investigate the nature and evolution of large-scale structure within the SSA22 protocluster region at z = 3.09 using cosmological simulations. A redshift histogram constructed from current spectroscopic observations of the SSA22 protocluster reveals two separate peaks at z = 3.065 (blue) and z = 3.095 (red). Based on these data, we report updated overdensity and mass calculations for the SSA22 protocluster. We find {δ }b,{gal}=4.8+/- 1.8 and {δ }r,{gal}=9.5+/- 2.0 for the blue and red peaks, respectively, and {δ }t,{gal}=7.6+/- 1.4 for the entire region. These overdensities correspond to masses of {M}b=(0.76+/- 0.17)× {10}15{h}-1 {M}ȯ , {M}r=(2.15+/- 0.32)× {10}15{h}-1 {M}ȯ , and {M}t=(3.19+/- 0.40)× {10}15{h}-1 {M}ȯ for the red, blue, and total peaks, respectively. We use the Small MultiDark Planck (SMDPL) simulation to identify comparably massive z∼ 3 protoclusters, and uncover the underlying structure and ultimate fate of the SSA22 protocluster. For this analysis, we construct mock redshift histograms for each simulated z∼ 3 protocluster, quantitatively comparing them with the observed SSA22 data. We find that the observed double-peaked structure in the SSA22 redshift histogram corresponds not to a single coalescing cluster, but rather the proximity of a ∼ {10}15{h}-1 {M}ȯ protocluster and at least one > {10}14{h}-1 {M}ȯ cluster progenitor. Such associations in the SMDPL simulation are easily understood within the framework of hierarchical clustering of dark matter halos. We finally find that the opportunity to observe such a phenomenon is incredibly rare, with an occurrence rate of 7.4{h}3 {{{Gpc}}}-3. Based on data obtained at the W.M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California, and the National Aeronautics and Space Administration, and was made possible by the generous financial support of the W.M. Keck Foundation.

  3. Remote Ultra-low Light Imaging (RULLI) For Space Situational Awareness (SSA): Modeling And Simulation Results For Passive And Active SSA

    International Nuclear Information System (INIS)

    Thompson, David C.; Shirey, Robert L.; Roggemann, Michael C; Gudimetla, Rao

    2008-01-01

    Remote Ultra-Low Light Imaging detectors are photon limited detectors developed at Los Alamos National Laboratories. RULLI detectors provide a very high degree of temporal resolution for the arrival times of detected photoevents, but saturate at a photo-detection rate of about 10 6 photo-events per second. Rather than recording a conventional image, such as output by a charged coupled device (CCD) camera, the RULLI detector outputs a data stream consisting of the two-dimensional location, and time of arrival of each detected photo-electron. Hence, there is no need to select a specific exposure time to accumulate photo-events prior to the data collection with a RULLI detector this quantity can be optimized in post processing. RULLI detectors have lower peak quantum efficiency (from as low as 5% to perhaps as much as 40% with modern photocathode technology) than back-illuminated CCD's (80% or higher). As a result of these factors, and the associated analyses of signal and noise, we have found that RULLI detectors can play two key new roles in SSA: passive imaging of exceedingly dim objects, and three-dimensional imaging of objects illuminated with an appropriate pulsed laser. In this paper we describe the RULLI detection model, compare it to a conventional CCD detection model, and present analytic and simulation results to show the limits of performance of RULLI detectors used for SSA applications at AMOS field site

  4. Action of Mercaptan and Disulfide in Hydrogen Atom Exchange Reactions; Action des Thioalcools et des Disulfures dans les Reactions d'Echange d'Atomes d'Hydrogene; Vozdejstvie merkaptanov i disul'fidov v reaktsiyakh obmena atoma vodoroda; Accion de los Mercaptanos y Disulfuros en las Reacciones de Intercambio del Hidrogeno Atomico

    Energy Technology Data Exchange (ETDEWEB)

    Cohen, S. G. [Brandeis University Waltham, MA (United States)

    1965-10-15

    transfer reactions. The photoreduction of benzophenone in an ether is also inhibited by the sulfur compounds, by hydrogen atom transfer reactions. A mechanism exists in this system (unlike the ketone-alcohol systems) by which the sulfur compounds may be consumed irreversibly. This leads to an induction period, instead of to permanent retardation, about 15 quanta being negated by each molecule of sulfur compound. (author) [French] Des reactions induites par des radicaux libres, par photochimie et par des rayonnements de haute energie, peuvent etre catalysees ou inhibees par des reactions rapides d'echange d'atomes d'hydrogene des thioalcools et des disulfures. Les decarbonylations d'aldehydes, induites par des radicaux libres, amorcees par la lumiere et sensibilisees par la benzophenone,sont catalysees par les thioalcools. La reaction en chaftie de transfert d'atomes d'hydrogene, R' + RCH = O -> RH + RC = O est acceleree par une suite analogue de transferts d'atomes d'hydrogene mettant en jeu le compose soufre: R' + C{sub 6}H{sub 5}CH{sub 2}SH -> RH + C{sub 6}H{sub 5}CH{sub 2}S'; C{sub 6}H{sub 5}CH{sub 2}S + RCH = 0 -> C{sub 6}H{sub 5}CH{sub 2}SH + RC = 0. La photoreduction de la benzophenone en propanol-2 aboutit a un benzopinacol par une reaction qui n'est pas en chaine et se fait par l'intermediaire des radicaux (C{sub 6}H{sub 5}){sub 2}C-OH and (CH{sub 3}){sub 2}COH. . La reaction est retardee et inhibee par les thioalcools et les disulfures qui retransforment les radicaux en produits de depart par reactions rapides de transfert d'atomes d'hydrogene et retrouvent eux-memes leurs etats de valence primitifs, chaque molecule du compose soufre annulant les effets chimiques de nombreux quanta: (C{sub 6}H{sub 5}){sub 2}C-OH + AS' -> (C{sub 6}H{sub 5}){sub 2}C = O + ASH; (CH{sub 3}){sub 2}C-OH + ASH -> (CH{sub 3}){sub 2}C = 0 + AS'. On trouve la preuve de ce mecanisme dans l'equilibrage du thioalcool ou disulfure initialement present, dans la racemisation de l

  5. Vector Topographic Map Data over the BOREAS NSA and SSA in SIF Format

    Science.gov (United States)

    Knapp, David; Nickeson, Jaime; Hall, Forrest G. (Editor)

    2000-01-01

    This data set contains vector contours and other features of individual topographic map sheets from the National Topographic Series (NTS). The map sheet files were received in Standard Interchange Format (SIF) and cover the BOReal Ecosystem-Atmosphere Study (BOREAS) Northern Study Area (NSA) and Southern Study Area (SSA) at scales of 1:50,000 and 1:250,000. The individual files are stored in compressed Unix tar archives.

  6. Surviving space flight: case study on MELiSSA's CIII nitrifying compartment

    Science.gov (United States)

    Ilgrande, Chiara; Lasseur, Christophe; Mastroleo, Felice; Paille, Christel; Leys, Natalie; Morozova, Julia; Ilyin, Vyacheslav; Clauwaert, Peter; Christiaens, Marlies E. R.; Lindeboom, Ralph E. F.; Vlaeminck, Siegfried; Prat, Delphine; Arroyo, Jose M. C.; Conincx, Ilse; Van Hoey, Olivier; Roume, Hugo; Udert, Kai; Sas, Benedikt

    2016-07-01

    Space synthetic biology offers key opportunities for long-term space missions. Planets mining, terraformation, space medicine and Life Support technologies would all benefit from an integrative biological approach. However, space is a harsh environment for life: microgravity, temperature, UV and cosmic radiation can affect the health and functionality of microorganisms and plants, possibly preventing the optimal performance of the systems. The European Space Agency's Life Support System (MELiSSA) has been developed as a model for future long term Space missions and Space habitation. MELiSSA is a 5 compartment artificial ecosystem with microorganisms and higher, that aims at completely recycling gas, liquid and solid waste. In this study, the survival and functional activity after Lower Earth Orbit conditions of microbial nitrogen conversions, relevant for MELiSSA's CIII compartment, was tested. Synthetic communities containing Nitrosomonas europeae, Nitrosomonas ureae, Nitrobacter winogradskyi, Nitrospira moscoviensis and Cupriavidus pinatubonensis were exposed to the Lower Earth Orbit conditions of the International Space Station (ISS) for 7 days. Nitrosomonas europeae, Nitrobacter winogradskyi, Cupriavidus pinatubonensis, and three mixed communities (a urine nitrification sludge, a sludge containing aerobic ammonia oxidizing bacteria and anammox bacteria (OLAND), and an aquaculture sludge containing ammonia oxidizing archaea) were exposed to Lower Earth Orbit conditions for 44 days. Survival after both space flights was demonstrated because nitritation, nitratation, denitrification and anammox activity could be restored at a rate comparable to ground storage conditions. Our results validate the potential survival feasibility and suggest future space applications for N-related microorganisms.

  7. Sewage sludge ash (SSA in high performance concrete: characterization and application

    Directory of Open Access Journals (Sweden)

    C. M. A. Fontes

    Full Text Available ABSTRACT Sewage sludge originated from the process of treatment of wastewater has become an environmental issue for three main reasons: contains pathogens, heavy metals and organic compounds that are harmful to the environmental and human health; high volumes are daily generated; and shortage of landfill sites for proper disposal. This research deals with the viability study of sewage sludge utilization, after calcination process, as mineral admixture in the production of concrete. High-performance concretes were produced with replacement content of 5% and 10% by weight of Portland cement with sewage sludge ash (SSA. The influence of this ash was analyzed through physical and mechanical tests. Analysis showed that the mixtures containing SSA have lower values of compressive strength than the reference. The results of absorptivity, porosity and accelerated penetration of chloride ions, presents that mixtures containing ash showed reductions compared to the reference. This indicates that SSA provided refinement of the pore structure, which was confirmed by mercury intrusion porosimetry test.

  8. Rapid assessment of populations trends of invasive species: Singular Spectrum Analysis (SSA

    Directory of Open Access Journals (Sweden)

    DANA, ED

    2010-01-01

    Full Text Available Singular Spectrum Analysis (SSA is a powerful analytical approach for biodi-versity management. Its main advan-tages are due to its intuitive processing and visualization, since mathematical workflow is conceptually similar to the widely accepted Principal Components Analysis. Detailed analyses of popula-tion trends with mathematical tools are often difficult to achieve for managers by a number of reasons (large numbers or areas monitored, large number of species, insufficient statistics skills, strong knowledge level in demographic analyses, etc.. SSA has been used since the 1970’s in signal processing to clarify signal vs. noisy information, but it has also been used in climate change analy-sis and other developmental areas. Be-sides, SSA is a rapid-learning method for technicians and managers with medium level of mathematical knowledge. Free software in Unix environment is avail-able. Unfortunately, no free and friendly software is available for Win-dows SO. Although R package may offer solutions for really advanced users, it does not fit real work situations for managers of biological invasions. Cater-pillar (Gistat Group, Ltd is by now, the best option found by the author in terms of price, facility for results inter-pretation and time consumed in learn-ing. The main disadvantage is the poor content of tutorial files

  9. SSA DISABILITY. SGA Levels Appear to Affect the Work Behavior of Relatively Few Beneficiaries, but More Data Needed

    National Research Council Canada - National Science Library

    Baucus, Max

    2002-01-01

    ... physical or mental impairment has earnings that exceed the Substantial Gainful Activity (SGA) level, which represents SSA's principal standard for determining whether a disabled individual is able to work...

  10. The East Asian Development Experience: Policy Lessons, Implications, and Recommendations for Sub-Saharan Africa (SSA) Global Competitiveness

    OpenAIRE

    Ashford C. Chea

    2012-01-01

    The paper looks at the development experience of East Asia and draws lessons for Sub-Saharan Africa in building global competitiveness. It starts with a historical perspective of both regions’ developmental trajectories. This is followed by an analysis of the causes of East Asia’s superior economic performance and development and SSA underdevelopment. The article also draws policy lessons from East Asia development strategies for SSA global competitiveness. The paper ends with a presentation ...

  11. Adsorption studies at ionized surface layers by means of hot atoms; Etude, a l'aide d'atomes excites, de l'adsorption dans des couches superficielles ionisees; Issledovanie pri pomoshchi goryachikh atomov adsorbtsii na ionizirovannykh poverkhnostnykh sloyakh; Estudios, con ayuda de atomos excitados, de la adsorcion en capas superficiales ionizadas

    Energy Technology Data Exchange (ETDEWEB)

    Avrahami, Menashe; Steiger, Naftali H [Department of Chemistry, Technion - Israel Institute of Technology, Haifa (Israel)

    1962-03-15

    directement si l'on utilise des atomes excites. Des quantites extremement faibles d'ions radioactifs appropries, ou d'ions capables de subir in situ des transformations nucleaires induites, sont ajoutees a ces solutions, en remplacement de certains contre-ions coadsorbes sur les ions organiques adsorbes initialement. Des atomes excites dont l'energie va de 100 keV a quelques electrons volts seulement ont dans l'eau un parcours compris entre 1000A et des valeurs correspondant aux couches monomoleculaires. On peut donc s'en sarvir pour des etudes tres sensibles sur les couches superficielles. Les atomes excites qui sont expulses de la surface sont separes et comptes. Pour obtenir des particules de recul par desintegration {alpha}, le systeme {sup 212}Bi/{sup 208}Tl s'est revele satisfaisant. En ameliorant cette methode, on a pu obtenir des rensaignernents utiles sur les conditions d'adsorption en couches superficielles de dodecyl-sulfate de sodium. On a etudie la cinetique de cette adsorption en suivant dans le temps l'activite des particules de recul formees par adsorption d'ions Bi. On a mesure les isothermes d'adsorption des ions Bi en fonction de la concentration globale de la substance tensioactive sous differentes conditions de force ionique, de pH et d'activite {sup 212}Bi. En comparant ces isothermes avec ceux obtenus par mesure de la tension superficielle des solutions et en calculant l'exces de surface a l'aide d'un isotherme de Gibbs convenablement modifie, on a pu determiner l'adsorption de Bi{sup +++} et de Pb{sup ++} par rapport a celle de Na{sup +} et de H{sub 3}O{sup +} et, a partir de ces donnees, l'importance de l'echange ionique dans la couche adsorbee. Etant donne que cette methode permet de mesurer l'adsorption des especes ionisees, on a pu suivre les reactions de surface transformant les anions organiques primaires adsorbes en un etat non ionique. On a pu en tirer des conclusions sur la formation de savons acides non ionises en surface et sur certaines

  12. Overview of Human-Centric Space Situational Awareness (SSA) Science and Technology (S&T)

    Science.gov (United States)

    Ianni, J.; Aleva, D.; Ellis, S.

    2012-09-01

    A number of organizations, within the government, industry, and academia, are researching ways to help humans understand and react to events in space. The problem is both helped and complicated by the fact that there are numerous data sources that need to be planned (i.e., tasked), collected, processed, analyzed, and disseminated. A large part of the research is in support of the Joint Space Operational Center (JSpOC), National Air and Space Intelligence Center (NASIC), and similar organizations. Much recent research has been specifically targeting the JSpOC Mission System (JMS) which has provided a unifying software architecture. This paper will first outline areas of science and technology (S&T) related to human-centric space situational awareness (SSA) and space command and control (C2) including: 1. Object visualization - especially data fused from disparate sources. Also satellite catalog visualizations that convey the physical relationships between space objects. 2. Data visualization - improve data trend analysis as in visual analytics and interactive visualization; e.g., satellite anomaly trends over time, space weather visualization, dynamic visualizations 3. Workflow support - human-computer interfaces that encapsulate multiple computer services (i.e., algorithms, programs, applications) into a 4. Command and control - e.g., tools that support course of action (COA) development and selection, tasking for satellites and sensors, etc. 5. Collaboration - improve individuals or teams ability to work with others; e.g., video teleconferencing, shared virtual spaces, file sharing, virtual white-boards, chat, and knowledge search. 6. Hardware/facilities - e.g., optimal layouts for operations centers, ergonomic workstations, immersive displays, interaction technologies, and mobile computing. Secondly we will provide a survey of organizations working these areas and suggest where more attention may be needed. Although no detailed master plan exists for human

  13. Potential use of sewage sludge ash (SSA as a cement replacement in precast concrete blocks

    Directory of Open Access Journals (Sweden)

    Pérez-Carrión, M.

    2014-03-01

    Full Text Available The present study explored the technological feasibility of re-using sewage sludge ash (SSA as a Portland cement replacement in commercially manufactured pre cast concrete blocks. The blocks analysed were made to the guidelines laid down in Spain’s National Plan for Waste Water Treatment Plant Sludge, 2001–2006, and European Union specifications (CE marking for such products. Performance was compared in three families of blocks, with 0, 10 and 20% SSA. The findings proved that SSA is apt for pre cast concrete block manufacture and that, in addition to the economic and environmental benefits afforded, its use would improve certain of the properties of conventional block.El objetivo de esta investigación es estudiar el uso potencial de las cenizas de lodos de depuradora (CLD, como sustitución del cemento Portland en bloques de hormigón prefabricados, de forma que se pueda lograr una revalorización de este material de desecho mediante este procedimiento. La metodología utilizada en este trabajo se rige por las directrices del Plan Nacional Español de Lodos de Aguas Residuales de 2001–2006, y por las exigencias del Consejo Europeo (marcado CE, que es obligatorio para este tipo de productos. Se han utilizado dos niveles de sustitución de cemento (10% y 20%, y todos los resultados han sido referidos a las muestras control. Los resultados obtenidos muestran que es posible utilizar una sustitución parcial del cemento por CLD, en la fabricación de bloques de hormigón prefabricados, y por lo tanto, se pueden conseguir beneficios económicos y ambientales, así como la mejora de una serie de propiedades.

  14. MELiSSA third compartment: Nitrosomonas europaea and Nitrobacter winogradskyi axenic cultures in bioreactors

    Science.gov (United States)

    Cruvellier, Nelly; Lasseur, Christophe; Poughon, Laurent; Creuly, Catherine; Dussap, Gilles

    Nitrogen is a key element for the life and its balance on Earth is regulated by the nitrogen cycle. This loop includes several steps among which nitrification that permits the transformation of the ammonium into nitrate. The MELiSSA loop is an artificial ecosystem designed for life support systems (LSS). It is based on the carbon and nitrogen cycles and the recycling of the non-edible part of the higher plants and the waste produced by the crew. In this order, all the wastes are collected in the first compartment to degrade them into organic acids and CO2. These compounds are joining the second compartment which is a photoheterotrophic compartment where at the outlet an organic-free medium containing ammonium is produced. This solution will be the substrate of the third compartment where nitrification is done. This compartment has to oxidize the ammonium into nitrate, and this biological reaction needs two steps. In the MELiSSA loop, the nitrification is carried out by two bacteria: Nitrosomonas europaea ATCC® 19718™ which is oxidizing ammonia into nitrite and Nitrobacter winogradskyi ATCC® 25391™ which is producing nitrate from nitrite in the third compartment. These two bacteria are growing in axenic conditions on a fixed bed bioreactor filled with Biostyr® beads. The nitrogen compounds are controlled by Ionic Chromatography and colorimetric titration for each sample. The work presented here deals with the culture of both bacteria in pure cultures and mixed cultures in stirred and aerated bioreactors of different volumes. The first aim of our work is the characterization of the bacteria growth in bioreactors and in the nitrifying fixed-bed column. The experimental results confirm that the growth is slow; the maximal growth rate in suspended cultures is 0.054h-1 for Nitrosomonas europaea and 0.022h-1 for Nitrobacter winogradskyi. Mixed cultures are difficult to control and operate but one could be done for more than 500 hours. The characterization of the

  15. BOREAS Elevation Contours over the NSA and SSA in ARC/INFO Generate Format

    Science.gov (United States)

    Knapp, David; Nickeson, Jaime; Hall, Forrest G. (Editor)

    2000-01-01

    This data set was prepared by BORIS Staff by reformatting the original data into the ARC/INFO Generate format. The original data were received in SIF at a scale of 1:50,000. BORIS staff could not find a format document or commercial software for reading SIF; the BOREAS HYD-08 team pro-vided some C source code that could read some of the SIF files. The data cover the BOREAS NSA and SSA. The original data were compiled from information available in the 1970s and 1980s. The data are available in ARC/INFO Generate format files.

  16. BOREAS TF-8 NSA-OJP and SSA-OBS Ceilometer Data

    Science.gov (United States)

    Moore, Kathleen E.; Hall, Forrest G. (Editor); Huemmrich, Karl (Editor); Fitzjarrald, David R.

    2000-01-01

    The BOREAS TF-8 team used ceilometers to collect data on the fraction of the sky covered with clouds and the cloud height. Included with these data is the surface-based lifting condensation level, derived from temperature and humidity values acquired at the flux tower at the NSA-OJP site. Ceilo-meter data were collected at the NSA-OJP site in 1994 and at the NSA-OJP and SSA-OBS sites in 1996. The data are available in tabular ASCII files. The data files are available on a CD-ROM (see document number 20010000884).

  17. BOREAS RSS-7 Landsat TM LAI IMages of the SSA and NSA

    Science.gov (United States)

    Hall, Forrest G. (Editor); Nickeson, Jaime (Editor); Chen, Jing; Cihlar, Josef

    2000-01-01

    The BOReal Ecosystem-Atmosphere Study Remote Sensing Science (BOREAS RSS-7) team used Landsat Thematic Mapper (TM) images processed at CCRS to produce images of Leaf Area Index (LAI) for the BOREAS study areas. Two images acquired on 06-Jun and 09-Aug-1991 were used for the SSA, and one image acquired on 09-Jun-1994 was used for the NSA. The LAI images are based on ground measurements and Landsat TM Reduced Simple Ratio (RSR) images. The data are stored in binary image-format files.

  18. Effect of lime addition during sewage sludge treatment on characteristics of resulting SSA when it is used in cementitious materials.

    Science.gov (United States)

    Vouk, D; Nakic, D; Štirmer, N; Baricevic, A

    2017-02-01

    Final disposal of sewage sludge is important not only in terms of satisfying the regulations, but the aspect of choosing the optimal wastewater treatment technology, including the sludge treatment. In most EU countries, significant amounts of stabilized and dewatered sludge are incinerated, and sewage sludge ash (SSA) is generated as a by product. At the same time, lime is one of the commonly used additives in the sewage sludge treatment primarily to stabilize the sludge. In doing so, the question arose how desirable is such addition of lime if the sludge is subsequently incinerated, and the generated ash is further used in the production of cementitious materials. A series of mortars were prepared where 10-20% of the cement fraction was replaced by SSA. Since all three types of analyzed SSA (without lime, with lime added during sludge stabilization and with extra lime added during sludge incineration) yielded nearly same results, it can be concluded that if sludge incineration is accepted solution, lime addition during sludge treatment is unnecessary even from the standpoint of preserving the pozzolanic properties of the resulting SSA. Results of the research carried out on cement mortars point to the great possibilities of using SSA in concrete industry.

  19. Solar Flare Prediction Science-to-Operations: the ESA/SSA SWE A-EFFort Service

    Science.gov (United States)

    Georgoulis, Manolis K.; Tziotziou, Konstantinos; Themelis, Konstantinos; Magiati, Margarita; Angelopoulou, Georgia

    2016-07-01

    We attempt a synoptical overview of the scientific origins of the Athens Effective Solar Flare Forecasting (A-EFFort) utility and the actions taken toward transitioning it into a pre-operational service of ESA's Space Situational Awareness (SSA) Programme. The preferred method for solar flare prediction, as well as key efforts to make it function in a fully automated environment by coupling calculations with near-realtime data-downloading protocols (from the Solar Dynamics Observatory [SDO] mission), pattern recognition (solar active-region identification) and optimization (magnetic connectivity by simulated annealing) will be highlighted. In addition, the entire validation process of the service will be described, with its results presented. We will conclude by stressing the need for across-the-board efforts and synergistic work in order to bring science of potentially limited/restricted interest into realizing a much broader impact and serving the best public interests. The above presentation was partially supported by the ESA/SSA SWE A-EFFort project, ESA Contract No. 4000111994/14/D/MRP. Special thanks go to the ESA Project Officers R. Keil, A. Glover, and J.-P. Luntama (ESOC), M. Bobra and C. Balmer of the SDO/HMI team at Stanford University, and M. Zoulias at the RCAAM of the Academy of Athens for valuable technical help.

  20. Meet EPA's Dan Nelson

    Science.gov (United States)

    EPA’s Dan Nelson is the Director of the Human Research Protocol Office at the National Health and Environmental Effect Research Laboratory, Dan works to protect the rights and welfare of EPA’s research participants.

  1. Bahasa, Simbol, dan Religi

    OpenAIRE

    Supriyadi, Supriyadi

    1999-01-01

    Manusia sering disebut sebagai makhluk sosial, makhluk berakal, makhluk berseni, dan sebagainya. Tulisan ini secara tidak langsung membicarakan manusia sebagai makhluk berbahasa, bersimbol, dan bereligi . Meskipun demikian, titik tolaknya bukan pada manusia itu sendiri, tetapi pada bahasa, simbol, dan religinya, terutama pada hubungan di antara ketiganya . Hubungan antara bahasa dan simbol tidak diragukan lagi karena bahasa merupakan jenis simbol . Demikian juga hubungan antara simbol dengan ...

  2. Advantageous use of SSA technique to observe effects of thickness, antioxidant and oxygen in gamma irradiated low density polyethylene

    Energy Technology Data Exchange (ETDEWEB)

    Perez, C.J., E-mail: cjperez@fi.mdp.edu.ar [Research Institute of Material Science and Technology (INTEMA), National Research Council (CONICET), Engineering Faculty, Mar del Plata University, Av. J.B. Justo 4302, 7600 Mar del Plata (Argentina); Failla, M.D. [Planta Piloto de Ingenieria Quimica-PLAPIQUI (UNS-CONICET), Camino ' La Carrindanga' Km 7, 8000 Bahia Blanca (Argentina); Carella, J.M. [Research Institute of Material Science and Technology (INTEMA), National Research Council (CONICET), Engineering Faculty, Mar del Plata University, Av. J.B. Justo 4302, 7600 Mar del Plata (Argentina)

    2012-06-20

    Highlights: Black-Right-Pointing-Pointer Information from successive self-nucleation and annealing technique is analyzed. Black-Right-Pointing-Pointer Oxygen and antioxidants reduce crosslinking efficiency by reaction with free radicals. Black-Right-Pointing-Pointer Recognizable differences are obtained in samples irradiated at different atmospheres. - Abstract: Information obtained from successive self-nucleation and annealing (SSA) technique is analyzed, paying special attention to the observable effects of samples thickness and antioxidant and oxygen concentrations. Molecular structure changes for low density polyethylene (LDPE) samples, irradiated under three different atmospheres for doses between 33 and 222 kGy were analyzed, with emphasis on the changes of longer polymethylene crystallizable lengths. Antioxidant and oxygen concentrations were varied for samples of different thickness to study the effects on degradation. The changes in the molecular structure were followed simultaneously by SSA and Infrared spectroscopy (FTIR) via carbonyl group concentration. Preliminary quantifications of the SSA technique sensitivity are also advanced.

  3. Studies on tempering at different temperatures of the beta phase retained by water quenching in uranium-chromium alloys containing from 0,37 to 4 atoms of chromium percent (1963); Etude du revenu a differentes temperatures de la phase beta retenue par trempe a l'eau dans les alliages uranium-chrome contenant de 0,37 a 4 atomes pour cent de chrome (1963)

    Energy Technology Data Exchange (ETDEWEB)

    Degois, M [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1962-07-15

    The author made a systematic study of the annealing of the beta phase retained by water-quenching in uranium-chromium alloys of concentrations between 0.37 and 4 of chromium percent. It is shown that alloys containing less than 1 atom per cent are transformed at temperatures between room temperature and 250 deg. C according to a bainitic process involving activation energies of the order of 14,500 cal/mole. Alloys containing more than 1 at. per cent are transformed at temperature between 400 and 650 deg. C by way of a germination and growth process involving an activation energy of the order of 33,000 cal/mole. The limit of solubility of chromium in beta uranium plays a fundamental part in the transformations of the alloys. The TTT curves of beta {yields} alpha transformation were drawn by the use of a thermo-dilatometer of very low inertia. The transformation law may be expressed 1 x = exp. (kt){sup n}; x represents the degree of progression of the transformation, k a coefficient dependent on the temperature, and n an exponent depending only on the composition of the alloy. A micrographic and crystallographic study confirmed the results found by dilatometry; in particular it was possible to measure the progression rates of the transformation. (author) [French] L'auteur a fait une etude systematique du revenu de la phase beta retenue par trempe a l'eau dans les alliages uranium-chrome de teneurs comprises entre 0,37 et 4 atomes pour cent de chrome. Il a montre que les alliages qui contiennent moins de 1 atome pour cent de chrome se transforment aux temperatures comprises entre la temperature ordinaire et 250 deg. C selon un processus bainitique mettant en jeu des energies d'activatlon de l'ordre de 14500 cal/mole. Les alliages qui renferment plus de 1 atome pour cent de chrome se transforment aux temperatures comprises entre 400 et 650 deg. C suivant un processus de germination et croissance mettant en jeu une energie d'activation de l'ordre de -33000 cal/mole. La

  4. Effect of sewage sludge ash (SSA on the mechanical performance and corrosion levels of reinforced Portland cement mortars

    Directory of Open Access Journals (Sweden)

    Andión, L. G.ª

    2006-06-01

    Full Text Available The article describes a study conducted to determinecorrosion in reinforcement embedded in Portland cement(PC mortars with different percentages of sewage sludgeash (SSA admixtures. The polarization resistancetechnique was used to determine the steel corrosion rate(Icorr in the test specimens. The samples were subjectedto different environmental conditions and aggressiveagents: 100% relative humidity (RH, accelerated carbonationat 70% RH and seawater immersion. Portlandcement was partially substituted for SSA in the mixes atrates of 0, 10, 20, 30 and 60% (by mass to make thedifferent mortars. The results show that where cementwas replaced by SSA at rates of up to 10% by mass,mortar corrosion performance was comparable to thebehaviour observed in SSA-free mortars (control mortar:0% SSA. Data for higher rates are also shown. From themechanical standpoint, SSA exhibited moderate pozzolanicactivity and the best performance when SSA wasadded at a rate of 10% to mixes with a water/(binder:PC + SSA (w/b ratio of 0.5.Se ha estudiado el nivel de corrosion que presentan lasarmaduras embebidas en morteros fabricados con cementoPortland (CP con diferentes porcentajes de sustitucion deceniza de lodo de depuradora (CLD. Se ha utilizado la tecnicade la Resistencia a la Polarizacion para determinar lavelocidad de corrosion del acero embebido en las muestrasestudiadas. Las muestras se han sometido a diferentes condicionesambientales y agentes agresivos: 100% de humedadrelativa (HR, carbonatacion acelerada al 70% HR einmersion en agua de mar. Para la fabricacion de los distintosmorteros, el cemento Portland ha sido parcialmente sustituidopor CLD en los siguientes porcentajes en masa: 0,10, 20, 30 y 60%. Los resultados muestran que sustitucionesde cemento por CLD de hasta el 10% en masa no alteranel comportamiento frente a la corrosion de los morterosal compararlos con los morteros libres de CLD (morteroscontrol: 0% de sustitucion de cemento por CLD. Se

  5. Effects of Temperature and Pressure on Hot-Atom Reactions in Bromoethane; Effets de la Temperature et de la Pression sur les Reactions des Atomes Chauds dans le Bromoethane; Vliyanie temperatury i davleniya na reaktsii goryachikh atomov v bromehtane; Efectos de la Temperatura y de la Presion en las Reacciones de Atomos Calientes en el Bromoetano

    Energy Technology Data Exchange (ETDEWEB)

    Cole, A. J.; Mia, M. D.; Miller, G. E.; Shaw, P. F.D. [Nuclear Physics Laboratory, Oxford University, Oxford (United Kingdom)

    1965-04-15

    -Sign et -115 Degree-Sign C et a la pression atmospherique, ainsi qu'a la temperature de 18 Degree-Sign C et a des pressions allant jusqu'a 10{sup 4} atm. En plus des composes deja signales, ils ont trouve de faibles quantites de bromoethylene, de dibromo- 1,2-ethylene, de mono-et dibromopropanes et de mono-, di-, tri-et tetrabromobutanes; il existe en outre des indices indirects de la formation de bromobutenes. Les reactions qui dependent de la diffusion sont complexes-, on peut les expliquer en admettant qu'une pyrolyse du liquide se produit dans le voisinage de l'atome chaud et donne des radicaux bromoethyle et de l'ethylene. C'est alors a l'addition de radicaux a l'ethylene que sont dus a la fois la formation de bromures contenant plus de deux atomes de carbone et les rendements en ces bromures, qui dependent de la diffusion. D'une maniere generale, une reduction de la temperature ou un accroissement de la pression entraine une augmentation du rendement imputable a une diminution de la vitesse de diffusion. L'effet est le plus marque sur le rendement en dibromo-1, 2-ethanef qui se produit surtout par la reaction de diffusion des radicaux bromoethyle et qui est quadruple par l'application de 10{sup 4} atm du fait de la suppression de la dissociation CH{sub 2}-CH{sub 2}Br Rightwards-Arrow-Over-Leftwards-Arrow CH{sub 2} = CH{sub 2} + Br En revanche, la dissociation du radical (CH{sub 3} -CHBr) en bromoethylene et hydrogene (CH{sub 2} = CHBr + H) est impossible, et le rendement en dibromo-1,1-ethane est a peu pres independant de la pression. La variation, en fonction de la temperature et de la pression, du rendement en bromoethane pour de fortes concentrations de brome est voisine de celle qui avait ete prevue precedemment par l'un des auteurs. (author) [Spanish] Se ha estudiado el rendimiento de los compuestos que contienen {sup 80m}Br, producidos por irradiacion de mezclas de bromoetano y bromo con neutrones de 14 MeV a 18 Degree-Sign C, -80 Degree-Sign C y -115 Degree

  6. BOREAS RSS-8 BIOME-BGC SSA Simulation of Annual Water and Carbon Fluxes

    Science.gov (United States)

    Hall, Forrest G. (Editor); Nickeson, Jaime (Editor); Kimball, John

    2000-01-01

    The BOREAS RSS-8 team performed research to evaluate the effect of seasonal weather and landcover heterogeneity on boreal forest regional water and carbon fluxes using a process-level ecosystem model, BIOME-BGC, coupled with remote sensing-derived parameter maps of key state variables. This data set contains derived maps of landcover type and crown and stem biomass as model inputs to determine annual evapotranspiration, gross primary production, autotrophic respiration, and net primary productivity within the BOREAS SSA-MSA, at a 30-m spatial resolution. Model runs were conducted over a 3-year period from 1994-1996; images are provided for each of those years. The data are stored in binary image format. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).

  7. Atom optics

    International Nuclear Information System (INIS)

    Balykin, V. I.; Jhe, W.

    1999-01-01

    Atom optics, in analogy to neutron and electron optics, deals with the realization of as a traditional elements, such as lenes, mirrors, beam splitters and atom interferometers, as well as a new 'dissipative' elements such as a slower and a cooler, which have no analogy in an another types of optics. Atom optics made the development of atom interferometer with high sensitivity for measurement of acceleration and rotational possible. The practical interest in atom optics lies in the opportunities to create atom microprobe with atom-size resolution and minimum damage of investigated objects. (Cho, G. S.)

  8. 20 CFR 408.1205 - How can a State have SSA administer its State recognition payment program?

    Science.gov (United States)

    2010-04-01

    ... recognition payment program? 408.1205 Section 408.1205 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SPECIAL BENEFITS FOR CERTAIN WORLD WAR II VETERANS Federal Administration of State Recognition Payments § 408.1205 How can a State have SSA administer its State recognition payment program? A State (or...

  9. 20 CFR 408.1235 - How does the State transfer funds to SSA to administer its recognition payment program?

    Science.gov (United States)

    2010-04-01

    ... administer its recognition payment program? 408.1235 Section 408.1235 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SPECIAL BENEFITS FOR CERTAIN WORLD WAR II VETERANS Federal Administration of State Recognition Payments § 408.1235 How does the State transfer funds to SSA to administer its recognition payment program...

  10. Persistent fetal sinus bradycardia associated with maternal anti-SSA/Ro and anti-SSB/La antibodies

    NARCIS (Netherlands)

    Chockalingam, Priya; Jaeggi, Edgar T.; Rammeloo, Lukas A.; Haak, Monique C.; Adama van Scheltema, Phebe N.; Breur, Johannes M. P. J.; Bartelings, Margot M.; Clur, Sally-Ann B.; Blom, Nico A.

    2011-01-01

    To study the clinical course and outcome of fetal sinus bradycardia (SB) due to maternal antibody-induced sinus node dysfunction. We reviewed the maternal, prenatal, and postnatal findings of fetuses with SB associated with elevated maternal anti-SSA/Ro and anti-SSB/La antibodies. Of the 6 cases

  11. Comment s'inventer un père écrivain: Albert camus chez Maïssa Bey

    NARCIS (Netherlands)

    Rosello, M.

    2015-01-01

    This article focuses on the role played by Camus in Maïssa Bey’s work. Focusing on the ambivalent and paradoxical place he occupies in Au commencement était la mer and l’Ombre d’un homme qui marche au soleil, I analyse the construction of the father or rather Bey’s definition of fathers. The

  12. 78 FR 37875 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Bureau of the Fiscal Service...

    Science.gov (United States)

    2013-06-24

    ...: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching... above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988... computer matching involving the Federal government could be performed and adding certain protections for...

  13. 75 FR 54213 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Office of Personnel Management...

    Science.gov (United States)

    2010-09-03

    ... 1021 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer.... SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub... computer matching involving the Federal government could be performed and adding certain protections for...

  14. 76 FR 21091 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Centers for Medicare & Medicaid...

    Science.gov (United States)

    2011-04-14

    ...: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching...: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503...), as amended, (Pub. L. 100-503, the Computer Matching and Privacy Protection Act (CMPPA) of 1988), the...

  15. 76 FR 5235 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA Internal Match)-Match Number 1014

    Science.gov (United States)

    2011-01-28

    ...; Computer Matching Program (SSA Internal Match)--Match Number 1014 AGENCY: Social Security Administration... regarding protections for such persons. The Privacy Act, as amended, regulates the use of computer matching....C. 552a, as amended, and the provisions of the Computer Matching and Privacy Protection Act of 1988...

  16. 76 FR 12397 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Bureau of the Public Debt (BPD...

    Science.gov (United States)

    2011-03-07

    ...; Computer Matching Program (SSA/ Bureau of the Public Debt (BPD))--Match Number 1038 AGENCY: Social Security... as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection... containing SSNs extracted from the Supplemental Security Record database. Exchanges for this computer...

  17. 76 FR 71417 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Law Enforcement Agencies (LEA...

    Science.gov (United States)

    2011-11-17

    ...; Computer Matching Program (SSA/ Law Enforcement Agencies (LEA)) Match Number 5001 AGENCY: Social Security... protections for such persons. The Privacy Act, as amended, regulates the use of computer matching by Federal... accordance with the Privacy Act of 1974, as amended by the Computer Matching and Privacy Protection Act of...

  18. Atom-by-atom assembly

    International Nuclear Information System (INIS)

    Hla, Saw Wai

    2014-01-01

    Atomic manipulation using a scanning tunneling microscope (STM) tip enables the construction of quantum structures on an atom-by-atom basis, as well as the investigation of the electronic and dynamical properties of individual atoms on a one-atom-at-a-time basis. An STM is not only an instrument that is used to ‘see’ individual atoms by means of imaging, but is also a tool that is used to ‘touch’ and ‘take’ the atoms, or to ‘hear’ their movements. Therefore, the STM can be considered as the ‘eyes’, ‘hands’ and ‘ears’ of the scientists, connecting our macroscopic world to the exciting atomic world. In this article, various STM atom manipulation schemes and their example applications are described. The future directions of atomic level assembly on surfaces using scanning probe tips are also discussed. (review article)

  19. Analisis Kebijakan dan Efektivitas Organisasi

    Directory of Open Access Journals (Sweden)

    Amir Syarifudin Kiwang

    2015-05-01

    Full Text Available Penerapan Peraturan Gubernur Nusa Tenggara Timur Nomor 8 Tahun 2011 tentang Organisasi dan Tata Kerja Unit Pelaksana Teknis Pendidikan dan Pelatihan Koperasi dan Usaha Mikro Kecil dan Menengah pada Dinas Koperasi dan Usaha Mikro Kecil dan Menengah Provinsi Nusa Tenggara Timur adalah dalam rangka untuk meningkatkan efektivitas kerja organisasi pada UPT Diklat Koperasi dan UMKM. Penelitian ini berusaha untuk melihat dampak kebijakan organisasi terhadap efektivitas organisasi dengan menggunakan enam elemen variabel dari kebijakan dan praktik manajemen. Keenam elemen tersebut adalah penetapan tujuan strategis, pencarian dan pemanfaatan sumber daya, lingkungan prestasi, proses komunikasi, kepemimpinan dan pengambilan keputusan, serta adaptasi dan inovasi organisasi. Penelitian kualitatif ini menggunakan pendekatan studi kasus. Teknik analisis data yang digunakan adalah analisis data model Miles dan Huberman, yang terdiri atas reduksi data, display/penyajian data, dan kesimpulan/verifikasi. Hasil penelitian menunjukkan bahwa efektivitas organisasi pada UPT Diklat koperasi dan UMKM belum berjalan secara baik, hal ini dapat dilihat dari beberapa hal antara lain, belum adanya tenaga spesialisasi pengelola diklat dan tenaga khusus (sarjana di bidang perkoperasian dan kondisi lingkungan kerja (lingkungan prestasi pada UPT Diklat koperasi dan UMKM yang belum efektif. Penempatan pegawai juga belum tepat, mutasi ke UPT Diklat Koperasi dan UMKM tidak memperhatikan latar belakang pendidikan dan spesialisasi/keahlian pegawai sehingga membutuhkan waktu dalam proses penyesuaian serta menurunkan jumlah pelaksanaan diklat dikarenakan keterbatasan alokasi dana.

  20. Sewage sludge ash (SSA) from large and small incineration plants as a potential source of phosphorus - Polish case study.

    Science.gov (United States)

    Smol, Marzena; Kulczycka, Joanna; Kowalski, Zygmunt

    2016-12-15

    The aim of this research is to present the possibility of using the sewage sludge ash (SSA) generated in incineration plants as a secondary source of phosphorus (P). The importance of issues related to P recovery from waste materials results from European Union (UE) legislation, which indicated phosphorus as a critical raw material (CRM). Due to the risks of a shortage of supply and its impact on the economy, which is greater than other raw materials, the proper management of phosphorus resources is required in order to achieve global P security. Based on available databases and literature, an analysis of the potential use of SSA for P-recovery in Poland was conducted. Currently, approx. 43,000 Mg/year of SSA is produced in large and small incineration plants and according to in the Polish National Waste Management Plan 2014 (NWMP) further steady growth is predicted. This indicates a great potential to recycle phosphorus from SSA and to reintroduce it again into the value chain as a component of fertilisers which can be applied directly on fields. The amount of SSA generated in installations, both large and small, varies and this contributes to the fact that new and different P recovery technology solutions must be developed and put into use in the years to come (e.g. mobile/stationary P recovery installations). The creation of a database focused on the collection and sharing of data about the amount of P recovered in EU and Polish installations is identified as a helpful tool in the development of an efficient P management model for Poland. Copyright © 2016 Elsevier Ltd. All rights reserved.

  1. TANGKI SEPTIK DAN MASALAHNYA

    Directory of Open Access Journals (Sweden)

    Sri Soewasti Soesanto

    2012-10-01

    Full Text Available Manusia yang sehat tiap hari membuang tinja yang harus ditampung dan/atau diolah secara saniter. Meskipun Indonesia telah 55 tahun merdeka dan telah memiliki banyak ahli sanitasi/teknik penyehatan baik lulusan dalam maupun luar negeri, namun cara pengelolaan tinja yang ada kebanyakan masih belum memenuhi syarat kesehatan. Tangki septik dianggap sebagai cara penampungan tinja yang terbaik, padahal sebenarnya masih terjadi pencemaran tanah dan air melalui saluran perembesan.Tangki septik (septic tank merupakan salah satu macam sarana pengolahan tinja manusia yang pada garis besarnya terdiri dari sebuah tangki pembusukan lumpur (sludge digester dan saluran perembesan efluen. Tangki pembusukan harus memenuhi syarat mengenai perbandingan panjang dan lebar serta syarat kedalaman maksimum dan minimum, agar pembusukan lumpur dari tinja manusia dapat berjalan sempurna malahan tidak berbau busuk lagi.

  2. Atomic Transport Problems of Interest in Nuclear Systems; Problemes de Transport Atomique Presentant un Interet dans les Systemes Nucleaires; Problemy perenosa atomov, predstavlyayushchie interes v yadernykh sistemakh; Problemas de Transporte Atomico de Interes para la Ingenieria Nuclear

    Energy Technology Data Exchange (ETDEWEB)

    Lundy, T. S.; Winslow, F. R. [Oak Ridge National Laboratory, TN (United States)

    1966-02-15

    ) [French] Les auteurs discutent plusieurs problemes qui surgissent lorsqu'on veut appliquer les constantes fondamentales de diffusion a des systemes presentant un interet pratique, notamment a ceux que l'on rencontre dans le genie nucleaire. Ces problemes comprennent des experiences de diffusion isotherme, la diffusion sous gradient thermique et les effets de rayonnements sur les processus de diffusion. La plupart des donnees dignes de foi sur la diffusion dans les solides ont ete obtenues a partir de cas dans lesquels il n'y avait essentiellement pas de gradient de concentration des especes diffusantes. Toutefois, dans les systemes qui presentent un interet pour les specialistes du genie nucleaire, il y a presque invariablement des gradients de concentration. C'est pourquoi il faut avoir une connaissance pratique de la relation entre les coefficients d'autodiffusion et de diffusion chimique pour pouvoir determiner les coefficients applicables dans chaque cas d'espece. En outre, il faut egalement connaitre les coefficients d'activite thermodynamique en fonction de la composition. Recemment, il a ete clairement demontre qu'il est dangereux d'utiliser aveuglement une expression d'Arrhenius pour decrire les variations de la diffusion selon la temperature, car cela peut entrainer des erreurs considerables dans le calcul theorique des coefficients de diffusion. Les auteurs discutent les consequences qui en decoulent, particulierement pour les systemes cubiques centres refractaires. Ils ont etudie, tant theoriquement qu'experimentalement, l'effet d'un gradient thermique sur la distribution des impuretes de substitution dans un metal. Ces travaux ont permis de mieux apprecier l'importance de cet effet dans des systemes presentant un interet du point de vue nucleaire. L'accroissement de la diffusion par les champs de rayonnements demeure toujours un probleme d'un interet reel. Les auteurs ont fait les premieres mesures directes de l'effet du bombardement par des particules rapides

  3. DEPRESI DAN GANGGUAN TIDUR

    Directory of Open Access Journals (Sweden)

    Wayan Eko Radityo

    2012-12-01

    Full Text Available Depresi merupakan gangguan mood berupa kesedihan yang intens, berlangsung dalamwaktu lama, dan mengganggu kehidupan normal yang insidennya semakin meningkatseiring dengan meningkatnya tekanan hidup. Tahun 2020, depresi diperkirakanmenempati urutan kedua penyakit di dunia. Gejala-gejala depresi terdiri dari gangguanemosi, gangguan kognitif, keluhan somatik, gangguan psikomotor, dan gangguanvegetatif. Salah satu gejala depresi yang muncul adalah gangguan tidur yang bisaberupa insomnia, bangun secara tiba-tiba, dan hipersomnia. Hal ini disebabkan olehgangguan neurotransmiter dan regulasi hormon. Selain sebagai gejala depresi, gangguantidur juga bisa merupakan penyebab depresi. Beberapa penelitian memberikanhubungan gangguan tidur dapat meningkatkan risiko depresi di kemudian hari.

  4. The influence of quorum sensing in compartment II of the MELiSSA loop

    Science.gov (United States)

    Condori, Sandra; Mastroleo, Felice; Wattiez, Ruddy; Leys, Natalie

    MELiSSA (Micro-Ecological Life Support System Alternative) has been conceived as a 5 compartments microorganisms and higher plants recycling system for long haul space flights. Rhodospirillum rubrum S1H colonizes compartment II. Previous work reported that continuous culture of the bacterium in a photobioreactor could lead to thick biofilm formation, leading to bioreactor arrest. Our aim is to investigate the unknown quorum sensing (QS) system of R. rubrum S1H, specifically under MELiSSA relevant culture conditions meaning light anaerobic (LAN) and using acetate as carbon source. In that purpose an autoinducer synthase gene (Rru_A3396) knockout mutant was constructed by allelic exchange generating strain M68. In addition phenotypic comparison between wild type (WT) and M68 was performed. Results of thin layer chromatography assay where Agrobacterium tumefaciens NT1 have been used as reporter strain showed that WT produces acyl-homoserine lactones (AHLs) from C4 to C12 acyl carbon chain length; however, in M68 no AHLs were detected confirming that gene Rru_A3396 (named rruI) encodes an autoinducer synthase. Interestingly under a low shear or static environment M68 showed cell aggregation similar as reported in a closely related bacterium Rhodobacter sphaeroides (cerI mutant). In contrast to WT, M68 did not form biofilm and exhibited a decreased motility and pigment content. M68 vs wild type transcriptomics results showed that 326 genes were statistically significant differentially expressed. Downregulation of genes related to photosynthesis e.g., reaction center subunits, light harvesting complex and photosynthetic assembly proteins was observed. Similar results were obtained for preliminary proteomic analysis. Results obtained showed that in R. rubrum S1H the AHL-based QS system regulates almost 8% of the genome which is linked to biofilm formation among other biological processes described above. Since strain M68 could not be used in compartment II due to its less

  5. Atomic polarizabilities

    International Nuclear Information System (INIS)

    Safronova, M. S.; Mitroy, J.; Clark, Charles W.; Kozlov, M. G.

    2015-01-01

    The atomic dipole polarizability governs the first-order response of an atom to an applied electric field. Atomic polarization phenomena impinge upon a number of areas and processes in physics and have been the subject of considerable interest and heightened importance in recent years. In this paper, we will summarize some of the recent applications of atomic polarizability studies. A summary of results for polarizabilities of noble gases, monovalent, and divalent atoms is given. The development of the CI+all-order method that combines configuration interaction and linearized coupled-cluster approaches is discussed

  6. Atomic polarizabilities

    Energy Technology Data Exchange (ETDEWEB)

    Safronova, M. S. [Department of Physics and Astronomy, University of Delaware, Newark, DE 19716 (United States); Mitroy, J. [School of Engineering, Charles Darwin University, Darwin NT 0909 (Australia); Clark, Charles W. [Joint Quantum Institute, National Institute of Standards and Technology and the University of Maryland, Gaithersburg, Maryland 20899-8410 (United States); Kozlov, M. G. [Petersburg Nuclear Physics Institute, Gatchina 188300 (Russian Federation)

    2015-01-22

    The atomic dipole polarizability governs the first-order response of an atom to an applied electric field. Atomic polarization phenomena impinge upon a number of areas and processes in physics and have been the subject of considerable interest and heightened importance in recent years. In this paper, we will summarize some of the recent applications of atomic polarizability studies. A summary of results for polarizabilities of noble gases, monovalent, and divalent atoms is given. The development of the CI+all-order method that combines configuration interaction and linearized coupled-cluster approaches is discussed.

  7. Atomic physics

    CERN Document Server

    Foot, Christopher J

    2007-01-01

    This text will thoroughly update the existing literature on atomic physics. Intended to accompany an advanced undergraduate course in atomic physics, the book will lead the students up to the latest advances and the applications to Bose-Einstein Condensation of atoms, matter-wave inter-ferometry and quantum computing with trapped ions. The elementary atomic physics covered in the early chapters should be accessible to undergraduates when they are first introduced to the subject. To complement. the usual quantum mechanical treatment of atomic structure the book strongly emphasizes the experimen

  8. Atomic physics

    International Nuclear Information System (INIS)

    Armbruster, P.; Beyer, H.; Bosch, F.; Dohmann, H.D.; Kozhuharov, C.; Liesen, D.; Mann, R.; Mokler, P.H.

    1984-01-01

    The heavy ion accelerator UNILAC is well suited to experiments in the field of atomic physics because, with the aid of high-energy heavy ions atoms can be produced in exotic states - that is, heavy atoms with only a few electrons. Also, in close collisions of heavy ions (atomic number Z 1 ) and heavy target atoms (Z 2 ) short-lived quasi-atomic 'superheavy' systems will be formed - huge 'atoms', where the inner electrons are bound in the field of the combined charge Z 1 + Z 2 , which exceeds by far the charge of the known elements (Z <= 109). Those exotic or transient superheavy atoms delivered from the heavy ion accelerator make it possible to study for the first time in a terrestrial laboratory exotic, but fundamental, processes, which occur only inside stars. Some of the basic research carried out with the UNILAC is discussed. This includes investigation of highly charged heavy atoms with the beam-foil method, the spectroscopy of highly charged slow-recoil ions, atomic collision studies with highly ionised, decelerated ions and investigations of super-heavy quasi-atoms. (U.K.)

  9. Fisiologi dan Gangguan Keseimbangan Natrium, Kalium dan Klorida serta Pemeriksaan Laboratorium

    Directory of Open Access Journals (Sweden)

    Rismawati Yaswir

    2012-09-01

    Full Text Available AbstrakElektrolit adalah senyawa di dalam larutan yang berdisosiasi menjadi partikel yang bermuatan (ion positifatau negatif. Sebagian besar proses metabolisme memerlukan dan dipengaruhi oleh elektrolit. Konsentrasielektrolit yang tidak normal dapat menyebabkan banyak gangguan. Pemeliharaan tekanan osmotik dan distribusibeberapa kompartemen cairan tubuh manusia adalah fungsi utama empat elektrolit mayor, yaitu natrium (Na+,kalium (K+, klorida (Cl-, dan bikarbonat (HCO3-. Pemeriksaan keempat elektrolit mayor tersebut dalam klinisdikenal sebagai ”profil elektrolit. Natrium adalah kation terbanyak dalam cairan ekstrasel, kalium kation terbanyakdalam cairan intrasel dan klorida merupakan anion terbanyak dalam cairan ekstrasel. Jumlah natrium, kalium danklorida dalam tubuh merupakan cermin keseimbangan antara yang masuk terutama dari saluran cerna dan yangkeluar terutama melalui ginjal. Gangguan keseimbangan natrium, kalium dan klorida berupa hipo- dan hiper-. Hipoterjadibila konsentrasi elektrolit tersebut dalam tubuh turun lebih dari beberapa miliekuivalen dibawah nilai normaldan hiper- bila konsentrasinya meningkat diatas normal.Pemeriksaan laboratorium untuk menentukan kadarnatrium, kalium dan klorida adalah dengan metode elektroda ion selektif, spektrofotometer emisi nyala,spektrofotometer atom serapan, spektrofotometri berdasarkan aktivasi enzim, pemeriksaan kadar klorida denganmetode titrasi merkurimeter, dan pemeriksaan kadar klorida dengan metode titrasi kolorimetrik-amperometrik.Kata kunci: elektrolit, keseimbangan, gangguan keseimbanganAbstractElectrolyte is compound in condensation which is disociation become particle which is charged (ionnegative or positive. Most metabolism processes need and influenced by electrolyte. Electrolyte concentrationwhich abnormal can cause many troubles. Conservancy of osmotic pressure and distribution some human beingbody fluid compartment are especial function four major electrolyte, that is natrium (Na

  10. Ultracold atoms on atom chips

    DEFF Research Database (Denmark)

    Krüger, Peter; Hofferberth, S.; Haller, E.

    2005-01-01

    Miniaturized potentials near the surface of atom chips can be used as flexible and versatile tools for the manipulation of ultracold atoms on a microscale. The full scope of possibilities is only accessible if atom-surface distances can be reduced to microns. We discuss experiments in this regime...

  11. Benefits of Applying Predictive Intelligence to the Space Situational Awareness (SSA) Mission

    Science.gov (United States)

    Lane, B.; Mann, B.; Millard, C.

    Recent events have heightened the interest in providing improved Space Situational Awareness (SSA) to the warfighter using novel techniques that are affordable and effective. The current Space Surveillance Network (SSN) detects, tracks, catalogs and identifies artificial objects orbiting earth and provides information on Resident Space Objects (RSO) as well as new foreign launch (NFL) satellites. The reactive nature of the SSN provides little to no warning on changes to the expected states of these RSOs or NFLs. This paper will detail the use of the historical data collected on RSOs to characterize what their steady state is, proactively help identify when changes or anomalies have occurred using a pattern-of-like activity based intelligence approach, and apply dynamic, adaptive mission planning to the observables that lead up to a NFL. Multiple hypotheses will be carried along with the intent or the changes to the steady state to assist the SSN in tasking the various sensors in the network to collect the relevant data needed to help prune the number of hypotheses by assigning likelihood to each of those activities. Depending on the hypothesis and thresholds set, these likelihoods will then be used in turn to alert the SSN operator with changes to the steady state, prioritize additional data collections, and provide a watch list of likely next activities.

  12. BOREAS AFM-08 ECMWF Hourly Surface and Upper Air Data for the SSA and NSA

    Science.gov (United States)

    Viterbo, Pedro; Betts, Alan; Hall, Forrest G. (Editor); Newcomer, Jeffrey A.; Smith, David E. (Technical Monitor)

    2000-01-01

    The Boreal Ecosystem-Atmosphere Study (BOREAS) Airborne Fluxes and Meteorology (AFM)-8 team focused on modeling efforts to improve the understanding of the diurnal evolution of the convective boundary layer over the boreal forest. This data set contains hourly data from the European Center for for Medium-Range Weather Forecasts (ECMWF) operational model from below the surface to the top of the atmosphere, including the model fluxes at the surface. Spatially, the data cover a pair of the points that enclose the rawinsonde sites at Candle Lake, Saskatchewan, in the Southern Study Area (SSA) and Thompson, Manitoba, in the Northern Study Area (NSA). Temporally, the data include the two time periods of 13 May 1994 to 30 Sept 1994 and 01 Mar 1996 to 31 Mar 1997. The data are stored in tabular ASCII files. The number of records in the upper air data files may exceed 20,000, causing a problem for some software packages. The ECMWF hourly surface and upper air data are available from the Earth Observing System Data and Information System (EOSDIS) Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC). The data files are available on a CD-ROM (see document number 20010000884).

  13. Keragaman dan Peran Biologi Arthrophoda pada Sawah Irigasi dan Tegalan

    OpenAIRE

    Suwarno, Suwarno

    2016-01-01

    Penelitian ini bertujuan untuk mengetahui keragaman arthropoda dan peran biologinya pada tanah sawah irigasi dan tegalan. Penelitian ini dilaksanakan di daerah persawahan di daerah Sragen pada bulan Maret – Mei 2016. Metode Penelitian dengan menggunakan pitfall trap atau perangkap jebakan yang diletakkan area persawahan dan tegalan. Teknik pengumpulan data dengan menggunakan purposive sampling. Sampel arthropoda yang diperoleh diidentifikasi dan dianalisis di Laboratorium pendidikan Biologi. ...

  14. Evaluasi Sifat Morpologi dan Teknologi Pengolahan pada Gabah dan Beras

    OpenAIRE

    Santosa, Susilo

    2017-01-01

    Penelitian evaluasi dan beras terhadap mutu dan jumlah hasil ditekankan pada lr36 , lr38 dan Cisadane. Penelitian dilakukan di laboratorium Balai Penelitian Tanaman Pangan Karawang. Hasil studi menunjukkan diantara ketiga varitas, Cisadane mempunyai ukuran dimensi butiran yang lebih besar daripada Ir36 dan Ir38. Di antara ketiga varitas, persen kulit sekam yang tertinggi didapat 23,57 % pada lr38 diikuti 22,32% pada Ir36 dan 19,5% pada Cisadane. Persen beras pecah kulit tertinggi diperoleh pa...

  15. Evaluasi Sifat Morpologi Dan Teknologi Pengolahan Pada Gabah Dan Beras

    OpenAIRE

    Santosa, Susilo

    1982-01-01

    Penelitian evaluasi dan beras terhadap mutu dan jumlah hasil ditekankan pada lr36 , lr38 dan Cisadane. Penelitian dilakukan di laboratorium Balai Penelitian Tanaman Pangan Karawang. Hasil studi menunjukkan diantara ketiga varitas, Cisadane mempunyai ukuran dimensi butiran yang lebih besar daripada Ir36 dan Ir38. Di antara ketiga varitas, persen kulit sekam yang tertinggi didapat 23,57 % pada lr38 diikuti 22,32% pada Ir36 dan 19,5% pada Cisadane. Persen beras pecah kulit tertinggi diperoleh pa...

  16. Forecasting Energy-Related CO2 Emissions Employing a Novel SSA-LSSVM Model: Considering Structural Factors in China

    Directory of Open Access Journals (Sweden)

    Huiru Zhao

    2018-03-01

    Full Text Available Carbon dioxide (CO2 emissions forecasting is becoming more important due to increasing climatic problems, which contributes to developing scientific climate policies and making reasonable energy plans. Considering that the influential factors of CO2 emissions are multiplex and the relationships between factors and CO2 emissions are complex and non-linear, a novel CO2 forecasting model called SSA-LSSVM, which utilizes the Salp Swarm Algorithm (SSA to optimize the two parameters of the least squares support sector machine (LSSVM model, is proposed in this paper. The influential factors of CO2 emissions, including the gross domestic product (GDP, population, energy consumption, economic structure, energy structure, urbanization rate, and energy intensity, are regarded as the input variables of the SSA-LSSVM model. The proposed model is verified to show a better forecasting performance compared with the selected models, including the single LSSVM model, the LSSVM model optimized by the particle swarm optimization algorithm (PSO-LSSVM, and the back propagation (BP neural network model, on CO2 emissions in China from 2014 to 2016. The comparative analysis indicates the SSA-LSSVM model is greatly superior and has the potential to improve the accuracy and reliability of CO2 emissions forecasting. CO2 emissions in China from 2017 to 2020 are forecast combined with the 13th Five-Year Plan for social, economic and energy development. The comparison of CO2 emissions of China in 2020 shows that structural factors significantly affect CO2 emission forecasting results. The average annual growth of CO2 emissions slows down significantly due to a series of policies and actions taken by the Chinese government, which means China can keep the promise that greenhouse gas emissions will start to drop after 2030.

  17. Ubiquitous atom

    International Nuclear Information System (INIS)

    Spruch, G.M.; Spruch, L.

    1974-01-01

    The fundamentals of modern physics, including the basic physics and chemistry of the atom, elementary particles, cosmology, periodicity, and recent advances, are surveyed. The biology and chemistry of the life process is discussed to provide a background for considering the effects of atomic particles on living things. The uses of atomic power in space travel, merchant shipping, food preservation, desalination, and nuclear clocks are explored. (Pollut. Abstr.)

  18. Atomic physics

    International Nuclear Information System (INIS)

    Anon.

    1976-01-01

    Research activities in atomic physics at Lawrence Berkeley Laboratory during 1976 are described. Topics covered include: experiments on stored ions; test for parity violation in neutral weak currents; energy conservation and astrophysics; atomic absorption spectroscopy, atomic and molecular detectors; theoretical studies of quantum electrodynamics and high-z ions; atomic beam magnetic resonance; radiative decay from the 2 3 Po, 2 levels of helium-like argon; quenching of the metastable 2S/sub 1/2/ state of hydrogen-like argon in an external electric field; and lifetime of the 2 3 Po level of helium-like krypton

  19. Dislocations and elementary processes of plasticity in FCC metals: atomic scale simulations; Dislocations et processus elementaires de la plasticite dans les metaux CFC: apports des simulations a l'echelle atomique

    Energy Technology Data Exchange (ETDEWEB)

    Rodney, D

    2000-07-01

    We present atomic-scale simulations of two elementary processes of FCC crystal plasticity. The first study consists in the simulation by molecular dynamics, in a nickel crystal, of the interactions between an edge dislocation and glissile interstitial loops of the type that form under irradiation in displacement cascades. The simulations show various atomic-scale interaction processes leading to the absorption and drag of the loops by the dislocation. These reactions certainly contribute to the formation of the 'clear bands' observed in deformed irradiated materials. The simulations also allow to study quantitatively the role of the glissile loops in irradiation hardening. In particular, dislocation unpinning stresses for certain pinning mechanisms are evaluated from the simulations. The second study consists first in the generalization in three dimensions of the quasi-continuum method (QCM), a multi-scale simulation method which couples atomistic techniques and the finite element method. In the QCM, regions close to dislocation cores are simulated at the atomic-scale while the rest of the crystal is simulated with a lower resolution by means of a discretization of the displacement fields using the finite element method. The QCM is then tested on the simulation of the formation and breaking of dislocation junctions in an aluminum crystal. Comparison of the simulations with an elastic model of dislocation junctions shows that the structure and strength of the junctions are dominated by elastic line tension effects, as is assumed in classical theories. (author)

  20. Contribution to the study of the {sup 31}P, {sup 1}H spin spin coupling constant N. M. R. in three co-ordinated phosphorus compounds. Influence of the bond orientation and of the nature of the substituent around the phosphorus atom; Contribution a l'etude des constantes de couplage {sup 31}P, {sup 1}H en R.M.N. dans les composes organo-phosphores tricoordines. Influence des facteurs geometriques et de la nature des substituants au niveau du phosphore

    Energy Technology Data Exchange (ETDEWEB)

    Robert, J B [Commissariat a l' Energie Atomique, Grenoble (France). Centre d' Etudes Nucleaires

    1969-07-01

    In order to investigate the influence of the configuration at the phosphorus atom and the influence of the substituents attached to the phosphorus atom on the J{sub PH} spin spin coupling constant, we have performed the NMR spectrum analysis of some three coordinated organo-phosphorus compounds. The studied coupling constants are {sup 3}J{sub PH} through P-O-C-H and P-C-C-H fragments and {sup 2}J{sub PH} through P-C-H fragment. The results clearly show that on the NMR time scale, in all the studied compounds (1,3,2-dioxaphospholanes, 1,3,2-dioxaphosphorinanes, 3-phospha-cyclopentene and 4-phosphorinanone) there is no inversion of the bonds around phosphorous. This conclusion held also for secondary phosphines. For a given geometry of the bonds joining the P and H atoms, and a given disposition of the bonds around the phosphorus atom, there is only a little influence of the nature of the substituents on the J{sub PH} spin coupling constants. The geometrical dependence of the {sup 3}J{sub PH} cannot be explained by a 'Karplus law'. There is an influence of the bond disposition around phosphorus. In the case of the {sup 2}J{sub P-C-H}, one can plot a curve {sup 2}J{sub P-C-H} = f({alpha}) (0{<=} {alpha} {<=} 180), {alpha} denote the dihedral angle of the two plane defined the first one by the P, C and H atoms, and the second one by the P-C bond together with the three-fold axis of the bond around phosphorus assuming a regular pyramidal arrangement. The function {sup 2}J{sub P-C-H} = f({alpha}) has two maxima, one for {alpha} = 0 degrees and the other for {alpha} = 180 degrees, and also a minimum for {alpha} = 110 degrees. (author) [French] Ce travail consiste en l'analyse par resonance magnetique nucleaire des constantes de couplage phosphore-proton dans des derives organo-phosphores tricoordines dans un double but: examen de la stabilite des liaisons au niveau du phosphore et etude de l'influence de la disposition des liaisons et de la nature de substituants au

  1. Human Ro60 (SSA2) genomic organization and sequence alterations, examined in cutaneous lupus erythematosus.

    Science.gov (United States)

    Millard, T P; Ashton, G H S; Kondeatis, E; Vaughan, R W; Hughes, G R V; Khamashta, M A; Hawk, J L M; McGregor, J M; McGrath, J A

    2002-02-01

    The Ro 60 kDa protein (Ro60 or SSA2) is the major component of the Ro ribonucleoprotein (Ro RNP) complex, to which an immune response is a specific feature of several autoimmune diseases. The genomic organization and any sequence variation within the DNA encoding Ro60 are unknown. To characterize the Ro60 gene structure and to assess whether any sequence alterations might be associated with serum anti-Ro antibody in subacute cutaneous lupus erythematosus (SCLE), thus potentially providing new insight into disease pathogenesis. The cDNA sequence for Ro60 was obtained from the NCBI database and used for a BLAST search for a clone containing the entire genomic sequence. The intron-exon borders were confirmed by designing intronic primer pairs to flank each exon, which were then used to amplify genomic DNA for automated sequencing from 36 caucasian patients with SCLE (anti-Ro positive) and 49 with discoid LE (DLE, anti-Ro negative), in addition to 36 healthy caucasian controls. Heteroduplex analysis of polymerase chain reaction (PCR) products from patients and controls spanning all Ro60 exons (1-8) revealed a common bandshift in the PCR products spanning exon 7. Sequencing of the corresponding PCR products demonstrated an A > G substitution at nucleotide position 1318-7, within the consensus acceptor splice site of exon 7 (GenBank XM001901). The allele frequencies were major allele A (0.71) and minor allele G (0.29) in 72 control chromosomes, with no significant differences found between SCLE patients, DLE patients and controls. The genomic organization of the DNA encoding the Ro60 protein is described, including a common polymorphism within the consensus acceptor splice site of exon 7. Our delineation of a strategy for the genomic amplification of Ro60 forms a basis for further examination of the pathological functions of the Ro RNP in autoimmune disease.

  2. FITOAKUMULASI LOGAM BERAT TIMBAL,KROM, DAN KADMIUM DARI TANAH MENGGUNAKAN TANAMAN KANGKUNG DARAT (Ipomea reptans poir)

    OpenAIRE

    Asmawati A; Taba, Paulina; Lion, Syarifuddin

    2008-01-01

    ABSTRAK TEKNOSAINS 2009 Telah dilakukan penelitian fioakumulasi spesies logam berat Cd,cr,dan Pb pada tanah tercemar dengan menggunakan tanaman kangkung darat (Ipomoae reptans Poir) pada variasi waktu panen dan konsentrasi masing-masing logam pada media tanaman kangkung tersebut. Hasil analisis ketiga logam dengan spektrofotometer serapan atom menunjukkan bahwa konsentrasi maksimum ketiga logam ini masing-masing adalah ; 1342,01; 1067,55; dan 1627,90 mg/kg berat dengan waktu tanam 21 hari....

  3. Atomic physics

    CERN Document Server

    Born, Max

    1969-01-01

    The Nobel Laureate's brilliant exposition of the kinetic theory of gases, elementary particles, the nuclear atom, wave-corpuscles, atomic structure and spectral lines, electron spin and Pauli's principle, quantum statistics, molecular structure and nuclear physics. Over 40 appendices, a bibliography, numerous figures and graphs.

  4. Early Atomism

    Indian Academy of Sciences (India)

    https://www.ias.ac.in/article/fulltext/reso/015/10/0905-0925. Keywords. Atomic theory; Avogadro's hypothesis; atomic weights; periodic table; valence; molecular weights; molecular formula; isomerism. Author Affiliations. S Ramasesha1. Solid State and Structural Chemistry Unit, Indian Institute of Science, Bangalore 560 012, ...

  5. Atom spectroscopy

    International Nuclear Information System (INIS)

    Kodling, K.

    1981-01-01

    Experiments on atom photoabsorption spectroscopy using synchrotron radiation in the 10-1000 eV range are reviewed. Properties of the necessary synchrotron radiation and the experiment on absorption spectroscopy are briefly described. Comparison with other spectroscopy methods is conducted. Some data on measuring photoabsorption, photoelectron emission and atom mass spectra are presented [ru

  6. Exotic atoms

    International Nuclear Information System (INIS)

    Horvath, D.; Lambrecht, R.M.

    1984-01-01

    This bibliography on exotic atoms covers the years 1939 till 1982. The annual entries are headed by an introduction describing the state of affairs of the branch of science and listing the main applications in quantum electrodynamics, particle physics, nuclear physics, atomic physics, chemical physics and biological sciences. The bibliography includes an author index and a subject index. (Auth.)

  7. The SSB-positive/SSA-negative antibody profile is not associated with key phenotypic features of Sjögren's syndrome

    DEFF Research Database (Denmark)

    Baer, Alan N; McAdams DeMarco, Mara; Shiboski, Stephen C

    2015-01-01

    phenotypic features. Among SICCA participants classified with SS on the basis of the American-European Consensus Group or American College of Rheumatology criteria, only 2% required the anti-SSB-alone test result to meet these criteria. CONCLUSIONS: The presence of anti-SSB, without anti-SSA antibodies, had...... participants, 2061 (63%) had negative anti-SSA/anti-SSB, 1162 (35%) had anti-SSA with or without anti-SSB, and 74 (2%) anti-SSB alone. Key SS phenotypic features were more prevalent and had measures indicative of greater disease activity in those participants with anti-SSA, either alone or with anti-SSB, than...... in those with anti-SSB alone or negative SSA/SSB serology. These between-group differences were highly significant and not explained by confounding by age, race/ethnicity or gender. Participants with anti-SSB alone were comparable to those with negative SSA/SSB serology in their association with these key...

  8. Problems presented by the filtration and sampling of aerosols in the atomic energy programme; Problemes poses par la filtration et le prelevement des aerosols dans le cadre de l'energie atomique

    Energy Technology Data Exchange (ETDEWEB)

    Cochinal, R [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires

    1959-07-01

    The maximum permissible limits for radioactive aerosols are much lower than those for aerosols encountered in the non-nuclear industries. These limits depend on numerous factors such as: nature of the radiation, half-life, etc. The radioactive aerosols can be prepared by various methods. The filtering of the air in high activity laboratories or in plutonium treatment factories necessitates an installation consisting of: - aspiration filters, - extraction filters of very high efficiency (those used for {alpha} emitter cells: designed to be replaced without incurring contamination risks; those used for {gamma} emitter cells: designed to be replaced by remote control). The filtering in nuclear reactors is also effectuated by filter papers: - the G1 reactor with open circuit: the air coolant is entirely filtered at the entry and on leaving; - the G2, G3 and EDF1 reactors with closed circuits: filtering under pressure of a small portion of the coolant gas. (author) [French] Les limites maxima permises des aerosols radioactifs sont beaucoup plus faibles que celles des aerosols rencontres dans l'industrie classique. Elles dependent de nombreux facteurs tel que: nature du rayonnement, periode radioactive, etc... La formation des aerosols radioactifs est de nature diverse. La filtration des laboratoires de haute activite, ou d'usines d'elaboration de plutonium conduit a des types d'installations comportant: - des filtres d'aspiration; - des filtres d'extraction a rendement extremement eleve (type pour cellules emettrices {alpha} concu pour etre change sans risque de contamination, type pour cellules emettrices {gamma}: concu pour etre change a distance) La filtration des reacteurs nucleaires sont egalement effectuee par des papiers filtres: - reacteur G1 a circuit ouvert: air de refroidissement totalement filtre a l'aspiration et a l'extraction; - reacteurs G2, G3, EDF1: a circuit ferme: filtration sous pression d'une faible partie du gaz de refroidissement. (auteur)

  9. Atomic fusion, Gerrard atomic fusion

    International Nuclear Information System (INIS)

    Gerrard, T.H.

    1980-01-01

    In the approach to atomic fusion described here the heat produced in a fusion reaction, which is induced in a chamber by the interaction of laser beams and U.H.F. electromagnetic beams with atom streams, is transferred to a heat exchanger for electricity generation by a coolant flowing through a jacket surrounding the chamber. (U.K.)

  10. Liever kraanwater dan bronwater

    NARCIS (Netherlands)

    Kole, A.P.W.

    2011-01-01

    Een test in het Restaurant van de Toekomst van de invloed van CO2-labels op het aankoopgedrag van consumenten, heeft nog geen duidelijk beeld opgeleverd. Wel pakten mensen vaker kraanwater dan bronwater.

  11. Dan Performer Mei Lanfang

    DEFF Research Database (Denmark)

    Risum, Janne

    2010-01-01

    The convention of performing female characters (dan characters) in Beijing opera, as practised by its most prominent male performer of female characters Mei Lanfang, and its and his cultural context and aesthetic aim...

  12. Superradiators created atom by atom

    Science.gov (United States)

    Meschede, Dieter

    2018-02-01

    High radiation rates are usually associated with macroscopic lasers. Laser radiation is “coherent”—its amplitude and phase are well-defined—but its generation requires energy inputs to overcome loss. Excited atoms spontaneously emit in a random and incoherent fashion, and for N such atoms, the emission rate simply increases as N. However, if these atoms are in close proximity and coherently coupled by a radiation field, this microscopic ensemble acts as a single emitter whose emission rate increases as N2 and becomes “superradiant,” to use Dicke's terminology (1). On page 662 of this issue, Kim et al. (2) show the buildup of coherent light fields through collective emission from atomic radiators injected one by one into a resonator field. There is only one atom ever in the cavity, but the emission is still collective and superradiant. These results suggest another route toward thresholdless lasing.

  13. Dislocation glide in Ni-Al solid solutions from the atomic scale up: a molecular dynamics study; Etude du glissement des dislocations dans la solution solide Ni-Al par simulation a l'echelle atomique

    Energy Technology Data Exchange (ETDEWEB)

    Rodary, E

    2003-01-01

    The glide of an edge dislocation in solid solutions is studied by molecular dynamics, at fixed temperature and imposed external stress. We have optimized an EAM potential for Ni(1 a 8% A1): it well reproduces the lattice expansion, local atomic order, stacking fault energy as a function of composition, as well as the elastic properties of the {gamma}' phase with L1{sub 2} structure. On increasing the stress, the dislocation is first immobile, then glides with a velocity proportional to the stress and the velocity saturates on reaching the transverse sound velocity. However, only beyond a static threshold stress, {sigma}{sub s}, does the dislocation glide a distance large enough to allow macroscopic shear; the linear part of the velocity-stress curve extrapolates to zero at a dynamical threshold stress, {sigma}{sub d}, The friction coefficient, and the threshold stresses ({sigma}{sub s} and {sigma}{sub d}), increase with the A1 concentration and decrease with temperature (300 and 500 K). Close to the critical shear stress, {sigma}{sub s}, the dislocation glide is analysed with a 'stop and go' model. The latter yields the flight velocity between obstacles, the mean obstacle density and the distribution of the waiting time on each obstacle as a function of stress, composition and temperature. The obstacle to the glide is proposed to be the strong repulsion between Al atoms brought into nearest neighbour position by the glide process, and not the dislocation-solute interaction. The microscopic parameters so defined are introduced into a micro-mechanical model, which well reproduces the known behaviour of nickel base solid solutions. (author)

  14. Atomic interferometry

    International Nuclear Information System (INIS)

    Baudon, J.; Robert, J.

    2004-01-01

    Since the theoretical works of L. De Broglie (1924) and the famous experiment of Davisson and Germer (1927), we know that a wave is linked with any particle of mass m by the relation λ = h/(mv), where λ is the wavelength, v the particle velocity and h is the Planck constant. The basic principle of the interferometry of any material particle, atom, molecule or aggregate is simple: using a simple incident wave, several mutually consistent waves (with well-defined relative phases) are generated and controllable phase-shifts are introduced between them in order to generate a wave which is the sum of the previous waves. An interference figure is obtained which consists in a succession of dark and bright fringes. The atomic interferometry is based on the same principle but involves different techniques, different wave equations, but also different beams, sources and correlations which are described in this book. Because of the small possible wavelengths and the wide range of possible atomic interactions, atomic interferometers can be used in many domains from the sub-micron lithography to the construction of sensors like: inertial sensors, gravity-meters, accelerometers, gyro-meters etc. The first chapter is a preliminary study of the space and time diffraction of atoms. The next chapters is devoted to the description of slit, light separation and polarization interferometers, and the last chapter treats of the properties of Bose-Einstein condensates which are interesting in atomic interferometry. (J.S.)

  15. PREFERENSI PEMBIAYAAN USAHA MIKRO DAN KECIL : PERSPEKTIF GENDER DAN ENTREPRENEURABILITY

    Directory of Open Access Journals (Sweden)

    Khaira Amalia Fachrudin

    2013-06-01

    Full Text Available Preferensi pembiayaan dalam perusahaan besar lebih didasarkan pada karakteristik perusahaan tersebut.  Namun dalam usaha mikro dan kecil hal ini mungkin berbeda dan bergantung pada karakteristik pemiliknya seperti gender dan entrepreneurability.   Perbedaan gender mungkin juga membedakan entrepreneurability dan dukungan yang diterima.  Penelitian ini akan menguji apakah terdapat perbedaan preferensi pembiayaan berdasarkan gender, entrepreneurability berdasarkan gender dan berdasarkan preferensi pembiayaan, serta perbedaan dukungan berdasarkan gender.  Sampel dari usaha mikro dan kecil yang bergerak dalam bidang kuliner  diuji dengan uji beda Independent Sample t Test dan kemudian dengan Crosstabulation untuk lebih memperinci hasilnya.  Hasil uji menunjukkan bahwa tidak terdapat perbedaan yang signifikan preferensi pembiayaan berdasarkan gender dan berdasarkan  entrepreneurability, namun entrepreneurability berbeda signifikan berdasarkan gender dan juga ditemukan bahwa dukungan moral, tenaga, dan modal yang diterima pemilik usaha pria dan wanita tidak berbeda signifikan (p value lebih kecil dari 0.05.   Hasil ini menunjukkan bahwa terdapat kesetaraan gender dalam pembiayaan usaha dan entrepreneurability lebih tinggi pada pria.  Pria pemilik usaha juga mendapatkan dukungan tenaga kerja yang lebih banyak daripada wanita.  Dukungan tenaga ini adalah salah satu bentuk  financial bootstrapping karena dapat mengurangi pembiayaan usaha

  16. Atomic politics

    International Nuclear Information System (INIS)

    Skogmar, G.

    1979-01-01

    The authors basic point is that the military and civil sides of atomic energy cannot be separated. The general aim of the book is to analyze both the military and civil branches, and the interdependence between them, of American foreign policy in the atomic field. Atomic policy is seen as one of the most important imstruments of foreign policy which, in turn, is seen against the background of American imperialism in general. Firstly, the book investigates the most important means by which the United States has controlled the development in the nuclear field in other countries. These means include influencing the conditions of access to nuclear resources of various kinds, influencing the flow of technical-economic information and influencing international organizations and treaties bearing on atomic energy. The time period treated is 1945-1973. 1973 is chosen as the end-year of the study mainly because of the new conditions in the whole energy field initiated by the oil crisis in that year. The sources of the empirical work are mainly hearings before the Joint Committee on Atomic Energy of the U.S. Congress and legal material of various kinds. Secondly, the goals of the American policy are analyzed. The goals identified are armament effect, non-proliferation (horizontal), sales, and energy dependence. The relation between the main goals is discussed.The discussion is centered on the interdependence between the military and the civil aspects, conflict and coincidence of various goals, the relation between short-term and long-term goals, and the possibilities of using one goal as pretext for another. Thirdly, some causes of the changes in the atomic policy around 1953 and 1963 are identified. These are the strategic balance, the competitive situation, the capacity (of the American atomic productive apparatus), and the nuclear technological stage. The specific composition of these four factors at the two time-points can explain the changes of policy. (author)

  17. DETEKSI DAN MANAJEMEN REFEEDING SYNDROME

    OpenAIRE

    Darmadi Darmadi; Riska Habriel Ruslie

    2012-01-01

    AbstrakRefeeding syndrome (RFS) dideskripsikan sebagai perubahan biokimiawi, manifestasi klinis dan komplikasi sebagai konsekuensi pemberian nutrisi pada pasien kurang gizi. Refeeding syndrome ini menyebabkan dampak buruk dan kematian. Sindroma ini lebih sering terjadi pada kelompok risiko. Refeeding syndrome merupakan suatu sindroma yang sering tak terdiagnosis oleh karena itu perlu peningkatan pengetahuan dan kesadaran dari tenaga medis untuk mengurangi morbiditas dan mortalitas dari RFS. K...

  18. Atomic secrecy

    International Nuclear Information System (INIS)

    Sweet, W.

    1979-01-01

    An article, The H-Bomb Secret: How We Got It, Why We're Telling It, by Howard Morland was to be published in The Progressive magazine in February, 1979. The government, after learning of the author's and the editors' intention to publish the article and failing to persuade them to voluntarily delete about 20% of the text and all of the diagrams showing how an H-bomb works, requested a court injunction against publication. Acting under the Atomic Energy Act of 1954, US District Court Judge Robert W. Warren granted the government's request on March 26. Events dealing with the case are discussed in this publication. Section 1, Progressive Hydrogen Bomb Case, is discussed under the following: Court Order Blocking Magazine Report; Origins of the Howard Morland Article; Author's Motives, Defense of Publication; and Government Arguments Against Disclosure. Section 2, Access to Atomic Data Since 1939, contains information on need for secrecy during World War II; 1946 Atomic Energy Act and its effects; Soviet A-Bomb and the US H-Bomb; and consequences of 1954 Atomic Energy Act. Section 3, Disputed Need for Atomic Secrecy, contains papers entitled: Lack of Studies on H-Bomb Proliferation; Administration's Position on H-Bombs; and National Security Needs vs Free Press

  19. INOVASI DAN STRATEGI PENCAPAIANNYA

    Directory of Open Access Journals (Sweden)

    Liem Ferryanto

    2009-01-01

    Full Text Available Innovation is the way of life of any institution to profitably sustain its life. It starts with empathy, the ability to reach outside of ourselves and walk in someone else’s shoes, and optimal implementation of the newly advanced technology. Innovation shows its results through continuously hard working efforts known as "10 Thousand Hours Rule". As world uncertainty creates complexity we, instead of predicting, should therefore anticipate the future by creating and managing real options on contingent projects or elements of alternative optimal strategies. This should reflect into our portfolio strategy. Abstract in Bahasa Indonesia: Inovasi merupakan darah bagi suatu institusi untuk bisa hidup berkelanjutan serta menguntungkan. Inovasi berupa penemuan baru secara sistematis yang berawal dari empati, kemampuan untuk melihat dunia melalui mata orang lain, dan pemanfaatan secara optimal kemajuan teknologi yang ada. Inovasi baru menghasilkan buahnya melalui kerja keras, yaitu dengan mengikuti “Aturan 10 Ribu Jam” secara berkesinambungan. Ketidakpastian, interaksi, keterbatasan dan degradasi menciptakan kompleksitas tentang kebutuhan dan solusi di masa depan. Oleh sebab itu daripada meramalkan risiko yang bakal terjadi, kita sebaiknya memasang strategi berupa skenario untuk mereduksi akibat dari risiko masa depan yang tidak kita mengerti. Skenario ini dapat diperoleh lewat penciptaan dan penanganan beberapa pilihan nyata atas semua proyek antisipatif yang ada. Kata kunci: Inovasi, ketidakpastian dan kompleksitas, aturan 10 ribu jam, paradoks strategi, peta jalan, empati, kerja berkesinambungan.

  20. PENGELOLAAN PENELITIAN DAN PENGEMBANGAN KESEHATAN DI THAILAND, MYANMAR, DAN INDIA

    Directory of Open Access Journals (Sweden)

    Anorital, SKM Anorital, SKM

    2012-09-01

    Full Text Available Dalam bulan Januari 1991 yang lalu, Sdr. Anorital, SKM (Ka. Subbag. Pengumpulan dan PengolahanData Badan Litbangkes dan H. Syafwani Mirin, SKM (Ka. Bag. Keuangan Badan Litbangkes memperoleh fellowship dari WHO untuk melakukan studi perbandingan ke institusi-institusi penelitian kesehatan di Thailand,Myanmar, dan India.Berikut di bawah ini tulisan bersangkutan yang menggambarkan secara garis besar pengelolaan penelitian dan pengembangan kesehatan pada masing-masing negara obyek studi. Semoga informasi yang terkandung pada tulisan ini dapat bermanfaat bagi pengembangan Badan Penelitian dan Pengembangan Kesehatan.

  1. Production characteristics of lettuce Lactuca sativa L. in the frame of the first crop tests in the Higher Plant Chamber integrated into the MELiSSA Pilot Plant

    Science.gov (United States)

    Tikhomirova, Natalia; Lawson, Jamie; Stasiak, Michael; Dixon, Mike; Paille, Christel; Peiro, Enrique; Fossen, Arnaud; Godia, Francesc

    Micro-Ecological Life Support System Alternative (MELiSSA) is an artificial closed ecosystem that is considered a tool for the development of a bioregenerative life support system for manned space missions. One of the five compartments of MELiSSA loop -Higher Plant Chamber was recently integrated into the MELiSSA Pilot Plant facility at Universitat Aut`noma deo Barcelona. The main contributions expected by integration of this photosynthetic compartment are oxygen, water, vegetable food production and CO2 consumption. Production characteristics of Lactuca sativa L., as a MELiSSA candidate crop, were investigated in this work in the first crop experiments in the MELiSSA Pilot Plant facility. The plants were grown in batch culture and totaled 100 plants with a growing area 5 m long and 1 m wide in a sealed controlled environment. Several replicates of the experiments were carried out with varying duration. It was shown that after 46 days of lettuce cultivation dry edible biomass averaged 27, 2 g per plant. However accumulation of oxygen in the chamber, which required purging of the chamber, and decrease in the food value of the plants was observed. Reducing the duration of the tests allowed uninterrupted test without opening the system and also allowed estimation of the crop's carbon balance. Results of productivity, tissue composition, nutrient uptake and canopy photosynthesis of lettuce regardless of test duration are discussed in the paper.

  2. Induction of Osmoadaptive Mechanisms and Modulation of Cellular Physiology Help Bacillus licheniformis Strain SSA 61 Adapt to Salt Stress

    Energy Technology Data Exchange (ETDEWEB)

    Paul, Sangeeta; Aggarwal, Chetana; Thakur, Jyoti Kumar; Bandeppa, G. S.; Khan, Md. Aslam; Pearson, Lauren M.; Babnigg, Gyorgy; Giometti, Carol S.; Joachimiak, Andrzej

    2015-01-06

    Bacillus licheniformis strain SSA 61, originally isolated from Sambhar salt lake, was observed to grow even in the presence of 25 % salt stress. Osmoadaptive mechanisms of this halotolerant B. licheniformis strain SSA 61, for long-term survival and growth under salt stress, were determined. Proline was the preferentially accumulated compatible osmolyte. There was also increased accumulation of antioxidants ascorbic acid and glutathione. Among the different antioxidative enzymes assayed, superoxide dismutase played the most crucial role in defense against salt-induced stress in the organism. Adaptation to stress by the organism involved modulation of cellular physiology at various levels. There was enhanced expression of known proteins playing essential roles in stress adaptation, such as chaperones DnaK and GroEL, and general stress protein YfkM and polynucleotide phosphorylase/polyadenylase. Proteins involved in amino acid biosynthetic pathway, ribosome structure, and peptide elongation were also overexpressed. Salt stress-induced modulation of expression of enzymes involved in carbon metabolism was observed. There was up-regulation of a number of enzymes involved in generation of NADH and NADPH, indicating increased cellular demand for both energy and reducing power.

  3. Neurodevelopment in children with and without congenital heart block born to anti-Ro/SSA-positive mothers.

    Science.gov (United States)

    Skog, Amanda; Tingström, Joanna; Salomonsson, Stina; Sonesson, Sven-Erik; Wahren-Herlenius, Marie

    2013-01-01

    To define factors influencing neurodevelopment in children with and without complete congenital heart block (CHB) born to mothers with Ro/SSA autoantibodies. Medical records of a population-based cohort of siblings with (n = 60) and without (n = 54) CHB born 1974-2009 to anti-Ro/SSA-positive mothers were retrieved from children primary healthcare centres and school health services and used to extract data on neurodevelopment. Impaired neurodevelopment was reported in 16% of the children (18/114) during the follow-up time of 13.0 (8.2-17.5) years, median (quartiles). Reported problems included speech (9%), motor (8%) and learning (8%) impairment, attention deficit (5%) and behavioural impairment (4%). Impairment in motor skill development was more common in boys (p influenced by maternal SLE (p influenced by both maternal SLE (p influence neurodevelopment. Follow-up of neurodevelopment should therefore be considered for children with CHB, especially if the mother is diagnosed with SLE. ©2012 The Author(s)/Acta Paediatrica ©2012 Foundation Acta Paediatrica.

  4. BOREAS HYP-8 DEM Data Over The NSA-MSA and SSA-MSA in The AEAC Projection

    Science.gov (United States)

    Knapp, David E.; Hall, Forrest G. (Editor); Wang, Xue-Wen; Band, L. E.; Smith, David E. (Technical Monitor)

    2000-01-01

    These data were derived from the original Digital Elevation Models (DEMs) produced by the Boreal Ecosystem-Atmosphere Study (BOREAS) Hydrology (HYD)-8 team. The original DEMs were in the Universal Transverse Mercator (UTM) projection, while this product is projected in the Albers Equal-Area Conic (AEAC) projection. The pixel size of the data is 100 meters, which is appropriate for the 1:50,000-scale contours from which the DEMs were made. The original data were compiled from information available in the 1970s and 1980s. This data set covers the two Modeling Sub-Areas (MSAs) that are contained within the Southern Study Area (SSA) and the Northern Study Area (NSA). The data are stored in binary, image format files. The DEM data over the NSA-MSA and SSA-MSA in the AEAC projection are available from the Earth Observing System Data and Information System (EOSDIS) Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC). The data files are available on a CD-ROM (see document number 20010000884).

  5. Antimatter atoms

    International Nuclear Information System (INIS)

    Anon.

    1996-01-01

    In january 1996, CERN broadcasted the information of the creation of nine anti-hydrogen atoms, observed through disintegration products. The experimental facility was CERN LEAR ring. An antiproton beam scattered a xenon jet, and the resulting antimatter was first selected by its insensitivity to beam bending magnets. Their disintegration was detected in thin NaI detectors, in which the anti-atoms are at once deprived from their positron. Then, magnetic and time-of-flight spectrometers are used. (D.L.)

  6. Atomic theories

    CERN Document Server

    Loring, FH

    2014-01-01

    Summarising the most novel facts and theories which were coming into prominence at the time, particularly those which had not yet been incorporated into standard textbooks, this important work was first published in 1921. The subjects treated cover a wide range of research that was being conducted into the atom, and include Quantum Theory, the Bohr Theory, the Sommerfield extension of Bohr's work, the Octet Theory and Isotopes, as well as Ionisation Potentials and Solar Phenomena. Because much of the material of Atomic Theories lies on the boundary between experimentally verified fact and spec

  7. Spectral Ly{alpha}, Ly{beta}, and H{alpha} line shapes for the H atom in the presence of a magnetic field in a plasma; Profils des raies spectrales Ly{alpha}, Ly{beta}, et H{alpha} de l'atome H en presence d'un champ magnetique dans un plasma

    Energy Technology Data Exchange (ETDEWEB)

    Nguyen, H; Herman, L [Laboratoire de Recherches Physiques, Faculte des sciences, 9 Quai Saint Bernard, 75 - Paris (France); Drawin, H W [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1967-02-15

    This report contains numerical data of the line shapes of Ly{alpha}, Ly{beta}, and H{alpha} for the following parameters: 1. 10{sup 2} {<=} H [gauss] {<=} 1.2. 10{sup 5} 1. 10{sup 15}{<=} N [cm{sup -3}] {<=} 1. 10{sup 18} cm{sup -3} 1. 10{sup 4} {<=} T [deg. K] {<=} 4. 10{sup 4} where H = magnetic field strength, K = density of plasma ions, T = electron temperature. (authors) [French] Dans ce rapport, on donne les valeurs numeriques des contours des raies spectrales Ly{alpha}, Ly{beta}, et H{alpha} pour les valeurs suivantes des parametres H, N et T 1. 10{sup 2} {<=} H [gauss] {<=} 1.2. 10{sup 5} 1. 10{sup 15}{<=} N [cm{sup -3}] {<=} 1. 10{sup 18} cm{sup -3} 1. 10{sup 4} {<=} T [deg. K] {<=} 4. 10{sup 4} ou H intensite du champ magnetique, N = densite des ions, T = temperature electronique. (auteurs)

  8. Quantification of ion or atom transfer phenomena in materials implanted by nuclear methods; Quantification de phenomenes de transferts ioniques ou atomiques dans des materiaux implantes par la mise en oeuvre de methodes nucleaires

    Energy Technology Data Exchange (ETDEWEB)

    Oudadesse, Hassane [Clermont-Ferrand-2 Univ., 63 - Aubiere (France)

    1998-05-18

    Knowledge of transfer of the constituents of a system from regions of higher to lower concentration is of interest for implanted bio-materials. It allows determining the rate at which this material is integrated in a living material. To evaluate the ossification kinetics and to study the bio-functionality in corals of Ca and Sr, irradiations with a 10{sup 13} n.cm{sup -2}.s{sup -1} was performed, followed by the examination of changes in the localization of these elements. By using PIXE analysis method the distribution of Ca, P, Sr, Zn and Fe in the implant, bone and bone-implant interfaces were determined. Thus, it was shown that resorption of coral in sheep is achieved in 5 months after implantation and is identical to the cortical tissues 4 months after implantation in animals as for instance in hares. We have analyzed the tissues from around the prostheses extracted from patients. The samples were calcined and reduced to powder weighting some milligrams. We have adopted for this study the PIXE analysis method. The samples were irradiated by a proton beam of 3 MeV and about 400 {mu}m diameter. The results show the presence of the elements Ti, Fe, Cr, Ni or Zn according to the type of the implanted prosthesis. This dispersal of the metallic ions and atoms contaminate the tissues. The transfer factors translate the exchanges between bone and the implanted material. The solvatation phenomenon and the electric charge equilibrium explain the transfer order of cations Mg{sup 2+}, Ca{sup 2+} and Sr{sup 2+} and of the anion PO{sub 4}{sup 3-}. We have also determined these factors for the elements Ti, Cr and Ni. An original technique to study the bone bio-functionality was used. Use of phosphate derivatives labelled by {sup 99m}Tc allows obtaining information about the fixation of radioactive tracer. It was found that only after the eighth month at the implantation the neo-formed bone fixes the MDP (methyl diphosphate) labelled by {sup 99m}Tc in a similar way as in the

  9. Atoms stories

    International Nuclear Information System (INIS)

    Radvanyi, P.; Bordry, M.

    1988-01-01

    Physicists from different countries told each evening during one learning week, to an audience of young people, some great discoveries in evoking the difficulties and problems to which the researchers were confronted. From Antiquity to a more recent history, it is a succession of atoms stories. (N.C.)

  10. Atomic physics

    International Nuclear Information System (INIS)

    Held, B.

    1991-01-01

    This general book describes the change from classical physics to quantum physics. The first part presents atom evolution since antiquity and introduces fundamental quantities and elements of relativity. Experiments which have contributed to the evolution of knowledge on matter are analyzed in the second part. Applications of wave mechanics to the study of matter properties are presented in the third part [fr

  11. Kinerja Dan Efisiensi Bank Pemerintah (Bumn) Dan Busn Yang Go Publik Di Indonesia

    OpenAIRE

    Haryanto, Sugeng

    2012-01-01

    Penelitian ini menganalisis kinerja dan tingkat efisiensi bank-bank BUMN dan BUSN yang go Publik di Bursa Efek Indonesia. Sample penelitian ini mengambil tiga bank BUMN Bank BNI 46, Bank Mandiri dan Bank BRI) dan tiga bank BUSN (Bank BCA, Bank Niaga dan Bank Panin) dengan periode analisis tahun 2005-2011. Varibael yang digunakan meliputi ROA, ROE, LAR. LDR, NPL dan BOPO. Tujuan dari penelitian ini adalah melihat dan menganalisis perbedaan kinerja antara Bank BUMN dan BUSN yang go public di...

  12. Kondisi oral higiene dan karies gigi pada vegetarian dan non vegetarian di Maha Vihara Maitreya Medan

    OpenAIRE

    Prawira, Albert

    2011-01-01

    Perbedaan pola makan antara vegetarian dan non vegetarian dapat mempengaruhi kesehatan gigi dan mulut. Tujuan penelitian adalah untuk mengetahui kondisi oral higiene dan karies gigi pada umat vegetarian dan non vegetarian di Maha Vihara Maitreya Medan. Jenis penelitian adalah survei deskriptif. Sampel terdiri atas 74 vegetarian dan 65 non vegetarian. Pemeriksaan oral higiene dan karies gigi masing-masing menggunakan indeks OHIS Greene dan Vermillion dan indeks DMFT Klein, se...

  13. Penjajakan Kadar Logam Berat Pb Pada Tanaman Kangkung Darat (Ipomea reptans Poir) Asal Kecamatan Medan Deli Dan Kangkung Air (Ipomea aquatica Forsk) Asal Kecamatan Sunggal Kota Medan.

    OpenAIRE

    Rumajar, Antonius Theodorus B

    2011-01-01

    Penelitian ini dilakukan di lahan pertanian kangkung darat (Ipomea reptans Poir) asal kecamatan Medan Deli dan kangkung air (Ipomea aquatica Forsk) asal kecamatan Sunggal kota Medan dan Laboratorium Riset dan Teknologi Fakultas Pertanian, Universitas Sumatera Utara Medan yang dilakukan pada bulan Juni 2010 sampai Oktober 2010. Penelitian ini menggunakan alat AAS (Atomic Absorption Spectroscopy) dengan dua (2) kali ulangan berdasarkan metode deskriptif analitik. Hasil penelitian menunjukkan ba...

  14. Ultraviolet radiation (UVR) induces cell-surface Ro/SSA antigen expression by human keratinocytes in vitro: a possible mechanism for the UVR induction of cutaneous lupus lesions

    International Nuclear Information System (INIS)

    Jones, S.K.

    1992-01-01

    Antinuclear antibodies are useful markers of connective tissue disease. In this study, UVB but not UVA induced the expression of Ro/SSA antigen on keratinocyte surfaces in vitro. This expression was also found with the extractable nuclear antigens RnP and Sm, but not with single or double-stranded DNA. The expression was prevented by blocking protein synthesis, suggesting that it was an active process. The results suggest that UVB exposure may result in the expression of Ro/SSA antigen on the surfaces of basal keratinocytes in vivo. This antigen could then bind circulating antibody leading to the cutaneous lesions in neonatal and subacute cutaneous lupus erythematosus. (Author)

  15. An analysis of the potential for achieving the fourth millennium development goal in SSA with domestic resources.

    Science.gov (United States)

    O'Hare, Bernadette; Makuta, Innocent

    2015-02-25

    The importance of good health is reflected in the fact that more than half of the eight Millennium Development Goals (MDGs) are aimed at improving health status. Goal 4 (MDG4) aims to reduce child mortality. The progress indicator for goal 4 is the under-five mortality rate (U5M), with a targeted reduction of two thirds by 2015 from 1990 levels. This paper seeks to compare the time (in years) Sub Saharan African (SSA) countries will take to reach their MDG4 target at the current rate of decline, and the time it could have taken to reach their target if domestic resources had not been lost through illicit financial flows, corruption and servicing of debt since 2000. We estimate the amount by which the Gross Domestic Product (GDP) per capita would increase (in percentage terms) if losses of resource through illicit financial flows, corruption and debt servicing, were reduced. Using the income elasticity of U5M, a metric which reports the percentage change in U5M for a one percent change in GDP per capita, we estimate the potential gains in the annual reduction of the under-five mortality if these resource losses were reduced. At the current rate of reduction in U5M, nine countries out of this sample of 36 SSA countries (25%) will achieve their MDG4 target by 2015. In the absence of the leakages (IFF, corruption and debt service) 30 out of 36 (83%) would reach their MDG4 target by 2015 and all except one country, Zimbabwe would have achieved their MDG4 by 2017 (97%). In view of the uncertainty of the legitimacy of African debts we have also provided results where we excluded debt repayment from our analysis. Most countries would have met MDG4 target by curtailing these outflows. In order to release latent resources in SSA for development, action will be needed both by African countries and internationally. We consider that stemming these outflows, and thereby reducing the need for aid, can be achieved with a more transparent global financial system.

  16. IDE DAN DESAIN

    Directory of Open Access Journals (Sweden)

    Priscilia Yunita Wijaya

    1999-01-01

    Full Text Available We have seen many desain all around our everyday living. Design exist in the form of brochures%2C posters%2C banners%2C signages%2C book covers%2C and etcetera. Some are nice and easy to understand%2C some are ok%2C and some look like they are not fully develop and thought. A word that run across our mind whrn we enjoying a design is idea . A good design almost always associated with a good idea%2C is it tru? This paper is going to discuss about desain and its relationship to idea. Abstract in Bahasa Indonesia : Banyak desain yang diamati dalam kehidupan kita sehari-hari. Desain hadir dalam bentuk brosur%2C poster%2C spanduk%2C tanda-tanda%2C sampul buku%2C dan lain sebagainya. Ada beberapa yang bagus dan mudah untuk dimengerti%2C beberapa yang biasa%2C dan beberapa yang tampak asal dibuat. Sebuah kata yang terlintas dalam pemikiran kita dalam menikmati sebuah desain adalah ide . Sebuah desain yang baik selalu di identikan dengan ide yang baik%2C benarkah hal ini? Apakah desain dan apa hubungannya dengan ide akan dibahas pada tulisan ini.

  17. BOREAS HYD-8 DEM Data Over the NSA-MSA and SSA-MSA in the UTM Projection

    Science.gov (United States)

    Wang, Xue-Wen; Hall, Forrest G. (Editor); Knapp, David E. (Editor); Band, L. E.; Smith, David E. (Technical Monitor)

    2000-01-01

    The BOREAS HYD-8 team focused on describing the scaling behavior of water and carbon flux processes at local and regional scales. These DEMs were produced from digitized contours at a cell resolution of 100 meters. Vector contours of the area were used as input to a software package that interpolates between contours to create a DEM representing the terrain surface. The vector contours had a contour interval of 25 feet. The data cover the BOREAS MSAs of the SSA and NSA and are given in a UTM map projection. Most of the elevation data from which the DEM was produced were collected in the 1970s or 1980s. The data are stored in binary, image format files. The data files are available on a CD-ROM (see document number 20010000884) or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).

  18. Preliminary Modelling of Mass Flux at the Surface of Plant Leaves within the MELiSSA Higher Plant Compartments

    Science.gov (United States)

    Holmberg, Madeleine; Paille, Christel; Lasseur, Christophe

    The ESA project Micro Ecological Life Support System Alternative (MELiSSA) is an ecosystem of micro-organisms and higher plants, constructed with the objective of being operated as a tool to understand artificial ecosystems to be used for a long-term or permanent manned planetary base (e.g. Moon or Mars). The purpose of such a system is to provide for generation of food, water recycling, atmospheric regeneration and waste management within defined standards of quality and reliability. As MELiSSA consists of individual compartments which are connected to each other, the robustness of the system is fully dependent on the control of each compartment, as well as the flow management between them. Quality of consumables and reliability of the ecosystem rely on the knowledge, understanding and control of each of the components. This includes the full understanding of all processes related to the higher plants. To progress in that direction, this paper focuses on the mechanical processes driving the gas and liquid exchanges between the plant leaf and its environment. The process responsible for the mass transfer on the surface of plant leaves is diffusion. The diffusion flux is dependent on the behaviour of the stoma of the leaf and also on the leaf boundary layer (BL). In this paper, the physiology of the leaf is briefly examined in order to relate parameters such as light quality, light quantity, CO2 concentration, temperature, leaf water potential, humidity, vapour pressure deficit (VPD) gradients and pollutants to the opening or closing of stomata. The diffusion process is described theoretically and the description is compared to empirical approaches. The variables of the BL are examined and the effect airflow in the compartment has on the BL is investigated. Also presented is the impact changes in different environmental parameters may have on the fluid exchanges. Finally, some tests, to evaluate the accuracy of the concluded model, are suggested.

  19. Application of indirect immunofluorescent test with an improved HEp-2 substrate tranfected with human Ro60/SSA autoantigens

    International Nuclear Information System (INIS)

    Lv Liangjing; Chen Shunle; Gu Yueying; Shen Nan; Bao Chunde; Wang Yuan; Xue Feng; Ye Peng; Yu Chongzhao

    2006-01-01

    To develop an improved substrate for indirect immunofluorescent test (IIF) to detect anti-Ro/SSA autoantibodies, the human 60-kDa Ro/SSA autoantigens (Ro60) cDNAs were obtained from placental cDNA library using PCR and were cloned into the mammalian expression vectorpEGFP-C1. Then the recombinant plasmids were transfected into HEp-2 cells. We con- firmed the overexpression, localization and antigenicity of fusion proteins in transfected cells by means of fluorescence microscopy, immunoblotting and IIF. HEp-2 and HEp-Ro60 was analyzed by IIF using a panel of 10 precipitinpositive anti-Ro human sera simultaneously. Stable expression of Ro60-GFP (green fluorescent protein) fusion proteins maintained ten more generations. And Ro60-GFP kept the antigenicity of Ro and had its own characteristic immunofluorescent pattern in HEp-Ro60 cells. The transfectants dramatically increased the sensitivity of IIF testing (a mean increase of 6.7-fold in endpoint titer, P<0.01). Eight (8/10) positive an- ti-Ro sera showed characteristic immunofluorescent pattern on HEp-Ro60, including two sera which were antinuclear antibodies (ANA) negative on untransfected HEp-2. IIF-ANA in all healthy sera were negative on HEp-Ro60. As a kind of new substrate of IIF, the Ro60 transfectants can be used to detect anti-Ro antibodies. In addition, transfected HEp-2 cells kept the immunofluorescent property of HEp-2 cells in IIF-ANA tests and could be employed as substrate for the routine IIF-ANA detection. The method improved the sensitivity of IIF-ANA. (authors)

  20. Frequency chain to measure the 2S-8S/8D transitions in atomic hydrogen: measurement of the Rydberg constant in frequency unit; Chaine de frequence optique pour mesurer les transitions 2S-8S/8D dans l'atome d'hydrogene: mesure de la constante de Rydberg en unite de frequence

    Energy Technology Data Exchange (ETDEWEB)

    Nez, F

    1993-10-15

    The aim of this thesis is to make a pure measurement of the frequency of the 2S-8S/8D two-photon transition in atomic hydrogen. In that purpose we have built a frequency chain in which hydrogen frequencies are compared with the difference of two optical standards, the methane stabilized He-Ne laser (3.39 {mu}m) and the iodine stabilized He-Ne laser (633 nm). The radiation from a home made Ti-sapphire laser (TS2) at 778 nm is mixed, in a LiIO{sub 3} crystal, with the one of a auxiliary He-Ne laser at 3.39 {mu}m to produce a synthesized radiation at 633 nm. The frequency of the Ti-sapphire (TS1) laser used for the two photon excitation is 89 GHz away from the one of TS2. To compare these two lasers, we have used a Schottky diode. The two lasers and a microwave radiation at 89 GHz, produced by a Gunn diode, are focused on the Schottky diode. The Gunn diode is phase locked on an ultra-stable quartz oscillator. In this way, we have linked an optical frequency of atomic hydrogen to the cesium clock without interferometry. From our measurements, we have deduced a new value of the Rydberg constant: R{sub {infinity}} equals 109737.3156834 (24) cm{sup -1} with an uncertainty of 2.2 10{sup -11}. Our uncertainty is near the one of the Q.E.D calculations giving the theoretical values of the energy levels. This value, which is currently the most precise available, is in good agreement with the recent result obtained from the 1S-2S and 2S-4D transitions. (author)

  1. Atom-surface potentials and atom interferometry

    International Nuclear Information System (INIS)

    Babb, J.F.

    1998-01-01

    Long-range atom-surface potentials characterize the physics of many actual systems and are now measurable spectroscopically in deflection of atomic beams in cavities or in reflection of atoms in atomic fountains. For a ground state, spherically symmetric atom the potential varies as -1/R 3 near the wall, where R is the atom-surface distance. For asymptotically large distances the potential is weaker and goes as -1/R 4 due to retardation arising from the finite speed of light. This diminished interaction can also be interpreted as a Casimir effect. The possibility of measuring atom-surface potentials using atomic interferometry is explored. The particular cases studied are the interactions of a ground-state alkali-metal atom and a dielectric or a conducting wall. Accurate descriptions of atom-surface potentials in theories of evanescent-wave atomic mirrors and evanescent wave-guided atoms are also discussed. (author)

  2. URGENSI DAN PROSPEK PENGATURAN (IUS CONSTITUENDUM UU TENTANG CONTEMPT OF COURT UNTUK MENEGAKKAN MARTABAT DAN WIBAWA PERADILAN

    Directory of Open Access Journals (Sweden)

    Lilik Mulyadi

    2015-07-01

    Full Text Available UU Contempt of Court merupakan kebutuhan yang bersifat urgent, segera dan mendesak, sehingga perlu dilakukan kajian dan penelitian secara kritis, akademis dan bersifat komprehensif untuk menjaga keluhuran dan menegakkan martabat dan wibawa peradilan.

  3. Epistemologi dan Keterbatasan Teori Gravitasi

    Directory of Open Access Journals (Sweden)

    Erwin Erwin

    2017-08-01

    Full Text Available Peristiwa tentang kecenderungan jatuhnya benda-benda menuju pusat bumi dan keteraturan peredaran planet dan benda-benda langit lainnya dalam tata surya dahulu dianggap dua fenomena yang berbeda. Mekanika benda langit dan mekanika bumi yang sebelumnya merupakan dua pengetahuan yang terpisah, dianggap satu kesatuan oleh Sir Isaac Newton. Newton mengemukakan hukum gravitasi umum yaitu gaya tarik menarik antara dua benda besarnya sebanding dengan massa masing-masing benda dan berbanding terbalik dengan kuadrat jarak antara kedua benda. Hukum gravitasi ini sukses menjalaskan bagaimana benda cendrung jatuh menuju pusat bumi dan peredaran planet dan benda-benda langit lain mengelilingi matahari dalam sistem tata surya. Namun hukum gravitasi Newton ternyata tidak sepenuhnya tepat, beberapa hal dapat dijelaskan dengan hukum relativitas Einstein, namun demikian hukum relativitas Einstein juga dicurigai masih perlu diamandemen agar dapat menjelaskan fenomena alam dengan tepat.

  4. EPISTEMOLOGI DAN KETERBATASAN TEORI GRAVITASI

    Directory of Open Access Journals (Sweden)

    Erwin Erwin

    2017-08-01

    Full Text Available Peristiwa tentang kecenderungan jatuhnya benda-benda menuju pusat bumi dan keteraturan peredaran planet dan benda-benda langit lainnya dalam tata surya dahulu dianggap dua fenomena yang berbeda. Mekanika benda langit dan mekanika bumi yang sebelumnya merupakan dua pengetahuan yang terpisah, dianggap satu kesatuan oleh Sir Isaac Newton. Newton mengemukakan hukum gravitasi umum yaitu gaya tarik menarik antara dua benda besarnya sebanding dengan massa masing-masing benda dan berbanding terbalik dengan kuadrat jarak antara kedua benda. Hukum gravitasi ini sukses menjalaskan bagaimana benda cendrung jatuh menuju pusat bumi dan peredaran planet dan benda-benda langit lain mengelilingi matahari dalam sistem tata surya. Namun hukum gravitasi Newton ternyata tidak sepenuhnya tepat, beberapa hal dapat dijelaskan dengan hukum relativitas Einstein, namun demikian hukum relativitas Einstein juga dicurigai masih perlu diamandemen agar dapat menjelaskan fenomena alam dengan tepat.

  5. Exotic atoms

    International Nuclear Information System (INIS)

    Kunselman, R.

    1993-01-01

    The experiments use a solid hydrogen layer to form muonic hydrogen isotopes that escape into vacuum. The method relies on transfer of the muon from protium to either a deuteron or a triton. The resulting muonic deuterium or muonic tritium will not immediately thermalize because of the very low elastic cross sections, and may be emitted from the surface of the layer. Measurements which detect decay electrons, muonic x-rays, and fusion products have been used to study the processes. A target has been constructed which exploits muonic atom emission in order to learn more about the energy dependence of transfer and muon molecular formation

  6. ISLAM DAN RADIKALISME: Upaya Antisipasi dan Penanggulangannya

    Directory of Open Access Journals (Sweden)

    Idrus Ruslan

    2017-02-01

    Full Text Available Sejak tragedi pemboman WTC tanggal 11 September 2001 yang disusul dengan rangkaian peledakan bom di sejumlah negara, banyak orang non Muslim yang berasumsi bahwa ajaran Islam identik dengan radikalisme. Walaupun assumsi yang berkembang itu dapat dimaklumi, namun keyakinan tersebut tentu saja tidak sepenuhnya benar. Karena meskipun terdapat sekelompok orang Islam yang berbuat radikal, akan tetapi mayoritas Muslim justru bertentangan dengan mereka. Lagi pula, jika dicermati secara mendalam, sesungguhnya Islam sama sekali tidak mentolerir tindakan radikal. Ia adalah agama kasih sayang yang sangat mendodrong penganutnya untuk berbuat baik terhadap orang lain, termasuk kepada orang-orang non-Muslim. Artikel ini menawarkan beberapa upaya strategis dalam mengantisipasi dan menanggulangi bahaya radikalisme-terorisme.

  7. SARANA PENGUJIAAN MUTU MAKANAN PADA BEBERAPA PABRIK MAKANAN YANG MEMPRODUKSI PRODUK OLAHAN HASIL PETERNAKAN DAN PERIKANAN

    Directory of Open Access Journals (Sweden)

    Ani Isnawati

    2012-10-01

    oleh 7 pabrik (30,4 %, Gas Chromatografi dan Spektrofotometer Serapan Atom dimiliki hanya oleh 1 pabrik (4,3%. Untuk uji Mikrobiologi peralatan yang dipunyai pabrik adalah autoclave dan oven dipunyai 12 pabrik (52,2 % dan Laminar air flow hanya dimiliki oleh 2 pabrik  (8, 7 %.

  8. 75 FR 30839 - Privacy Act of 1974; CMS Computer Match No. 2010-03, HHS Computer Match No. 1003, SSA Computer...

    Science.gov (United States)

    2010-06-02

    ... 1974; CMS Computer Match No. 2010-03, HHS Computer Match No. 1003, SSA Computer Match No. 1048, IRS... Services (CMS). ACTION: Notice of renewal of an existing computer matching program (CMP) that has an...'' section below for comment period. DATES: Effective Dates: CMS filed a report of the Computer Matching...

  9. TiSSA pleenum "Sotsiaaltöö kriisi ajal" : mida on sotsiaaltööl pakkuda ja kes saab sellest kasu? / Regina Lind

    Index Scriptorium Estoniae

    Lind, Regina

    2010-01-01

    22.-27. aug. 2010 toimus Tallinna Ülikoolis TiSSA doktorantide eelkonverents ja pleenum. Pleenumil peetud sotsiaalteadlaste ettekannetest. Esinesid: Holger Ziegler, Karin Böllert, Catrin Heite, Hans van Ewijk, Walter Lorenz, Mikko Mäntysaari, Heinz Sünker, Synnöve Karvinen-Niinikoski, Olga Borodkina

  10. DIVERSITAS DAN KERAPATAN MANGROVE, GASTROPODA DAN BIVALVIA DI ESTUARI PERANCAK, BALI

    OpenAIRE

    Susiana; Ali, Syamsu Alam; Rukminasari, Nita

    2011-01-01

    Penelitian ini bertujuan membandingkan diversitas dan kerapatan mangrove dengan kepadatan gastropoda dan bivalvia di mangrove alami dan rehabilitasi. Pengukuran ekosistem mangrove menggunakan transek kuadrat 10 m x 10 m. Kelimpahan dan kepadatan gastropoda dan bialvia menggunakan transek kuadrat berukuran 1 m x 1 m. Analisis nMDS, cluster untuk melihat hubungan karekteristik mangrove alami dan rehabilitasi dianalisis secara deskriptif dan analisis regresi untuk mendetermi...

  11. Atom Skimmers and Atom Lasers Utilizing Them

    Science.gov (United States)

    Hulet, Randall; Tollett, Jeff; Franke, Kurt; Moss, Steve; Sackett, Charles; Gerton, Jordan; Ghaffari, Bita; McAlexander, W.; Strecker, K.; Homan, D.

    2005-01-01

    Atom skimmers are devices that act as low-pass velocity filters for atoms in thermal atomic beams. An atom skimmer operating in conjunction with a suitable thermal atomic-beam source (e.g., an oven in which cesium is heated) can serve as a source of slow atoms for a magneto-optical trap or other apparatus in an atomic-physics experiment. Phenomena that are studied in such apparatuses include Bose-Einstein condensation of atomic gases, spectra of trapped atoms, and collisions of slowly moving atoms. An atom skimmer includes a curved, low-thermal-conduction tube that leads from the outlet of a thermal atomic-beam source to the inlet of a magneto-optical trap or other device in which the selected low-velocity atoms are to be used. Permanent rare-earth magnets are placed around the tube in a yoke of high-magnetic-permeability material to establish a quadrupole or octupole magnetic field leading from the source to the trap. The atoms are attracted to the locus of minimum magnetic-field intensity in the middle of the tube, and the gradient of the magnetic field provides centripetal force that guides the atoms around the curve along the axis of the tube. The threshold velocity for guiding is dictated by the gradient of the magnetic field and the radius of curvature of the tube. Atoms moving at lesser velocities are successfully guided; faster atoms strike the tube wall and are lost from the beam.

  12. DAKWAH DAN PEMBERDAYAAN PEREMPUAN

    Directory of Open Access Journals (Sweden)

    Siti Nurmahyati

    2017-02-01

    Full Text Available Da’wah is an attempt to persuade and influence others in realizing the teachings of Islam, to achieve worldly prosperity and welfare of the hereafter. The success was fueled by propaganda aspects are interrelated, anatara preachers, propaganda material, propaganda strategy, mad’u (target da’wah. The number of women in this country nearly half of people (49.36. therefore, it is important to empower women in da’wah to build their own people in consciousness and religious activities that provide the basics of life prosperous world and hereafter.   Dakwah merupakan suatu upaya untuk mengajak dan mempengaruhi orang lain dalam merealisasikan ajaran Islam, untuk mencapai tujuan kesejahteraan duniawi maupun kesejahteraan ukhrawi. Keberhasilan tersebut pun dipicu oleh berbagai aspek dakwah yang saling terkait, antara juru dakwah, materi dakwah, strategi dakwah, mad’u (sasaran dakwah. Jumlah kaum perempuan di negara ini hampir mencapai separuh dari jumlah masyarakatnya (49,36. Oleh karena itu, sangat penting sekali pemberdayaan perempuan dalam dakwah untuk membangun kaumnya sendiri dalam kesadaran dan aktivitas-aktivitas keagamaan yang memberikan dasar kehidupan sejahtera duniawi dan ukhrawi.

  13. ASIMETRI INFORMASI DAN UNDERPRICING

    Directory of Open Access Journals (Sweden)

    Tety Anggita Safitri

    2013-03-01

    Full Text Available Tujuan penelitian ini adalah untuk menguji pengaruh asimetri informasi terhadap underpricing. Penelitian ini menggunakan sampel 63 perusahaan yang melakukan penawaran umum perdana di Bursa Efek Indonesia dalam kurun waktu 2005-2010. Analisis data menggunakan regresi linier berganda, yaitu menguji proksi asimetri informasi yang terdiri atas ukuran perusahaan, umur perusahaan, proporsi saham yang ditawarkan kepada masyarakat, reputasi underwriter dan reputasi auditor terhadap underpricing. Hasil penelitian ini mengindikasikan bahwa reputasi underwriter dan reputasi auditor berpengaruh terhadap underpricing. Ukuran perusahaan, umur perusahaan dan proporsi saham yang ditawarkan tidak berpengaruh terhadap underpricing.The aim of this research is to examine the effect of assymetric information on underpricing. This research used a sample of 63 companies that make initial public offering on the Indonesia Stock Exchange in the period of 2005-2010. The data analysis is using multiple linear regression, which is testing the proxy of asymmetric information which consists of the firm size, the firm age, the proportion of shares offered to the public, underwriter reputation and auditor reputation on underpricing. This research indicates that underwriter reputation and auditor reputation have a significant effect on underpricing. The firm size, the firm age and the proportion of shares offered to the public have no significant effect on underpricing.

  14. DAMPAK NEGATIF PERKEMBANGAN TEKNOLOGI INFORMATIKA DAN KOMUNIKASI DAN CARA ANTISIFASINYA

    Directory of Open Access Journals (Sweden)

    I Gede Ratnaya

    2011-03-01

    Full Text Available Sampai saat ini perkembangan ilmu pengetahuan telah menghantarkan masyarakat menuju babak baru yaitu babak yang memanfaatkan peralatan-peralatan yang merupakan hasil dari teknologi. Penggunaan tenaga manusia yang semakin hari semakin kecil volumenya sering kali menyebabkan orang kehilangan pekerjaannya karena tugasnya telah tergantikan oleh peralatan atau mesin. Sebagai sarana penyampaian informasi dan komunikasi, komputer bisa dipakai sebagai sarana berinternetan. Lewat internet orang bisa mencari bermacam-macam informasi dan berkomunikasi. Peran yang dapat diberikan oleh aplikasi teknologi informasi ini adalah mendapatkan informasi untuk kehidupan pribadi seperti informasi tentang kesehatan, hobi, rekreasi, dan rohani. Selain memberikan keuntungan, ternyata peralatan teknologi informasi dan komunikasi juga memberikan dampak negatif bagi penggunanya. Dampak negatif tersebut muncul sebagai akibat dari penggunaan yang salah atau tidak bertanggung jawab dari yang menggunakan. Beberapa dampak negatif tersebut adalah 1. Anak lebih banyak menghabiskan waktu menonton TV ketimbang melakukan hal lainnya (seperti belajar dan olah raga, 2. Anak kehilangan kemampuan berbaur dengan masyarakat dan cenderung nyaman dengan kehidupan online, 3 Adanya pelanggaran hak cipta, 4.  Kejahatan di internet, 5. Penyebaran virus komputer, dan 6. Pornografi, perjudian, penipuan, tayangan kekerasan. Adapun cara mengatasi dampak-dampak negatif tersebut adalah : 1. Gunakan teknologi untuk menjalin hubungan dengan orang yang sudah dikenal, 2. Cari komunitas positif  yang sering melakukan pertemuan didunia nyata, 3. Perlunya penegakkan hukum yang berlaku dengan dibentuknya polisi internet, 4. Menghindari pemakaian telepon seluler yang berfitur canggih oleh anak-anak dibawah umur dan lebih mengawasi penggunaan telepon seluler, 5. Perbanyak membaca buku-buku yang bersifat edukatif dan bersifat keimanan serta aplikasi komputer yang bersifat mendidik, dan 6. Perlunya pengaturan

  15. Preparation and characterization of PVA/SSA membranes with Al{sub 2}O{sub 3} nanoparticles for fuel cell applications; Preparacao de caracterizacao de membranas de PVAL/SSA na presenca de nanoparticulas de Al{sub 2}O{sub 3} para aplicacao em celulas de combustivel

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Paula N.; Pires, Alfredo T.N. [Grupo de Estudo em Materiais Polimericos - POLIMAT - UFSC, Florianopolis, SC (Brazil); Catarino, Margarida; Brandao, Lucia; Tanaka, Alfredo; Mendes, Adelio [Faculdade de Engenharia da Universidade do Porto, Porto (Portugal)

    2011-07-01

    In the present study, PVA/SSA membranes were prepared with and without the addition of Al{sub 2}O{sub 3} nanoparticles. Sulfosuccinic acid (SSA) was used as the crosslinking agent. Membranes were prepared with different amounts of SSA (26, 43 and 55 wt.%) and with 5 and 10 wt.% of nanoparticles. Crosslinking was performed at 90 degree C during 1.5 h. Membranes were analyzed by infrared spectroscopy, thermal analysis, water absorption, ion exchange capacity (IEC) and proton conductivity. The results showed that control of the crosslinking conditions, IEC value, water absorption and polymer structure are of significant importance to obtain a set of properties suitable for application in proton exchange membrane fuel cells. (author)

  16. KETERGANTUNGAN ONLINE GAME DAN PENANGANANNYA

    Directory of Open Access Journals (Sweden)

    Ridwan Syahran

    2015-06-01

    Full Text Available Penelitian ini dimaksudkan untuk mengetahui perilaku yang ditimbulkan dari kecanduan bermaian online game pada siswa SMP Negeri 1 Palu yang meliputi faktor-faktor penyebab kecanduan, keadaan psikologis yang ditimbulkan dari kecanduan bermain online game dan dampak-dampak yang ditimbulkan dari kecanduan bermain online game.Pendekatan penelitian ini adalah penelitian kualitatif dengan jenis penelitian studi kasus dengan berdasarkan responden dan informan sebagai bahan sumber data. Dalam proses pengumpulan data digunakan teknik observasi dan wawancara, dimana setelah data diperoleh selanjutnya dianalisis dengan menggunakan analisis deskriptif kualitatif.Berdasarkan hasil penelitian ini, bahwa subyek (RZ dan (MT, kedua subyek penelitian menjadi ketergantungan atau kecanduan untuk bermain online game yang dikarenakan tersedianya beberapa fasilitas pendukung untuk bermain game di rumah, adanya faktor sosial dari pertemanan dengan teman bermain dan keingintahuan yang sangat besar terhadap suatu jenis game. Penanganan ketergantungan game online dengan bantuan dari berbagai pihak terutama pihak sekolah memberikan kepercayaan kepada konselor sekolah atau guru BK untuk mengadakan seminar kepada orang tua siswa tentang game online dan masalah yang akan ditimbulkan, mengatur waktu belajar dan bermain anak, memasukkan materi tentang game online dan dampaknya kepada siswa serta memberikan penyaluran yang baik dalam memilih game yang edukatif serta Menjalin komunikasi interpersonal agar anak dapat terbuka dengan orang tua.

  17. Imobilisasi TiO2 ke dalam Resin Penukar Kation dan Aplikasinya sebagai Fotokatalis dalam Proses Fotoreduksi Ion Hg2+

    Directory of Open Access Journals (Sweden)

    Rosyid Ridho

    2017-03-01

    Full Text Available Abstrak Dalam rangka mengembangkan bahan fotokatalitis TiO2 pada penelitian ini telah dilakukan preparasi fotokatalis TiO2-Resin yang disertai dengan karakterisasi dan uji aktivitas untuk proses fotoreduksi ion Hg(II. Preparasi imobilisasi ini dilakukan dengan metode pertukaran ion yang di ikuti dengan kalsinasi pada suhu tertentu. Pada preparasi telah dipelajari pengaruh konsentrasi Titanium Isopropoksida sebagai sumber ion Ti(IV terhadap TiO2-Resin yang dikarakterisasi dengan menggunakan Difraksi Sinar X (XRD dan Thermografimetri (TGA. Pada proses fotoreduksi ion Hg(II dipelajari pengaruh massa fotokatalis, kadar TiO2 yang terimobilisasi ke dalam resin, konsentrasi Ion Hg(II, dan pengaruh pH. Proses fotoreduksi dilakukan dalam suatu reaktor tertutup yang dilengkapi dengan lampu UV, yaitu dengan cara menyinari campuran yang terdiri dari larutan ion Hg(II dan serbuk fotokatalis TiO2-Resin, disertai dengan pengadukan selama waktu tertentu. Hasil fotoreduksi dihitung berdasarkan selisih antara konsentrasi ion Hg(II awal dengan ion Hg(II yang tak tereduksi. Penentuan konsentrasi ion Hg(II yang tak tereduksi dilakukan dengan menggunakan Spektrofotometer Serapan Atom (SSA teknik pembangkitan uap dingin atau Cold Vapor Atomic Absorption Spectrophotometry(CV-AAS. Hasil preparasi menunjukkan semakin tinggi konsentrasi Titanium Isopropoksida yang ditambahkan pada resin semakin tinggi juga kadar TiO2 yang terbentuk pada TiO2-Resin. Hasil uji fotokatalis menunjukkan bahwa penggunaan fotokatalis TiO¬2-Resin dapat meningkatkan hasil fotoreduksi ion Hg(II yang peningkatannya lebih tinggi dibandingkan TiO2 serbuk. Penambahan fotokatalis dengan massa yang semakin besar menambah efektivitas fotoreduksi terhadap ion Hg(II yang semakin besar, namun jika ditambahkan massa fotokatalis yang lebih tinggi lagi akan menurunkan efektivitas fotoreduksi terhadap ion Hg(II. Kenaikan konsentrasi Hg(II menyebabkan efektivitas fotoreduksi semakin rendah. Pada pH 1-4 terjadi

  18. Contribution to the study of the {sup 31}P, {sup 1}H spin spin coupling constant N. M. R. in three co-ordinated phosphorus compounds. Influence of the bond orientation and of the nature of the substituent around the phosphorus atom; Contribution a l'etude des constantes de couplage {sup 31}P, {sup 1}H en R.M.N. dans les composes organo-phosphores tricoordines. Influence des facteurs geometriques et de la nature des substituants au niveau du phosphore

    Energy Technology Data Exchange (ETDEWEB)

    Robert, J.B. [Commissariat a l' Energie Atomique, Grenoble (France). Centre d' Etudes Nucleaires

    1969-07-01

    In order to investigate the influence of the configuration at the phosphorus atom and the influence of the substituents attached to the phosphorus atom on the J{sub PH} spin spin coupling constant, we have performed the NMR spectrum analysis of some three coordinated organo-phosphorus compounds. The studied coupling constants are {sup 3}J{sub PH} through P-O-C-H and P-C-C-H fragments and {sup 2}J{sub PH} through P-C-H fragment. The results clearly show that on the NMR time scale, in all the studied compounds (1,3,2-dioxaphospholanes, 1,3,2-dioxaphosphorinanes, 3-phospha-cyclopentene and 4-phosphorinanone) there is no inversion of the bonds around phosphorous. This conclusion held also for secondary phosphines. For a given geometry of the bonds joining the P and H atoms, and a given disposition of the bonds around the phosphorus atom, there is only a little influence of the nature of the substituents on the J{sub PH} spin coupling constants. The geometrical dependence of the {sup 3}J{sub PH} cannot be explained by a 'Karplus law'. There is an influence of the bond disposition around phosphorus. In the case of the {sup 2}J{sub P-C-H}, one can plot a curve {sup 2}J{sub P-C-H} = f({alpha}) (0{<=} {alpha} {<=} 180), {alpha} denote the dihedral angle of the two plane defined the first one by the P, C and H atoms, and the second one by the P-C bond together with the three-fold axis of the bond around phosphorus assuming a regular pyramidal arrangement. The function {sup 2}J{sub P-C-H} = f({alpha}) has two maxima, one for {alpha} = 0 degrees and the other for {alpha} = 180 degrees, and also a minimum for {alpha} = 110 degrees. (author) [French] Ce travail consiste en l'analyse par resonance magnetique nucleaire des constantes de couplage phosphore-proton dans des derives organo-phosphores tricoordines dans un double but: examen de la stabilite des liaisons au niveau du phosphore et etude de l'influence de la disposition des liaisons et de la nature de

  19. Atomic reactor thermal engineering

    International Nuclear Information System (INIS)

    Kim, Gwang Ryong

    1983-02-01

    This book starts the introduction of atomic reactor thermal engineering including atomic reaction, chemical reaction, nuclear reaction neutron energy and soon. It explains heat transfer, heat production in the atomic reactor, heat transfer of fuel element in atomic reactor, heat transfer and flow of cooler, thermal design of atomic reactor, design of thermodynamics of atomic reactor and various. This deals with the basic knowledge of thermal engineering for atomic reactor.

  20. Atomic energy

    International Nuclear Information System (INIS)

    Ramanna, R.

    1978-01-01

    Development of nuclear science in India, particularly the research and development work at the Bhabha Atomic Research Centre (BARC), Bombay, is described. Among the wide range of materials developed for specific functions under rigorous conditions are nuclear pure grade uranium, zirconium and beryllium, and conventional materials like aluminium, carbon steel and stainless steels. Radioisotopes are produced and used for tracer studies in various fields. Various types of nuclear gauges and nuclear instruments are produced. Radiations have been used to develop new high yielding groundnut mutants with large kernals. The sterile male technique for pest control and radiosterilization technique to process potatoes, onions and marine foods for storage are ready for exploitation. Processes and equipment have been developed for production of electrolytic hydrogen, electrothermal phosphorus and desalinated water. Indigenously manufactured components and materials are now being used for the nuclear energy programme. Indian nuclear power programme strategy is to build heavy water reactors and to utilise their byproduct plutonium and depleted uranium to feed fast breeder reactors which will produce more fissile material than burnt. Finally a special mention has been made of the manpower development programme of the BARC. BARC has established a training school in 1957 giving advanced training in physics, chemistry and various branches of engineering and metallurgy

  1. Kandungan Tembaga (Cu dan Timbal (Pb pada Lamun Enhalus accoroides dari Perairan Batam, Kepulauan Riau, Indonesia

    Directory of Open Access Journals (Sweden)

    Ismarti Ismarti

    2017-02-01

    Full Text Available The objective of the present study was to analyze the metal content of copper and lead in Enhalus accoroides seagrass in Batam Island waters. Samples of seagrass (E. accoroides were collected from six locations along the western region of Batam Island then dried and performed with acid destruction. The measurements of Cu and Pb in the samples were conducted by Atomic Absorption Spectrophotometer. The result showed that there was an increasing of copper and lead contaminant level on sample E accoroides during two periods in a year.  The Cu level ranged from 0.63 to 46.1 mg/kg, meanwhile, lead level ranged from  2.14 to 10.52mg/kg respectively. The highest accumulation of copper and lead were recorded on leaves, it was reached 10.81 mg/kg and 5.98mg/kg, respectively. Penelitian ini bertujuan menganalisis kandungan logam tembaga (Cu dan timbal (Pb pada lamun Enhalus accoroides di sepanjang perairan barat Pulau Batam. Sampel lamun dikumpulkan dari enam lokasi  kemudian dikeringkan dan dilakukan destruksi dengan asam. Penentuan kadar logam tembaga dan timbal dalam sampel dilakukan dengan spektrometri serapan atom. Hasil penelitian menunjukan adanya peningkatan kadar logam Cu dan Pb pada sampel lamun E. accoroides selama 2 periode sampling dalam 1 tahun. Kadar logam Cu dan Pb pada lamun secara berturut berada pada rentang 0.63-46.1 mg/kg dan 2.14-10.52mg/kg. Akumulasi logam Cu dan Pb dalam lamun E. accoroides tertinggi pada bagian daun sebanyak 10.81 mg/kg Cu dan 5.98 mg/kg Pb.

  2. Effects of the Extraterrestrial Environment on Plants: Recommendations for Future Space Experiments for the MELiSSA Higher Plant Compartment

    Directory of Open Access Journals (Sweden)

    Silje A. Wolff

    2014-05-01

    Full Text Available Due to logistical challenges, long-term human space exploration missions require a life support system capable of regenerating all the essentials for survival. Higher plants can be utilized to provide a continuous supply of fresh food, atmosphere revitalization, and clean water for humans. Plants can adapt to extreme environments on Earth, and model plants have been shown to grow and develop through a full life cycle in microgravity. However, more knowledge about the long term effects of the extraterrestrial environment on plant growth and development is necessary. The European Space Agency (ESA has developed the Micro-Ecological Life Support System Alternative (MELiSSA program to develop a closed regenerative life support system, based on micro-organisms and higher plant processes, with continuous recycling of resources. In this context, a literature review to analyze the impact of the space environments on higher plants, with focus on gravity levels, magnetic fields and radiation, has been performed. This communication presents a roadmap giving directions for future scientific activities within space plant cultivation. The roadmap aims to identify the research activities required before higher plants can be included in regenerative life support systems in space.

  3. Bremsstrahlung in atom-atom collisions

    International Nuclear Information System (INIS)

    Amus'ya, M.Y.; Kuchiev, M.Y.; Solov'ev, A.V.

    1985-01-01

    It is shown that in the collision of a fast atom with a target atom when the frequencies are on the order of the potentials or higher, there arises bremsstrahlung comparable in intensity with the bremsstrahlung emitted by an electron with the same velocity in the field of the target atom. The mechanism by which bremsstrahlung is produced in atom-atom collisions is elucidated. Results of specific calculations of the bremsstrahlung spectra are given for α particles and helium atoms colliding with xenon

  4. GAMBARAN JENIS DAN JUMLAH KONSUMSI FAST FOOD DAN SOFT DRINK PADA MAHASISWA OBESITAS DI UNIVERSITAS HASANUDDIN

    OpenAIRE

    Suryanti, Rut; Jafar, Nurhaedar; Syam, Aminuddin

    2013-01-01

    Konsumsi fast food dan soft drink dapat menyebabkan kelebihan berat badan dan obesitas.Penelitian ini bertujuan untuk mengetahui gambaran jenis dan jumlah zat gizi makro dari konsumsi fast food dan soft drink pada mahasiswa yang obesitas.Jenis penelitian adalah deskriptif, dilaksanakan pada bulan Mei-Juni 2013 di Universitas Hasanuddin dengan jumlah responden 60 orang. Instrument penelitian adalah kuesioner identitas diri dan food frekuensiSemiQuantitatif fast food dan soft drink, food pictur...

  5. PERSEPSI DAN TRANSFORMASI VISI DAN MISI PADA CIVITAS AKADEMIKA STAIN PEKALONGAN

    Directory of Open Access Journals (Sweden)

    Imam Khanafi

    2013-05-01

    Full Text Available Penelitian ini mengukur tingkat persepsi visi dan misi civitas akademika STAIN Pekalongan, dan mengukur juga tingkat implementasi sebagai transformasi visi misi tersebut serta menemukan hubungan antara persepsi dengan implementasinya. Kajian ini memiliki signifikan yang strategis dalam konteks manajemen dan pengembangan Pendidikan di STAIN Pekalongan dan lembaga pendidikan lainnya. Hal ini karena posisi visi dan misi sebagai kerangka acuan (frame of reference yang mengarahkan dan menjelaskan kepada keseluruh unsur civitas akademika dalam setiap program kerjanya.

  6. Validation of IPS Single-Station Analysis (SSA) Using MEXART Routines in Multi-Station Spectra. Comparison with Cross Correlation Function (CCF) Analysis.

    Science.gov (United States)

    Bisi, M. M.; Chang, O.; Gonzalez-Esparza, A.; Fallows, R. A.; Aguilar-Rodriguez, E.

    2017-12-01

    The phenomenon of Interplanetary Scintillation (IPS) occurs from the scattering of radio waves coming from compact radio sources that cross electron density fluctuations in the interplanetary medium. By analyzing these fluctuations in the measurements of flux intensity of galactic (compact) radio sources in a radio telescope, it is possible to infer some properties of structures in the solar wind. Studies based on observations of IPS have provided valuable information on the physics of the internal heliosphere for over 50 years. There are two techniques that provide IPS results: 1) Single-Station Analysis (SSA), where a theoretical model is fitted to the observed spectrum; and 2) Cross-Correlation Function (CCF), where two antennas separated by a few hundred kilometers simultaneously and independently observe the same radio source. In order to combine and complement solar wind speed determinations, it is important to validate the results of these two IPS techniques. In this work we analyze events from previously studied observations from MERLIN (Multi-Element Radio-Linked Interferometer Network) using the CCF methodology. The SSA model fit is applied to these observations and compared with the previous results to validate the two techniques. The objective is to know the behavior of the parameters in cases studied by CCFs that can be implemented in the SSA model. This work studies the capability of SSA model fit to describe complex events in the interplanetary environment and seeks to improve the adjustment of parameters from individual spectra to the theoretical model. The validation of these two methodologies is important to be able to combine data in real time from different radio telescopes which is necessary for the success of the Worldwide Interplanetary Scintillation Stations (WIPSS) Network to monitor solar wind structures using IPS data.

  7. Function of SSA subfamily of Hsp70 within and across species varies widely in complementing Saccharomyces cerevisiae cell growth and prion propagation.

    Directory of Open Access Journals (Sweden)

    Deepak Sharma

    2009-08-01

    Full Text Available The cytosol of most eukaryotic cells contains multiple highly conserved Hsp70 orthologs that differ mainly by their spatio-temporal expression patterns. Hsp70s play essential roles in protein folding, transport or degradation, and are major players of cellular quality control processes. However, while several reports suggest that specialized functions of Hsp70 orthologs were selected through evolution, few studies addressed systematically this issue.We compared the ability of Ssa1p-Ssa4p from Saccharomyces cerevisiae and Ssa5p-Ssa8p from the evolutionary distant yeast Yarrowia lipolytica to perform Hsp70-dependent tasks when expressed as the sole Hsp70 for S. cerevisiae in vivo. We show that Hsp70 isoforms (i supported yeast viability yet with markedly different growth rates, (ii influenced the propagation and stability of the [PSI(+] and [URE3] prions, but iii did not significantly affect the proteasomal degradation rate of CFTR. Additionally, we show that individual Hsp70 orthologs did not induce the formation of different prion strains, but rather influenced the aggregation properties of Sup35 in vivo. Finally, we show that [URE3] curing by the overexpression of Ydj1p is Hsp70-isoform dependent.Despite very high homology and overlapping functions, the different Hsp70 orthologs have evolved to possess distinct activities that are required to cope with different types of substrates or stress situations. Yeast prions provide a very sensitive model to uncover this functional specialization and to explore the intricate network of chaperone/co-chaperone/substrates interactions.

  8. Atomic weight versus atomic mass controversy

    International Nuclear Information System (INIS)

    Holden, N.E.

    1985-01-01

    A problem for the Atomic Weights Commission for the past decade has been the controversial battle over the names ''atomic weight'' and ''atomic mass''. The Commission has considered the arguments on both sides over the years and it appears that this meeting will see more of the same discussion taking place. In this paper, I review the situation and offer some alternatives

  9. Perancangan dan Analisis Redistribution Routing Protocol OSPF dan EIGRP

    Directory of Open Access Journals (Sweden)

    DWI ARYANTA

    2016-02-01

    Full Text Available Abstrak OSPF (Open Shortest Path First dan EIGRP (Enhanced Interior Gateway Routing Protocol adalah dua routing protokol yang banyak digunakan dalam jaringan komputer. Perbedaan karakteristik antar routing protokol menimbulkan masalah dalam pengiriman paket data. Teknik redistribution adalah solusi untuk melakukan komunikasi antar routing protokol. Dengan menggunakan software Cisco Packet Tracer 5.3 pada penelitian ini dibuat simulasi OSPF dan EIGRP yang dihubungkan oleh teknik redistribution, kemudian dibandingkan kualitasnya dengan single routing protokol EIGRP dan OSPF. Parameter pengujian dalam penelitian ini adalah nilai time delay dan trace route. Nilai trace route berdasarkan perhitungan langsung cost dan metric dibandingkan dengan hasil simulasi. Hasilnya dapat dilakukan proses redistribution OSPF dan EIGRP. Nilai delay redistribution lebih baik 1% dibanding OSPF dan 2-3% di bawah EIGRP tergantung kepadatan traffic. Dalam perhitungan trace route redistribution dilakukan 2 perhitungan, yaitu cost untuk area OSPF dan metric pada area EIGRP. Pengambilan jalur utama dan alternatif pengiriman paket berdasarkan nilai cost dan metric yang terkecil, hal ini terbukti berdasarkan perhitungan dan simulasi. Kata kunci: OSPF, EIGRP, Redistribution, Delay, Cost, Metric. Abstract OSPF (Open Shortest Path First and EIGRP (Enhanced Interior Gateway Routing Protocol are two routing protocols are widely used in computer networks. Differences between the characteristics of routing protocols pose a problem in the delivery of data packets. Redistribution technique is the solution for communication between routing protocols. By using the software Cisco Packet Tracer 5.3 in this study were made simulating OSPF and EIGRP redistribution linked by technique, then compared its quality with a single EIGRP and OSPF routing protocols. Testing parameters in this study is the value of the time delay and trace route. Value trace route based on direct calculation of cost

  10. Anisotropy of the Chemical Shift Tensor for Fluorines in UF{sub 6} : Application to the Fluorine Atom Movement Model; Anisotropie du Tenseur de Deplacement Chimique des Fluors dans UF{sub 6}: Application au Modele du Mouvement des Atomes de Fluor; Anizotropiya tenzora khimicheskogo zameshcheniya ftora v UF{sub 6}. Primenenie k modeli dvizheniya atomov ftora; Anisotropia del Tensor de Desplazamiento Quimico de los Atomos de Fluor en el UF{sub 6}: Aplicacion al Modelo del Movimiento de los Atomos de Fluor

    Energy Technology Data Exchange (ETDEWEB)

    Rigny, P. [Centre d' Etudes Nucleaires de Saclay (France)

    1965-10-15

    'uranium poly- cristallin par la resonance magnetique du fluor a ete faite par R. Blinc et coll. a 40 Mc/s. L'auteur rappelle que le spectre obtenu a basse temperature (t < -20 Degree-Sign C) peut s'analyser en une superposition de deux raies, ce qui confirme la structure trouvee par Hoard et Stroupe aux rayons X ou, l'octaedre UF{sub 6} ayant un axe long et deux axes courts, les atomes de fluor se repartissent entre deux types de sites. L'evolution du spectre avec la temperature - coalescence des deux raies - suggere l'existence d'un mouvement des atomes de fluor entre les deux types de sites. En reprenant ces experiences a 56,4 Mc/s et a 94 Mc/s, l'auteur a pu montrer l'existence d'une forte anisotropie axiale du tenseur de deplacement chimique (environ 650 ppm). La raie d'absorption obtenue dans ces conditions pour une poudre est complexe et on est conduit pour l'etudier a envisager une fonction de forme f(h), qui est la probabilite que possede un grain de poudre d'avoir une orientation qui le fait resonner pour la valeur h du champ. En l'absence de mouvement (spectre de basse temperature), la fonction de forme pour chacune des deux raies (correspondant aux deux types de sites) a la forme obtenue pour des atomes tous equivalents. On sait que les parametres des tenseurs de deplacements chimiques renseignent sur le caractere des liaisons chimiques. On est ainsi conduit, par exemple, a attribuer un important caractere ionique (I Asymptotically-Equal-To 1/2) aux liaisons de l'uranium avec les deux atomes de fluor les plus eloignes. En presence de mouvement, la fonction de forme est tres differente et depend du type de mouvement. Pour UF{sub 6}, l'etude de la forme de la raie unique (t > 20 Degree-Sign C) en presence d'anisotropie montre que les atomes de fluor d'une meme molecule s'echangent entre eux, chaque atome passant environ 5 {mu}s a 30 Degree-Sign C dans chacune des positions, avec une energie d'activation d'environ 0,5 eV. (author) [Spanish] R. Blinc y colabs. han

  11. Highly excited atoms

    International Nuclear Information System (INIS)

    Kleppner, D.; Littman, M.G.; Zimmerman, M.L.

    1981-01-01

    Highly excited atoms are often called Rydberg atoms. These atoms have a wealth of exotic properties which are discussed. Of special interest, are the effects of electric and magnetic fields on Rydberg atoms. Ordinary atoms are scarcely affected by an applied electric or magnetic field; Rydberg atoms can be strongly distorted and even pulled apart by a relatively weak electric field, and they can be squeezed into unexpected shapes by a magnetic field. Studies of the structure of Rydberg atoms in electric and magnetic fields have revealed dramatic atomic phenomena that had not been observed before

  12. Laser-assisted atom-atom collisions

    International Nuclear Information System (INIS)

    Roussel, F.

    1984-01-01

    The basic layer-assisted atom-atom collision processes are reviewed in order to get a simpler picture of the main physical facts. The processes can be separated into two groups: optical collisions where only one atom is changing state during the collision, the other acting as a spectator atom, and radiative collisions where the states of the two atoms are changing during the collision. All the processes can be interpreted in terms of photoexcitation of the quasimolecule formed during the collisional process. (author)

  13. ALMA DEEP FIELD IN SSA22: A CONCENTRATION OF DUSTY STARBURSTS IN A z = 3.09 PROTOCLUSTER CORE

    Energy Technology Data Exchange (ETDEWEB)

    Umehata, H.; Ivison, R. J. [European Southern Observatory, Karl-Schwarzschild-Str. 2, D-85748 Garching (Germany); Tamura, Y.; Kohno, K.; Izumi, T.; Makiya, R. [Institute of Astronomy, School of Science, The University of Tokyo, 2-21-1 Osawa, Mitaka, Tokyo 181-0015 (Japan); Alexander, D. M.; Smail, I. [Centre for Extragalactic Astronomy, Department of Physics, Durham University, South Road, Durham DH1 3LE (United Kingdom); Geach, J. E. [Centre for Astrophysics Research, Science and Technology Research Institute, University of Hertfordshire, Hatfield AL10 9AB (United Kingdom); Hatsukade, B.; Kato, Y.; Kawabe, R.; Lee, M.; Matsuda, Y.; Nakanishi, K.; Saito, T. [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan); Hughes, D. H. [Department of astronomy, University of Massachusetts, Amherst, MA 01003 (United States); Ikarashi, S. [Kapteyn Astronomical Institute, University of Groningen, P.O. Box 800, 9700AV Groningen (Netherlands); Kubo, M. [Institute for Cosmic Ray Research, University of Tokyo, 5-1-5 Kashiwa-no-Ha, Kashiwa City, Chiba 277-8582 (Japan); Lehmer, B., E-mail: humehata@eso.org [Department of Physics, University of Arkansas, 226 Physics Building, 835 West Dickson Street, Fayetteville, AR 72701 (United States); and others

    2015-12-10

    We report the results of 1.′5 × 3′ mapping at 1.1 mm with the Atacama Large Millimeter/submillimeter Array toward the central region of the z = 3.09 SSA22 protocluster. By combining our source catalog with archival spectroscopic redshifts, we find that eight submillimeter galaxies (SMGs) with flux densities, S{sub 1.1} {sub mm} = 0.7–6.4 mJy (L{sub IR} ∼ 10{sup 12.1}–10{sup 13.1} L{sub ⊙}) are at z = 3.08–3.10. Not only are these SMGs members of the protocluster, but they in fact reside within the node at the junction of the 50 Mpc scale filamentary three-dimensional structure traced by Lyα emitters in this field. The eight SMGs account for a star formation rate density (SFRD) ∼10 M{sub ⊙} yr{sup −1} Mpc{sup −3} in the node, which is two orders of magnitudes higher than the global SFRD at this redshift. We find that four of the eight SMGs host an X-ray-luminous active galactic nucleus. Our results suggest that the vigorous star formation activity and the growth of supermassive black holes (SMBHs) occurred simultaneously in the densest regions at z ∼ 3, which may correspond to the most active historical phase of the massive galaxy population found in the core of the clusters in the present universe. Two SMGs are associated with Lyα blobs, implying that the two populations coexist in high-density environments for a few cases.

  14. The MELiSSA GreenMOSS Study: Preliminary Design Considerations for a Greenhouse Module on the Lunar Surface

    Science.gov (United States)

    Lobascio, Cesare; Paille, Christel; Lamantea, Matteo Maria; Boscheri, Giorgio; Rossetti, Vittorio

    Extended human presence on an extraterrestrial planetary surface will be made possible by the development of life support systems affordable in the long term. The key elements to support the goal will be the maximization of closure of air and water cycles, as well as the development of cost-effective and reliable hardware, including a careful strategic effort toward reduction of spare parts and consumables. Regenerative life support systems likely represent the final step toward long term sustainability of a space crew, allowing in situ food production and regeneration of organic waste. Referring to the MELiSSA loop, a key element for food production is the Higher Plant Compartment. The paper focuses on the preliminary design of a Greenhouse at the lunar South Pole, as performed within the “Greenhouse Module for Space System” (GreenMOSS) study, under a contract from the European Space Agency. The greenhouse is in support to a relatively small crew for provision of an energetic food complement. Resources necessary for the greenhouse such as water, carbon dioxide and nitrogen are assumed available, as required. The relevant mass and energy balances for incoming resources should be part of future studies, and should help integrate this element with the interfacing MELISSA compartments. Net oxygen production and harvested crop biomass from the greenhouse system will be quantified. This work presents the results of the two major trade-offs performed as part of this study: artificial vs natural illumination and monocrop vs multicrop solutions. Comparisons among possible design solutions were driven by the ALiSSE metric as far as practicable within this preliminary stage, considering mass and power parameters. Finally, the paper presents the mission duration threshold for determining the convenience of the designed solution with respect to other resources provision strategies

  15. Pengaruh Perebusan, Penggaraman Dan Penjemuran Pada Udang Dan Cumi Terhadap Pembentukan 7 Ketokolesterol

    Directory of Open Access Journals (Sweden)

    Rudi Riyanto

    2007-12-01

    Full Text Available Penelitian pengaruh perebusan, penggaraman dan penjemuran pada udang dan cumi terhadap pembentukan 7‑ketokolesterol telah dilakukan. Dalam penelitian ini, udang dan cumi masing ­masing dibagi dalam dua kelompok. Pada kelompok pertama diberikan perlakuan perebusan dalam air, dan pada kelompok kedua diberikan perlakuan perebusan dalam air garam (3% air garam untuk udang dan 20% air garam untuk cumi. Setelah perebusan, dilakukan pengeringan di bawah matahari (udang dikupas dahulu sebelum dijemur. Pengambilan sampel dilakukan saat kondisi segar, setelah direbus dan setelah dijemur. Pengamatan dilakukan terhadap kandungan 7‑ketokolesterol, kolesterol, nilai TBA, dan kadar air. Hasil penelitian menunjukkan bahwa perebusan, penggaraman dan penjemuran berpengaruh terhadap pembentukan 7‑ketokolesterol sampai konsentrasi 20,82 ppm pada udang dan 15,05 ppm pada cumi sebagai konsentrasi tertinggi produk hasil oksidasi kolesterol yang terbentuk. Penelitian ini dapat dijadikan bukti bahwa pemanasan (perebusan dan penjemuran, serta penggaraman berpengaruh dalam proses oksidasi kolesterol pada udang dan cumi.

  16. Code ATOM for calculation of atomic characteristics

    International Nuclear Information System (INIS)

    Vainshtein, L.A.

    1990-01-01

    In applying atomic physics to problems of plasma diagnostics, it is necessary to determine some atomic characteristics, including energies and transition probabilities, for very many atoms and ions. Development of general codes for calculation of many types of atomic characteristics has been based on general but comparatively simple approximate methods. The program ATOM represents an attempt at effective use of such a general code. This report gives a brief description of the methods used, and the possibilities of and limitations to the code are discussed. Characteristics of the following processes can be calculated by ATOM: radiative transitions between discrete levels, radiative ionization and recombination, collisional excitation and ionization by electron impact, collisional excitation and ionization by point heavy particle (Born approximation only), dielectronic recombination, and autoionization. ATOM explores Born (for z=1) or Coulomb-Born (for z>1) approximations. In both cases exchange and normalization can be included. (N.K.)

  17. Gene transcript analysis blood values correlate with {sup 68}Ga-DOTA-somatostatin analog (SSA) PET/CT imaging in neuroendocrine tumors and can define disease status

    Energy Technology Data Exchange (ETDEWEB)

    Bodei, L. [European Institute of Oncology, Division of Nuclear Medicine, Milan (Italy); Kidd, M.; Modlin, I.M.; Drozdov, I. [Wren Laboratories, Branford, CT (United States); Prasad, V. [Charite University Hospital, Department of Nuclear Medicine, Berlin (Germany); Severi, S.; Paganelli, G. [Istituto Scientifico Romagnolo per lo Studio e la Cura dei Tumori (IRST) IRCCS, Nuclear Medicine and Radiometabolic Units, Meldola (Italy); Ambrosini, V. [S. Orsola-Malpighi University Hospital, Nuclear Medicine, Bologna (Italy); Kwekkeboom, D.J.; Krenning, E.P. [Erasmus Medical Center Rotterdam, Nuclear Medicine Department, Rotterdam (Netherlands); Baum, R.P. [Zentralklinik Bad Berka, THERANOSTICS Center for Molecular Radiotherapy and Imaging, Bad Berka (Germany)

    2015-08-15

    Precise determination of neuroendocrine tumor (NET) disease status and response to therapy remains a rate-limiting concern for disease management. This reflects limitations in biomarker specificity and resolution capacity of imaging. In order to evaluate biomarker precision and identify if combinatorial blood molecular markers and imaging could provide added diagnostic value, we assessed the concordance between {sup 68}Ga-somatostatin analog (SSA) positron emission tomography (PET), circulating NET gene transcripts (NETest), chromogranin A (CgA), and Ki-67 in NETs. We utilized two independent patient groups with positive {sup 68}Ga-SSA PET: data set 1 ({sup 68}Ga-SSA PETs undertaken for peptide receptor radionuclide therapy (PRRT), as primary or salvage treatment, n = 27) and data set 2 ({sup 68}Ga-SSA PETs performed in patients referred for initial disease staging or restaging after various therapies, n = 22). We examined the maximum standardized uptake value (SUV{sub max}), circulating gene transcripts, CgA levels, and baseline Ki-67. Regression analyses, generalized linear modeling, and receiver-operating characteristic (ROC) analyses were undertaken to determine the strength of the relationships. SUV{sub max} measured in two centers were mathematically evaluated (regression modeling) and determined to be comparable. Of 49 patients, 47 (96 %) exhibited a positive NETest. Twenty-six (54 %) had elevated CgA (χ{sup 2} = 20.1, p < 2.5 x 10{sup -6}). The majority (78 %) had Ki-67 < 20 %. Gene transcript scores were predictive of imaging with >95 % concordance and significantly correlated with SUV{sub max} (R {sup 2} = 0.31, root-mean-square error = 9.4). The genes MORF4L2 and somatostatin receptors SSTR1, 3, and 5 exhibited the highest correlation with SUV{sub max}. Progressive disease was identified by elevated levels of a quotient of MORF4L2 expression and SUV{sub max} [ROC-derived AUC (R {sup 2} = 0.7, p < 0.05)]. No statistical relationship was identified

  18. Gene transcript analysis blood values correlate with 68Ga-DOTA-somatostatin analog (SSA) PET/CT imaging in neuroendocrine tumors and can define disease status

    International Nuclear Information System (INIS)

    Bodei, L.; Kidd, M.; Modlin, I.M.; Drozdov, I.; Prasad, V.; Severi, S.; Paganelli, G.; Ambrosini, V.; Kwekkeboom, D.J.; Krenning, E.P.; Baum, R.P.

    2015-01-01

    Precise determination of neuroendocrine tumor (NET) disease status and response to therapy remains a rate-limiting concern for disease management. This reflects limitations in biomarker specificity and resolution capacity of imaging. In order to evaluate biomarker precision and identify if combinatorial blood molecular markers and imaging could provide added diagnostic value, we assessed the concordance between 68 Ga-somatostatin analog (SSA) positron emission tomography (PET), circulating NET gene transcripts (NETest), chromogranin A (CgA), and Ki-67 in NETs. We utilized two independent patient groups with positive 68 Ga-SSA PET: data set 1 ( 68 Ga-SSA PETs undertaken for peptide receptor radionuclide therapy (PRRT), as primary or salvage treatment, n = 27) and data set 2 ( 68 Ga-SSA PETs performed in patients referred for initial disease staging or restaging after various therapies, n = 22). We examined the maximum standardized uptake value (SUV max ), circulating gene transcripts, CgA levels, and baseline Ki-67. Regression analyses, generalized linear modeling, and receiver-operating characteristic (ROC) analyses were undertaken to determine the strength of the relationships. SUV max measured in two centers were mathematically evaluated (regression modeling) and determined to be comparable. Of 49 patients, 47 (96 %) exhibited a positive NETest. Twenty-six (54 %) had elevated CgA (χ 2 = 20.1, p < 2.5 x 10 -6 ). The majority (78 %) had Ki-67 < 20 %. Gene transcript scores were predictive of imaging with >95 % concordance and significantly correlated with SUV max (R 2 = 0.31, root-mean-square error = 9.4). The genes MORF4L2 and somatostatin receptors SSTR1, 3, and 5 exhibited the highest correlation with SUV max . Progressive disease was identified by elevated levels of a quotient of MORF4L2 expression and SUV max [ROC-derived AUC (R 2 = 0.7, p < 0.05)]. No statistical relationship was identified between CgA and Ki-67 and no relationship with imaging parameters

  19. CORPORATE IDENTITY SEJARAH DAN APLIKASINYA

    Directory of Open Access Journals (Sweden)

    Christine Suharto Cenadi

    1999-01-01

    Full Text Available In the recent globalization era%2C and the developed market%2C many companies compete to attract consumers to buy their products. One of the keys to compete and survive in this developing market is by creating an image and graphic identity. This paper will discuss about corporate identity%2C image%2C its purpose and applications. Abstract in Bahasa Indonesia : Dalam era globalisasi dewasa ini%2C dan dengan berkembangnya pasar (market%2C banyak perusahaan bersaing untuk menarik perhatian konsumen untuk membeli produknya. Salah satu cara untuk bersaing dan dapat bertahan di dalam pasar yang terus berkembang ini adalah dengan menciptakan suatu image dan identitas graphic. Tulisan ini akan membahas tentang corporate identity%2C image%2C fungsi dan aplikasinya

  20. Profil Sensori dan Nilai Gizi Beberapa Jenis Ikan Patin dan Hibrid Nasutus

    Directory of Open Access Journals (Sweden)

    Theresia Dwi Suryaningrum

    2010-11-01

    Full Text Available Penelitian mengenai profil sensori dan nilai gizi filet patin Siam (Pangasius hypopthalmus, Jambal (Pangasius djambal Bleeker, Pasupati, Nasutus serta hasil silangan Siam dan Nasutus (hibrid Nasutus telah dilakukan. Analisis sensori dilakukan dengan uji pembeda menyeluruh, uji pembeda atribut, uji kesukaan, dan uji rangking. Pengamatan lainnya dilakukan terhadap edible portion dan nilai gizi (proksimat dan profil asam amino. Hasil penelitian menunjukkan bahwa filet patin hibrid Nasutus lebih memiliki kesamaan warna dengan filet patin Nasutus daripada filet patin Siam. W arna daging filet patin hibrid Nasutus berbeda nyata dengan induknya yaitu patin Nasutus dan patin Siam. Panelis lebih menyukai warna filet patin hibrid Nasutus dibandingkan dengan patin Pasupati. Patin hibrid Nasutus mempunyai tekstur yang berbeda nyata dengan Nasutus dan Jambal yang kompak dan padat, tetapi mempunyai kesamaan dengan patin Siam dan Pasupati yang agak kompak dan agak padat. Berdasarkan intensitas warna, hasil uji pembeda atribut dan uji kesukaan, maka secara berturut-turut panelis menyukai filet patin Jambal, Nasutus, hibrid Nasutus, Pasupati, dan Siam. Hibrid Nasutus mempunyai edible portionpaling tinggi (49% dibandingkan dengan patin lainnya tetapi mempunyai kadar air, kadar lemak, dan kadar protein yang lebih rendah dan berbeda nyata dengan induknya (patin Siam dan Nasutus. Patin Siam mengandung asam amino esensial paling tinggi di antara berbagai jenis patin yang diteliti. Profil asam amino patin hibrid Nasutus, Jambal, Pasupati, dan Nasutus hampir sama, kecuali pada patin Siam yang mengandung glisin, leusin, isoleusin, histidin, serin, treonin, dan prolin yang lebih tinggi dibandingkan dengan patin lainnya

  1. MENGENALI GEJALA TINITUS DAN PENATALAKSANAANNYA

    Directory of Open Access Journals (Sweden)

    Dewi Purwita Agustini

    2016-05-01

    Full Text Available Telinga berdenging atau dikenal dalam bahasa medis sebagai tinitus, banyak dikeluhkan sebagai suatu bising atau bunyi yang muncul di kepala tanpa adanya rangsangan dari luar. Adapun keluhan yang dialami ini seperti bunyi mendengung, mendesis, menderu, atau berbagai variasi bunyi yang lain. Tinitus bukanlah penyakit atau sindroma, tapi hanya merupakan gejala yang mungkin berasal dari satu atau sejumlah kelainan. Sebetulnya suara yang terdengar oleh telinga tersebut belum tentu bersifat kelainan atau patologis. Jika orang sehat yang terbukti telinganya normal, berada dalam ruang kedap (anehoic chamber, maka ia akan dapat mendengar berbagai macam suara yang berasal dari berbagai organ tubuhnya sendiri yang memang bekerja setiap saat, contohnya: pernapasan, kontraksi jantung, dan aliran darah. Kenyataannya, dalam kehidupan sehari-hari, suasana yang memungkinkan suara fisiologis atau normal tersebut terdengar oleh seseorang sangat jarang tercipta dan bahkan dalam kamar yang sunyi di malam hari sekalipun. Hal ini dikarenakan, bunyi masking dari lingkungan dengan berintensitas bunyi sekitar 25 – 30 dB. Tinitus baru menjadi gejala jika suara organ tubuh intensitasnya melebihi bunyi masking lingkungan tadi. Tinitus kerap diderita terutama orang pada kelompok usia pertengahan dan usia tua. Menurut data statistic dari pusat kesehatan di Amerika, sekitar 32% orang dewasa pernah mengalami tinitus pada suatu saat tertentu dalam hidupnya, dan 6 % nya sangat menganggu dan cukup sulit disembuhkan. Di Inggris, 17% populasi juga memiliki masalah tinitus. Sayangnya di Indonesia belum ada data statistic yang memadai, namun berdasarkan pengalaman empiris, penderita tinitus cukup banyak dan sering ditemui di tempat praktek, klinik, maupun rumah sakit. Meski tinitus bukanlah keadaan yang membahayakan, munculnya gejala ini pada hampir kebanyakan orang sangat mengganggu dan sering mempengaruhi kualitas hidup dan pekerjaannya. Kata Kunci: Tinitus, berdenging, telinga

  2. Le CRDI dans les Philippines

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI appuie la recherche dans les. Philippines depuis 1972. Le travail qu'y ont accompli des universités et des instituts de recherche vigoureux et la participation active de la société civile ont entraîné d'importantes améliorations dans les domaines de l'agriculture, du suivi de la pauvreté et de la gestion des forêts.

  3. XML specifications DanRIS

    DEFF Research Database (Denmark)

    2009-01-01

    XML specifications for DanRIS (Danish Registration- og InformationsSystem), where the the aim is: Improved exchange of data Improved data processing Ensuring future access to all gathered data from the year 1999 until now......XML specifications for DanRIS (Danish Registration- og InformationsSystem), where the the aim is: Improved exchange of data Improved data processing Ensuring future access to all gathered data from the year 1999 until now...

  4. Ketergantungan Online Game Dan Penanganannya

    OpenAIRE

    Syahran, Ridwan

    2015-01-01

    Penelitian ini dimaksudkan untuk mengetahui perilaku yang ditimbulkan dari kecanduan bermaian online game pada siswa SMP Negeri 1 Palu yang meliputi faktor-faktor penyebab kecanduan, keadaan psikologis yang ditimbulkan dari kecanduan bermain online game dan dampak-dampak yang ditimbulkan dari kecanduan bermain online game.Pendekatan penelitian ini adalah penelitian kualitatif dengan jenis penelitian studi kasus dengan berdasarkan responden dan informan sebagai bahan sumber data. Dalam proses ...

  5. ENERGI DAN DAMPAKNYA TERHADAP LINGKUNGAN

    Directory of Open Access Journals (Sweden)

    I Made Astra

    2010-11-01

    Full Text Available Energi dapat berubah dari satu bentuk ke bentuk yang  lainnya, perubahannya sering mempengaruhi lingkungan dan udara yang kita hirup dengan berbagai cara. Energy kimia dalam bahan bakar fosil diubah menjadi energy panas, mekanik, atau listrik melalui pembakaran dan  ini sebagai penghasil polutan terbesar. Dan dengan demikian pembangkit listrik, kendaraan bermotor, dan kompor adalah penyebab utama terjadinya polusi udara.  Polutan yang dikeluarkan biasanya dikelompokan menjadi  hidrokarbon (HC, nitrogen oksida (NOx, dan  karbon monoksida (CO. Polutan yang dihasilkan pada pembakaran fosil merupakan faktor terbesar terjadinya asap, hujan asam,  pemanasan global dan perubahan iklim.   The conversion of energy from one form to another often affects the environment and the air we breath in many ways. Pollutants are emitted as the chemical energy in fossil fuels is converten to thermal, mechanical, or electrical energy via combustion, and thus power plants, motor vehicles, and even stoves take the blame for air pollution, and  the pollutants released by the vehicles are usually grouped as hydrocarbons (HC, nitrogen oxides (NOx, and carbon monoxide (CO. Pollutans emitted during the combustion of fossil fuels are responsible for smog, acid rain, and global warming and climate change.

  6. Isolasi dan Karakterisasi Ralstonia syzygii

    Directory of Open Access Journals (Sweden)

    Yanuar Danaatmadja

    2009-07-01

    Full Text Available Ralstonia syzygii is one of important pathogens of cloves. This study was aimed at obtaining pure culture of R. syzygi from diseased plant tissue samples. The acterium was isolated from infected clove plantations in Ungaran, Central Java. It had the ability to make clove seedlings show symptoms and then die 41 days after inoculation. The reisolated bacterium also showed its ability to kill clove seedlings after 17 days. The bacterium is gram negative, able to ultilize glucose, sucrose, maltose, mannitol, sorbitol, dulcitol, and glycerol, able to hydrolyze starch, grow well at 27oC, able to catalyze and release water and oxygen from hydrogen peroxyde (H2O2 and aerobically.   Ralstonia syzygii merupakan salah satu patogen penting pada tanaman cengkeh. Penelitian ini dilakukan untuk mendapakan isolat murni R syzygii dari jaringan tanaman terinfeksi. Bakteri diisolasi dari pertanaman cengkeh sakit yang berasal dari daerah Ungaran, Jawa Tengah. Bakteri menunjukkan kemampuan untuk menyebabkan bibit tanaman cangkeh sakit dan kemudian mati 41 hsi. Bakteri hasil reisolasi juga menunjukkan kemampuannya menyebabkan sakit dan kematian pada bibit tanaman cengkeh setelah 17 hsi. Bakteri yang diperoleh bersifat gram negatif, mampu memanfaatkan glukosa, sukrosa, maltosa, manitol, sorbitol, dulsitol, dan gliserol, mampu menghidrolisis pati, tumbuh baik pada suhu 27o C, mampu mengkatalisis dan melepaskan air dan oksigen dari hydrogen peroxide (H2O2 dan bersifat aerob.

  7. Intelligent Sensors for Atomization Processing of Molten Metals and Alloys

    Science.gov (United States)

    1988-06-01

    20ff. 12. Hirleman, Dan E. Particle Sizing by Optical , Nonimaging Techniques. Liquid Particle Size Measurement Techniques, ASTM, 1984, pp. 35ff. 13...sensors are based on electric, electromagnetic or optical principles, the latter being most developed in fields obviously related to atomization. Optical ...beams to observe various interference, diffraction, and heterodyning effects, and to observe, with high signal-to-noise ratio, even weak optical

  8. Atomic fountain and applications

    International Nuclear Information System (INIS)

    Rawat, H.S.

    2000-01-01

    An overview of the development of working of MOT along with the basic principle of laser atom cooling and trapping is given. A technique to separate the cooled and trapped atoms from the MOT using atomic fountain technique will also be covered. The widely used technique for atomic fountain is, first to cool and trap the neutral atoms in MOT and then launch them in the vertical direction, using moving molasses technique. Using 133 Cs atomic fountain clock, time improvement of 2 to 3 order of magnitude over a conventional 133 Cs atomic clock has been observed

  9. Interferometry with atoms

    International Nuclear Information System (INIS)

    Helmcke, J.; Riehle, F.; Witte, A.; Kisters, T.

    1992-01-01

    Physics and experimental results of atom interferometry are reviewed and several realizations of atom interferometers are summarized. As a typical example of an atom interferometer utilizing the internal degrees of freedom of the atom, we discuss the separated field excitation of a calcium atomic beam using four traveling laser fields and demonstrate the Sagnac effect in a rotating interferometer. The sensitivity of this interferometer can be largely increased by use of slow atoms with narrow velocity distribution. We therefore furthermore report on the preparation of a laser cooled and deflected calcium atomic beam. (orig.)

  10. Penskalaan Butir Format Respons Pilihan dan Respons Bebas Berdasarkan Model Rasch dan Partial Credit

    OpenAIRE

    Eko Hariadi

    2007-01-01

    Penelitian melihat pengaruh jumlah parameter butir, kategori respons bebas (RB), pengaruh sampel terhadap akurasi estimasi parameter kemampuan untuk menghasilkan estimasi yang stabil dan pengaruh pembobotan butir RP dan butir RB terhadap kesalahan baku. Penelitian dalam dua tahap, simulasi menggunakan 30 kondisi dengan replikasi 50 dengan variabel panjang tes, jumlah kategori, dan jumlah parameter butir, dan analisis deskriptif, dilanjutkan penerapan penskalaan gabungan butir tipe res...

  11. Metode Sederhana dan Efektif untuk Penghitungan dan Visualisasi Tiga Dimensi (3D) Biofilm Vibriio Cholera

    OpenAIRE

    Kurniawan, Andi; Fadjar, Mohamad; Sukoso, Sukoso; Prihanto, Asep Awaludin

    2015-01-01

    Mikroorganisme yang mampu menghasilkan biofim menimbulkan masalah yang serius dalam bidang kesehatan dan pangan. Penelitian biofim bagi sebagian peneliti sangat identik dengan kerumitan proses penghitungan dan visualisasi penutupan permukaan substrat penempelan bakteri. Penelitian ini ditujukan untuk mengetahui efiiensi metode alternatif untuk menghitung dan memvisualisasikan biofimVibrio cholera. Pada penelitian ini beberapa faktor lingkungan seperti pH, suhu, dan kondisi kultur diujicobakan...

  12. Three-atom clusters

    International Nuclear Information System (INIS)

    Pen'kov, F.M.

    1998-01-01

    The Born-Oppenheimer approximation is used to obtain an equation for the effective interaction in three atoms bound by a single electron. For low binding energies in an 'electron + atom' pair, long-range forces arise between the atoms, leading to bound states when the size of the three-atom cluster is a few tens of angstrom. A system made of alkali-metal atoms is considered as an example

  13. Stable atomic hydrogen: Polarized atomic beam source

    International Nuclear Information System (INIS)

    Niinikoski, T.O.; Penttilae, S.; Rieubland, J.M.; Rijllart, A.

    1984-01-01

    We have carried out experiments with stable atomic hydrogen with a view to possible applications in polarized targets or polarized atomic beam sources. Recent results from the stabilization apparatus are described. The first stable atomic hydrogen beam source based on the microwave extraction method (which is being tested ) is presented. The effect of the stabilized hydrogen gas density on the properties of the source is discussed. (orig.)

  14. Purwarupa Sistem Integrasi Quadcopter dan Mobile Robot

    OpenAIRE

    Dharmawan, Andi; Lusiarta Putera, Christian Antonia

    2012-01-01

    AbstrakQuadcopter, juga dikenal sebagai quadrotor, adalah helikopter dengan empat motor yang dilengkapi dengan  empat buah propeller pada masing-masing motornya yang digunakan untuk terbang dan bermanuver. Pada quadcopter terdapat 3 variabel sudut yang menjadi element utama dalam pengendaliannya yaitu roll, pitch, dan yaw yang diperoleh dari penggabungan sensor accelerometer, gyroscope dan magnetometer dengan metode Direction Cosine Matrix. Pada sistem integrasi mobile robot dan quadcopter, d...

  15. Review Dendrimer : Definisi, Sintesis, Aplikasi Dan Prospektif

    OpenAIRE

    Rahmi, Dwinna

    2013-01-01

    Dendrimer merupakan makrostruktur monodisperse dengan banyak cabang yang homogen dan degree of branching (DB) 100%. Dua cara sintesis dendrimer yaitu convergent dan divergent dilakukan. Convergent dilakukan dengan reaksi kovalen antara dua dan lebih monomer. Divergent dimulai dengan pembentukan inti dilanjutkan dengan pembentukan cabang yang merupakan group fungsional yang aktif. Sejauh ini dendrimer sudah banyak diterapkan pada bidang farmasi yaitu drug delivery dan non farmasi pada proses i...

  16. Rancang Bangun Aplikasi Enkripsi dan Dekripsi Email Dengan Menggunakan Algoritma Advanced Encryption Standard Dan Knapsack

    Directory of Open Access Journals (Sweden)

    Timothy John Pattiasina

    2014-07-01

    Full Text Available Advanced Encryption Standard (AES dan Knapsack adalah dua algoritma enkripsi simetris dan asimetris yang paling sering digunakan. Penelitian ini menganalisa kedua algoritma AES dan algoritma Knapsack. Prototipe aplikasi enkripsi email ini dirancang dengan menggabungkan karateristik algoritma AES dan Knapsack untuk memecahkan masalah keamanan email. Algoritma AES digunakan untuk mengenkripsi dan deskripsi email berupa teks atau file, sedangkan Algoritma Knapsack di gunakan untuk mengenkripsi kunci AES. Enkripsi hybrid yang diterapkan pada aplikasi bertujuan untuk menambah keamanan informasi dalam sebuah jaringan.

  17. KORELASI ANTARA ISLAM DAN EKONOMI

    Directory of Open Access Journals (Sweden)

    Akmal Zainal Abidin

    2015-03-01

    Full Text Available CORELATION BETWEEN ISLAM AND ECONOMY. This paper aims to identifies about the correlation between economic and Islam. Islam is the perfect religion that governs all things in life, including the economy. This is evident with the concept of  well-being which is described in the al-Quran and Sunnah. Basically the goal of every human life is to prosper, although humans make sense of  well- being with a different perspective. Most understand economics assume that welfare is the welfare of  earthly material. But to make sense of well-being with the term al-Falah, is meaning holistic wellbeing and balance between material and spiritual dimensions. al-Quran and Sunnah have taught that the human being will be achieved if  living in balance between material and spiritual. This is because human life does not just stop in the life of this world, but there is still a second life that will be faced by humanity in the hereafter, and well-being will be achieved with the truth is that people can balance the needs of the world and the hereafter, and that is what is taught in Islamic economics. Keywords: Islam, Economy, Prosperity. Tulisan ini bertujuan untuk menjelasakn tentang korelasi antara ekonomi  dan  Islam.  Islam  adalah  agama  yang  sempurna  yang mengatur segala hal dalam kehidupan ini, termasuk juga ekonomi. Hal ini terbukti dengan konsep kesejahteraan yang dipaparkan dalam al-Quran dan Sunnah. Pada dasarnya tujuan hidup setiap manusia adalah untuk mencapai kesejahteraan, meskipun manusia memaknai kesejahteraan dengan perspektif  yang berbeda-beda. Sebagian besar paham ekonomi menganggap bahwa kesejahteraan adalah kesejahteraan material duniawi. Namun Islam memaknai kesejahteraan dengan istilah  Falah  yang  berarti  kesejahteraan  holistik  dan  seimbang antara dimensi material dan spiritual. Al-Quran dan Sunnah telah mengajarkan bahwa kesejahteraan akan tercapai jika manusia menjalani hidup secara seimbang antara material dan

  18. Advances in atomic spectroscopy

    CERN Document Server

    Sneddon, J

    2000-01-01

    This fifth volume of the successful series Advances in Atomic Spectroscopy continues to discuss and investigate the area of atomic spectroscopy.It begins with a description of the use of various atomic spectroscopic methods and applications of speciation studies in atomic spectroscopy. The emphasis is on combining atomic spectroscopy with gas and liquid chromatography. In chapter two the authors describe new developments in tunable lasers and the impact they will have on atomic spectroscopy. The traditional methods of detection, such as photography and the photomultiplier, and how they are being replaced by new detectors is discussed in chapter three. The very active area of glow discharge atomic spectrometry is presented in chapter four where, after a brief introduction and historical review, the use of glow discharge lamps for atomic spectroscopy and mass spectrometry are discussed. Included in this discussion is geometry and radiofrequency power. The future of this source in atomic spectroscopy is also dis...

  19. Atomic and molecular manipulation

    CERN Document Server

    Mayne, Andrew J

    2011-01-01

    Work with individual atoms and molecules aims to demonstrate that miniaturized electronic, optical, magnetic, and mechanical devices can operate ultimately even at the level of a single atom or molecule. As such, atomic and molecular manipulation has played an emblematic role in the development of the field of nanoscience. New methods based on the use of the scanning tunnelling microscope (STM) have been developed to characterize and manipulate all the degrees of freedom of individual atoms and molecules with an unprecedented precision. In the meantime, new concepts have emerged to design molecules and substrates having specific optical, mechanical and electronic functions, thus opening the way to the fabrication of real nano-machines. Manipulation of individual atoms and molecules has also opened up completely new areas of research and knowledge, raising fundamental questions of "Optics at the atomic scale", "Mechanics at the atomic scale", Electronics at the atomic scale", "Quantum physics at the atomic sca...

  20. Microfabricated Waveguide Atom Traps.

    Energy Technology Data Exchange (ETDEWEB)

    Jau, Yuan-Yu [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2017-09-01

    A nanoscale , microfabricated waveguide structure can in - principle be used to trap atoms in well - defined locations and enable strong photon-atom interactions . A neutral - atom platform based on this microfabrication technology will be prealigned , which is especially important for quantum - control applications. At present, there is still no reported demonstration of evanescent - field atom trapping using a microfabricated waveguide structure. We described the capabilities established by our team for future development of the waveguide atom - trapping technology at SNL and report our studies to overcome the technical challenges of loading cold atoms into the waveguide atom traps, efficient and broadband optical coupling to a waveguide, and the waveguide material for high - power optical transmission. From the atomic - physics and the waveguide modeling, w e have shown that a square nano-waveguide can be utilized t o achieve better atomic spin squeezing than using a nanofiber for first time.

  1. Progress in atomic spectroscopy

    International Nuclear Information System (INIS)

    Beyer, H.J.; Kleinpoppen, H.

    1984-01-01

    This book presents reviews by leading experts in the field covering areas of research at the forefront of atomic spectroscopy. Topics considered include the k ordering of atomic structure, multiconfiguration Hartree-Fock calculations for complex atoms, new methods in high-resolution laser spectroscopy, resonance ionization spectroscopy (inert atom detection), trapped ion spectroscopy, high-magnetic-field atomic physics, the effects of magnetic and electric fields on highly excited atoms, x rays from superheavy collision systems, recoil ion spectroscopy with heavy ions, investigations of superheavy quasi-atoms via spectroscopy of electron rays and positrons, impact ionization by fast projectiles, and amplitudes and state parameters from ion- and atom-atom excitation processes

  2. Karakteristik Dan Spektrum Manajemen Pendidikan Islam

    OpenAIRE

    Jannah, Siti Raudhatul

    2013-01-01

    Artikel ini mendiskusikan mengenai manajemen pendidikan Islam, karakteristik, dan spektrumnya. Karakteristik manajemen pendidikan Islam harus didasarkan pada al-Qur'an dan Hadits serta pemikiran rasional yang telah diuji validitasnya. Spektrum manajemen pendidikan Islam meliputi lingkup manajemen personalia pendidikan Islam, manajemen peserta didik pendidikan Islam, maanjemen kurikulum pendidikan Islam, manajemen keuangan pendidikan Islam, manajemen sarana dan prasarana pendidikan Islam, mana...

  3. PRODUKSI NANOFIBER DAN APLIKASINYA DALAM PENGOLAHAN AIR

    OpenAIRE

    Krisnandika, Vania Elita

    2017-01-01

    Abstrak Kebutuhan air meningkat seiring meningkatnya jumlah penduduk dan taraf kehidupan masyarakat. Pembangunan yang dilakukan secara terus-menerus dan sangat cepat di Indonesia mengakibatkan penurunan kualitas air permukaan. Teknologi membran merupakan salah satu teknologi pengolahan air yang menghasilkan produk dengan kualitas tinggi. Membran berstruktur nano, khususnya nanofiber, saat ini menjadi perhatian karena menjawab kebutuhan teknologi filtrasi yang efektif dan hemat biaya. Pr...

  4. DETEKSI DAN MANAJEMEN REFEEDING SYNDROME

    Directory of Open Access Journals (Sweden)

    Darmadi Darmadi

    2012-09-01

    Full Text Available AbstrakRefeeding syndrome (RFS dideskripsikan sebagai perubahan biokimiawi, manifestasi klinis dan komplikasi sebagai konsekuensi pemberian nutrisi pada pasien kurang gizi. Refeeding syndrome ini menyebabkan dampak buruk dan kematian. Sindroma ini lebih sering terjadi pada kelompok risiko. Refeeding syndrome merupakan suatu sindroma yang sering tak terdiagnosis oleh karena itu perlu peningkatan pengetahuan dan kesadaran dari tenaga medis untuk mengurangi morbiditas dan mortalitas dari RFS. Karena alasan tersebut ditulis tinjauan pustaka ini yang akan membahas mengenai patofisiologi, faktor risiko, manifestasi klinis, dan manajemennya.Kata kunci : refeeding syndrome, kurang gizi, hipofosfatemia, dukungan nutrisiAbstractRefeeding syndrome (RFS describel as biochemical changes, clinical manifestations, and complications that can occur as a consequence of feeding a malnourished individual. RFS can result in serious harm and death. RFS more commonly occurs in at-risk populations. Increased awareness amongst healthcare professionals is likely to reduce morbidity and mortality. This review examines the pathophysiology, risk factors, clinical manifestations, and management of RFS.Key word : refeeding syndrome, malnourished, hypophosphatemia, nutritional support

  5. Islam, Media, dan Politik : Sebuah Perdebatan dan Kontempelasi Nilai Berdemokrasi

    Directory of Open Access Journals (Sweden)

    Idil Akbar

    2016-10-01

    Full Text Available Infact, press or media is one of pilar democracy. Media in democracy is a public sphere to communi-cation and makes relation, and a same time as public arena to gain information. But, media also could not release from streotypes and tendency that usually bring of interest, either the owner or ideology. It is meaning media can not released from perspective distorsion, values bias and take a side. Media also effective to become propaganda instrument for a political interest and an ideology. It is seen like how media in US, for example, stereotype of Islam in discourses contradiction and glob-al interest opposition. Then, Islam dominantly identified as doctrine teaches radicalism, fundamen-talism and terorism. Thus, it is often be justification for US to operate the military mission in the name of democracy. Tak dipungkiri pers atau media menjadi salah satu pilar bagi demokrasi. Media dalam demokrasi adalah sebagai ruang bagi publik berkomunikasi dan berinteraksi, sekaligus sarana publik mem-peroleh informasi tentang banyak hal. Namun, media juga tak bisa dilepaskan dari stereotip dan kecenderungan-kecenderungan, yang biasanya membawa kepentingan, baik pemilik maupun ide-ologi. Media karenanya tak lepas dari distorsi perspektif, bias nilai dan berpihak. Media juga efektif menjadi alat propaganda bagi sebuah kepentingan politik dan ideologi, seperti bagaimana media di negara Amerika, misalnya, menstereotipkan Islam dalam analisis pertentangan wacana dan kepent-ingan global. Sehingga, dominan Islam diidentikkan dengan sematan sebagai ajaran yang mengajarkan radikalisme, fundamentalisme dan terorisme. Karenanya pula seringkali menjadi alasan pembenar bagi Amerika untuk menjalankan misi militer atas nama demokrasi.

  6. Atomic Fisher information versus atomic number

    International Nuclear Information System (INIS)

    Nagy, A.; Sen, K.D.

    2006-01-01

    It is shown that the Thomas-Fermi Fisher information is negative. A slightly more sophisticated model proposed by Gaspar provides a qualitatively correct expression for the Fisher information: Gaspar's Fisher information is proportional to the two-third power of the atomic number. Accurate numerical calculations show an almost linear dependence on the atomic number

  7. Musisi Sekuler dan Gerejawi

    Directory of Open Access Journals (Sweden)

    Benny Cristovel

    2007-12-01

    Full Text Available Menjadi seorang musisi tidak sekedar bermain musik atau menyanyi saja. Ada jenjang-jenjang yang akan dilewatidalam dunia musik, yang pada akhirnya setiap musisi dihadapkan kepada tanggung jawab dalam dunia tersebut. Di jaman ini, jika jenjang seorang musisi sudah tahap profesional, maka musik dan bisnis merupakan hal yang tidak terpisahkan. Jadi tidak heran jika ada banyak orang yang memimpikan untuk berkarier dalam bidang musik, bahkan telah men1adicita-cita sejak kecil.Jadi penting bagi musisi gerejawi benar-benar "mengkotakkan dirinya" terhadap persepsi yang dianut oleh musisi sekuler, bukan mencampurkannya. Hal ini sangat esensial, karena musisi gerejawi bukan melayani manusia melainkan oleh anugerah Tuhan dipercayakan pekerjaan ini. Dengan demikian pelayanan sebagai musisi gerejawi tidak tercemar oleh persepsi dari dunia musik sekuler. Selain itu musisi gerejawi dapat merefleksikan Tuhan yang disembahnya kepada dunia sekuler, karena tujuan dari semua yang dilakukannya adalah untuk kemuliaan nama Tuhan.

  8. Atomic-fluorescence spectrophotometry

    International Nuclear Information System (INIS)

    Bakhturova, N.F.; Yudelevich, I.G.

    1975-01-01

    Atomic-fluorescence spectrophotometry, a comparatively new method for the analysis of trace quantities, has developed rapidly in the past ten years. Theoretical and experimental studies by many workers have shown that atomic-fluorescence spectrophotometry (AFS) is capable of achieving a better limit than atomic absorption for a large number of elements. The present review examines briefly the principles of atomic-fluorescence spectrophotometry and the types of fluorescent transition. The excitation sources, flame and nonflame atomizers, used in AFS are described. The limits of detection achieved up to the present, using flame and nonflame methods of atomization are given

  9. La violencia en las mujeres usuarias de los servicios de salud en el IMSS y la SSA Violence in Mexican women using public health services

    OpenAIRE

    Héctor Gómez-Dantés; José Luis Vázquez-Martínez; Sonia B Fernández-Cantón

    2006-01-01

    OBJETIVO: Comparar la prevalencia y determinar los factores de riesgo asociados a la violencia entre las mujeres derechohabientes del IMSS y sin servicios de seguridad social (SSS). MATERIAL Y MÉTODOS: Se analizó la información sobre violencia doméstica de la ENVIM notificada por las mujeres usuarias de los servicios de salud del IMSS y de la población femenina sin servicios de seguridad social SSA y seguro popular. El análisis bivariado y multivariado se realizó en STATA V.7. RESULTADOS: La ...

  10. Komposit Nano TiO2 Dengan PCC, Zeolit atau Karbon Aktif Untuk Menurunkan Total Krom dan Zat Organik Pada Air Limbah Industri Penyamakan Kulit

    Directory of Open Access Journals (Sweden)

    Bumiarto Nugroho Jati

    2012-04-01

    Full Text Available Telah dilakukan penelitian untuk menurunkan total krom dan zat organik pada limbah industri penyamakan kulit dengan menggunakan nano TiO2 yang dikompositkan dengan adsorben karbon aktif, zeolit, dan precipitated calcium carbonate (PCC dalam suatu reaktor fotokatalitik yang disusun secara batch dan dilengkapi dengan 6 buah lampu UV dan magnetic stirrer. Penurunan kadar krom total diukur dengan menggunakan Atomic Absorption Spectro-photometer (AAS dan penurunan zat organik dianalisa dengan menggunakan titrasi permanganatometri. Hasil penelitian menunjukkan pengolahan terbaik untuk penurunan kadar krom total adalah dengan menggunakan komposit TiO2:PCC = 8:2 yang dapat menurunkan total krom hampir 100% pada menit ke-170 dengan konsentrasi awal 214,35 mg/L. Untuk penurunan kadar zat organik, pengolahan terbaik dengan menggunakan komposit TiO2:PCC = 9:1 yang dapat menurunkan kadar zat organik hingga 100% pada menit ke-180. 

  11. PENGELOLAAN ZAKAT OLEH NEGARA DAN SWASTA Studi Efektifitas dan Efisiensi Pengelolaan Zakat Oleh BAZ Dan LAZ Kota Madiun

    Directory of Open Access Journals (Sweden)

    Atik Abidah

    2010-12-01

    Full Text Available Abstraks: Keberadaan lembaga zakat di Indonesia yang diakui oleh perundang-undangan ada dua, yaitu Badan Amil Zakat (BAZ dan Lembaga Amil Zakat (LAZ. BAZ adalah lembaga zakat yang dikelola oleh pemerintah, sedangkan LAZ adalah lembaga yang dikelola oleh masyarakat. Artikel ini merupakan merupakan hasil penelitian lapangan dengan menggunakan pendekatan kualitatif. Data digali langsung dari BAZ Kota Madiun dan LAZ dalam hal ini ada 2 lembaga, yaitu Lembaga Manajemen Infaq (LMI dan Baitul Maal Hidayatullah (BMH. Hasil penelitian BAZ lebih efektif dibanding LAZ, karena BAZ di bawah naungan Pemerintah Kota Madiun dan didukung dengan kebijakan dalam menjalankan progam kerjanya. Sedangkan pada LAZ (LMI dan BMH karena sifatnya mandiri, maka segala sesuatunya akan efektif jika mereka bekerja keras, dan itulah yang selama ini dilakukan oleh LMI dan BMH, sehingga sampai saat ini mereka masih eksis.

  12. INTERAKSI DAN HARMONI UMAT BERAGAMA

    Directory of Open Access Journals (Sweden)

    Joko Tri Haryanto

    2012-05-01

    Masyarakat Singkawang adalah masyarakat yang terdiri atas berbagai kelompok suku bangsa dan agama. Secara historis, masyarakat Singkawang mampu mem­pertahankan harmoni antar agama. Model interaksi sosial yang bersifat asosiatif tampaknya potensial untuk mendukung harmoni di dalam masyarakat. Ber­dasarkan paradigma fungsional-struktural, masyarakat diasumsikan sebagai sistem organik yang memiliki huungan antar bagiannya untuk mempertahankan masyarakat. Interaksi sosial di dalam masyarakat Singkawang dikembangkan melalui interaksi di dalam lingkup keluarga, lingkungan sekitar, aktifitas ekonomi, para pimpinan agama, dan hubungan di dalam lingkup budaya dan tradisi. Meskipun demikian, hubungan antar unsur masyarakat masih kosmopolitan, yang di dalamnya anggota masyarakat kurang aktif dalam mengembangkan harmoni masyarakat.

  13. A Single Atom Antenna

    International Nuclear Information System (INIS)

    Trinter, Florian; Williams, Joshua B; Weller, Miriam; Waitz, Markus; Pitzer, Martin; Voigtsberger, Jörg; Schober, Carl; Kastirke, Gregor; Müller, Christian; Goihl, Christoph; Burzynski, Phillip; Wiegandt, Florian; Wallauer, Robert; Kalinin, Anton; Schmidt, Lothar Ph H; Schöffler, Markus S; Jahnke, Till; Dörner, Reinhard; Chiang, Ying-Chih; Gokhberg, Kirill

    2015-01-01

    Here we demonstrate the smallest possible implementation of an antenna-receiver complex which consists of a single (helium) atom acting as the antenna and a second (neon) atom acting as a receiver. (paper)

  14. ETIKA BISNIS AL-GHAZALI DAN ADAM SMITH DALAM PERSPEKTIF ILMU BISNIS DAN EKONOMI

    Directory of Open Access Journals (Sweden)

    AM. M. Hafidz MS.

    2013-05-01

    Full Text Available Penelitian ini adalah untuk mengeksplorasi: (1 pembangunan etika bisnis yang telah dirumuskan oleh al-Ghazali dan Adam Smith, (2 persamaan dan perbedaan antara dua etika bisnis pria, dan (3 relevansi bisnis mereka etika bisnis modern dunia dan ekonomi. Bisnis etika dibangun oleh al-Ghazali dan Smith di dataran praksis tidak jauh berbeda. Etika bisnis konstruksi dibangun oleh al-Ghazali didasarkan pada prinsip-prinsip seperti orientasi itikad baik tentang dunia dan akhirat, kejujuran, kepentingan pribadi dan social keseimbangan, dan perilaku / perbuatan yang tepat. Di sisi lain, etika bisnis konstruksi dibangun oleh Smith, berdasarkan keadilan, altruisme, keadilan dan liberal (kebebasan ekonomi. Baik etika bisnis yang diperkenalkan oleh kedua sangat relevan untuk menjadi digunakan sebagai bahan pokok acuan dalam etika bisnis modern.

  15. Pengembangan Sistem Otomatisasi AC dan Lampu Menggunakan Fuzzy dan Raspberry Pi

    Directory of Open Access Journals (Sweden)

    Rudy Ariyanto

    2017-11-01

    Full Text Available Otomatisasi AC dan lampu dilakukan untuk menghemat energi yang digunakan pada kehidupan sehari-hari. Dalam pengembangan otomatisasi AC dan lampu perlu menerapkan sebuah perangkat yang memiliki fungsi maksimal dengan harga yang minimal. Raspberry Pi merupakan perangkat atau modul dengan harga rendah yang mampu melakukan komunikasi wireless tanpa bantuan modul lain. Dalam pengembangan otomatisasi AC dan lampu juga diperlukan sebuah metode yang mampu melakukan kontrol terhadap nyala AC dan lampu. Penerapan metode fuzzy dapat dilakukan untuk menghimpun informasi keadaan ruang yang didapat dari sensor untuk menentukan nyala AC dan lampu secara otomatis. Oleh sebab itu pada penelitian ini mengusulkan pengembangan otomatisasi AC dan lampu menggunakan Raspberry Pi dan Fuzzy. Otomatisasi AC dan lampu menggunakan Raspberry Pi yang menerapkan metode Fuzzy dapat menghemat energi hingga 59,87% dalam hal lama waktu nyala AC dan 57,47% untuk lumenasi lampu

  16. Atom chips: mesoscopic physics with cold atoms

    International Nuclear Information System (INIS)

    Krueger, P.; Wildermuth, S.; Hofferberth, S.; Haller, E.; GAllego Garcia, D.; Schmiedmayer, J.

    2005-01-01

    Full text: Cold neutral atoms can be controlled and manipulated in microscopic potentials near surfaces of atom chips. These integrated micro-devices combine the known techniques of atom optics with the capabilities of well established micro- and nanofabrication technology. In analogy to electronic microchips and integrated fiber optics, the concept of atom chips is suitable to explore the domain of mesoscopic physics with matter waves. We use current and charge carrying structures to form complex potentials with high spatial resolution only microns from the surface. In particular, atoms can be confined to an essentially one-dimensional motion. In this talk, we will give an overview of our experiments studying the manipulation of both thermal atoms and BECs on atom chips. First experiments in the quasi one-dimensional regime will be presented. These experiments profit from strongly reduced residual disorder potentials caused by imperfections of the chip fabrication with respect to previously published experiments. This is due to our purely lithographic fabrication technique that proves to be advantageous over electroplating. We have used one dimensionally confined BECs as an ultra-sensitive probe to characterize these potentials. These smooth potentials allow us to explore various aspects of the physics of degenerate quantum gases in low dimensions. (author)

  17. Sistem Informasi Penjualan dan Pemesanan Layanan Berbasis Web dan SMS Gateway di Petshop "PetZone"

    Directory of Open Access Journals (Sweden)

    Siska Fadhilah Wati

    2013-09-01

    Full Text Available Dewasa ini teknologi informasi sangat membantu dalam dunia bisnis. Kemudahan yang ditawarkan akan menjaring lebih banyak konsumen. Namun, perusahan tingkat menengah seperti PetZone saat ini masih jarang yang menawarkan kemudahan berbelanja atau pemesanan layanan secara online. Oleh karena itu diperlukan sebuah sistem berbasis web di perusahaan PetZone yang dapat memudahkan pemilik dan karyawan dalam apenjualan, pelayanan, dan pemasaran, serta memudahkan pelanggan dalam jual-beli barang dan jasa. Atas dasar masalah tersebut dibangun Sistem Informasi Penjualan dan Pemesanan Layanan Berbasis Web dan SMS Gateway untuk menunjang proses bisnis yang ada. Sistem informasi dibangun menggunakan bahasa pemrograman PHP framework Codeigniter, javascript untuk tampilan yang dinamis, dan database MySQL. Proses pembuatan dan pengembangan Sistem Informasi Penjualan ini menggunakan metode air terjun. Metode air terjun meliputi kebutuhan pengguna, analisis, rancangan, implementasi dan pengujian. Pemodelan Sistem Informasi yang dibangun menggunakan metode berorientasi objek UML (Unified Modeling Language yang terdiri dari Use case  diagram, Class diagram dan Sequence diagram. Hasil pengujian Sistem Informasi Penjualan dan Pemesanan Layanan Berbasis Web dan SMS Gateway menunjukkan bahwa semua fitur yang terdapat baik dalam sistem informasi maupun SMS gateway dapat bekerja dengan baikdengan ratusan sample data, dan server SMS gateway dapat memproses lebih dari satu SMS secara bersamaan. Dalam perkembangan ke depannya nanti, Sistem Informasi Penjualan dan Pemesanan Layanan Berbasis Web dan SMS Gateway masih dapat dikembangkan lagi dengan menambah fitur-fitur pada SMS gateway sehingga lebih memudahkan konsumen.

  18. Quasi-atoms

    International Nuclear Information System (INIS)

    Armbruster, P.

    1976-01-01

    The concept of a quasi-atom is discussed, and several experiments are described in which molecular or quasi-atomic transitions have been observed. X-ray spectra are shown for these experiments in which heavy ion projectiles were incident on various targets and the resultant combined system behaved as a quasi-atom. This rapidly developing field has already given new insight into atomic collision phenomena. (P.J.S.)

  19. Efikasi Kendiri: Perbandingan Antara Islam dan Barat

    Directory of Open Access Journals (Sweden)

    Noornajihan, J.

    2014-12-01

    Full Text Available Terminologi efikasi kendiri (EK merupakan terminologi yang diperkenalkan dalam ilmu psikologi sekitar tahun 70-an. Namun, istilah ini masih kurang difahami oleh kebanyakan individu terutama mereka yang bukan berlatar belakangkan bidang psikologi. Oleh itu, satu keperluan hasil penulisan ini diketengahkan, memandangkan konsep ini penting dalam diri setiap individu bagi memacu kecemerlangan diri. Justeru, kertas kerja ini akan mengupas serba ringkas mengenai konsep EK dari perspektif Islam dan Barat, dengan melihat kepada beberapa titik persamaan dan perbezaan antara kedua-dua pandangan. Islam dan Barat bersetuju bahawa individu yang memiliki EK yang tinggi merupakan individu yang berfikiran positif, berani mengambil risiko dan tidak mudah berputus. Namun pandangan Islam terhadap konsep ini lebih luas, kerana Islam mengaitkan konsep ini dengan konsep tauhid uluhiyyah dan konsep manusia sebagai ahsan al-taqwim. Oleh demikian, EK dari perspektif Islam lebih bersifat kekal dan umum, di samping individu yang berefikasi tinggi menurut Islam ialah individu yang memiliki sifat sabar, syukur, redha dan redha.

  20. PERANCANGAN DAN PENGEMBANGAN PROTOTYPE SISTEM PARKIR

    Directory of Open Access Journals (Sweden)

    Indah Ayu Septriyaningrum

    2016-10-01

    Abstrak  Sistem parkir manual pada pelayanan parkir mall memerlukan pengelolaan dan pengembangan sistem yang lebih rumit dan jauh dari kata efisien. Informasi yang didapatkan pengelola parkir terkait kondisi parkir di lapangan setiap harinya masih kurang. Tujuan dari penelitian ini adalah merancang dan mengembangkan prototype sistem parkir. Metode pengembangan dan perancangan sistem pada penelitian ini adalah metode Waterfall. Hasil yang didapatkan adalah sistem ini dapat mendeteksi keberadaan mobil pada slot parkir yang tersedia dengan bantuan Intel Galileo Board Gen 2 sebagai kontroler, sensor LDR (Light Dependent Resistor dan sensor ultrasonik (PING sebagai alat bantu pendeteksi keberadaan mobil. Sistem dapat menampilkan aktifitas parkir pada aplikasi web seperti kondisi lahan parkir kosong, lahan terisi, waktu masuk, waktu keluar, lama parkir dan kapasitas parkir yang tersedia serta grafik pemakaian lahan parkir. Dapat disimpulkan bahwa perancangan dan pengembangan sistem berhasil diimplementasikan. Kata Kunci : Sistem parkir, waterfall, Intel Galileo Board Gen 2,sensor LDR (Light Dependent Resistor, sensor ultrasonik

  1. Atomic Energy Control Act

    International Nuclear Information System (INIS)

    1970-01-01

    This act provides for the establishment of the Atomic Energy Control Board. The board is responsible for the control and supervision of the development, application and use of atomic energy. The board is also considered necessary to enable Canada to participate effectively in measures of international control of atomic energy

  2. Atomic Spectra Database (ASD)

    Science.gov (United States)

    SRD 78 NIST Atomic Spectra Database (ASD) (Web, free access)   This database provides access and search capability for NIST critically evaluated data on atomic energy levels, wavelengths, and transition probabilities that are reasonably up-to-date. The NIST Atomic Spectroscopy Data Center has carried out these critical compilations.

  3. Rational construction of an ssa-type of MOF through pre-organizing the ligand's conformation and its exceptional gas adsorption properties.

    Science.gov (United States)

    Wang, Yao; He, Minghui; Tian, Zhi; Zhong, Haoyan; Zhu, Lisha; Zhang, Yingying; Zhang, Xiaoping; Chen, De-Li; He, Yabing

    2018-02-13

    Ssa-type MOFs constructed from dicopper paddlewheels and bent diisophthalate ligands exhibit a promising potential for gas adsorption which benefits from their rich open copper sites and polyhedron-based cages with suitable sizes. However, the rational construction of such types of MOFs is exceedingly challenging because the bent diisophthalate ligands employed are inclined to exhibit various conformations and thus are prone to form MOFs with varied topologies. In this work, by pre-organizing the ligand's conformation, we successfully targeted an ssa-type MOF ZJNU-57 from a bent diisophthalate ligand. More significantly, ZJNU-57 exhibits excellent hydrolytic stability and high C 2 H 2 and CO 2 uptake capacities as well as impressive C 2 H 2 /CH 4 and CO 2 /CH 4 adsorption selectivities, indicating its promising potential for C 2 H 2 /CH 4 and CO 2 /CH 4 separation, which are relevant to acetylene production and natural gas purification. This work not only provides a rare water-stable MOF based on the Cu 2 (COO) 4 cluster for highly selective adsorption of C 2 H 2 and CO 2 from CH 4 , but also demonstrates that the ligand conformation-controlled assembly strategy may be an efficient approach toward the construction of MOF materials with definite topologies for specific applications.

  4. Efektivitas Weblog dan Facebook Terintegrasi untuk Pembelajaran Virtual

    OpenAIRE

    Hartono

    2014-01-01

    Abstrak: Saat ini, banyak mahasiswa menghabiskan waktu mereka di internet. Mereka melakukan kegiatan seperti membuat blog, mengunduh, mengunggah, chatting, dan berinteraksi melalui facebook. Mahasiswa sekarang ini hidup dengan teknologi. Penelitian menunjukkan bahwa weblog dan facebook berpotensi mendukung belajar dan mengajar. Guru dan pendidik menggunakan kegiatan tersebut untuk meningkatkan kualitas belajar. Penelitian ini bertujuan untuk mengetahui efektivitas weblog dan facebook ketika d...

  5. Atom-atom collision cascades localization

    International Nuclear Information System (INIS)

    Kirsanov, V.V.

    1980-01-01

    The presence of an impurity and thermal vibration influence on the atom-atom collision cascade development is analysed by the computer simulation method (the modificated dynamic model). It is discovered that the relatively low energetic cascades are localized with the temperature increase of an irradiated crystal. On the basis of the given effect the mechanism of splitting of the high energetic cascades into subcascades is proposed. It accounts for two factors: the primary knocked atom energy and the irradiated crystal temperature. Introduction of an impurity also localizes the cascades independently from the impurity atom mass. The cascades localization leads to intensification of the process of annealing in the cascades and reduction of the post-cascade vacancy cluster sizes. (author)

  6. Lõuka tuuliku restaureerimine / Dan Lukas

    Index Scriptorium Estoniae

    Lukas, Dan

    2005-01-01

    Hiiumaal Pühalepa vallas Vahtrepa külas Lõuka talu maadel asuva pukktuuliku ajaloost, restaureerimise käigust. Teostus: Dan Lukas. Muinsuskaitseline järelevalve: Tõnu Sepp, tema kommentaar. Ill.:pukktuuliku lõiked ja korruste plaanid, 7 värv. fotot

  7. Internal Control: Peran Dan Perkembangannya

    OpenAIRE

    Murtin, Alek

    2000-01-01

    Perhatian terhadap pentingnya internal control dalam organisasi berjalan dari waktu ke waktu untuk meningkatkan fungsi internal control yang disesuaikan dengan perkembangan lingkungan organisasi, dimulai dengan adanya internal check, kemudian internal control system, internal control structure dan terakhir adalah internal control-integrated framework. Internal control system sempat berkembang beberapa tahun di Indonesia yang selanjutnya digantikan oleh internal control structure yang digunaka...

  8. Asuransi Takaful: Prospek Dan Tantangannya

    OpenAIRE

    Sobirin, Achmad; Muhtar, Muchsin

    1994-01-01

    Dewasa ini perhatian terhadap nilai-nilai syariah Islam terhadap muamalah khususnya di bidang ekonomi menjadi besar. Lembaga perekonomian yang terjalin dengan pranata keagamaan makin menggejala dimana-mana dan kini sedang tumbuh mencari bentuk untuk dapat diterima di tengah-tengah masyarakat.

  9. KETENTUAN TENTANG STANDAR PELAYANAN MINIMAL BIDANG KELUARGA BERENCANA DAN KELUARGA SEJAHTERA BERDASARKAN ASAS PERIKEMANUSIAAN DAN HAK ASASI MANUSIA

    Directory of Open Access Journals (Sweden)

    . Riyanti

    2017-01-01

    Hasil penelitian, ketentuan tentang standar pelayanan minimal bidang keluarga berencana, keluarga sejahtera dan asas perikemanusiaan dengan hak asasi manusia sangat berhubungan keterbatasan lingkup pelayanan dan standar pelaksanaan Komunikasi Informasi dan Edukasi yang tidak jelasberdampak pada tidak dipenuhinya hak asasi manusia untuk mendapatkan kesetaraan dan kebebasan dalam pelayanan keluarga berencana dan keluarga sejahtera.

  10. KINERJA DAN EFISIENSI BANK PEMERINTAH (BUMN DAN BUSN YANG GO PUBLIK DI INDONESIA

    Directory of Open Access Journals (Sweden)

    Sugeng Haryanto

    2012-06-01

    Full Text Available Penelitian ini menganalisis kinerja dan tingkat efisiensi bank-bank BUMN dan BUSN yang go Publik di Bursa Efek Indonesia.  Sample penelitian ini mengambil  tiga bank BUMN Bank BNI 46, Bank Mandiri dan Bank BRI  dan tiga bank BUSN (Bank BCA, Bank Niaga dan Bank Panin dengan periode analisis tahun 2005-2011. Varibael yang digunakan meliputi ROA, ROE, LAR. LDR, NPL dan BOPO. Tujuan dari penelitian ini adalah melihat dan menganalisis perbedaan kinerja antara Bank BUMN dan BUSN yang go public di Bursa Efek Indonesia tahun 2005-2011.  Pendekatan pengukuran kinerja yang digunakan adalah Return on Asset (ROA, Return on Equity (ROE dan Loan to Deposit Ratio (LDR, Loan to Asset Ratio (LAR,  dan efisiensi bank. Hasil dari penelitian menunjukkan bahwa 1 Bank-bank nasional, baik itu bank BUMN maupun BUSN menunjukkan kinerja yang semakin baik, 2 tidak terdapat perbedaan yang signifikan antara kinerja bank BUMN dan BUSN untuk variabel ROA, ROE, LAR, LDR, dan BOPO sedangkan variabel NPL yang merupakan indikator risiko kredit menunjukkan adanya perbedaan yang signifikan antara Bank BUMN dan BUSN

  11. STUDI BANDING PELAPISAN MATERIAL SKD11 DENGAN METODE PHYSICAL VAPOUR DEPOSITION DAN THERMAL DIFUSION PADA KOMPONEN INSERT DIES MESIN STAMPING PRESS

    Directory of Open Access Journals (Sweden)

    Robertus Suryo Bisono

    2017-02-01

    Full Text Available Telah dilakukan pelapisan menggunakan Titanium Alumunium Nitrid (TIAlN dengan metode PVD Coating (Physical Vapour Diposition dan TD (Thermal Difusion  untuk perlakuan permukaan baja perkakas SKD11 sebagai material Insert Die komponen mesin Stamping Press setelah perlakuan hardening. Perlakuan permukaan dimaksudkan untuk meningkatkan kualitas permukaan khususnya kekerasan dan perubahan struktur mikro yang terjadi. Untuk mengetahui tingkat keberhasilan dari perlakuan permukaan tersebut dilakukan dengan memvariasi waktu proses, masing masing 2 sample diproses pada 4 jam, 5 jam dan 6 jam dengan temperatur  proses masing-masing  400ᴼ C. Kemudian satu dari tiap variable sample tersebut di panaskan pada suhu 1000ᴼ C selama 1 jam, pendinginan dilalukan dengan udara bebas tanpa proses quenching Untuk mengetahui hasilnya dilakukan uji kekerasan mikro Vickers, pengamatan struktur mikro Scanning Eectron Microscope (SEM, dan pengujian komposisi dengan Energy Defersif Sepectroscopy (EDS untuk mengetahui tingkat penyerapan material terdifusi. Hasil menunjukan bahwa SKD11 yang dilapisi TiAlN dengan metode PVD selama 6 jam menghasilkan lapisan yang paling keras yaitu 1363 HV dengan ketebalan lapisan 5,3µm. Proses pemanasan 1000⁰C selama 1 jam pada sample mengakibatkan penurunan kekerasan sample dan lapisan permukaan sample menjadi lebih tebal hingga 50µm. Penambahan lapisan diakibatkan oleh terdifusinya atom atom yang menyusun lapisan TiAlN ke dalam substrat serta keluarnya atom atom penyusun lapisan hingga membentuk lapisan kompleks.

  12. PEMBINAAN DAN PENGEMBANGAN USAHA KECIL

    Directory of Open Access Journals (Sweden)

    Sentot Harman Glendoh

    2001-01-01

    Full Text Available Small business as an economic activity of society on a small scale, has a central role in the economy of Indonesia. Although the economic crisis has created a great disturbance in the live of large and middle-size business, apparently small business continues to function well in the lower levels of the economy. The main role of small business is: 1 use excess labor; 2 as a producer of goods and services at reachable prices for the lower economic levels of society; 3 as a potential producer of foreign exchange because of the success of this type of industry in producing non-oil commodities for export. Remembering that the role of small business is large and has great influence on the lower economic levels of society, it is quite necessary to pay attention to the development of this sector. Abstract in Bahasa Indonesia : Usaha kecil sebagai kegiatan ekonomi rakyat berskala kecil memiliki peran sentral dalam perekonomian Indonesia. Walaupun krisis ekonomi telah memporakporandakan kehidupan bidang usaha besar dan menengah, ternyata usaha kecil tetap tegar dan berjalan marak dikawasan kehidupan ekonomi tingkat bawah. Peran pokok usaha kecil ini adalah: (1 sebagai penyerap tenaga kerja, (2 sebagai penghasil barang dan jasa pada tingkat harga yang terjangkau bagi kebutuhan rakyat banyak yang berpenghasilan rendah, (3 sebagai penghasil devisa negara yang potensial kerena keberhasilannya dalam meproduksi komoditi ekspor non migas. Mengingat peran usaha kecil tersebut sangat besar andilnya bagi negara dan masyarakat kecil dilapisan bawah, maka pembinaan dan pengembangannya sangat perlu diperhatikan. Kata kunci: pembinaan, pengembangan, usaha kecil.

  13. AGROFORESTRI UNTUK ADAPTASI DAN MITIGASI PERUBAHAN IKLIM

    Directory of Open Access Journals (Sweden)

    Tigor Butarbutar

    2017-01-01

    Full Text Available Hilangnya tutupan lahan hutan karena konversi hutan untuk pemukiman, perkebunan, pertanian dan kebutuhan untuk pembangunan di sektor lain, telah menyebabkan perubahan pola cuaca/iklim di berbagai tempat. Perubahan iklim dapat diantisipasi dengan mitigasi dan adaptasi. Mitigasi berarti usahausaha pencegahan yang perlu dilakukan, sedangkan adaptasi merupakan kegiatan-kegiatan penyesuaian yang perlu dilakukan untuk dapat hidup dan bertahan dan meningkatkan ketahanan, kelenturan dan mengarahkemigrasikarenakondisiiklimyangberbeda.Agroforestridapatmemitigasidanmengadaptasi perubahaniklim dengan alasan-alasansebagaiberikut: aPencampuranjenis pohonpenghasilkayu,buah dan lain-lain, karena campuran jenis lebih baik dari tanaman murni; b Pencampuran jenis yang didasarkan pada sifat toleransi ( dan , sehingga akan memanfaatkan seluruh cahaya untuk fotosintesis; c Pencampuran perbedaan umur; d Pencampuran berdasarkan perbedaan waktu pemanenan; e Penggabungan nilai ekonomi, sosial dan budaya sehingga perubahan vegetasi dapat berjalan seiring dengan perubahan sosial dan budaya secara berangsur yang dapat disesuaikan dengan perubahan iklim; dan f Dapat digunakan sebagai model untuk memfasilitasi perubahan kelompok vegetasi menjadi kelompok yang baru (adaptasi, seperti teori perubahan vegetasi melalui perladangan berpindah-pindahyangteratur.

  14. INDUSTRIALISASI DAN TANTANGANNYA PADA SEKTOR PENDIDIKAN

    Directory of Open Access Journals (Sweden)

    Arif Unwanullah

    2015-10-01

    Full Text Available Abstrak: Industrialisasi dan Tantangannya pada Sektor Pendidikan. Sumbangan pendidikan dalam perubahan dan pembangunan masa lalu telah bergeser dengan kemajuan teknoekonomi dan komunikasi. Perubahan yang terjadi telah menggeser tatanan kehidupan dan pandangan masyarakat. Materialisme, kapitalisme, efisiensi, dan efektivitas telah menjadi tujuan dan semangat hidup. Pergeseran pandangan masyarakat telah mengubah pula pandangan keberhasilan dan mutu pendidikan, di mana pendidikan diukur dari keberhasilan dalam keterserapan lulusan dalam dunia kerja, oleh karenanya pendidikan dianalisis dari karakteristik sebagai investasi (capital-investment. Pergeseran makna dan tanggung jawab pendidikan mendorong dunia pendidikan melakukan pembaruan dengan alternatif: membangun pembaruan penalaran warganya menuju pemerdekaan dan pendewasaan, pendidikan dilaksanakan secara komprehensif dan bekerjasama dengan semua pihak secara kemitraan, dan membangun visi pendidikan secara komprehensif dan simultan dengan semua pihak. Kata kunci: perubahan sosial, materialistik, modernisasi dan kapitalis Abstract: Industrialization and its education Sector challenges. Contribution of education has shifted with the progress of technology, economy, and communication. The changes have shifted the society's views. Materialism, capitalism, efficiency, and effectiveness have become of interest and enthusiasm for life. The shift has changed society's view, i.e. the view of success and quality of education, in which education is measured from a rate of the absorption of graduates into labor market, therefore education is analyzed from the characteristics of an investment (capital-investment. A shift in meaning and responsibility of education encourages the education sector to create reformation through these following alternatives: creating new thoughts towards liberation and maturation, implementing education comprehensively and cooperating with all parties in partnership, and creating

  15. Desain dan Uji Kinerja Fungsional Sistem Penggerak dan Kendali ROVERGARD

    Directory of Open Access Journals (Sweden)

    Moh Fikri Pomalingo

    2017-04-01

    Full Text Available Abstract The high population rate has an impact on increasing of land function change from agricultural land become housing and commercial building. As a result, it is difficult to get land for planting in the urban area. Therefore, this research is aimed to design equipment that can be used for planting in the narrow land using vertical gardening. This paper will report about design and functional testing of drive and control system on ROVERGARD. Drive system is based on water pump with additional gear train and chainsprocket mechanism. Control system use was on open loop type based on timer. The performance test of drive system was focused on electrical energy consumption and rotational speed of the system that was measured by multifunctional mini ammeter and tachometer. The control system was tested during 4 days, to evaluate their performances between set point and actual timing while filling water tank and rotate the system at maximal load condition. Electrical power consumption was 208 W at average rotational speed 2703 rpm. Increasing load caused an increase of energy consumption but made the drive rotation decline. The position control performance had on position error around 50 cm. Consequently, setting time on timer must be adjusted. Abstrak Laju pertumbuhan penduduk yang tinggi, mengakibatkan tingginya alih fungsi lahan pertanian menjadi bangunan perumahan dan komersial. Masalah ini mengakibatkan sulitnya mencari lahan pertanian di daerah padat penduduk khususnya perkotaan. Oleh karena itu perlu dirancang sebuah alat yang dapat digunakan untuk bercocok tanam di lahan sempit. Tujuan dari penelitian ini adalah mendesain dan menguji sistem penggerak dan kendali pada ROVERGARD. Sistem penggerak berasal dari pompa air yang dimodifikasi. Sedangkan sistem kendali menggunakan tipe open loop berbasis waktu dimana timer sebagai komponen utamanya. Pengujian kinerja penggerak difokuskan pada konsumsi listrik dan rpm yang diukur menggunakan

  16. KONTEKS DAN KONSTRUKSI SOSIAL MENGENAI KEMATIAN ELEKTIF ( EUTHANASIA ∗

    Directory of Open Access Journals (Sweden)

    Helly Prajitno Soetjipto

    2015-09-01

    konteks sosial dan konstruksi sosial kematian. Euthanasia didiskusikan di dalam suatu kerangka pikir yang mencoba memberi perhatian kepada hal-hal yang kontekstual dan interpretatif fenomena sosial suatu proses kematian dan kejadian kematian

  17. DIAGNOSIS DAN PENATALAKSANAAru LIMFOMA ORtsITA

    Directory of Open Access Journals (Sweden)

    Ardizal Rahman

    2014-12-01

    Full Text Available Limfoma orbita merujuk pada limfoma yang terjadi di konjungtiva, kelenjar lakrimal, palpebradan otot-otot ekstraokular. Limfoma primer non-Hodgkin (NHL dari orbita dapat ditemukanpada hanya 1o/o dari semua limforna non-Hodgkin. Anaiisis mutasi somatik pada regiovariabel (V dari immunoglobulin (ig dan segmen gen rantai berat (H telah menunjukkanperan dari stimulasi antigen kronik pada patogenesis limfoma /nucosa-associated lymphoidflssue (MALT. Patogen mikroba seperti Helicobacter pylaridan Chlamydia pneumonia dapaimendasari proses inflamasi dan pada akhirnya memicu akuisisi MALT juga memainkanperan penting dalam tranformasi maligna dan ekspansi klonal lanjutan limfoma. Penentuanstadium kanker sangat penting karena akan menentukan terapi apa yang akan diberikan dankemungkinan remisi dan prognosisnya. Berdasarkan sistem stadium Ann-Arbor, limfoma yangterbatas di orbita disebut sebagai stadium l, keterlibatan struktur sekitar (sinus paranasal,tonsil, dan hidung menjadikannya stadium ll. Stadium lll adalah penyakit nodal abdominaldibawah diafragma dan stadium lV merujuk pada keterlibatan yang tersebar dari satu ataulebih lokasi ekstranodal (hepar, sum-sum tulang atau sistem saraf pusat. Mayoritas pasiendatang dengan keluhan massa konjungtiva berwarna pink (91%, diikuti hiperemis konjungtiva(32%, propiosis (27%, massa palpebra atau orbita (19"fi, penurunan visus dan ptosis (6%,dan diplopia(2%. Bilateralitas terjadi pada 10% hingga 15% kasus dimana 80 % terjadisecarasimultan sedangkan 20% merupakan kondisi yang berurutan. Penilaian lanjut untuk stagingyang akurat dan perencanaan terapitermasuk anamnesis yang lengkap dan pemeriksaan fisik,pemeriksaan laboratorium rutin, elektroforesis protein sei-um, LDH serum, Fr-mikroglobulin,rontgen thoraks, CT scan thoraks, abdornen, dan pelvis, dan biopsisum-sum tulang. Diagnosapositif harus berdasarkan pada perneriksaan histologik dari sampeltumor yang memadai yangdiperoleh dengan biopsiorbita. Beberapa kriteria

  18. Atomic collisions research with excited atomic species

    International Nuclear Information System (INIS)

    Hoogerland, M.D.; Gulley, R.J.; Colla, M.; Lu, W.; Milic, D.; Baldwin, K.G.H.; Buckman, S.J.

    1999-01-01

    Measurements and calculations of fundamental atomic collision and spectroscopic properties such as collision cross sections, reaction rates, transition probabilities etc. underpin the understanding and operation of many plasma and gas-discharge-based devices and phenomena, for example plasma processing and deposition. In almost all cases the complex series of reactions which sustains the discharge or plasma, or produces the reactive species of interest, has a precursor electron impact excitation, attachment, dissociation or ionisation event. These processes have been extensively studied in a wide range of atomic and molecular species and an impressive data base of collision cross sections and reaction rates now exists. However, most of these measurements are for collisions with stable atomic or molecular species which are initially in their ground electronic state. Relatively little information is available for scattering from excited states or for scattering from unstable molecular radicals. Examples of such species would be metastable excited rare gases, which are often used as buffer gases, or CF 2 radicals formed by electron impact dissociation in a CF 4 plasma processing discharge. We are interested in developing experimental techniques which will enable the quantitative study of such exotic atomic and molecular species. In this talk I would like to outline one such facility which is being used for studies of collisions with metastable He(2 3 S) atoms

  19. TRANSFORMASI ORGANISASIONAL DAN MSDM: HAMBATAN DAN IMPLIKASINYA PADA REKRUTMEN DAN SELEKSI

    Directory of Open Access Journals (Sweden)

    Licen Indahwati Darsono

    2002-01-01

    Full Text Available Rapid change of environment is an external force that causes the organization to transform. Fundamentally, the main purpose of the transformation is to change the organizational structure to be more flexible and competitive with fewer hierarchial levels, managers, and employees. The transformation needs to be radical, causing resistance from the organization's members. Their resistance can cause the transformation to fail, therefore organization must find ways to lessen this resistance. First, organization must learn about the diversity of its members' cultures and values. Second, organization must build its own organizational culture which can support the success of the transformation, by communicating it with the members of the organization. To support organizational culture building efforts, it needs changes in human resources practices, especially recruitment and selection. Abstract in Bahasa Indonesia : Perubahan yang cepat dalam lingkungan merupakan kekuatan eksternal yang mengakibatkan transformasi dalam sebuah organisasi. Pada dasarnya, tujuan utama dari transformasi tersebut adalah merubah struktur organisasi agar menjadi lebih fleksibel dan mampu bersaing, dengan tingkat structural yang sedikit, serta jumlah manajer dan karyawan yang lebih kecil. Transformasi tersebut harus menyeluruh, dan hal ini dapat menyebabkan resistensi dari para anggota organisasi yang memperhambat perubahan tersebut. Resistensi itu bisa menyebabkan perubahan tersebut batal, oleh karena itu organisasi harus mencari jalan untuk mengurangi hambatan-hambatan tersebut. Pertama, organisasi harus belajar keanekaragaman dari budaya dan nilai anggotanya. Kedua, organisasi harus mengembangkan budaya organisasi sendiri melalui komunikasi yang baik dengan anggotanya. Untuk mendukung usaha mengembangkan budaya organisasi, harus ada perubaban pada kebijakan sumber daya manusia, terutama dalam rekrutmen dan seleksi karyawan. Kata kunci: transformasi, resistensi, budaya

  20. Perbandingan Akurasi Pengukuran Suhu Dan Kelembaban Antara Sensor DHT11 Dan DHT22

    OpenAIRE

    Saptadi, Arief Hendra

    2014-01-01

    Suhu dan kelembaban merupakan dua objek pengukuran yang acapkali terdapat di dalam sistem akuisisi data. Terdapat banyak piranti sensor yang berfungsi untuk mengukur dua objek tersebut dan akurasi merupakan salah satu parameter yang dapat digunakan untuk memilihnya. DHT11 dan DHT22 adalah sensor seri DHT dari Aosong Electronics yang dapat melakukan pengukuran suhu dan kelembaban secara serempak dengan keluaran digital. Informasi tentang akurasi terdapat di dalam lembar data keduanya. Kendati ...

  1. Pertumbuhan dan Mutu Fisik Bibit Jabon (Anthocephalus Cadamba Miq.) di Polibag dan Politub

    OpenAIRE

    Junaedi, Ahmad

    2010-01-01

    Informasi pertumbuhan dan mutu fisik bibit jabon (Anthocephalus cadamba Miq.) di wadah bibit dengan volume yang berbeda diperlukan sebagai bagian yang akan diperhitungkan dalam pemilihan wadah bibit yang akan digunakan. Penelitian ini dilakukan untuk mengetahui pertumbuhan dan mutu fisik bibit jabon yang disapih pada wadah bibit polibag (volume 300 cm3) dan politub (volume 60 cm3). Tahapan penelitian meliputi : pembibitan serta pengamatan pertumbuhan dan penilaian mutu fisik bibit jabon yang ...

  2. Dampak belanja irigasi dan jaringan terhadap output PDRB sektor pertanian dan pertumbuhan ekonomi Kota Jambi

    OpenAIRE

    Aminah, Siti; Parmadi, Parmadi

    2018-01-01

    Penelitian ini bertujuan untuk menganalisis perkembangan Belanja irigasi dan jaringan serta perkembangan output GDP sektor pertanian Kota Jambi selama periode tahun 2005-2015 dan menganalisis pengaruh belanja irigasi dan jaringan terhadap  GDP Output sektor pertanian dan pertumbuhan ekonomi Kota Jambi. Hasil penelitian menunjukkan Selama periode penelitian tahun 2005-2015 dengan rata-rata pertumbuhan 61,98%, nilai rata-rata PDRB harga berlaku Kota Jambi sebesar 157.601,68 dalam juta rupi...

  3. Atoms - molecules - nuclei. Vol. 1

    International Nuclear Information System (INIS)

    Otter, G.; Honecker, R.

    1993-01-01

    This first volume covers the following topics: Wave-particle dualism, classical atomic physics; the Schroedinger equation, angular momentum in quantum physics, one-electron atoms and many-electron atoms with atomic structure, atomic spectra, exotic atoms, influence of electric and magnetic fields

  4. ASUPAN SENG, KADAR SERUM SENG, DAN STUNTING PADA ANAK SEKOLAH DI PESISIR SEMARANG

    Directory of Open Access Journals (Sweden)

    Adriyan Pramono

    2016-09-01

    Full Text Available ABSTRACTThe purpose of this study is to determine prevalence of at risk inadequate intake of dietary zinc, and to analyze differences of zinc serum level between dietary zinc quintile and stunting status. A cross sectional study was conducted to 70 school children (9-12 years selected by simple random sampling. Height was measured by stadiometer and weight was measured using calibrated digital weight-scale. Zinc serum level was analyzed by Atomic Absorbance Spectrophotometry (AAS method, and dietary intake of zinc and iron was obtained using semi-quantitative Food Frequency Questionnaire (FFQ. Data were analyzed using Anova test. Seventy percent subjects were at risk inadequate intake of dietary zinc based on Estimated Average Requirement (EAR cut off and zinc serum levels among all subjects in this study were <65 μg/dl. There were 47.1% stunting children found in this study. Mean zinc serum levels significantly differences between dietary zinc quintile (p=0.000 and between stunting status (p=0.000. At risk inadequate dietary zinc still contributed to zinc deficiency in coastal school children population. Zinc status was significantly different between stunted and normal children.Keywords: coastal area, dietary zinc, EAR, stunting, zinc serum levelsABSTRAKPenelitian ini bertujuan untuk mengetahui prevalensi risiko kurangnya asupan seng dan menganalisis perbedaan kadar serum seng antara kuintil asupan seng dan status stunting. Studi cross sectional dilakukan terhadap 70 anak sekolah (9-12 tahun yang dipilih secara acak sederhana. Tinggi badan diukur dengan stadiometer dan berat diukur dengan menggunakan timbangan digital terkalibrasi. Kadar seng serum dianalisis dengan metode Atomic Absorbance Spectrophotometry (AAS, dan data asupan seng dan besi diperoleh melalui wawancara dengan Food Frequency Questionnaire (FFQ. Data dianalisis dengan metode analisis statistik Anova. Sejumlah 70% subjek berisiko kurangnya asupan seng makanan berdasarkan

  5. Wacana Penjarahan Dan Kekerasan Simbolik Terhadap Petani

    Directory of Open Access Journals (Sweden)

    Agus Sudibyo

    2002-01-01

    Full Text Available Perlawanan kaum petani sudah lama terjadi dalam konteks sejarah hubungan antara si kaya dan si miskin dan antara kaum petani dan negara. Persoralannya selalu bahwa negara, aparat keamanan dan pemilik modal telah mengambil alih secara paksa surplus ekonomi dari petani. Mereka bekerja sama dalam aksi penyerobotan tanah petani, pendirian perkebunan-perkebunan dan dalam menghadapi gerakan protes petani. Negara bukan hanya menghadapi gerakan perlawanan petani dengan represi-represi fisik. Secara sistematis negara juga melakukan propaganda dengan menciptakan gambaran-gambaran yang unfavourable tentang petani pelaku penjarahan dalam berbagai representasi wacana. Dalam batas tertentu, media massa justru memperkuat kecenderungan ini dengan menonjolkan dimensi kekerasan, pemberontakan dan anarkisme dalam mewacanakan aksi-aksi penjarahan petani.

  6. Motivasi, Kebiasaan, dan Keamanan Penggunaan Internet

    Directory of Open Access Journals (Sweden)

    Zinggara Hidayat

    2017-01-01

    Full Text Available Abstract: This study investigates motivation, habits, and security of internet use by high schools and universities students in Jakarta, Bogor, Depok, Tangerang, and Bekasi. This descriptive and quantitative reasearch uses survey method. The findings of the study show that the strongest motivation is to show self existence, entertainment, and academic purposes. At some points, the habit of using the internet also makes the students face some risks such as verbal and nonverbal abuses, bullying, pornoghrapy, account hacking, and the risk of interaction with unknown parties. Abstrak: Penelitian ini menyelidiki motivasi, kebiasaan, dan keamanan penggunaan internet di antara siswa sekolah menengah atas dan universitas di Jakarta, Bogor, Depok, Tangerang, dan Bekasi. Penelitian deskriptif kuantitatif ini menggunakan metode survei. Hasil penelitian menunjukkan bahwa motivasi paling kuat adalah untuk memperlihatkan eksistensi diri, pencarian hiburan, dan penyelesaian tugas akademis. Kebiasaan penggunaan internet oleh pelajar dan mahasiswa menghadapi beberapa risiko, seperti kekerasan verbal dan nonverbal,

  7. SOSIAL MEDIA DAN PERUBAHAN INDEKS PRESTASI MAHASISWA

    Directory of Open Access Journals (Sweden)

    Risnah Risnah

    2015-12-01

    Tujuan dari penelitian ini adalah mengetahui jumlah mahasiswa semester II, IV, dan VI Jurusan Keperawatan yang menggunakan internet secara aktif dan karak-teristiknya, membandingkan hasil belajar mahasiswa semester II-III, IV-V, dan VI-VII Jurusan Keperawatan, dan mengetahui pengaruh sosial media (facebook dan twitter terhadap perubahan indeks prestasi mahasiswa, dengan jumlah res-ponden sebanyak 150 orang. Penelitian ini adalah deskriptif dengan desain pene-litian kausal. Pengumpulan data dengan menggunakan instrumen berupa kuesio-ner, dengan jumlah responden sebanyak 150 orang. Adapun hasil penelitian me-nunjukkan bahwa indeks prestasi mahasiswa dengan penggunaan sosial media umumnya responden menyatakan sosial media tidak mempengaruhi indeks prestasi. Dari hasil analisis uji statistik diperoleh terdapat pengaruh antara sosial media (facebook dan twitter dengan indeks prestasi. Dengan begitu, penggunaan sosial media harus digunakan sebagaimana mestinya, agar mahasiswa/i yang ak-tif pengunaan sosial media tidak mempengaruhi indeks prestasinya.

  8. Atomic and molecular sciences

    International Nuclear Information System (INIS)

    Lane, N.F.

    1989-01-01

    The theoretical atomic and molecular physics program at Rice University addresses basic questions about the collision dynamics of electrons, atoms, ions and molecules, emphasizing processes related to possible new energy technologies and other applications. The program focuses on inelastic collision processes that are important in understanding energy and ionization balance in disturbed gases and plasmas. Emphasis is placed on systems and processes where some experimental information is available or where theoretical results may be expected to stimulate new measurements. Examples of current projects include: excitation and charge-transfer processes; orientation and alignment of excited states following collisions; Rydberg atom collisions with atoms and molecules; Penning ionization and ion-pair formation in atom-atom collisions; electron-impact ionization in dense, high-temperature plasmas; electron-molecule collisions; and related topics

  9. Modern atomic physics

    CERN Document Server

    Natarajan, Vasant

    2015-01-01

    Much of our understanding of physics in the last 30-plus years has come from research on atoms, photons, and their interactions. Collecting information previously scattered throughout the literature, Modern Atomic Physics provides students with one unified guide to contemporary developments in the field. After reviewing metrology and preliminary material, the text explains core areas of atomic physics. Important topics discussed include the spontaneous emission of radiation, stimulated transitions and the properties of gas, the physics and applications of resonance fluorescence, coherence, cooling and trapping of charged and neutral particles, and atomic beam magnetic resonance experiments. Covering standards, a different way of looking at a photon, stimulated radiation, and frequency combs, the appendices avoid jargon and use historical notes and personal anecdotes to make the topics accessible to non-atomic physics students. Written by a leader in atomic and optical physics, this text gives a state-of-the...

  10. Persepsi Santri dan Kiai terhadap Pluralisme Agama di Pendidikan Ulama Tarjih Muhammadiyah (PUTM dan Aswaja Nusantara Yogyakarta

    Directory of Open Access Journals (Sweden)

    Zainal Arifin

    2017-05-01

    Abstrak: Perdebatan pluralisme agama masih mengemuka dalam konteks masyarakat majemuk di Nusantara. Bahkan, tidak jarang menimbulkan konflik dan perang pemikiran. Menarik melihat perspektif kiai dan santri Muhammadiyah dan NU terhadap isu pluralisme melalui praktik pendidikan di Ulama Tarjih Muhammadiyah (PUTM Yogyakarta dan Pondok Pesantren Aswaja Nusantara Yogyakarta yang dianggap representatif karena membawa muatan konsep, ide dan paradigma dari Muhammadiyah dan NU. Penelitian ini bersifat kualitatif,  data diperoleh dari wawancara dan studi kepustakaan dengan saling memberikan verifikasi, koreksi dan pelengkap. Hasil penelitian ini, PUTM dan Pesantren Aswaja Nusantara memiliki konsep yang sama dalam memegang teguh akidah, yakni sikap eksklusif dan menolak pluralisme secara teologis namun menerimanya secara sosiologis. Sehingga, paradigma dari dua lembaga tersebut merepresentasikan dari paradigma Muhammadiyah dan NU dalam merespon fenomena pluralisme agama dan budaya.

  11. VAKSIN DENGUE DAN PERKEMBANGANNYA SAAT INI DAN DI MASA MENDATANG

    Directory of Open Access Journals (Sweden)

    Triwibowo Ambar Garjito

    2012-09-01

    Full Text Available Dengue virus merupakan salah satu virus anggota dari famili Flaviviridae yang sejak tahun 1956 telah dikenal dapat menimbulkan demam dengue maupun demam berdarah dengue (DBD. Penyakit yang ditularkan oleh nyamuk Aedes aegypti ini diperkirakan telah menjangkiti pada selatar 50-100 juta manusia dengan 500.000 kasus di antaranya dalam manifestasi yang ganas yang dikenal sebagai dengue haemorrhagic fever dan dengue shock syndrome dan 25.000 di antaranya berakibat fatal (meninggal. Saat ini pengembangan vaksin merupakan salah satu solusi yang diharapkan dapat menekan penyebaran penyakit tersebut. E (envelope merupakan salah satu bagian dari protein struktural virus yang sangat penting dalam pengembangan vaksin, yaitu sebagai badan yang memproduksi antibodi netralisasi untuk protein. Non-struktural protein l juga telah diketahui sebagai salah satu komponen penting dalam pengembangan vaksin oleh karena kemampuannya untuk dapat diekspresi pada permukaan sel yang diinfeksi yang dapat menjadi target untuk immune cytolisis. Ada dua pendekatan yang digunakan dalam memproduksi suatu vaksin dengue, yaitu: a. Vaksin hidup yang telah dilemahkan (live attenuated vaccine: b. Vaksin hasil rekayasa (engineered vaccine. Penelitian terhadap vaksin DENV baik rekombinan maupun non-rekombinan yang didasarkan pada uji virus telah dilakukan secara terus-menerus baik pada monyet dan manusia. Sampai saat ini telah dikembangkan sejumlah kandidat vaksin DENV yang berdasar pada tetravalent virus dengue, yaitu a. vaksin konvensional, b. vaksin dengue rekombinan berdasar pada flavivirus, c. vaksin intertypic chimeric, d. vaksin chimerivac, e. vaksin dengue rekombinan menggunakan vector non-ftavivirus dan f. vector adenovirus. Namun demikian, sampai sekarang belum ada vaksin yang siap digunakan untuk menangkal infeksi ke empat serotype virus dengue, sehingga masih diharapkan untuk pengembangan virus lebih lanjut.   Kata kunci: Aedes aegypti, dengue virus, vaksin dengue.

  12. BAHAYA LATEN INFEKSI GONORE DAN KLAMIDIA DI ASIA SELATAN & ASIA TENGGARA, DI INDONESIA DAN KOTA MANADO

    Directory of Open Access Journals (Sweden)

    Aron Pirade

    2014-04-01

    menempati urutan tertinggi. Wilayah Asia Selatan dan Asia Timur-Selatan (juga disebut Asia Tenggara adalah wilayah dengan prevalensi Gonore dan Klamidia terbesar. Prevalensi Gonore di tahun 1995 dan 1999 yaitu 29.11 dan 27.2 juta penduduk wilayah Asia Selatan dan Asia Tenggara. Klamidia, di tahun 1995 dan tahun 1999 yaitu 40.48 dan 42.89 juta penduduk wilayah Asia Selatan dan Asia Tenggara. Di Indonesia sendiri, pada 11 area penelitian menunjukkan bahwa prevalensi Gonore dalam wilayah Indonesia menunjukkan rata-rata prosentasenya 20%-40% dari keseluruhan STI pada wanita beresiko tinggi terkena STI. Sedangkan infeksi oleh Klamidia prosentasenya 15%- 45% dari keseluruhan STI pada wanita beresiko tinggi terkena penyakit kelamin. Prosentase Gonore dan Klamidia di Kota Manado rata-rata 15-30%. Tingginya prevalensi infeksi Gonore dan Klamidia di Asia Tenggara, ternyata diikuti juga dengan tingginya perkembangan infeksi Gonore dan Klamidia di Indonesia dan Kota Manado.

  13. Metal atom oxidation laser

    International Nuclear Information System (INIS)

    Jensen, R.J.; Rice, W.W.; Beattie, W.H.

    1975-01-01

    A chemical laser which operates by formation of metal or carbon atoms and reaction of such atoms with a gaseous oxidizer in an optical resonant cavity is described. The lasing species are diatomic or polyatomic in nature and are readily produced by exchange or other abstraction reactions between the metal or carbon atoms and the oxidizer. The lasing molecules may be metal or carbon monohalides or monoxides

  14. Advances in atomic spectroscopy

    CERN Document Server

    Sneddon, J

    1997-01-01

    This series describes selected advances in the area of atomic spectroscopy. It is primarily intended for the reader who has a background in atmoic spectroscopy; suitable to the novice and expert. Although a widely used and accepted method for metal and non-metal analysis in a variety of complex samples, Advances in Atomic Spectroscopy covers a wide range of materials. Each Chapter will completely cover an area of atomic spectroscopy where rapid development has occurred.

  15. Economical Atomic Layer Deposition

    Science.gov (United States)

    Wyman, Richard; Davis, Robert; Linford, Matthew

    2010-10-01

    Atomic Layer Deposition is a self limiting deposition process that can produce films at a user specified height. At BYU we have designed a low cost and automated atomic layer deposition system. We have used the system to deposit silicon dioxide at room temperature using silicon tetrachloride and tetramethyl orthosilicate. Basics of atomic layer deposition, the system set up, automation techniques and our system's characterization are discussed.

  16. Atomic physics made clear

    International Nuclear Information System (INIS)

    Meinhold, H.

    1980-01-01

    This book is a popular introduction into the foundations of atomic physics und quantum mechanics. Starting from some phenomenological concepts Bohr's model and the construction of the periodic system regarding the shell structure of atoms are introduced. In this framework the selection rules and magnetic moments of atomic electrons are considered. Finally the wave-particle dualism is considered. In the appendix some mathematical methods are described which are useful for a deeper penetration into the considered ideas. (HSI)

  17. NCEP ATP III dan Framingham score

    OpenAIRE

    Hasan, Refli; Fahila, Reny

    2016-01-01

    Laporan ini merupakan Program Pendidikan Kolesterol National yang diperbaharui yaitu pedoman klinis untuk melakukan pengujian kolesterol dan manajemen. ATP III dibuat berdasarkan bukti dan laporan ekstensif yang akan menjadi referensi dan rekomendasi ilmiah. Laporan ATP III dapat dijadikan pedoman untuk pemberian terapi penurun kolesterol yang intensif dalam praktek. Pedoman ini hanya sebagai informasi , tidak dapat mempengaruhi secara mutlak dalam penilaian klinis dokter yang akhirnya menent...

  18. Deeply bound pionic atom

    International Nuclear Information System (INIS)

    Toki, Hiroshi; Yamazaki, Toshimitsu

    1989-01-01

    The standard method of pionic atom formation does not produce deeply bound pionic atoms. A study is made on the properties of deeply bound pionic atom states by using the standard pion-nucleus optical potential. Another study is made to estimate the cross sections of the formation of ls pionic atom states by various methods. The pion-nucleus optical potential is determined by weakly bound pionic atom states and pion nucleus scattering. Although this potential may not be valid for deeply bound pionic atoms, it should provide some hint on binding energies and level widths of deeply bound states. The width of the ls state comes out to be 0.3 MeV and is well separated from the rest. The charge dependence of the ls state is investigated. The binding energies and the widths increase linearly with Z azbove a Z of 30. The report then discusses various methods to populate deeply bound pionic atoms. In particular, 'pion exchange' reactions are proposed. (n, pπ) reaction is discussed first. The cross section is calculated by assuming the in- and out-going nucleons on-shell and the produced pion in (n1) pionic atom states. Then, (n, dπ - ) cross sections are estimated. (p, 2 Heπ - ) reaction would have cross sections similar to the cross section of (n, dπ - ) reaction. In conclusion, it seems best to do (n, p) experiment on heavy nuclei for deeply bound pionic atom. (Nogami, K.)

  19. Single atom oscillations

    International Nuclear Information System (INIS)

    Wiorkowski, P.; Walther, H.

    1990-01-01

    Modern methods of laser spectroscopy allow the study of single atoms or ions in an unperturbed environment. This has opened up interesting new experiments, among them the detailed study of radiation-atom coupling. In this paper, the following two experiments dealing with this problem are reviewed: the single-atom maser and the study of the resonance fluorescence of a single stored ion. The simplest and most fundamental system for studying radiation-matter coupling is a single two-level atom interacting with a single mode of an electromagnetic field in a cavity. This problem received a great deal of attention shortly after the maser was invented

  20. Atomic hydrogen reactor

    International Nuclear Information System (INIS)

    Massip de Turville, C.M.D.

    1982-01-01

    Methods are discussed of generating heat in an atomic hydrogen reactor which involve; the production of atomic hydrogen by an electrical discharge, the capture of nascent neutrons from atomic hydrogen in a number of surrounding steel alloy tubes having a high manganese content to produce 56 Mn, the irradiation of atomic hydrogen by the high energy antineutrinos from the beta decay of 56 Mn to yield nascent neutrons, and the removal of the heat generated by the capture of nascent neutrons by 55 Mn and the beta decay of 56 Mn. (U.K.)

  1. DESAIN, TATA LETAK, DAN KONSTRUKSI TAMBAK

    Directory of Open Access Journals (Sweden)

    Akhmad Mustafa

    2008-12-01

    Full Text Available Komoditas yang umum dibudidayakan di tambak Indonesia adalah udang dan ikan bandeng yang menjadi komoditas unggulan untuk dikembangkan. Salah satu faktor penting yang sangat menentukan keberhasilan usaha budidaya tambak adalah rekayasa tambak yang mencakup disain, tata letak, dan konstruksi tambak. Secara umum, desain petakan tambak merupakan perencanaan bentuk tambak yang meliputi: ukuran panjang dan lebar petakan, kedalaman, ukuran pematang, ukuran berm, dan ukuran saluran keliling, serta ukuran dan letak pintu air. Tata letak suatu unit tambak harus memenuhi tujuan seperti: menjamin kelancaran mobilitas operasional sehari-hari, menjamin kelancaran dan keamanan pasok air, serta pembuangannya, dapat menekan biaya konstruksi tanpa mengurangi fungsi teknis dari unit tambak yang dibangun dan mempertahankan kelestarian lingkungan. Konstruksi tambak yang menggambarkan proses pengerjaan tambak harus disesuaikan dengan desain dan tata letak yang telah ada. Rekayasa tambak diarahkan pada kemampuan untuk menciptakan kondisi yang sesuai dengan keadaan alami yang dituntut oleh organisme akuatik yang dibudidayakan sehingga produktivitas tambak meningkat, efisien secara ekonomis, dan berkelanjutan.

  2. KONTEKTUALISASI DAN (KEMUNGKINAN KONSEKUENSINYA BAGI PSIKOLOGI

    Directory of Open Access Journals (Sweden)

    Prof. Supratiknya

    2015-09-01

    jaran di perguruan tinggi seperti kita kenal sekarang (selanjutnya disebut psikologi, lahir di Jerman pada penghujung abad ke‐19. Selanjutnya psikologi berkembang pesat di Amerika Utara khususnya Amerika Serikat dan negara‐negara lain di Eropa yang lebih dulu mengalami industrialisasi khususnya di Eropa Barat. 1 Alhasil, paling tidak sampai dasawarsa 1980‐an perkembangan dan persebaran psikologi di tingkat global ditandai oleh ketimpangan di antara apa yang oleh Moghaddam (1987 disebut tiga dunia tempat psikologi dikembangkan dan dipraktekkan, disimak antara lain berdasarkan besarnya produksi pengetahuan psikologis yang disebarluaskan melalui penyelenggaraan pendidikan tinggi psikologi maupun lewat publikasi ilmiah berupa baik berkala maupun buku rujukan dan buku teks.

  3. TheoSSA - Model WD Spectra on Demand: The Impact of Ne, Na, Mg, and Iron-group Elements on the Balmer Lines

    Science.gov (United States)

    Reindl, N.; Rauch, T.

    2015-06-01

    The registered German Astrophysical Virtual Observatory (GAVO) service TheoSSA provides easy access to synthetic stellar spectra. This GAVO database contains already ten thousands of these, which were calculated with different chemical compositions of the elements H to Ni. In addition to the database, it is possible to calculate individual spectra for hot, compact stars based on the Tübingen NLTE Model-Atmosphere Package (TMAP) via the TMAW service. The TMAW models were, in the pilot phase, restricted to the elements H, He, C, N, and O. Now, TMAW is extended to additionally consider opacities from Ne, Na, and Mg. Soon, TMAW will also be able to include the opacities from the so-called iron-group elements (Ca - Ni). We describe the improvements and show the impact of Ne, Na, Mg, and iron-group elements on the Balmer lines.

  4. Atom dynamics in laser fields

    International Nuclear Information System (INIS)

    Jang, Su; Mi, No Gin

    2004-12-01

    This book introduces coherent dynamics of internal state, spread of atoms wave speed, semiclassical atoms density matrix such as dynamics equation in both still and moving atoms, excitation of atoms in movement by light, dipole radiating power, quantum statistical mechanics by atoms in movement, semiclassical atoms in movement, atoms in movement in the uniform magnetic field including effects of uniform magnetic field, atom cooling using laser such as Doppler cooling, atom traps using laser and mirrors, radiant heat which particles receive, and near field interactions among atoms in laser light.

  5. Highlights from 4STAR Sky-Scanning Retrievals of Aerosol Intensive Optical Properties from Multiple Field Campaigns with Detailed Comparisons of SSA Reported During SEAC4RS

    Science.gov (United States)

    Dunagan, Stephen E.

    2016-01-01

    The 4STAR (Spectrometer for Sky-Scanning, Sun-Tracking Atmospheric Research) instrument combines airborne sun tracking capabilities of the Ames Airborne Tracking Sun Photometer (AATS-14) with AERONET (Aerosol Robotic Network)-like sky-scanning capability and adds state-of-the-art fiber-coupled grating spectrometry to yield hyperspectral measurements of direct solar irradiance and angularly resolved sky radiance. The combination of sun-tracking and sky-scanning capability enables retrievals of wavelength-dependent aerosol optical depth (AOD), mode-resolved aerosol size distribution (SD), asphericity, and complex refractive index, and thus also the scattering phase function, asymmetry parameter, single-scattering albedo (SSA), and absorption aerosol optical thickness (AAOT). From 2012 to 2014 4STAR participated in four major field campaigns: the U.S. Dept. of Energy's TCAP (Two-Column Aerosol Project) I & II campaigns, and NASA's SEAC4RS (Studies of Emissions, Atmospheric Composition, Clouds and Climate Coupling by Regional Surveys) and ARISE (Arctic Radiation - IceBridge Sea & Ice Experiment) campaigns. Establishing a strong performance record, 4STAR operated successfully on all flights conducted during each of these campaigns. Sky radiance spectra from scans in either constant azimuth (principal plane) or constant zenith angle (almucantar) were interspersed with direct beam measurements during level legs. During SEAC4RS and ARISE, 4STAR airborne measurements were augmented with flight-level albedo from the collocated Shortwave Spectral Flux Radiometer (SSFR) providing improved specification of below-aircraft radiative conditions for the retrieval. Calibrated radiances and retrieved products will be presented with particular emphasis on detailed comparisons of ambient SSA retrievals and measurements during SEAC4RS from 4STAR, AERONET, HSRL2 (High Spectral Resolution Lidar), and from in situ measurements.

  6. 4STAR Sky-Scanning Retrievals of Aerosol Intensive Optical Properties from Multiple Field Campaigns with Detailed Comparisons of SSA Reported During SEAC4RS

    Science.gov (United States)

    Flynn, Connor; Dahlgren, R. P.; Dunagan, S.; Johnson, R.; Kacenelenbogen, M.; LeBlanc, S.; Livingston, J.; Redemann, J.; Schmid, B.; Segal Rozenhaimer, M.; hide

    2015-01-01

    The 4STAR (Spectrometer for Sky-Scanning, Sun-Tracking Atmospheric Research) instrument combines airborne sun tracking capabilities of the Ames Airborne Tracking Sun Photometer (AATS-14) with AERONET-like sky-scanning capability and adds state-of-the-art fiber-coupled grating spectrometry to yield hyper spectral measurements of direct solar irradiance and angularly resolved sky radiance. The combination of sun-tracking and sky-scanning capability enables retrievals of wavelength-dependent aerosol optical depth (AOD), mode-resolved aerosol size distribution (SD), asphericity, and complex refractive index, and thus also the scattering phase function, asymmetry parameter, single-scattering albedo (SSA), and absorption aerosol optical thickness (AAOT).From 2012 to 2014 4STAR participated in four major field campaigns: the U.S. Dept. of Energy TCAP I II campaigns, and NASAs SEAC4RS and ARISE campaigns. Establishing a strong performance record, 4STAR operated successfully on all flights conducted during each of these campaigns. Sky radiance spectra from scans in either constant azimuth (principal plane) or constant zenith angle (almucantar) were interspersed with direct beam measurements during level legs. During SEAC4RS and ARISE, 4STAR airborne measurements were augmented with flight-level albedo from the collocated Shortwave Spectral Flux Radiometer (SSFR) providing improved specification of below-aircraft radiative conditions for the retrieval. Calibrated radiances and retrieved products will be presented with particular emphasis on detailed comparisons of ambient SSA retrievals and measurements during SEAC4RS from 4STAR, AERONET, HSRL2, and from in situ measurements.

  7. Stellar parameters for the central star of the planetary nebula PRTM 1 using the German Astrophysical Virtual Observatory service TheoSSA

    Science.gov (United States)

    Rauch, T.; Demleitner, M.; Hoyer, D.; Werner, K.

    2018-04-01

    The German Astrophysical Virtual Observatory (GAVO) developed the registered service TheoSSA (theoretical stellar spectra access) and the supporting registered VO tool TMAW (Tübingen Model-Atmosphere WWW interface). These allow individual spectral analyses of hot, compact stars with state-of-the-art non-local thermodynamical equilibrium (NLTE) stellar-atmosphere models that presently consider opacities of the elements H, He, C, N, O, Ne, Na, and Mg, without requiring detailed knowledge about the involved background codes and procedures. Presently, TheoSSA provides easy access to about 150 000 pre-calculated stellar spectral energy distributions (SEDs) and is intended to ingest SEDs calculated by any model-atmosphere code. In the case of the exciting star of PN PRTM 1, we demonstrate the easy way to calculate individual NLTE stellar model-atmospheres to reproduce an observed optical spectrum. We measured T_eff = 98 000± 5 000 K, log (g / cm/s^2) = 5.0^{+0.3}_{-0.2}, and photospheric mass fractions of H =7.5 × 10-1 (1.02 times solar), He =2.4 × 10-1 (0.96), C =2.0 × 10-3 (0.84), N =3.2 × 10-4 (0.46), and O =8.5 × 10-3 (1.48) with uncertainties of ±0.2 dex. We determined the stellar mass and luminosity of 0.73^{+0.16}_{-0.15} M_{⊙} and log (L/L⊙) = 4.2 ± 0.4, respectively.

  8. TASAWUF DAN TANTANGAN PERUBAHAN SOSIAL

    Directory of Open Access Journals (Sweden)

    Yusno Abdullah Otta

    2010-12-01

    Full Text Available Abstract: Sufism in the eras of globalization and information often faces considerable challenges. The function and role of religion in modern life have in some aspects diminished, including sufism because it is claimed to have played no or less role in resolving problems nor stimulating social change. As one of Islamic traditions, sufism makes ihsan as its essential teaching. By this concept, sufism encourages humans to pray to God wholeheartedly. Sufism is now required to show its own existence and function by making fundamental contribution for modern life, an era which differ socio-culturally from the one when sufism firstly emerged. Sufism thus needs to adapt itself to the changes in the era of information and globalization so that it will remain relevant and suitable for human progress. Sufism needs to release itself from its exclusivism and to avoid being trapped in its own logic, namely speculative-trancendentalism Abstrak: Tasawuf di era globalisasi dan informasi seperti saat ini tengah menghadapi tantangan yang sangat berat. Kehidupan modern sudah sampai pada taraf tidak lagi mempercayai fungsi dan peran agama, termasuk di dalamnya tasawuf, sebagai ‘sesuatu’ yang dapat memberikan solusi bagi perubahan sosial. Sebagai manifestasi paripurna dari ajaran Islam, tasawuf berintikan pada konsep Ihsān yang mengajarkan untuk beribadah kepada Sang Pencipta secara ikhlas. Untuk menunjukkan eksistensinya, tasawuf dituntut peran aktifnya secara konstruktif-solutif terhadap berbagai kebutuhan manusia modern yang amat berbeda dengan setting maupun struktur masyarakat pada saat tasawuf “dilahirkan” pada zamannya. Tasawuf dituntut untuk memerlukan “baju” baru di era informasi yang kerap berubah ini, agar tetap realible dan suitable dengan kemajuan zaman. Hal itu dapat dilakukan dengan berusaha “keluar” dari eksklusifismenya dengan meminjam tradisi filsafat analitik pasca positivisme dan tradisi eksistensialis serta dinamika filsafat

  9. Analisis Kinerja EIGRP dan OSPF pada Topologi Ring dan Mesh

    Directory of Open Access Journals (Sweden)

    DWI ARYANTA

    2014-01-01

    Full Text Available ABSTRAK EIGRP (Enhanced Interior Gateway Routing Protocol dan OSPF (Open Shortest Path Fisrt adalah routing protokol yang banyak digunakan pada suatu jaringan komputer. EIGRP hanya dapat digunakan pada perangkat Merk CISCO, sedangkan OSPF dapat digunakan pada semua merk jaringan. Pada penelitian ini dibandingkan delay dan rute dari kedua routing protokol yang diimplementasikan pada topologi Ring dan Mesh. Cisco Packet Tracer 5.3 digunakan untuk mensimulasikan kedua routing protokol ini. Skenario pertama adalah perancangan jaringan kemudian dilakukan pengujian waktu delay 100 kali dalam 5 kasus. Skenario kedua dilakukan pengujian trace route untuk mengetahui jalur yang dilewati paket data lalu memutus link utama. Pada skenario kedua juga dilakukan perbandingan nilai metric dan cost hasil simulasi dengan perhitungan rumus. Skenario ketiga dilakukan pengujian waktu konvergensi untuk setiap routing protokol pada setiap topologi. Hasilnya EIGRP lebih cepat 386 µs daripada OSPF untuk topologi Ring sedangkan OSPF lebih cepat 453 µs daripada EIGRP untuk topologi Mesh. Hasil trace route menunjukan rute yang dipilih oleh routing protokol yaitu nilai metric dan cost yang terkecil. Waktu konvergensi rata-rata topologi Ring pada EIGRP sebesar 12,75 detik dan 34,5 detik pada OSPF sedangkan topologi Mesh di EIGRP sebesar 13 detik dan 35,25 detik di OSPF. Kata Kunci: EIGRP, OSPF, Packet Tracer 5.3, Ring, Mesh, Konvergensi ABSTRACT EIGRP (Enhanced Interior Gateway Routing Protocol and OSPF (Open Shortest Path Fisrt is the routing protocol that is widely used in a computer network. EIGRP can only be used on devices Brand CISCO, while OSPF can be used on all brands of network. In this study comparison of both the delay and the routing protocol implemented on Ring and Mesh topology. Cisco Packet Tracer 5.3 is used to simulate both the routing protocol. The first scenario is the design of the network and then do the test of time delay 100 times in 5 cases. The

  10. Analisis Kinerja EIGRP dan OSPF pada Topologi Ring dan Mesh

    Directory of Open Access Journals (Sweden)

    DWI ARYANTA

    2016-02-01

    Full Text Available ABSTRAK EIGRP (Enhanced Interior Gateway Routing Protocol dan OSPF (Open Shortest Path Fisrt adalah routing protokol yang banyak digunakan pada suatu jaringan komputer. EIGRP hanya dapat digunakan pada perangkat Merk CISCO, sedangkan OSPF dapat digunakan pada semua merk jaringan. Pada penelitian ini dibandingkan delay dan rute dari kedua routing protokol yang diimplementasikan pada topologi Ring dan Mesh. Cisco Packet Tracer 5.3 digunakan untuk mensimulasikan kedua routing protokol ini. Skenario pertama adalah perancangan jaringan kemudian dilakukan pengujian waktu delay 100 kali dalam 5 kasus. Skenario kedua dilakukan pengujian trace route untuk mengetahui jalur yang dilewati paket data lalu memutus link utama. Pada skenario kedua juga dilakukan perbandingan nilai metric dan cost hasil simulasi dengan perhitungan rumus. Skenario ketiga dilakukan pengujian waktu konvergensi untuk setiap routing protokol pada setiap topologi. Hasilnya EIGRP lebih cepat 386 µs daripada OSPF untuk topologi Ring sedangkan OSPF lebih cepat 453 µs daripada EIGRP untuk topologi Mesh. Hasil trace route menunjukan rute yang dipilih oleh routing protokol yaitu nilai metric dan cost yang terkecil. Waktu konvergensi rata-rata topologi Ring pada EIGRP sebesar 12,75 detik dan 34,5 detik pada OSPF sedangkan topologi Mesh di EIGRP sebesar 13 detik dan 35,25 detik di OSPF. Kata Kunci : EIGRP, OSPF, Packet Tracer 5.3, Ring, Mesh, Konvergensi ABSTRACT EIGRP (Enhanced Interior Gateway Routing Protocol and OSPF (Open Shortest Path Fisrt is the routing protocol that is widely used in a computer network. EIGRP can only be used on devices Brand CISCO, while OSPF can be used on all brands of network. In this study comparison of both the delay and the routing protocol implemented on Ring and Mesh topology. Cisco Packet Tracer 5.3 is used to simulate both the routing protocol. The first scenario is the design of the network and then do the test of time delay 100 times in 5 cases. The

  11. Atoms stories; Histoire d`atomes

    Energy Technology Data Exchange (ETDEWEB)

    Radvanyi, P; Bordry, M [Centre National de la Recherche Scientifique (CNRS), 75 - Paris (France)

    1988-12-31

    Physicists from different countries told each evening during one learning week, to an audience of young people, some great discoveries in evoking the difficulties and problems to which the researchers were confronted. From Antiquity to a more recent history, it is a succession of atoms stories. (N.C.)

  12. Low energy atom-atom collisions

    International Nuclear Information System (INIS)

    Child, M.S.

    1980-01-01

    The semiclassical theory of atom-atom potential scattering and of low energy inelastic atom-atom scattering is reviewed. Particular attention is given to the origin and interpretation of rainbow structure, diffraction oscillations and exchange oscillations in the potential scattering differential cross-section, and to the glory structure and symmetry oscillations in the integral cross-section. Available methods for direct inversion of the cross-section data to recover the potential are reviewed in some detail. The theory of non-adiabatic transitions is introduced by a short discussion of interaction mechanisms and of diabetic and adiabatic representations. Analytical S matrix elements are presented for two state curve-crossing (Landau-Zener-Stuckelberg), Demkov and Nikitin models. The relation between Stuckelberg oscillations in the S matrix and in the differential cross-section is discussed in terms of interference between trajectories belonging to two different classical deflection functions. The energy dependences of the inelastic integral cross-section for curve-crossing and Demkov type transitions are also discussed. Finally the theory is reviewed in relation to a recent close-coupled study of fine structure transitions in F( 2 P) + Xe( 2 S) scattering

  13. KEJAHATAN PORNOGRAFI Upaya Pencegahan dan Penanggulangannya di Kabupaten Ponorogo

    Directory of Open Access Journals (Sweden)

    Irma Rumtianing Uswatul Hanifah

    2013-12-01

    Full Text Available Pemerintah telah mengeluarkan undang-undang No 44 Tahun 2008 tentang pornografi. Tujuan dari undang-undang tersebut salah satunya mewujudkan dan memelihara tatanan kehidupan masyarakat yang beretika, berkepribadian luhur, menjungjung tinggi nilai-nilai Ketuhanan Yang Maha Esa, serta menghormati harkat dan martabat kemanusiaan. Dalam perkembangannya, materi pornografi mengalami pertumbuhan dan penyebaran yang pesat seiring dengan perkembangan dan kemajuan teknologi informasi dan komunikasi. Peredaran dan penyebaran film porno kini semakin pesat karena ditopang dengan kecanggihan sarana informasi dan komunikasi salah satunya media internet yang bisa diakses oleh masyarakat pada setiap saat. Tulisan berikut akan mengkaji bagaimana upaya dan trategi yang dilakukan oleh Pemerintah Kabupaten Ponorogo dalam mencegah dan menanggulangi kejahatan pornografi di Kabupaten Ponorogo, apa hambatan dan bagaimana solusi dalam pencegahan serta penanggulangan kejahatan pornografi di Kabupaten Ponorogo serta bagaimana formulasi kebijakan untuk pencegahan dan penanggulangan kejahatan pornografi di Kabupaten Ponorogo. Kata kunci: Pornografi, Polres, KP3A

  14. Atoms, Molecules, and Compounds

    CERN Document Server

    Manning, Phillip

    2007-01-01

    Explores the atoms that govern chemical processes. This book shows how the interactions between simple substances such as salt and water are crucial to life on Earth and how those interactions are predestined by the atoms that make up the molecules.

  15. Atomic Energy Control Board

    International Nuclear Information System (INIS)

    Blackman, N.S.; Gummer, W.K.

    1982-02-01

    This paper has been prepared to provide an overview of the responsibilities and activities of the Atomic Energy Control Board. It is designed to address questions that are often asked concerning the establishment of the Atomic Energy Control Board, its enabling legislation, licensing and compliance activities, federal-provincial relationships, international obligations, and communications with the public

  16. mu. -nucleon atoms

    Energy Technology Data Exchange (ETDEWEB)

    Dobretsov, Yu; Dolgoshein, B; Kirillov-Ugryumov, V

    1980-12-01

    The properties and formation are described of ..mu..-nucleon atoms, the Larmor method of muon spin precession is discussed and the experimental confirmation of the existence of ..mu..-nucleon atoms is shown. The prospects of their use are indicated.

  17. μ-nucleon atoms

    International Nuclear Information System (INIS)

    Dobretsov, Yu.; Dolgoshejn, B.; Kirillov-Ugryumov, V.

    1980-01-01

    The properties and formation are described of μ-nucleon atoms, the Larmor method of muon spin precession is discussed and the experimental confirmation of the existence of μ-nucleon atoms is shown. The prospects of their use are indicated. (J.P.)

  18. Atomic Ferris wheel beams

    Science.gov (United States)

    Lembessis, Vasileios E.

    2017-07-01

    We study the generation of atom vortex beams in the case where a Bose-Einstein condensate, released from a trap and moving in free space, is diffracted from a properly tailored light mask with a spiral transverse profile. We show how such a diffraction scheme could lead to the production of an atomic Ferris wheel beam.

  19. Atom lithography of Fe

    NARCIS (Netherlands)

    Sligte, te E.; Smeets, B.; van der Stam, K.M.R.; Herfst, R.W.; Straten, van der P.; Beijerinck, H.C.W.; Leeuwen, van K.A.H.

    2004-01-01

    Direct write atom lithography is a technique in which nearly resonant light is used to pattern an atom beam. Nanostructures are formed when the patterned beam falls onto a substrate. We have applied this lithography scheme to a ferromagnetic element, using a 372 nm laser light standing wave to

  20. Beyond the Atom

    Science.gov (United States)

    Cox, John

    2011-08-01

    1. Introduction - the atom in the seventies; 2. The vacuum tube; 3. The new rays; 4. The new substances; 5. Disintegration; 6. A family tree; 7. Verifications and results; 8. The objective reality of molecules; 9. The new atom; Bibliography; Index.

  1. When Atoms Want

    Science.gov (United States)

    Talanquer, Vicente

    2013-01-01

    Chemistry students and teachers often explain the chemical reactivity of atoms, molecules, and chemical substances in terms of purposes or needs (e.g., atoms want or need to gain, lose, or share electrons in order to become more stable). These teleological explanations seem to have pedagogical value as they help students understand and use…

  2. Atom electron scattering

    International Nuclear Information System (INIS)

    Santoso, B.

    1976-01-01

    Green Lippmann-Schwinger functions operator representations, derivation of perturbation method using Green function and atom electron scattering, are discussed. It is concluded that by using complex coordinate places where resonances occur, can be accurately identified. The resonance can be processed further for practical purposes, for example for the separation of atom. (RUW)

  3. Atomic energy for progress

    International Nuclear Information System (INIS)

    1974-01-01

    The film discusses the functions and activities of the Philippine Atomic Energy Commission. Shown are the applications of atomic energy in research, agriculture, engineering, industry and medicine, as well as the construction of the research reactor and its inauguration by President Marcos

  4. Zeeman atomic absorption spectroscopy

    International Nuclear Information System (INIS)

    Loos-Vollebregt, M.T.C. de.

    1980-01-01

    A new method of background correction in atomic absorption spectroscopy has recently been introduced, based on the Zeeman splitting of spectral lines in a magnetic field. A theoretical analysis of the background correction capability observed in such instruments is presented. A Zeeman atomic absorption spectrometer utilizing a 50 Hz sine wave modulated magnetic field is described. (Auth.)

  5. Isotopes and atomic weights

    International Nuclear Information System (INIS)

    Zhang Qinglian

    1990-01-01

    A review of the chemical and mass spectrometric methods of determining the atomic weights of elements is presented. A, special discussion is devoted to the calibration of the mass spectrometer with highly enriched isotopes. It is illustrated by the recent work on europium. How to choose the candidate element for new atomic weight determination forms the last section of the article

  6. KANDUNGAN ASAM AMINO, TAURIN, MINERAL MAKRO-MIKRO, DAN VITAMIN B12 UBUR-UBUR (Aurelia aurita SEGAR DAN KERING

    Directory of Open Access Journals (Sweden)

    - - Nurjanah

    2014-06-01

    Full Text Available Tujuan penelitian adalah menentukan komposisi gizi, asam amino, taurin, mineral makro dan mikro,dan vitamin B12 pada ubur-ubur (Aurelia aurita segar dan kering. Asam amino esensial pada ubur-uburyaitu arginina, leusina, valina, treonina, lisina, isoleusina, fenilalanina, metionina, dan histidina, sedangkanasam amino non esensial yaitu asam glutamat, glisina, asam aspartat, serina, alanina, dan tirosina. Asamamino esensial tertinggi segar dan kering adalah arginina sebesar 1,72% (bk dan 1,44% (bk dan terendahhistidina yaitu sebesar 0,19% (bk dan 0,13% (bk. Asam amino non esensial segar dan kering tertinggiadalah asam glutamat dan glisina yaitu sebesar 3,26% (bk dan 2,62% (bk dan terkecil tirosina sebesar0,38% (bk dan 0,41% (bk. Taurin segar sebesar 2,68% (bk dan kering sebesar 0,67% (bk. Mineral makrotertinggi segar dan kering adalah natrium yaitu 180.092,1 ppm (bk dan 111.209,4 ppm (bk, terkecil adalahkalsium yaitu 5.750,2 ppm (bk dan 11,1 ppm (bk. Mineral mikro tertinggi segar dan kering adalah iodium yaitu8.291,5 ppm (bk dan 1.800 ppm (bk dan yang terkecil adalah tembaga yaitu 1,1 ppm (bk dan 0,6 ppm (bk.Vitamin B12 segar adalah 396,6 μm/100 g (bk dan kering 63,5 μm/100 g (bk.Kata kunci: asam amino, mineral, taurin, ubur-ubur (Aurelia aurita, vitamin B12

  7. Atomic diffusion in stars

    CERN Document Server

    Michaud, Georges; Richer, Jacques

    2015-01-01

    This book gives an overview of atomic diffusion, a fundamental physical process, as applied to all types of stars, from the main sequence to neutron stars. The superficial abundances of stars as well as their evolution can be significantly affected. The authors show where atomic diffusion plays an essential role and how it can be implemented in modelling.  In Part I, the authors describe the tools that are required to include atomic diffusion in models of stellar interiors and atmospheres. An important role is played by the gradient of partial radiative pressure, or radiative acceleration, which is usually neglected in stellar evolution. In Part II, the authors systematically review the contribution of atomic diffusion to each evolutionary step. The dominant effects of atomic diffusion are accompanied by more subtle effects on a large number of structural properties throughout evolution. One of the goals of this book is to provide the means for the astrophysicist or graduate student to evaluate the importanc...

  8. Theoretical atomic physics

    CERN Document Server

    Friedrich, Harald

    2017-01-01

    This expanded and updated well-established textbook contains an advanced presentation of quantum mechanics adapted to the requirements of modern atomic physics. It includes topics of current interest such as semiclassical theory, chaos, atom optics and Bose-Einstein condensation in atomic gases. In order to facilitate the consolidation of the material covered, various problems are included, together with complete solutions. The emphasis on theory enables the reader to appreciate the fundamental assumptions underlying standard theoretical constructs and to embark on independent research projects. The fourth edition of Theoretical Atomic Physics contains an updated treatment of the sections involving scattering theory and near-threshold phenomena manifest in the behaviour of cold atoms (and molecules). Special attention is given to the quantization of weakly bound states just below the continuum threshold and to low-energy scattering and quantum reflection just above. Particular emphasis is laid on the fundamen...

  9. Antiprotonic-hydrogen atoms

    International Nuclear Information System (INIS)

    Batty, C.J.

    1989-07-01

    Experimental studies of antiprotonic-hydrogen atoms have recently made great progress following the commissioning of the low energy antiproton facility (LEAR) at CERN in 1983. At the same time our understanding of the atomic cascade has increased considerably through measurements of the X-ray spectra. The life history of the p-bar-p atom is considered in some detail, from the initial capture of the antiproton when stopping in hydrogen, through the atomic cascade with the emission of X-rays, to the final antiproton annihilation and production of mesons. The experiments carried out at LEAR are described and the results compared with atomic cascade calculations and predictions of strong interaction effects. (author)

  10. Kemampuan Penalaran Dan Komunikasi Matematis : Apa, Mengapa, Dan Bagaimana Ditingkatkan Pada Mahasiswa

    Directory of Open Access Journals (Sweden)

    Cita Dwi Rosita

    2014-01-01

    Full Text Available Matematika diberikan kepada semua siswa tanpa terkecuali agar terlatih berpikir secara logis, analitis, sistematis, dan kreatif. Dengan kompetensi-kompetensi tersebut diharapkan siswa dapat memiliki kemampuan menerima, mengelola, dan memanfaatkan pengetahuan yang diperolehnya untuk bertahan hidup dalam keadaan yang selalu berubah dan kompetitif. Latihan berpikir, merumuskan dan memecahkan masalah serta mengambil kesimpulan akan membantu siswa untuk mengembangkan pemikirannya atau intelegensinya. Dengan demikian, semakin banyak siswa berlatih memecahkan masalah matematis maka akan semakin mengerti dan berkembang cara berpikirnya. Kemahiran siswa dalam memecahkan masalah matematis, dipengaruhi oleh kemampuannya dalam memahami matematika. Kemampuan bernalar berperan penting dalam memahami matematika. Bernalar secara matematis merupakan suatu kebiasaan berpikir, dan layaknya suatu kebiasaan, maka penalaran semestinya menjadi bagian yang konsisten dalam setiap pengalaman-pengalaman matematis siswa. Dari pengalaman-pengalaman awal siswa belajar materi matematika, penting bagi guru untuk membantu siswa memahami bahwa penegasan-penegasan harus selalu mempunyai alasan. Komunikasi matematis berperan penting pada proses pemecahan masalah. Melalui komunikasi ide bisa menjadi objek yang dihasilkan dari sebuah refleksi, penghalusan, diskusi, dan pengembangan. Proses komunikasi juga membantu dalam proses pembangunan makna dan pempublikasian ide. Ketika para siswa ditantang untuk berpikir dan bernalar tentang matematika dan mengomunikasikan hasil pikiran mereka secara lisan atau dalam bentuk tulisan, sebenarnya mereka sedang belajar menjelaskan dan meyakinkan. Mendengarkan penjelasan lain, berarti sedang memberi kesempatan kepada siswa untuk mengembangkan pemahaman mereka.

  11. KEADILAN ORGANISASIONAL DAN KONSEKUENSINYA TERHADAP ORGANIZATIONAL CITIZENSHIP BEHAVIOR GURU SMA DAN SMK KOTA MADIUN*

    Directory of Open Access Journals (Sweden)

    Veronika Agustini Srimulyani

    2017-11-01

    Full Text Available Keadilan organisasional memiliki potensi untuk menciptakan manfaat besar bagi organisasi dan karyawan, dan salah satu manfaatnya adalah menumbuhkan extra-role behavior (ERB atau organizational citizenship behavior (OCB. Tujuan dari penelitian ini untuk menganalisis konsekuensi keadilan organisasional (keadilan distributif, keadilan prosedural, dan keadilan interaksional pada organizational citizenship behavior guru SMA dan guru SMK di Kota Madiun. OCB dibagi menjadi dua jenis yaitu citizenship behaviors directed toward individuals (OCB-I dan citizenship behaviors directed towards the organisation (OCB-O. Penelitian ini menggunakan pendekatan kuantitatif dengan metode survei. Sampel penelitian ini adalah 409 guru, yang dipilih secara non-acak. Data diperoleh dengan menyebarkan kuesioner. Analisis data menggunakan analisis regresi. Hasil penelitian disimpulkan: keadilan distributif dan keadilan interaksional berpengaruh positif signifikan terhadap OCB-I dan OCB-O; keadilan prosedural tidak berpengaruh signifikan terhadap OCB-I tetapi keadilan prosedural berpengaruh positif signifikan terhadap OCB-O.

  12. Cross section measurements of the processes occurring in the fragmentation of H{sub n}{sup +} (3 {<=} n {<=} 35) hydrogen clusters induced by high speed (60 keV/u) collisions on helium atoms; Mesure des sections efficaces des differents processus intervenant dans la fragmentation d`agregats d`hydrogene H{sub n}{sup +} (3 {<=} n {<=} 35) induite par collision a haute vitesse (60 keV/u) sur un atome d`helium

    Energy Technology Data Exchange (ETDEWEB)

    Louc, Sandrine [Inst. de Physique Nucleaire, Lyon-1 Univ., 69 - Villeurbanne (France)

    1997-09-15

    Different processes involved in the fragmentation of ionised hydrogen clusters H{sub 3} + (H{sub 2}){sub (n-3)/2} (n = 5-35) have been studied in the same experiment: the fragmentation of the cluster is induced by the collision with an helium atom at high velocity ({approx_equal} c/100). The collision is realised in reversed kinematic - clusters are accelerated - which allows the detection of neutral and charged fragments. The different channels of fragmentation are identified by using coincidence techniques. For all the cluster sizes studied the capture cross sections of one electron of the target by the cluster is equal to the capture cross section of the H{sub 3}{sup +} ion. In the same way, the dissociation cross section of the H{sub 3}{sup +} core of the cluster does not depend on cluster size. These fragmentation processes are due to the interaction of H{sub 3}{sup +} core of the cluster and the helium atom without ionization of another component of the cluster. On the contrary, the cross sections of loss of one, two and three molecules by the cluster and the dissociation cross section of the cluster in all its molecular components depends strongly on the cluster size. This dependence is different from the one measured for the metastable decay of the cluster. Thus, the process of loss of molecules induced by a collision should correspond to a different dissociation mechanism. In regard of the singularities observed for the size dependence, the H{sub 9}{sup +}, H{sub 15}{sup +}, H{sub 19}{sup +} and H{sub 29}{sup +} clusters could be the `core` of the biggest clusters. These observation are in agreement with the size effects of smaller magnitude observed for the dissociation cross section (all the processes). The values of the cross section for the process of at least one ionization of the cluster indicate that about 80% of the fragmentation events result from this process. (author) 114 refs., 74 figs., 9 tabs.

  13. ANALISIS TINGKAT KEPUASAN DAN HARAPAN PASEN TERHADAP PELAYANAN PUSKESMAS DAN RUMAH SAKIT DAERAH PROVINSI DIY

    Directory of Open Access Journals (Sweden)

    Sunarto Sunarto

    2010-10-01

    Full Text Available Kepuasan merupakan perasaan seseorang mengenai kesenangan atau kekecewaan sebagai hasil membandingkan antara kinerja dan harapan. Jumlah kunjungan Puskesmas tahun 2007 sebesar 3.094.027 pasien yang terdiri dari 3.076442 rawat jalan dan 17.585 rawat inap. Penelitian untuk mengentahui gambaran tingkat kepuasan dan untuk mengetahui perbedaan tingkat kepuasan dan harapan pasien yang mendapatkan pelayanan Puskemas dan rumah sakit menurut wilayah Kabupatet / Kota di Propinsi DIY Penelitian ini merupakan penelitian deskriptif analitik dengan menggunakan rancangan cros sectional. Instrumen penelitian yang digunakan adalah kuisioner dengan 35 item pernyataan yang diambil dari atribut-atribut SERVQUAL dalam 5 dimensi. Total sampel untuk lima Kabupaten Kota sebanyak 1000, masing-masing Kabupaten Kota 200. Penelitian ini dilakukan terhadap pasien yang menerima pelayanan kesehatan di Puskesmas dan Rumah Sakit Daerah di Kabupaten-Kota Daerah Istimewa Yogyakarta. Penilaian tingkat kepuasan pasien ketika mereka berobat ke Puskesmas dan Rumah Sakit di Propinsi DIY, dengan menggunakan skala O sampai 4. Hasilnya adalah dimensi tangibles, rata-rata kepuasan pasien (2,96 cukup dan harapan pasien (3,38 pada dimensi reliability, rata-rata kepuasan pasien (3,01 bagus dan harapan pasien (3,40. Pada dimensi responsiveness, rata-rata kepuasan pa-sien (3,07 bagus dan harapan pasien (3,42. Dimensi assurance, rata-rata kepuasan pasien (3, 1 0 bagus dan harapan pasien (3 ,42. pada dimensi emphaty, rata-rata kepuasan pasien (3,02 bagus dan harapan pasien (3,35. Hasil uji statistik didapatkan nilai p > 0.05, berarti pada alpha 5%, dapat disimpulkan bahwa tidak terdapat perbedaan tingkat kepuasan diantara kelima wilayah kabupaten/kota di DIY. Penilaian tingkat kepuasan pasien, ketika mereka berkunjung ke Puskesmas dan Rumah Sakit di DIY secara rata-rata bagus dan tidak ada perbedaan tingkat kepuasan menurut wilayah Kabupaten-Kota di Propinsi DIY. Kata Kunci : Kepuasan, harapan

  14. Produksi Panel Dinding Bangunan Tahan Gempa dan Ramah Lingkungan dari Limbah Bahan Berbahaya dan Beracun Industri Minyak dan Gas

    Directory of Open Access Journals (Sweden)

    Luqman Hakim

    2015-10-01

    Full Text Available Berdasarkan hasil uji karakteristik fisik terhadap panel dinding dari komposit limbah industry migas berupa activated alumina, sandblasting dan glasswall yang telah dilakukan pada tahun pertama diketahui bahwa kuat lentur tertinggi diperoleh dari sampel B4 yaitu sebesar 67,8 Kg/Cm2 dengan standar DIN 1101 17 Kg/cm2, kuat desak sampel B 2 68,31 N/mm2 dengan standar bata merah 25 N/mm2 dan batako 20 N/mm2 dan tingkat keausan terendah diperoleh dari sampel 37 streap. Dari hasil tersebut diketahui bahwa uji telah memiliki kemampuan lebih tinggi jika dibandingkan dengan standar yang berlaku. Maka pada penelitian lanjutan yang akan dilakukan bertujuan untuk mempelajari apakah produk panel dinding ini ramah lingkungan sehingga aman bagi kesehatan manusia dan lingkungan sekitarnya.Penelitian dilakukan dengan menggunakan metode uji toxicity characteristic leaching procedure (TCLP dan LC50 terhadap produk panel dinding terbaik. Uji TCLP yang akan dilakukan yaitu dengan cara mendestruksi dan ekstraksi produk panel dinding dengan menggunakan rotating agitator selama 24 jam kemudian diuji dengan menggunakan AAS untuk mengetahui konsentrasi logam berat yang terdapat dalam produl panel dinding. Adapun untuk uji LC50 dilakukan dengan menggunakan hewan uji larva udang atau tikus.Berdasarkan hasil uji TCLP dan LC50 diketahui bahwa: a Kadar kandungan logam berat yang terdapat di dalam wall panel setelah dilakukan uji TCLP ternyata berada dibawah baku mutu seperti yang telah ditetapkan dalam PP No.85 Tahun 1999. Jadi ini artinya produk wall panel dalam penelitian ini ramah lingkungan, b pengujian terhadap bahan baku wall panel, Limbah Activated Alumina, Sandblasting dan Glasswoll sebelum di solidifikasi dapat mematikan sebesar 50% hewan uji pada konsentrasi 116.667 ppm dalam waktu 96 jam, dan c hasil uji LC50 terhadap produk wall panel selama 96 jam tidak menunjukkan adanya kematian hewan uji. Dari hasil penelitian ini dapat disimpulkan bahwa produk wall panel dari

  15. UPAYA MENINGKATKAN HASIL BELAJAR, AKTIVITAS DAN SIKAP PADA MATERI GETARAN, GELOMBANG DAN BUNYI, MELALUI METODE DISKUSI, OBSERVASI, DAN EKSPERIMEN

    Directory of Open Access Journals (Sweden)

    Yuni Lestari Purnomowati

    2016-03-01

    Full Text Available Penelitian dilakukan menggunakan metodePenelitian Tindaan Kelas (PTK. Penelitian ini dilaksanakan di  SMKN 3 Metro pada siswa Kelas XI-TKJa semester genapTahun Pelajaran 2012/2013 berjumlah 31 siswa.Sasaran perubahan dalam penelitian ini yaitu peningkatan hasil, aktivitas dan sikap siswa terhadap pelajaran Fisika. Peneliti dapat menyimpulkan bahwa peningkatan hasil belajargetaran, gelombang dan bunyi terjadi karena kerjasama siswa selama proses pembelajaran menumbuhkan suasana yang nyaman sekaligus kompetitif. Perubahan sikap siswa terhadap pelajaran Fisika semakin baik. Ketika pembelajaran fisika mampu memberikan apa yang diharapkan oleh siswa, yaitu siswa merasa nyaman, tidak terintimidasi oleh guru dan teman karena keterbatasan yang dimilikinya, terlibat dengan teman sejawat pada saat menyelesaikan tugas-tugas yang diberikan dengan diskusi, melakukan observasi, dan bereksperimen, maka persepsi terhadap fisika sebagai objek menjadi berubah lebih baik. Adanya interaksi siswa dengan media pembelajaran karena kegiatan mendiskusikan, mengobservasi, dan melakukan eksperimen mendorong siswa menjadi aktif selama proses pembelajaran. Penelitian dilakukan menggunakan metodePenelitian Tindaan Kelas (PTK. Penelitian ini dilaksanakan di  SMKN 3 Metro pada siswa Kelas XI-TKJa semester genapTahun Pelajaran 2012/2013 berjumlah 31 siswa.Sasaran perubahan dalam penelitian ini yaitu peningkatan hasil, aktivitas dan sikap siswa terhadap pelajaran Fisika. Peneliti dapat menyimpulkan bahwa peningkatan hasil belajargetaran, gelombang dan bunyi terjadi karena kerjasama siswa selama proses pembelajaran menumbuhkan suasana yang nyaman sekaligus kompetitif. Perubahan sikap siswa terhadap pelajaran Fisika semakin baik. Ketika pembelajaran fisika mampu memberikan apa yang diharapkan oleh siswa, yaitu siswa merasa nyaman, tidak terintimidasi oleh guru dan teman karena keterbatasan yang dimilikinya, terlibat dengan teman sejawat pada saat menyelesaikan tugas-tugas yang

  16. Dhenggung Asmarandana dan Dhegung Banten: Sebuah Komparasi

    Directory of Open Access Journals (Sweden)

    Teguh -

    2013-11-01

    Full Text Available The Comparation of Dhenggung Asmarandana and Dhegung Banten. Penelitian ini membahas perbandinganantara gending Dhenggung Asmaradana gaya Surakarta dengan gending Dhegung Banten gaya Yogyakarta.Berdasarkan penelitian dapat disimpulkan bahwa kedua gending memiliki persamaan dan perbedaan. Persamaankeduanya terletak pada laras, pathet, bentuk gendhing, struktur gendhing, serta balungan gending. Sedangkanperbedaannya hanya pada nama dan garap tabuhan bonang.

  17. PERTUMBUHAN EKONOMI DAN KEBUTUHAN PANGAN DI INDONESIA

    Directory of Open Access Journals (Sweden)

    S. Rusdiana

    2017-04-01

    Full Text Available Pertumbuhan ekonomi berpengaruh terhadap kebutuhan pangan, sesuai dengan pertambahan jumah penduduk. Kebutuhan pangan di Indonesia hampir dapat dipenuhi semua, dari potensi domestik, kecuali untuk komoditas pangan asal daging impor dan kedelai yang masih mengalami defisit, sedangkan untuk beras, jagung, kacang maupun ubi, telor, daging ayam, dan susu mengalami surplus yang tinggi. Tujuan tulisan ini untuk mengetahui petumbuhan ekonomi dan kebutuhan pangan di Indonesia, sehingga dapat diatasi dengan penyediaan pangan asal pertanian dan peternakan sesuai kebutuhan. Pemerintah dapat mempertahankan dan berupaya terus memacu pembangunan ketahanan pangan, melalui program yang benar-benar mampu memperkokoh untuk ketahanan pangan, sekaligus dapat meningkatkan kesejahteraan masyarakat. Kebijakan pembangunan nasional dalam rangka mewujudkan kedaulatan pangan yang diarahkan pada peningkatan produksi pangan asal daging sapi dan tanamanm pangan beras. Tingkat pendapatan rumah tangga dapat mencerminkanmenjadi salah satu ukuran kemampuan dalam mengakses konsumsi pangan yang dibutuhkan beserta keragamannya.Pertumbuhan komoditi pangan yang paling tinggi setiap tahun adalah komoditi beras, sedangkan kontribusi daging sapi dalam memenuhi kebutuhan protein hewani menduduki urutan yang kedua setelah daging unggas. Dalam pencapaian swasembada pangan perlu difokuskan pada terwujudnya ketahanan pangan dan pengembangan teknologi pangan, diharapkan mampu memfasilitasi program pasca panen dan pengolahan hasil pertanian, secara efektif, serta mendukung kebijakan pemerintah, lebih memperhatikan masalah ketahanan pangan yang ada di Indonesia.

  18. (Crustacés, Amphipodes) dans la

    African Journals Online (AJOL)

    enseignant1

    Fadil, 2006 (Crustacés, Amphipodes) dans la source Tataw (Moyen Atlas, Maroc) ... sous-espèces ou des formes locales multiples dans toute l'Europe centrale [3 - 10]. .... le pH, et la conductivité électrique ont été réalisées sur le terrain à l'aide ...

  19. Experimental atomic physics

    International Nuclear Information System (INIS)

    Anon.

    1985-01-01

    The experimental atomic physics program within the physics division is carried out by two groups, whose reports are given in this section. Work of the accelerator atomic physics group is centered around the 6.5-MV EN tandem accelerator; consequently, most of its research is concerned with atomic processes occurring to, or initiated by, few MeV/amu heavy ions. Other activities of this group include higher energy experiments at the Holifield Heavy Ion Research Facility (HHIRF), studies of electron and positron channeling radiation, and collaborative experiments at other institutions. The second experimental group concerns itself with lower energy atomic collision physics in support of the Fusion Energy Program. During the past year, the new Electron Cyclotron Resonance Source has been completed and some of the first data from this facility is presented. In addition to these two activities in experimental atomic physics, other chapters of this report describe progress in theoretical atomic physics, experimental plasma diagnostic development, and atomic data center compilation activities

  20. Penerapan Sistem Remunerasi dan Kinerja Pelayanan

    Directory of Open Access Journals (Sweden)

    Tri Wisesa Soetisna

    2015-08-01

    Full Text Available Remunerasi dapat memengaruhi motivasi pegawai sekaligus meningkatkan kinerjanya. Demikian halnya di rumah sakit sebagai institusi pelayanan kesehatan yang padat modal, sumber daya manusia serta padat ilmu dan teknologi. Penelitian ini bertujuan untuk menganalisis persepsi pegawai terhadap implementasi sistem remunerasi dan kinerja unit pelayanan bedah jantung dewasa (UPBJD di rumah sakit. Penelitian ini menggunakan pendekatan mixed methods (kuantitatif dan kualitatif. Desain penelitian kuantitatif adalah potong lintang menggunakan instrumen kuesioner self-assessment. Sedangkan desain penelitian kualitatif adalah deskriptif, dilakukan melalui focus group discussion dan telaah dokumen pada data berupa buku jadwal, buku registrasi, catatan keperawatan, dan rekam medis. Pengambilan data dilakukan pada tahun 2013 di salah satu rumah sakit di Jakarta. Responden/informan adalah staf medis fungsional, perawat, dan petugas administrasi berjumlah 29 orang. Data dianalisis secara univariat (metode kuantitatif, dan content analysis (metode kualitatif. Hasil penelitian menunjukkan bahwa sebagian besar staf medis fungsional dan perawat tidak puas (71,2% dengan beberapa hal dalam penerapan sistem remunerasi, seperti pada sistem penggajian dan penentuan grading. Terlihat kinerja unit pelayanan bedah jantung dewasa mengalami kenaikan setiap tahun sebelum dan setelah penerapan sistem remunerasi. Diharapkan agar rumah sakit ini dapat memperbaiki sistem remunerasi yang sesuai ketentuan kebijakan dan menyusun formulasi insentif dan bonus yang lebih sesuai dengan kondisi saat ini serta perlu dilakukan sosialisasi yang tepat dan evaluasi secara berkala. Implementation of Remuneration System and Service Performance Remuneration can influence worker`s motivation, and improve their performance. Likewise in hospital as capital-intensive, human resources-intensive as well as knowledge and technology-intensive health care institution. This study aimed to analyze employee

  1. HUBUNGAN NONMONOTONIK ANTARA KONTROL DAN KINERJA PERUSAHAAN

    Directory of Open Access Journals (Sweden)

    Gede Juliarsa

    2012-07-01

    Full Text Available ABSTRAK Dalam rerangka agency theory, manajemen perusahaan merupakan agent yang harus bertanggung jawab kepada pemegang saham sebagai principal. Agent diberikan tanggung jawab untuk mengelola aset principal untuk dapat dikelola secara ekonomis. Studi ini bertujuan untuk mengetahui hubungan antara kinerja perusahaan dengan kepemilikan manajemen dan ukuran perusahaan. Studi ini menguji 46 kinerja perusahaan tahun 2001 terhadap perusahaan go public yang terdaftar di Bursa Efek Jakarta.  Data diperoleh dari Indonesian Capital Market Directory 2002. Pengujian hubungan antara kinerja perusahaan menggunakan Economic Value Added, kepemilikan manajemen, dan ukuran perusahaan dilakukan dengan analisis regresi berganda dan korelasi. Hasil pengujian menunjukkan bahwa hubungan antara kinerja perusahaan, ukuran perusahaan, dan kepemilikan manajemen adalah tidak monotonik, tetapi secara signifikan curvilinear. Temuan ini sesuai dengan penelitian yang dilakukan oleh Fogelberg dan Griffth (2000.   Kata kunci: economic value added, kepemilikan manajemen, kinerja,ukuran perusahaan, teori agensi

  2. Atomic mass spectrometry

    International Nuclear Information System (INIS)

    Sanz-Medel, A.

    1997-01-01

    The elemental inorganic analysis seems to be dominated today by techniques based on atomic spectrometry. After an evaluation of advantages and limitations of using mass analysers (ion detectors) versus conventional photomultipliers (photon detector) a brief review of the more popular techniques of the emerging Atomic Mass spectrometry is carried out. Their huge potential for inorganic trace analysis is such that in the future we could well witness how this end of the century and millennium marked the fall of the photons empire in Analytical Atomic Spectrometry. (Author)

  3. Physics of the atom

    CERN Document Server

    Wehr, Russell M; Adair, Thomas W

    1984-01-01

    The fourth edition of Physics of the Atom is designed to meet the modern need for a better understanding of the atomic age. It is an introduction suitable for students with a background in university physics and mathematical competence at the level of calculus. This book is designed to be an extension of the introductory university physics course into the realm of atomic physics. It should give students a proficiency in this field comparable to their proficiency in mechanics, heat, sound, light, and electricity.

  4. Atom trap trace analysis

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Z.-T.; Bailey, K.; Chen, C.-Y.; Du, X.; Li, Y.-M.; O' Connor, T. P.; Young, L.

    2000-05-25

    A new method of ultrasensitive trace-isotope analysis has been developed based upon the technique of laser manipulation of neutral atoms. It has been used to count individual {sup 85}Kr and {sup 81}Kr atoms present in a natural krypton sample with isotopic abundances in the range of 10{sup {minus}11} and 10{sup {minus}13}, respectively. The atom counts are free of contamination from other isotopes, elements,or molecules. The method is applicable to other trace-isotopes that can be efficiently captured with a magneto-optical trap, and has a broad range of potential applications.

  5. Division of atomic physics

    International Nuclear Information System (INIS)

    Kroell, S.

    1994-01-01

    The Division of Atomic Physics, Lund Institute of Technology (LTH), is responsible for the basic physics teaching in all subjects at LTH and for specialized teaching in Optics, Atomic Physics, Atomic and Molecular Spectroscopy and Laser Physics. The Division has research activities in basic and applied optical spectroscopy, to a large extent based on lasers. It is also part of the Physics Department, Lund University, where it forms one of eight divisions. Since the beginning of 1980 the research activities of our division have been centred around the use of lasers. The activities during the period 1991-1992 is described in this progress reports

  6. Atom trap trace analysis

    International Nuclear Information System (INIS)

    Lu, Z.-T.; Bailey, K.; Chen, C.-Y.; Du, X.; Li, Y.-M.; O'Connor, T. P.; Young, L.

    2000-01-01

    A new method of ultrasensitive trace-isotope analysis has been developed based upon the technique of laser manipulation of neutral atoms. It has been used to count individual 85 Kr and 81 Kr atoms present in a natural krypton sample with isotopic abundances in the range of 10 -11 and 10 -13 , respectively. The atom counts are free of contamination from other isotopes, elements,or molecules. The method is applicable to other trace-isotopes that can be efficiently captured with a magneto-optical trap, and has a broad range of potential applications

  7. Seminar dan Wokshop Jurnalistik Anak SMA “Yournalism”

    OpenAIRE

    T.R, Amal Gamasi; Nugroho, Adi; Setyabudi, Djoko

    2013-01-01

    PENDAHULUANMasyarakat Indonesia saat ini merupakan masyarakat informasi yangmenghabiskan sebagian besar waktunya dengan media komunikasi dan menggunakanteknologi informasi seperti ponsel dan komputer maupun laptop. Mereka akan mudahmelakukan pertukaran data informasi karena saat ini,mengingat konvergensi mediatidak hanya mengubah basis data dan medium yang menyalurkannya, tetapi jugasecara keseluruhan mengubah proses produksi, pengolahan, dan distribusi informasisehingga media-media seperti k...

  8. Section of Atomic Collisions

    International Nuclear Information System (INIS)

    Berenyi, D.; Biri, S.; Gulyas, L.; Juhasz, Z.; Kover, A.; Orban, A.; Palinkas, J.; Papp, T.; Racz, R.; Ricz, S.

    2009-01-01

    The Section of Atomic Collisions is a research unit with extended activity in the field of atomic and molecular physics. Starting from the study of atomic processes at the beamlines of nuclear physics accelerators in the seventies, our research community became one of the centers of fundamental research in Atomki. We also have a strong connection to materials sciences especially along the line of electron and ion spectroscopy methods. Our present activity covers a wide range of topics from atomic collision mechanisms of fundamental interest, to the complex interactions of electrons, ions, photons and antiparticles with atoms, molecules, surfaces, and specific nanostructures. In the last few years, an increasing fraction of our present topics has become relevant for applications, e.g., molecular collision studies for the radiation therapy methods of tumors, or ion-nanostructure interactions for the future construction of small ion-focusing elements. Our section belongs to the Division of Atomic Physics. The other unit of the Division is the Section of Electron Spectroscopy and Materials Sciences. There are traditionally good connections and a strong collaboration between the groups of the two sections in many fields. From the very beginning of our research work in atomic collisions, external collaborations were of vital importance for us. We regularly organize international workshops in the field of fast ion-atom collisions and related small conferences in Debrecen from 1981. Recently, we organized the Conference on Radiation Damage in Biomolecular Systems (RADAM 2008, Debrecen), and coorganized the Conference on Elementary Processes in Atomic Systems (CEPAS 2008, Cluj). We have access to several large scale facilities in Europe within the framework of formal and informal collaborations. The next themes are in this article: Forward electron emission from energetic atomic collisions; Positron-atom collisions; Photon-atom interactions; Interference effects in electron

  9. Innovation and optimization of a method of pump-probe polarimetry with pulsed laser beams in view of a precise measurement of parity violation in atomic cesium; Innovation et optimisation d'une methode de polarimetrie pompe-sonde avec des faisceaux laser impulsionnels en vue d'une mesure precise de violation de la parite dans l'atome de cesium

    Energy Technology Data Exchange (ETDEWEB)

    Chauvat, D

    1997-10-15

    While Parity Violation (PV) experiments on highly forbidden transitions have been using detection of fluorescence signals; our experiment uses a pump-probe scheme to detect the PV signal directly on a transmitted probe beam. A pulsed laser beam of linear polarisation {epsilon}{sub 1} excites the atoms on the 6S-7S cesium transition in a colinear electric field E || k(ex). The probe beam (k(pr) || k(ex)) of linear polarisation {epsilon}{sub 2} tuned to the transition 7S-6P(3/2) is amplified. The small asymmetry ({approx} 10{sup -6}) in the gain that depends on the handedness of the tri-hedron (E, {epsilon}{sub 1}, {epsilon}{sub 2}) is the manifestation of the PV effect. This is measured as an E-odd apparent rotation of the plane of polarization of the probe beam; using balanced mode polarimetry. New criteria of selection have been devised, that allow us to distinguish the true PV-signal against fake rotations due to electromagnetic interferences, geometrical effects, polarization imperfections, or stray transverse electric and magnetic fields. These selection criteria exploit the symmetry of the PV-rotation - linear dichroism - and the revolution symmetry of the experiment. Using these criteria it is not only possible to reject fake signals, but also to elucidate the underlying physical mechanisms and to measure the relevant defects of the apparatus. The present signal-to-noise ratio allows embarking in PV measurements to reach the 10% statistical accuracy. A 1% measurement still requires improvements. Two methods have been demonstrated. The first one exploits the amplification of the asymmetry at high gain - one major advantage provided by our detection method based on stimulated emission. The second method uses both a much higher incident intensity and a special dichroic component which magnifies tiny polarization rotations. (author)

  10. TUGAS DAN WEWENANG PUSAT PELAPORAN DAN ANALISIS TRANSAKSI KEUANGAN (PPATK DALAM PEMBERANTASAN TINDAK PIDANA PENCUCIAN UANG

    Directory of Open Access Journals (Sweden)

    Johari Johari

    2014-03-01

    Full Text Available Tugas dan wewenang Pusat Pelaporan dan Analisis Transaksi Keuangan (PPATK terdapat di dalam Pasal 26 dan Pasal 27 Undang-Undang No. 25 Tahun 2003 tentang Tindak Pencucian Uang. Berdasarkan ketentuan tersebut, tugas dan wewenang PPATK tersebut bertujuan untuk mendeteksi terjadinya tindak pidana pencucian uang, dan membantu penegakan hukum yang berkaitan dengan pencucian uang, termasuk tindak pidana asal yang melahirkannya (predicate offences. Namun, Peranan PPATK akan berjalan secara efektif apabila aparat penegak hukum seperti Kepolisian, Kejaksaan, Pengadilan, Bea dan Cukai, para regulator seperti Bank Indonesia, Departemen Keuangan, Badan Pengawas Pasar Modal serta Penyedia Jasa Keuangan, industri perbankan, asuransi, perusahaan pembiayaan, dana pensiun, perusahaan efek, pengelola reksadana, media massa, masyarakat bekerjasama secara terorganisir dan terpadu dalam pemberantasan tindak pencucian uang di Indonesia. Dengan kewenangan yang dimilikinya, PPATK dapat mengejar hasil dari kejahatan, apabila hasil kejahatan tersebut dapat dikejar dan disita maka negara dengan sendirinya akan mengurangi tindak kejahatan itu sendiri. Kata kunci : Pencucian uang, tindak pidana pencucian uang (money laundering, kejahatan terorganisir, dan Pusat Pelaporan dan Analisis Transaksi Keuangan (PPATK.

  11. PENGARUH VARIETAS DAN SISTEM BUDIDAYA TERHADAP PERTUMBUHAN, PRODUKSI, DAN KANDUNGAN GIZI JAGUNG (ZEA MAYS L.

    Directory of Open Access Journals (Sweden)

    Yukarie Ayu Wulandari

    2016-06-01

    Full Text Available Jagung merupakan bahan pangan yang berpotensi untuk dikembangkan sebagai pangan lokal, pakan, dan bahan baku industri. Mengingat pentingnya jagung, maka perlu adanya upaya untuk peningkatan produktivitasnya. Penelitian bertujuan untuk mengetahui pengaruh varietas dan sistem budidaya terhadap pertumbuhan, produksi, dan kandungan gizi jagung. Penelitian menggunakan Rancangan Petak Terbagi dengan petak utama varietas (Srikandi Putih-1 dan Srikandi Kuning-1 dan anak petak sistem budidaya (organik dan inorganik yang diulang lima kali. Hasil menunjukkan bahwa varietas Srikandi Putih-1 memberikan hasil tertinggi pada tinggi tanaman, jumlah daun, luas daun, lingkar batang, pati, dan vitamin A. Varietas Srikandi Kuning-1 memberikan hasil tertinggi pada produksi, protein dan lemak. Sistem budidaya inorganik memberikan hasil tertinggi pada tinggi tanaman, jumlah daun, panjang tongkol, bobot bersih tongkol, bobot pipilan kering, bobot 100 butir, konversihasil/ha, patidan protein. Interaksi varietas Srikandi Putih-1 dengan sistem budidaya organik memberikan hasil tertinggi terhadap jumlah daun, lingkar batang dan kandungan vitamin A. Varietas Srikandi Kuning-1 yang dibudidayakan secara inorganik memberikan hasil tertinggi terhadap bobot bersih tongkol, bobot pipilan kering, bobot 100 butir, konversi hasil ha-1 dan kandungan protein. Kandungan pati tertinggi pada varietas Srikandi Putih-1 yang dibudidayakan secara inorganik, sedangkan kandungan lemak tertinggi pada varietas Srikandi Kuning-1 yang dibudidayakan secara organik.

  12. Peran Mitra Strategis dan Agen Perubahan dalam Manajemen Talenta dan Kinerja Manajer

    Directory of Open Access Journals (Sweden)

    Ida Ketut Kusumawijaya

    2014-06-01

    Full Text Available Abstract  The purposes of the study are to analyze: (1 characteristic of strategic partner and change agent roles, talent management and managers performance, (2 influence of strategic partner and change agent roles to talent management and its impact to managers performance. Four hundred hotel managers in Bali were participated in this study by using proportional random sampling. Data were analyzed using descriptive analysis and SEM. The result shows that: (1 strategic partner and change agent role, talent management and managers performance are in enough category, (2 positive and significant effect between strategic partner and change agent roles to talent management and its impact to managers performance. Keywords:Strategic Partner Role, Change Agent Role, Talent Management, Managers Performance.AbstrakTujuan penelitian ini adalah untuk menganalisis: (1 karakteristik dari mitra strategis dan peran agen perubahan, manajemen bakat dan kinerja manajer, (2 pengaruh mitra strategis dan peran agen perubahan untuk manajemen bakat dan dampaknya terhadap kinerja manajer. Sebanyak empat ratus manajer hotel di Bali berpartisipasi dalam penelitian ini dengan menggunakan proporsional random sampling. Data dianalisis menggunakan analisis deskriptif dan SEM. Hasil penelitian menunjukkan bahwa: (1 mitra strategis dan peran agen perubahan, manajemen bakat dan kinerja manajer termasuk dalam kategori cukup, (2 pengaruh positif dan signifikan antara mitra strategis dan peran agen perubahan untuk manajemen bakat dan dampaknya terhadap kinerja manajer.Keywords: Peran Mitra Strategis, Peran Agen Perubahan, Manajemen Talenta, kinerja Manajer.

  13. History of early atomic clocks

    International Nuclear Information System (INIS)

    Ramsey, N.F.

    2005-01-01

    This review of the history of early atomic clocks includes early atomic beam magnetic resonance, methods of separated and successive oscillatory fields, microwave absorption, optical pumping and atomic masers. (author)

  14. Frequency shift due to blackbody radiation in a cesium atomic fountain and improvement of the clock performances; Deplacement de frequence du au rayonnement du corps noir dans une fontaine atomique a cesium et amelioration des performances de l'horloge

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, S

    2004-07-01

    FO1 was the first caesium fountain primary frequency standard in the world. The most recent evaluation in 2002 before improvement reached an accuracy of 1*10{sup -15} when operated with optical molasses. Working as an extremely precise and stable instrument, FO1 has contributed to fundamental physics and technical measurements: - Frequency comparison between Cs and Rb fountains over an interval of 5 years sets an upper limit for a possible variation of the fine structure constant as |alpha/alpha| < 2*10{sup -15}/y. The resolution is about 5 times better than the previous test in our laboratory. The projected accuracy of the space clock PHARAO is 1*10{sup -16}. We confirmed its Ramsey cavity performance by testing the phase difference between the two interaction zones in FO1. The measured temperature T dependent frequency shift of the Cs clock induced by the blackbody radiation field is given as nu(T)=154(6)*10{sup -6}*(T/300){sup 4}[1+{epsilon}(T/300){sup 2}] Hz with the theoretical value {epsilon} = 0,014. The obtained accuracy represents a 3 times improvement over the previous measurement by the PTB group. Some improvements have been carried out on FO1. The new FO1 version works directly with optical molasses loaded by a laser slowed atomic beam. The application of the adiabatic passage method to perform the state selection allows us to determine the atom number dependent frequency shifts due to the cold collision and cavity pulling effects at a level of of 10{sup -16}. Recently, the obtained frequency stability is 2,8*10{sup -14}*{tau}{sup -1/2} for about 4*10{sup 6} detected atoms. The accuracy is currently under evaluation, the expected value is a few times 10{sup -16}. (author)

  15. Atomic Energy Authority Bill

    International Nuclear Information System (INIS)

    Gray, J.H.N.; Stoddart, D.L.; Sinclair, R.M.; Ezra, D.

    1985-01-01

    The House, in Committee, discussed the following matters in relation to the Atomic Energy Authority Bill; financing; trading; personnel conditions of employment; public relations; organization; research programmes; fuels; energy sources; information dissemination. (U.K.)

  16. Atomic and Molecular Interactions

    International Nuclear Information System (INIS)

    2002-01-01

    The Gordon Research Conference (GRC) on Atomic and Molecular Interactions was held at Roger Williams University, Bristol, RI. Emphasis was placed on current unpublished research and discussion of the future target areas in this field

  17. Zeeman atomic absorption spectrometry

    International Nuclear Information System (INIS)

    Hadeishi, T.; McLaughlin, R.

    1978-08-01

    The design and development of a Zeeman atomic absorption spectrometer for trace element analysis are described. An instruction manual is included which details the operation, adjustment, and maintenance. Specifications and circuit diagrams are given

  18. Optics With Cold Atoms

    National Research Council Canada - National Science Library

    Hau, Lene

    2004-01-01

    .... And to test the novel atom sensor, we have built a moving-molasses magneto-optical trap in a geometry tailor-suited to the nanotube detector geometry, involving construction of a highly stable laser...

  19. Atomic Energy Control Regulations

    International Nuclear Information System (INIS)

    1992-01-01

    This is the consolidated text of the Atomic Energy Control Regulations of 17 March 1960, with amendments to 27 August 1992. The Regulations cover the licensing of nuclear facilities, radiation sources, including uranium mining, radiation protection questions, etc. (NEA)

  20. The atomic conflict

    International Nuclear Information System (INIS)

    Mez, L.

    1981-01-01

    This book provides a general view at the atomic programmes of several countries and makes an attempt to unmask the atomic industrial combines with their interlockings. The governments role is analysed as well as the atomic policy of the parties, union-trades and associations. Then, the anti-atomic movements in those countries, their forms of resistance, the resonance and the alternative proposals are presented. The countries concerned are Australia, the FRG, COMECON, Danmark, the EG, Finland, France, Great Britain, Ireland, Japan, the Netherlands, Norway, Austria, Sweden, Switzerland, Spain and the USA. For the pocket book version, Lutz Mez adds an updating epilogue which continues with the developments until springtime 1981. (orig./HP) [de

  1. Advances in atomic spectroscopy

    CERN Document Server

    Sneddon, J

    1998-01-01

    This volume continues the series'' cutting-edge reviews on developments in this field. Since its invention in the 1920s, electrostatic precipitation has been extensively used in industrial hygiene to remove dust and particulate matter from gases before entering the atmosphere. This combination of electrostatic precipitation is reported upon in the first chapter. Following this, chapter two reviews recent advances in the area of chemical modification in electrothermal atomization. Chapter three consists of a review which deal with advances and uses of electrothermal atomization atomic absorption spectrometry. Flow injection atomic spectroscopy has developed rapidly in recent years and after a general introduction, various aspects of this technique are looked at in chapter four. Finally, in chapter five the use of various spectrometric techniques for the determination of mercury are described.

  2. Atom chip gravimeter

    Science.gov (United States)

    Schubert, Christian; Abend, Sven; Gebbe, Martina; Gersemann, Matthias; Ahlers, Holger; Müntinga, Hauke; Matthias, Jonas; Sahelgozin, Maral; Herr, Waldemar; Lämmerzahl, Claus; Ertmer, Wolfgang; Rasel, Ernst

    2016-04-01

    Atom interferometry has developed into a tool for measuring rotations [1], accelerations [2], and testing fundamental physics [3]. Gravimeters based on laser cooled atoms demonstrated residual uncertainties of few microgal [2,4] and were simplified for field applications [5]. Atomic gravimeters rely on the interference of matter waves which are coherently manipulated by laser light fields. The latter can be interpreted as rulers to which the position of the atoms is compared. At three points in time separated by a free evolution, the light fields are pulsed onto the atoms. First, a coherent superposition of two momentum states is produced, then the momentum is inverted, and finally the two trajectories are recombined. Depending on the acceleration the atoms experienced, the number of atoms detected in the output ports will change. Consequently, the acceleration can be determined from the output signal. The laser cooled atoms with microkelvin temperatures used in state-of-the-art gravimeters impose limits on the accuracy [4]. Therefore, ultra-cold atoms generated by Bose-Einstein condensation and delta-kick collimation [6,7] are expected to be the key for further improvements. These sources suffered from a low flux implying an incompatible noise floor, but a competitive performance was demonstrated recently with atom chips [8]. In the compact and robust setup constructed for operation in the drop tower [6] we demonstrated all steps necessary for an atom chip gravimeter with Bose-Einstein condensates in a ground based operation. We will discuss the principle of operation, the current performance, and the perspectives to supersede the state of the art. The authors thank the QUANTUS cooperation for contributions to the drop tower project in the earlier stages. This work is supported by the German Space Agency (DLR) with funds provided by the Federal Ministry for Economic Affairs and Energy (BMWi) due to an enactment of the German Bundestag under grant numbers DLR 50WM

  3. Atoms at work

    International Nuclear Information System (INIS)

    1982-07-01

    This illustrated booklet discusses the following: atoms; fission of uranium; nuclear power plants; reactor types; plutonium (formation, properties, uses); radioactive waste (fuel cycle, reprocessing, waste management); nuclear fusion; fusion reactors; radiation; radioisotopes and their uses. (U.K.)

  4. Topics in atomic physics

    CERN Document Server

    Burkhardt, Charles E

    2006-01-01

    The study of atomic physics propelled us into the quantum age in the early twentieth century and carried us into the twenty-first century with a wealth of new and, in some cases, unexplained phenomena. Topics in Atomic Physics provides a foundation for students to begin research in modern atomic physics. It can also serve as a reference because it contains material that is not easily located in other sources. A distinguishing feature is the thorough exposition of the quantum mechanical hydrogen atom using both the traditional formulation and an alternative treatment not usually found in textbooks. The alternative treatment exploits the preeminent nature of the pure Coulomb potential and places the Lenz vector operator on an equal footing with other operators corresponding to classically conserved quantities. A number of difficult to find proofs and derivations are included as is development of operator formalism that permits facile solution of the Stark effect in hydrogen. Discussion of the classical hydrogen...

  5. Atomic Interferometry, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — Vertical cavity surface emitting lasers (VCSELs) is a new technology which can be used for developing high performance laser components for atom-based sensors...

  6. Atomic bomb cataracts

    International Nuclear Information System (INIS)

    Shiraeda, Kanji

    1992-01-01

    Eye disturbance caused by atomic bomb radiation can be divided into three groups: direct injury immediately after exposure, eye lesions associated with radiation syndrome, and delayed disturbance. The crystalline lens of the eye is the most radiosensitive. Atomic bomb cataract has been investigated in a number of studies. The first section of this chapter discusses radiation cataract in terms of the incidence and characteristics. The second section deals with atomic bomb cataract, which can be diagnosed based on the four criteria: (1) opacity of the crystalline lens, (2) a history of proximal exposure, (3) lack of eye disease complicating cataract, and (4) non-exposure to radiation other than atomic bombing. The prevalence of cataract and severity of opacity are found to correlate with exposure doses and age at the time of exposure. Furthermore, it is found to correlate with distance from the hypocenter, the condition of shielding, epilation, and the presence or absence or degree of radiation syndrome. (N.K.)

  7. PENGARUH CARA PENGAWETAN TERHADAP KOMPOSISI KIMIA DAN EFISIENSI DALAM BENTUK HAY DAN SILASE PADA DAUN 16 PROVENAN GAMAL (GLIRICIDIA SEPIUM

    Directory of Open Access Journals (Sweden)

    A. W. Puger

    2012-09-01

    Full Text Available RINGKASAN Percobaan yang bertujuan untuk mengetahui pengaruh cara pengawetan terhadap kandungan zat-zat makanan dan efisiensinya pada daun 16 provenan gamal telah dilaksanakan selama 3 bulan. Penelitian menggunakan rancangan acak lengkap yang terdiri atas 3 perlakuan pengawetan (gamal segar, gamal hay, dan gamal silase dan 3 blok sebagai ulangan. Setiap perlakuan terdiri atas 16 provenan, yaitu 6 dari Mexico (M, 4 dari Guatemala (G, dan satu provenan masing-masing dari Colombia (C, Indonesia (I, Nicaragua (N, Panama (P, Costa Rica (R, dan Venezuela (V. Sampel setiap daun (helai dan tangkai provenan sebelum dan setelah diawetkan dianalisis kandungan zat-zat makanannya dan dihitung efisiensinya setelah dibuat hay dan silase. Kandungan DM dan CP dari hay adalah tertinggi (P0,05 setelah diawetkan menjadi hay dan silase, sedangkan efisiensi DM, OM, dan CP dari hay lebih tinggi (P<0,05 daripada silase. Provenan P13, R12, dan M34 mengandung zat-zat makanan lebih tinggi; sementara provenan G14 dan G17 lebih efisien bila diawetkan dalam bentuk hay dan silase. Pada pertanian lahan kering pengawetan gamal dalam bentuk hay lebih efektif dan efisien jika dibandingkan dengan dalam bentuk silase.

  8. The Atomic Energy Control Board

    International Nuclear Information System (INIS)

    Doern, G.B.

    1976-01-01

    This study describes and assesses the regulatory and administrative processes and procedures of the Atomic Energy Control Board, the AECB. The Atomic Energy Control Act authorized the AECB to control atomic energy materials and equipment in the national interest and to participate in measures for the international control of atomic energy. The AECB is authorized to make regulations to control atomic energy materials and equipment and to make grants in support of atomic energy research. (author)

  9. Energy flux of hot atoms

    International Nuclear Information System (INIS)

    Wotzak, G.P.; Kostin, M.D.

    1976-01-01

    The process in which hot atoms collide with thermal atoms of a gas, transfer kinetic energy to them, and produce additional hot atoms is investigated. A stochastic method is used to obtain numerical results for the spatial and time dependent energy flux of hot atoms in a gas. The results indicate that in hot atom systems a front followed by an intense energy flux of hot atoms may develop

  10. Harnessing the atom

    International Nuclear Information System (INIS)

    1999-01-01

    Splitting the atom has had a major impact on the history of the latter part of the 20th century. This film depicts the many benefits - and also drawbacks - of nuclear technology, and describes how the International Atomic Energy Agency performs its various tasks. It touches on challenges such as the choice between major energy sources, growing concerns about the global climate, and prospects for nuclear arms control and disarmament

  11. Atomic Energy Act 1946

    International Nuclear Information System (INIS)

    1946-01-01

    This Act provides for the development of atomic energy in the United Kingdom and for its control. It details the duties and powers of the competent Minister, in particular his powers to obtain information on and to inspect materials, plant and processes, to control production and use of atomic energy and publication of information thereon. Also specified is the power to search for and work minerals and to acquire property. (NEA) [fr

  12. Hirshfeld atom refinement.

    Science.gov (United States)

    Capelli, Silvia C; Bürgi, Hans-Beat; Dittrich, Birger; Grabowsky, Simon; Jayatilaka, Dylan

    2014-09-01

    Hirshfeld atom refinement (HAR) is a method which determines structural parameters from single-crystal X-ray diffraction data by using an aspherical atom partitioning of tailor-made ab initio quantum mechanical molecular electron densities without any further approximation. Here the original HAR method is extended by implementing an iterative procedure of successive cycles of electron density calculations, Hirshfeld atom scattering factor calculations and structural least-squares refinements, repeated until convergence. The importance of this iterative procedure is illustrated via the example of crystalline ammonia. The new HAR method is then applied to X-ray diffraction data of the dipeptide Gly-l-Ala measured at 12, 50, 100, 150, 220 and 295 K, using Hartree-Fock and BLYP density functional theory electron densities and three different basis sets. All positions and anisotropic displacement parameters (ADPs) are freely refined without constraints or restraints - even those for hydrogen atoms. The results are systematically compared with those from neutron diffraction experiments at the temperatures 12, 50, 150 and 295 K. Although non-hydrogen-atom ADPs differ by up to three combined standard uncertainties (csu's), all other structural parameters agree within less than 2 csu's. Using our best calculations (BLYP/cc-pVTZ, recommended for organic molecules), the accuracy of determining bond lengths involving hydrogen atoms from HAR is better than 0.009 Å for temperatures of 150 K or below; for hydrogen-atom ADPs it is better than 0.006 Å(2) as judged from the mean absolute X-ray minus neutron differences. These results are among the best ever obtained. Remarkably, the precision of determining bond lengths and ADPs for the hydrogen atoms from the HAR procedure is comparable with that from the neutron measurements - an outcome which is obtained with a routinely achievable resolution of the X-ray data of 0.65 Å.

  13. Manipulating atoms with photons

    International Nuclear Information System (INIS)

    Cohen-Tannoudji, C.N.

    1998-01-01

    The article is a translation of the lecture delivered on the occasion of the 1997 Nobel Prize awarding ceremony. The physical mechanisms which allow manipulating of neutral atoms with laser photons are described. A remark is also made concerning several possible applications of ultra-cool atoms and streams of future research. The article is completed by Prof. Cohen-Tannoudji's autobiography. (Z.J.)

  14. Atoms, molecules & elements

    CERN Document Server

    Graybill, George

    2007-01-01

    Young scientists will be thrilled to explore the invisible world of atoms, molecules and elements. Our resource provides ready-to-use information and activities for remedial students using simplified language and vocabulary. Students will label each part of the atom, learn what compounds are, and explore the patterns in the periodic table of elements to find calcium (Ca), chlorine (Cl), and helium (He) through hands-on activities.

  15. Atomic bomb and leukemia

    Energy Technology Data Exchange (ETDEWEB)

    Ichimaru, M; Tomonaga, M; Amenomori, T; Matsuo, T [Nagasaki Univ. (Japan). School of Medicine

    1991-12-01

    Characteristic features of the leukemia among atomic bomb survivors were studied. Dose estimates of atomic bomb radiation were based on T65D, but the new dosimetry system DS86 was used for some analyses. The ratio of a single leukemia type to all leukemias was highest for chronic myelogenous leukemia (CML) in Hiroshima, and the occurrence of CML was thought to be most characteristic to atomic bomb radiation induced leukemia. The threshold of CML occurrence in Hiroshima is likely to be between 0.5{approx}0.09 Gy. However, the threshold of acute leukemia appears to be nearly 1 Gy. In the distribution of acute myeloid leukemia (AML) subtypes by French-American-British classification, there was no M3 case in 1 Gy or more group, although several atypical AML cases of survivors were observed. Although aplastic anemia has not increased as a late effect of the atomic bomb radiation exposure, many atypical leukemia or other myeloproliferative diseases who had been diagnosed as aplastic anemia or its related diseases have been experienced among atomic bomb survivors. Chromosome study was conducted using colony forming cells induced by hemopoietic stem cells of peripheral blood of proximal survivors. Same chromosome aberrations were observed in colony forming cells and peripheral T-cells in several atomic bomb survivors. (author).

  16. On the bosonic atoms

    Science.gov (United States)

    Amusia, M. Ya.; Chernysheva, L. V.

    2018-01-01

    We investigate ground state properties of atoms, in which substitute fermions - electrons by bosons, namely π --mesons. We perform some calculations in the frame of modified Hartree-Fock (HF) equation. The modification takes into account symmetry, instead of anti-symmetry of the pair identical bosons wave function. The modified HF approach thus enhances (doubles) the effect of self-action for the boson case. Therefore, we accordingly modify the HF equations by eliminating the self-action terms "by hand". The contribution of meson-meson and meson-nucleon non-Coulomb interaction is inessential at least for atoms with low and intermediate nuclear charge, which is our main subject. We found that the binding energy of pion negative ions A π - , pion atoms A π , and the number of extra bound pions ΔN π increases with the growth of nuclear charge Z. For e.g. Xe ΔN π = 4. As an example of a simple process with a pion atom, we consider photoionization that differs essentially from that for electron atoms. Namely, it is not monotonic decreasing from the threshold but has instead a prominent maximum above threshold. We study also elastic scattering of pions by pion atoms.

  17. Electron - atom bremsstrahlung

    International Nuclear Information System (INIS)

    Kim, L.

    1986-01-01

    Features of bremsstrahlung radiation from neutral atoms and atoms in hot dense plasmas are studied. Predictions for the distributions of electron-atom bremsstrahlung radiation for both the point-Coulomb potential and screened potentials are obtained using a classical numerical method. Results agree with exact quantum-mechanical partial-wave results for low incident electron energies in both the point-Coulomb and screened potentials. In the screened potential, the asymmetry parameter of a spectrum is reduced from the Coulomb values. The difference increases with decreasing energy and begins to oscillate at very low energies. The scaling properties of bremsstrahlung spectra and energy losses were also studied. It was found that the ratio of the radiative energy loss for positrons to that for electrons obeys a simple scaling law, being expressible fairly accurately as a function only of the quantity T 1 /Z 2 . This scaling is exact in the case of the point-Coulomb potential, both for classical bremsstrahlung and for the nonrelativistic dipole Sommerfeld formula. Bremsstrahlung from atoms in hot dense plasmas were also studied describing the atomic potentials by the temperature-and-density dependent Thomas-Fermi mode. Gaunt factors were obtained with the relativistic partial-wave method for atoms in plasmas of various densities and temperatures

  18. FAO and atomic energy

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1960-07-15

    During the past six years FAO has become more engaged in work concerned with atomic energy. In 1957 it established an Atomic Energy Branch. The new forces and new tools which have become available for use in the fight against poverty, disease and malnutrition can be of the greatest assistance in FAO's work in nearly all phases of the production, storage and distribution of food and other agricultural products. The Organization promotes their use to improve the standards of feeding, clothing and housing throughout the world. Another side of work related to atomic energy is concerned with combating contamination from the use of atomic energy for power production and other purposes. This raises considerable problems for food and agriculture, so that FAO also has a responsibility for assisting Governments in safeguarding their food and food-producing resources from contamination. FAO is essentially concerned with fostering wider knowledge of the many contributions that atomic science can make to agriculture, forestry, fisheries and nutrition. It is also concerned in assisting governments to establish sound programmes for applying atomic science in food and agriculture. One way of spreading such knowledge is through the publication of documents and reports

  19. Atomic clocks for geodesy

    Science.gov (United States)

    Mehlstäubler, Tanja E.; Grosche, Gesine; Lisdat, Christian; Schmidt, Piet O.; Denker, Heiner

    2018-06-01

    We review experimental progress on optical atomic clocks and frequency transfer, and consider the prospects of using these technologies for geodetic measurements. Today, optical atomic frequency standards have reached relative frequency inaccuracies below 10‑17, opening new fields of fundamental and applied research. The dependence of atomic frequencies on the gravitational potential makes atomic clocks ideal candidates for the search for deviations in the predictions of Einstein’s general relativity, tests of modern unifying theories and the development of new gravity field sensors. In this review, we introduce the concepts of optical atomic clocks and present the status of international clock development and comparison. Besides further improvement in stability and accuracy of today’s best clocks, a large effort is put into increasing the reliability and technological readiness for applications outside of specialized laboratories with compact, portable devices. With relative frequency uncertainties of 10‑18, comparisons of optical frequency standards are foreseen to contribute together with satellite and terrestrial data to the precise determination of fundamental height reference systems in geodesy with a resolution at the cm-level. The long-term stability of atomic standards will deliver excellent long-term height references for geodetic measurements and for the modelling and understanding of our Earth.

  20. FAO and atomic energy

    International Nuclear Information System (INIS)

    1960-01-01

    During the past six years FAO has become more engaged in work concerned with atomic energy. In 1957 it established an Atomic Energy Branch. The new forces and new tools which have become available for use in the fight against poverty, disease and malnutrition can be of the greatest assistance in FAO's work in nearly all phases of the production, storage and distribution of food and other agricultural products. The Organization promotes their use to improve the standards of feeding, clothing and housing throughout the world. Another side of work related to atomic energy is concerned with combating contamination from the use of atomic energy for power production and other purposes. This raises considerable problems for food and agriculture, so that FAO also has a responsibility for assisting Governments in safeguarding their food and food-producing resources from contamination. FAO is essentially concerned with fostering wider knowledge of the many contributions that atomic science can make to agriculture, forestry, fisheries and nutrition. It is also concerned in assisting governments to establish sound programmes for applying atomic science in food and agriculture. One way of spreading such knowledge is through the publication of documents and reports

  1. Atomic bomb and leukemia

    International Nuclear Information System (INIS)

    Ichimaru, M.; Tomonaga, M.; Amenomori, T.; Matsuo, T.

    1991-01-01

    Characteristic features of the leukemia among atomic bomb survivors were studied. Dose estimates of atomic bomb radiation were based on T65D, but the new dosimetry system DS86 was used for some analyses. The ratio of a single leukemia type to all leukemias was highest for chronic myelogenous leukemia (CML) in Hiroshima, and the occurrence of CML was thought to be most characteristic to atomic bomb radiation induced leukemia. The threshold of CML occurrence in Hiroshima is likely to be between 0.5∼0.09 Gy. However, the threshold of acute leukemia appears to be nearly 1 Gy. In the distribution of acute myeloid leukemia (AML) subtypes by French-American-British classification, there was no M3 case in 1 Gy or more group, although several atypical AML cases of survivors were observed. Although aplastic anemia has not increased as a late effect of the atomic bomb radiation exposure, many atypical leukemia or other myeloproliferative diseases who had been diagnosed as aplastic anemia or its related diseases have been experienced among atomic bomb survivors. Chromosome study was conducted using colony forming cells induced by hemopoietic stem cells of peripheral blood of proximal survivors. Same chromosome aberrations were observed in colony forming cells and peripheral T-cells in several atomic bomb survivors. (author)

  2. Profil Gangguan Kognitif pada Tumor Intrakranial Primer dan Metastasis

    OpenAIRE

    Kartika Maharani; Andira Larasari; Tiara Aninditha; Yetty Ramli

    2015-01-01

    Gangguan kognitif sering menyertai pasien tumor intrakranial dan menjadi penyebab utama disabilitas. Perbedaan patofisiologi tumor intrakranial primer (TIP) dan metastasis (TM) menyebabkan perbedaan gambaran klinis dan derajat  gangguan kognitif. Tujuan penelitian ini untuk mengetahui prevalensi dan profil gangguan kognitif pasien TIP dan TM. Disain penelitian potong-lintang retrospektif menggunakan data sekunder dari Poliklinik Saraf RSCM pada bulan Januari 2011-Desember 2013. Subjek b...

  3. Isolasi, Karakterisasi dan Potensi Bakteri Aerob sebagai Pendegradasi Limbah Organik

    OpenAIRE

    Zahidah, Dinda; Shovitri, Maya

    2013-01-01

    Penelitian ini dilakukan untuk mengisolasi dan mengkarakterisasi bakteri aerob yang mampu mendegradasi amilum, protein dan selulosa. Penelitian ini berhasil memurnikan dan mengkarakterisasi isolat bakteri C5 yang cenderung masuk ke genus Bacillus. Berdasarkan uji kualitatif amilolitik, selulolitik dan proteolitik, diketahui bahwa isolat C5 memiliki indeks amilolitik (IA) sebesar 0.93, indeks selulolitik (IS) sebesar 1.95 dan indeks proteolitik (IP) sebesar 1.39

  4. Atomic phenomena in dense plasmas

    International Nuclear Information System (INIS)

    Weisheit, J.C.

    1981-03-01

    The following chapters are included: (1) the plasma environment, (2) perturbations of atomic structure, (3) perturbations of atomic collisions, (4) formation of spectral lines, and (5) dielectronic recombination

  5. Cardiac fibroblast transcriptome analyses support a role for interferogenic, profibrotic, and inflammatory genes in anti-SSA/Ro-associated congenital heart block.

    Science.gov (United States)

    Clancy, Robert M; Markham, Androo J; Jackson, Tanisha; Rasmussen, Sara E; Blumenberg, Miroslav; Buyon, Jill P

    2017-09-01

    The signature lesion of SSA/Ro autoantibody-associated congenital heart block (CHB) is fibrosis and a macrophage infiltrate, supporting an experimental focus on cues influencing the fibroblast component. The transcriptomes of human fetal cardiac fibroblasts were analyzed using two complementary approaches. Cardiac injury conditions were simulated in vitro by incubating human fetal cardiac fibroblasts with supernatants from macrophages transfected with the SSA/Ro-associated noncoding Y ssRNA. The top 10 upregulated transcripts in the stimulated fibroblasts reflected a type I interferon (IFN) response [e.g., IFN-induced protein 44-like (IFI44L), of MX dynamin-like GTPase (MX)1, MX2, and radical S -adenosyl methionine domain containing 2 (Rsad2)]. Within the fibrotic pathway, transcript levels of endothelin-1 (EDN1), phosphodiesterase (PDE)4D, chemokine (C-X-C motif) ligand (CXCL)2, and CXCL3 were upregulated, while others, including adenomedullin, RAP guanine nucleotide exchange factor 3 (RAPGEF3), tissue inhibitor of metalloproteinase (TIMP)1, TIMP3, and dual specificity phosphatase 1, were downregulated. Agnostic Database for Annotation, Visualization and Integrated Discovery analysis revealed a significant increase in inflammatory genes, including complement C3A receptor 1 (C3AR1), F2R-like thrombin/trypsin receptor 3, and neutrophil cytosolic factor 2. In addition, stimulated fibroblasts expressed high levels of phospho-MADS box transcription enhancer factor 2 [a substrate of MAPK5 (ERK5)], which was inhibited by BIX-02189, a specific inhibitor of ERK5. Translation to human disease leveraged an unprecedented opportunity to interrogate the transcriptome of fibroblasts freshly isolated and cell sorted without stimulation from a fetal heart with CHB and a matched healthy heart. Consistent with the in vitro data, five IFN response genes were among the top 10 most highly expressed transcripts in CHB fibroblasts. In addition, the expression of matrix-related genes

  6. RESPON DAN KOPING PASIEN DM POST AMPUTASI

    Directory of Open Access Journals (Sweden)

    Candra Kusuma Negara

    2017-09-01

    Full Text Available Penyakit DM merupakan masalah kesehatan yang sangat penting karena berkaitan dengan tingginya kejadian komplikasi dan mortalitas yang tinggi. Bagi kebanyakan orang penyakit DM adalah suatu penyakit yang sangat mengkhawatirkan dan masyarakat sadar akan besarnya potensi bahaya yang ditimbulkannya. Bagi individu yang menderita DM dengan pasca amputasi, kehidupan selanjutnya merupakan babak baru yang penuh tantangan dan perubahan serta akan melalui proses koping terhadap proses perubahan tersebut. Secara umum penelitian ini bertujuan untuk mengeksplorasi berbagai pengalaman pasien DM pasca amputasi tentang respon dan koping yang dialaminya. Penelitian ini menggunakan studi fenomenologi. Pengambilan data menggunakan indepth interview pada empat orang partisipan yang dirawat jalan di Poli kaki diabetic RSUD Ulin Banjarmasin yang dilengkapi dengan pedoman wawancara dan informed consent. Metode analisis yang terstruktur dari Creswell menjadi 6 langkah. Terdapat 2 Tema yang ditemukan dalam penelitian ini yaitu berbagai respon post amputasi dan Berbagai koping pasien DM post amputasi. Berbagai respon post amputasi terdiri dari tiga Sub-Tema yaitu: (1 Mengalami hambatan fisik, (2 Mengalami perubahan peran, (3 Mengalami proses berduka, dan Terdapat empat Sub-Tema yang menggambarkan berbagai koping pasien DM post amputasi yaitu: (1 Lebih banyak beribadah, (2 Menerima keadaan, (3 Motivasi yang kuat, (4 Mencari dukungan sosial.

  7. Pengaruh Lama Perendaman dan Jenis Minuman Beralkohol Bir dan Tuak terhadap Kekerasan Email Gigi Manusia (In Vitro)

    OpenAIRE

    Magista, Malida; Nuryanti, Archadian; Wahyudi, Ivan Arie

    2014-01-01

    Erosi gigi merupakan hilangnya lapisan email gigi karena asam. Jenis asam, pH rendah, serta kandungan kalsium, fosfat, dan fluoride pada bir dan tuak diduga merupakan faktor kimiawi penyebab erosi gigi. Tujuan penelitian ini untuk mengetahui pengaruh lama perendaman dan jenis minuman beralkohol bir dan tuak terhadap kekerasan email gigi manusia (in vitro). Penelitian ini menggunakan 14 sampel gigi premolar pertama atas. Setiap gigi dibagi menjadi 2 bagian, bukal dan palatal. kemudian dibagi m...

  8. Pengaruh Lama Perendaman Dan Jenis Minuman Beralkohol Bir Dan Tuak Terhadap Kekerasan Email Gigi Manusia (in Vitro)

    OpenAIRE

    Magista, Malida; Nuryanti, Archadian; Wahyudi, Ivan Arie

    2014-01-01

    Erosi gigi merupakan hilangnya lapisan email gigi karena asam. Jenis asam, pH rendah, serta kandungan kalsium, fosfat, dan fluoride pada bir dan tuak diduga merupakan faktor kimiawi penyebab erosi gigi. Tujuan penelitian ini untuk mengetahui pengaruh lama perendaman dan jenis minuman beralkohol bir dan tuak terhadap kekerasan email gigi manusia (in vitro). Penelitian ini menggunakan 14 sampel gigi premolar pertama atas. Setiap gigi dibagi menjadi 2 bagian, bukal dan palatal. kemudian dibagi m...

  9. Pengaruh Perbedaan Jenis Asam dan Waktu Demineralisasi pada Nilai Rendemen dan Sifat Fisiko Kimia Gelatin Tulang Sapi Bali.

    OpenAIRE

    Ramadani, Dewi

    2014-01-01

    2014 Dewi Ramadani (I 411 10 267). Pengaruh Perbedaan Jenis Asam dan Waktu Demineralisasi pada Nilai Rendemen dan Sifat Fisiko Kimia Gelatin Tulang Sapi Bali. Muhammad Irfan Said Sebagai Pembimbing Utama dan Farida Nur Yuliati Sebagai Pembimbing Anggota. Gelatin merupakan senyawa hasil hidrolisis serabut kolagen secara persial. Tujuan dari penelitian ini adalah untuk melihat pengaruh jenis larutan dan waktu demineralisasi pada nilai rendemen dan sif...

  10. Epistaksis dan Hipertensi : Adakah Hubungannya?

    Directory of Open Access Journals (Sweden)

    Bestari J. Budiman

    2012-09-01

    Full Text Available Abstrak Latar Belakang: Epistaksis merupakan suatu kondisi klinis yang sering ditemui dan dapat terjadi pada semua umur dengan banyak variasi penyebabnya. Salah satu faktor risiko yang diduga ikut berperan dalam terjadinya epistaksis adalah hipertensi. Tujuan: Menjelaskan hubungan antara epistaksis dengan hipertensi. Tinjauan Pustaka: Hipertensi diduga tidak menyebabkan epistaksis secara langsung, tapi memperberat episode epistaksis. Mengendalikan tekanan darah sebagai salah satu faktor risiko, akan menurunkan insiden terjadinya epistaksis. Di ruang gawat darurat, pemberian obat anti hipertensi diberikan sebelum atau bersamaan dengan manajemen epistaksis itu sendiri. Kesimpulan: Terdapat hubungan antara epistaksis dengan hipertensi yang berlangsung lama dan adanya hipertrofi ventrikel kiri. Kata kunci : Hipertensi, kegawatdaruratan, penatalaksanaan epistaksis. Abstract Background: Epistaxis is a common clinical problem in all age groups with varied etiological factors. Hypertension has been suggested as a risk factor in epistaxis case. Purpose: To explain relationship between epistaxis and hypertension. Review: It has been suggested that hypertension does not cause epistaxis directly, but hypertension prolongs the episode of epistaxis when it does occur. The controlling for blood pressure as a risk factor will be decreased the incidencies of epistaxis. In emergency rooms, high blood pressure is usually treated before or in parallel with the management of epistaxis. Conclusion: There was an association between epistaxis and long duration of hypertension in adult and left ventricle hypertrophy. Key words : Hypertension, emergency case, management of epistaxis.

  11. Perbedaan konsumsi buah dan sayur pada anak sekolah dasar yang obes dan tidak obes di Kota Yogyakarta dan Kabupaten Bantul

    Directory of Open Access Journals (Sweden)

    Irma Nuraeni

    2016-03-01

    gender and energy intake, showed that obese  children who rarely consuming fruits (<7 times/week (OR=2,24, 95%CI: 1.53-3.28, rarely consuming vegetables (<7 times/week (OR=2,52, 95%CI: 1,70-3,73, and consuming fruits and vegetables less than 5 servings/day (equivalent to 400 g/day (OR= 4,59, 95%CI:2,11-10,00 were greater risk for being obesity.Conclusion:Obese children had rarely and less consume of fruits and vegetables than that did in non-obese children at Yogyakarta Municipality and District of Bantul. The children rarely and less consuming fruits and vegetables increased the risk of obesity.KEYWORDS: children obesity, vegetable, fruitABSTRAKLatar Belakang: Indonesia saat ini mengalami masalah gizi ganda, yaitu masalah gizi kurang dan gizi lebih. Kelebihan  gizi atau obesitas pada anak dan remaja apabila tidak diatasi maka berdampak menjadi obesitas pada masa dewasa yang berpotensi mengalami penyakit tidak menular, seperti jantung, hipertensi dan diabetes mellitus. Prevalensi obesitas pada anak di Provinsi Daerah Istimewa Yogyakarta mengalami peningkatan dari tahun ke tahun (1; 2. Obesitas disebabkan ketidakseimbangan antara masukan dengan keluaran energi. Anak cenderung mengkonsumsi padat energi yang berasa manis dan berlemak tinggi serta makanan kurang serat dari buah dan sayur. Beberapa penelitian menunjukkan peningkatan risiko obesitas pada orang yang kurang konsumsi buah dan sayur.Tujuan: Untuk mengetahui perbedaan frekuensi dan jumlah konsumsi buah dan sayur pada anak SD obes dan tidak obes di Kota Yogyakarta dan Kabupaten Bantul serta peran konsumsi buah dan sayur terhadap kejadian obesitas. Metode: Rancangan penelitian ini adalah case-control, 244 kasus (anak obes dan 244 kontrol (anak tidak obes. Subjek penelitian adalah anak usia 6-12 tahun yang duduk di kelas 1 hingga kelas 5 sekolah dasar di Kota Yogyakarta dan di Kabupaten Bantul. Data identitas diperoleh dari kuesioner terstruktur, sedangkan data frekuensi dan jumlah konsumsi buah dan sayur diperoleh

  12. ANEMIA DAN LAMA KONSUMSI OBAT ANTI TUBERCULOSIS

    Directory of Open Access Journals (Sweden)

    Anny Thuraidah

    2017-12-01

    Full Text Available Tuberkulosis adalah penyakit infeksi akibat kuman Mycobacterium tuberculosis yang dapat menginfeksi beberapa organ tubuh, diantaranya paru-paru, ginjal, dan tulang.Tujuan pengobatan tuberkulosis adalah memusnahkan basil tuberkulosis dengan cepat dan mencegah kekambuhan. Obat anti tuberkulosis (OAT dapat diterima dalam terapi, namun mempunyai efek toksik seperti agranulositosis, eosinofilia, trombositopenia dan anemia. Penelitian ini bertujuan untuk mengetahui hubungan lama konsumsi OAT pada pasien TB paru terhadap anemia. Penelitian ini bersifat Survey Analitic dengan rancangan Cross Sectional. Hasil penelitian rata-rata hitung sel darah merah 0 bulan 5,16 106/uL, 2 bulan 4,39 106/uL dan 6 bulan 4,61 106/uL, rata-rata kadar hemoglobin 0 bulan 15,17 g/dL, 2 bulan 12,73 g/dL dan 6 bulan 13,28 g/dL serta ratarata nilai hematokrit 0 bulan 44,26 %, 2 bulan 38,24 % dan 6 bulan 39,04 %. Dari hasil uji Spearman diperoleh nilai signifikan sebesar hitung sel darah merah 0,004 < α (0,05, kadar hemoglobin 0,007 < α (0,05 dan nilai hematokrit 0,015 < α (0,05 sehingga dapat disimpulkan ada hubungan antara lama konsumsi obat anti tuberkulosis pada pasien TB paru terhadap anemia dan nilai correlation coefficient hitung sel darah merah -0,531, kadar hemoglobin -0,479 serta nilai hematokrit -0,440 berarti memiliki kekuatan hubungan yang sedang. Disarankan untuk penelitian selanjutnya menggunakan parameter yang berbeda seperti jumlah trombosit, kadar AST/ALT dan sebaiknya menggunakan sampel atau pasien yang sama dari 0 bulan sampai 6 bulan.

  13. ISOLASI DAN IDENTIFIKASI KOMPONEN KIMIA MINYAK ATSIRI DAUN LEGUNDI (Vitex trifolia L.) DAN UJI AKTIVITAS ANTIMIKROBANYA

    OpenAIRE

    Mufidah, S.Si., M.Si., Apt.

    2004-01-01

    Dalam rangka pengembangan obat tradisional, telah dilakukan isolasi dan uji aktivitas antimikroba minyak atsiri daun legundi (Vitex trifolia, L.) familia Verbenaceae. Penelitian ini bertujuan untuk mengisolasi, menganalisis dan menguji aktivitas antimikroba minyak atsiri daun legundi. Isolasi dilakan dengan alat destilasi Stahl, diperoleh minyak atsiri sebanyak 0,02% v/b daun segar dan 0,08% v/b daun kering. Dari interpretasi data GC-MS tampak adanya 1,8 ???Cineole (17,83%), ???-terpiny...

  14. Status Oral Higiene Dan Periodontal Pada Pasien Diabetes Melitus Dan Non- Diabetes Di RSUD Dr. Pirngadi

    OpenAIRE

    Butar-Butar, Mardiah Rizqo

    2014-01-01

    Diabetes melitus adalah penyakit gangguan metabolisme ditandai dengan meningkatnya kadar gula darah yang terjadi karena kelainan sekresi insulin, kerja insulin, atau kedua-duanya. Diabetes melitus merupakan salah satu penyakit sistemik yang berperan sebagai faktor risiko penyakit periodontal. Penelitian ini bertujuan untuk mengetahui status oral higiene dan periodontal dan odd rasio periodontitis pada pasien Diabetes melitus dan non-Diabetes. Rancangan penelitian adalah case-control. Popul...

  15. Penskalaan Butir Format Respons Pilihan dan Respons Bebas Berdasarkan Model Rasch dan Partial Credit

    Directory of Open Access Journals (Sweden)

    Eko Hariadi

    2007-06-01

    Full Text Available Penelitian melihat pengaruh jumlah parameter butir, kategori respons bebas (RB, pengaruh sampel terhadap akurasi estimasi parameter kemampuan untuk menghasilkan estimasi yang stabil dan pengaruh pembobotan butir RP dan butir RB terhadap kesalahan baku. Penelitian dalam dua tahap, simulasi menggunakan 30 kondisi dengan replikasi 50 dengan variabel panjang tes, jumlah kategori, dan jumlah parameter butir, dan analisis deskriptif, dilanjutkan penerapan penskalaan gabungan butir tipe respons pilihan (rp dan butir respons bebas (rb pada konstruksi tes elektronika yang terdiri 40 butir pilihan ganda dan 4 butir jawaban tersusun, 3 butir memiliki lima kategori jawaban dan 1 butir dengan 4 kategori jawaban, melibatkan 355 siswa. Hasil penelitian menunjukkan: ukuran sampel kurang berpengaruh pada root mean square error atau (RSME> dan korelasi antara 9 dengan 0, namun berpengaruh terhadap akurasi estimasi parameter butir pilihan ganda (/>/y,dan parameter butir respons tersusun (3^- Jumlah parameter butir berpengaruh terhadap parameter kemampuan, tetapi tidak berpengaruh terhadap akurasi dari b^, dan S„,. Estimasi dari parameter tingkat kesulitan butir jawaban tersusun tiga kategori lebih akurat daripada butir jawaban tersusun lima kategori. Estimasi tahan {robust untuk parameter kesulitan butir jawaban tersusun 5 kategori memerlukan sampel minimal 250 responden, sedangkan untuk butir respons tersusun 3 kategori memerlukan sampel minimal 100 responden. Estimasi parameter kemampuan dari skor total (0^^ tidak sama dengan rata-rata jumlah tbeta dari masing-masing subtes (0^ + 0CR. Theta dari tes yang dikalibrasi bersama-sama berbeda dengan theta dari total subtes yang dikalibrasi secara terpisah. Korelasi kemampuan yang mengunakan pembobotan dan kemampuan tanpa pembobotan mempunyai suatu rentang dari 0,988 sampai 0,948. Kata kunci: penyekaiaan, model rash dan partial credit.

  16. Prinsip Transparansi dalam Perjanjian TBT dan SPS

    Directory of Open Access Journals (Sweden)

    Dina Widyaputri Kariodimedjo

    2012-02-01

    Full Text Available Transparency principle in the TBT and SPS Agreement is implemented by notification. Its application is prepared by related agencies through the making of regulations, establishment of enquiry points, building capacity and infrastructure. It guarantees certainty, predictability and credibility of Indonesia in international trade, and its application should not undermine national trade policy. Prinsip transparansi dalam Perjanjian TBT dan SPS diterapkan melalui notifikasi. Penerapan prinsip ini dilakukan oleh instansi-instansi terkait melalui pembuatan peraturan, upaya terkait kelembagaan, SDM dan infrastruktur. Prinsip yang bertujuan menciptakan kepastian, konsistensi bagi perdagangan dan kredibilitas Indonesia dalam perdagangan internasional, harus dilakukan tanpa mengorbankan kepentingan untuk mengamankan kebijakan impor nasional.

  17. SPIRITUALITAS MURIA: AKOMODASI TRADISI DAN WISATA

    Directory of Open Access Journals (Sweden)

    Ahmad Falah

    2012-12-01

    Tradisi “nyekar” sangat dikenal oleh orang Jawa, khususnya di makam Muria Kudus Jawa Tengah. Penelitian ini mengungkap bahwa kebanyakan peziarah makam ini bertujuan untuk mendapatkan keberkahan (tabarrukan, keamanan dan kemudahan dalam hidup, menguasai ilmu linuwih, disembuhkan dari penyakit, dan mengharapkan kebaikan dari nenek moyang. Kunjungan mereka ke makam itu memberikan dampak yang besar bagi kehidupan masyarakat, baik secara ekonomi maupun sosial. Dalam perspektif ekonomi, lebih dari 1.500 tenaga kerja tergantung pada keberadaan makam Muria. Dampak yang lain adalah slidaritas setempat, kompetisi sosial, dan kesempatan kerja yang mengakibatkan munculnya tumbuhnya pragmatisme di kalangan anggota masyarakat Muria.

  18. Media Sosial dan Perkembangan Komunikasi Korporat

    Directory of Open Access Journals (Sweden)

    Rina Juwita

    2017-07-01

    Full Text Available Kehadiran media sosial telah mengubah aktivitas komunikasi korporat dan dengan cepat merevolusi bagaimana kampanye atau program public relations berjalan. Jika dibandingkan dengan cara tradisional yang mengandalkan pada output murni, media sosial memaksa komunikasi korporat beralih pada proses dialog dimana para pemangku kepentingan, dan bukan hanya perusahaan sama-sama memiliki kekuasaan terhadap pesan yang beredar. Media sosial merupakan alat komunikasi revolusioner yang mengubah secara cepat bagaimana praktik PR menjadi bagian integral dari komunikasi korporat bagi sejumlah perusahaan dan menawarkan pilihan baru bagi para praktisi PR pada setiap aspek proses komunikasi yang dilakukan.

  19. Inovasi Desain, Teknologi, dan Pemasaran Lewat Website Usaha Kecil Menengah Batik dan Lutik (Lurik Batik di Kecamatan Laweyan Surakarta

    Directory of Open Access Journals (Sweden)

    Anastasia Riani Suprapti

    2016-12-01

      Tujuan penelitian terapan ini adalah untuk meningkatkan produktivitas dan mengembangkan produk batik dan lutik yang ada di wilayah Kecamatan Laweyan Surakarta dengan inovasi desain dan teknologi baru. Program ini bekerja sama dengan mitra UKM Batik Dewi (UKM 1 dan Batik Sinung Rejeki (UKM2 yang terletak di Kecamatan Laweyan. Pengusaha batik Laweyan dengan produknya berupa batik dan tekstil bermotif batik (printing dan cap dalam era globalisasi sekarang ini ternyata memiliki daya tahan yang baik, ditengah persaingan dengan produk sejenis dari daerah lain maupun dari luar negeri. Secara garis besar pola yang digunakan dalam implementasi penelitian ini meliputi: diskusi (FGD, kerja bengkel, operasional pabrik, pelatihan dan pendampingan (kelompok dan individu. Seperti halnya Usaha Kecil Menengah pada umumnya, pengusaha batik di Laweyan juga menghadapi masalah Internal meliputi  permodalan, inovasi desain, pemasaran, dan manajemen keuangan, yang meliputi administrasi keuangan/pembukuan. Beberapa solusi yang ditawarkan untuk mengatasi permasalahan yang dihadapi diantaranya adalah melakukan Inovasi desain dan teknologi, pengaturan layout pabrik, dan pemasaran lewat web. Selain itu mengembangkan desain motif batik yang lebih diminati pasar diberikan juga untuk pengembangan teknik kombinasi batik-lurik ikat dengan cara lukis dan pengelantangan. Penggunaan media teknologi informasi dan komunikasi untuk promosi lewat website. Adapun untuk usaha pengembangan manajemen pemasaran,  diusahakan media promosi dan menjalin kerjasama pemasaran  dengan instansi terkait, misalnya dengan mengikuti pameran-pameran di Solo dan Jakarta.

  20. Pengembangan Sistem Informasi Akuntansi Dan Pengelolaan Keuangan Modul Bendahara Menggunakan Teknologi Java dan PostgreSQL

    Directory of Open Access Journals (Sweden)

    Alfie Satria Hidayat

    2012-09-01

    Full Text Available Penerapan sistem informasi saat ini sudah menjadi kebutuhan yang krusial bagi proses bisnis instansi pemerintah. Direktorat Jenderal Perbendaharaan adalah salah satu instansi pemerintah di bawah Kementerian Keuangan yang memiliki tugas pokok dan fungsi terkait dengan siklus anggaran (budget cycle mulai dari perencanaan, pelaksanaan, sampai pertanggungjawaban anggaran. Saat ini terdapat banyak aplikasi yang dikembangkan oleh Direktorat Jenderal Perbendaharaan untuk membantu satuan kerja sebagai mitra kerja dalam pengelolaan Anggaran Pendapatan dan Belanja Negara. Namun, aplikasi-aplikasi tersebut belum terintegrasi padahal dalam proses bisnisnya semuanya saling terkait dan berurutan. Selain itu, beberapa aplikasi menggunakan database yang sama sehingga dimungkinkan terjadi duplikasi data dan memerlukan sinkronisasi jika terjadi perubahan. Diantara aplikasi yang ada, salah satunya terdapat aplikasi pembukuan bendahara. Melalui penelitian ini, penulis akan membuat Sistem Informasi Akuntansi dan Pengelolaan Keuangan (SIAPKAN  khususnya modul bendahara sebagai solusi untuk menjawab permasalahan dengan mengintegrasikan semua aplikasi yang terkait dalam proses siklus anggaran. Aplikasi ini merupakan aplikasi berbasis web yang akan dikembangkan dengan menggunakan bahasa pemrograman Java (Servlet dan JSP. Aplikasi ini akan menggunakan single database yaitu dengan database PostgreSQL sehingga data yang diolah dan disajikan lebih akurat dan proses bisnis akan berjalan lebih efektif dan efisien.

  1. Isolasi dan Identifikasi Mikroba Lipolitik dari Limbah Cair Surimi dan Rajungan

    Directory of Open Access Journals (Sweden)

    Devi Ambarwati Oktavia

    2017-05-01

    Full Text Available Industri pengolahan hasil perikanan di sepanjang pantai Utara Jawa seperti pengalengan rajungan di Cirebon (Jawa Barat dan pengolahan surimi di Kendal (Jawa Tengah, menghasilkan air limbah yang mengandung banyak protein dan lemak. Bakteri yang hidup di limbah yang banyak mengandung protein dan lemak tersebut diperkirakan memiliki kemampuan untuk menghidrolisis lemak menjadi asam lemak dan gliserol sehingga berpotensi untuk dimanfaatkan sebagai bioremedian alami bagi penanganan air limbah hasil perikanan di tempat lain. Penelitian ini bertujuan untuk melakukan penapisan dan identifikasi bakteri lipolitik potensial sebagai bioremedian air limbah perikanan. Penapisan dilakukan terhadap 11 isolat bakteri lipolitik dari air limbah yang diambil dari industri pengalengan rajungan di Cirebon dan pengolahan surimi di Kendal dengan menggunakan media spesifik agar tributirin. Isolat bakteri lipolitik potensial ditentukan berdasarkan zona bening yang terbentuk di sekitar koloni, yaitu sekurang-kurangnya 6 mm. Isolat bakteri potensial ini selanjutnya diidentifikasi secara molekuler berdasarkan analisis sekuen 16S-rDNA. Dari penapisan diperoleh empat isolat bakteri potensial, yaitu isolat SPB, SHj, SOr dan SKn. Identifikasi molekuler menunjukkan bahwa isolat SPB dan SHj masing-masing adalah Serratia fonticola 10AdanBacillus cereus strain 103.2.2dengan kemiripan 97%, isolat SOr memiliki kemiripan 96% dengan Bacillus pumilus strain vit bac1 dan isolat SKn adalah Enterococcus pseudoavium strain L3C21K2dengan kemiripan 87%. Keempat isolat tersebut berpotensi untuk dimanfaatkan sebagai bioremedian pada air limbah dari industri pengolahan hasil perikanan di Indonesia.

  2. EKSISTENSI DAN SEBARAN NYAMUK AEDES AEGYPTI DAN AEDES ALBOPICTUS DI KAMPUS UNIVERSITAS HASANUDDIN MAKASSAR

    Directory of Open Access Journals (Sweden)

    Yosefina Dota T

    2015-03-01

    Full Text Available Penelitian yang bertujuan untuk mengetahui eksistensi dan sebaran nyamuk Aedes aegypti dan Aedes albopictus telah dilakukan di Kampus Universitas Hasanuddin, Kec. Tamalanrea, Makassar. Penelitian bersifat eksploratif dengan melakukan sampling terhadap lima lokasi yaitu : a Fak. Peternakan (Utara, b Fak. Hukum (Timur, c Pusat Kegiatan Penelitian/PKP (Selatan, d Workshop/Dekat Pondokan mahasiswa (Barat dan e Fak. MIPA (Tengah. Sampling nyamuk menggunakan metode ovitrap (menggunakan attraktan Eluisine Indica L. dan survei terhadap berbagai tempat penampungan air. Sampel telur dan larva nyamuk yang diperoleh disimpan dalam microtube berisi alkohol 70% kemudian diidentifikasi berdasarkan Rueda (2004. Hasil penelitian menunjukkan bahwa Nyamuk Ae. aegypti dan Ae. albopictus ditemukan hidup dan berkembang biak di kampus Universitas Hasanuddin, Makassar. Eksistensi dan sebaran kedua jenis nyamuk tersebut dipengaruhi oleh faktor adanya manusia/masyarakat kampus yang beraktivitas baik di dalam ruangan (indoor maupun di luar ruangan (outdoor, adanya berbagai tempat penampungan air baik buatan (bak mandi, ember maupun barang bekas (botol/kaleng bekas, tempurung kelapa, vegetasi/tanaman dan berbagai macam hewan yang berada di sekitaran kampus. Hasil penelitian dalam ruangan (indoor menunjukkan bahwa nyamuk Ae. aegypti lebih banyak ditemukan hidup di dalam ruangan gedung PKP sedangkan Ae.albopictus lebih banyak di Fak. Hukum. Hasil penelitian di luar ruangan (outdoor menunjukkan bahwa nyamuk Ae. aegypti lebih banyak ditemukan hidup di area Workshop sedangkan Ae.albopictus lebih banyak di area PKP.

  3. Quantitative proteomics and network analysis of SSA1 and SSB1 deletion mutants reveals robustness of chaperone HSP70 network in Saccharomyces cerevisiae.

    Science.gov (United States)

    Jarnuczak, Andrew F; Eyers, Claire E; Schwartz, Jean-Marc; Grant, Christopher M; Hubbard, Simon J

    2015-09-01

    Molecular chaperones play an important role in protein homeostasis and the cellular response to stress. In particular, the HSP70 chaperones in yeast mediate a large volume of protein folding through transient associations with their substrates. This chaperone interaction network can be disturbed by various perturbations, such as environmental stress or a gene deletion. Here, we consider deletions of two major chaperone proteins, SSA1 and SSB1, from the chaperone network in Sacchromyces cerevisiae. We employ a SILAC-based approach to examine changes in global and local protein abundance and rationalise our results via network analysis and graph theoretical approaches. Although the deletions result in an overall increase in intracellular protein content, correlated with an increase in cell size, this is not matched by substantial changes in individual protein concentrations. Despite the phenotypic robustness to deletion of these major hub proteins, it cannot be simply explained by the presence of paralogues. Instead, network analysis and a theoretical consideration of folding workload suggest that the robustness to perturbation is a product of the overall network structure. This highlights how quantitative proteomics and systems modelling can be used to rationalise emergent network properties, and how the HSP70 system can accommodate the loss of major hubs. © 2015 The Authors. PROTEOMICS published by Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  4. Effect of the Prevalence of HIV/AIDS and the Life Expectancy Rate on Economic Growth in SSA Countries: Difference GMM Approach.

    Science.gov (United States)

    Waziri, Salisu Ibrahim; Mohamed Nor, Norashidah; Raja Abdullah, Nik Mustapha; Adamu, Peter

    2015-09-01

    The productivity of countries around the globe is adversely affected by the health-related problems of their labour force. This study examined the effect of the prevalence of human immunodeficiency virus/acquired immune deficiency syndrome (HIV/AIDS) and life expectancy on the economic growth of 33 Sub-Saharan African (SSA) countries over a period of 11 years (2002-2012). The study employed a dynamic panel approach as opposed to the static traditional approach utilised in the literature. The dynamic approach became eminent because of the fact that HIV/AIDS is a dynamic variable as its prevalence today depends on the previous years. The result revealed that HIV/AIDS is negatively correlated with economic growth in the region, with a coefficient of 0.014, and significant at the 1% level. That is, a 10% increase in HIV/AIDS prevalence leads to a 0.14% decrease in the GDP of the region. Tackling HIV/AIDS is therefore imperative to the developing Sub-Saharan African region and all hands must be on deck to end the menace globally.

  5. Deep Submillimeter and Radio Observations in the SSA22 Field. I. Powering Sources and the Lyα Escape Fraction of Lyα Blobs

    Science.gov (United States)

    Ao, Y.; Matsuda, Y.; Henkel, C.; Iono, D.; Alexander, D. M.; Chapman, S. C.; Geach, J.; Hatsukade, B.; Hayes, M.; Hine, N. K.; Kato, Y.; Kawabe, R.; Kohno, K.; Kubo, M.; Lehnert, M.; Malkan, M.; Menten, K. M.; Nagao, T.; Norris, R. P.; Ouchi, M.; Saito, T.; Tamura, Y.; Taniguchi, Y.; Umehata, H.; Weiss, A.

    2017-12-01

    We study the heating mechanisms and Lyα escape fractions of 35 Lyα blobs (LABs) at z ≈ 3.1 in the SSA22 field. Dust continuum sources have been identified in 11 of the 35 LABs, all with star formation rates (SFRs) above 100 M ⊙ yr-1. Likely radio counterparts are detected in 9 out of 29 investigated LABs. The detection of submillimeter dust emission is more linked to the physical size of the Lyα emission than to the Lyα luminosities of the LABs. A radio excess in the submillimeter/radio-detected LABs is common, hinting at the presence of active galactic nuclei. Most radio sources without X-ray counterparts are located at the centers of the LABs. However, all X-ray counterparts avoid the central regions. This may be explained by absorption due to exceptionally large column densities along the line-of-sight or by LAB morphologies, which are highly orientation dependent. The median Lyα escape fraction is about 3% among the submillimeter-detected LABs, which is lower than a lower limit of 11% for the submillimeter-undetected LABs. We suspect that the large difference is due to the high dust attenuation supported by the large SFRs, the dense large-scale environment as well as large uncertainties in the extinction corrections required to apply when interpreting optical data.

  6. UNESCO and atomic energy

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1960-01-15

    Atomic energy has been of particular concern to UNESCO virtually since the founding of this United Nations agency with the mission of promoting the advancement of science along with education and culture. UNESCO has been involved in the scientific aspects of nuclear physics - notably prior to the creation of the International Atomic Energy Agency - but it has also focussed its attention upon the educational and cultural problems of the atomic age. UNESCO's sphere of action was laid down by its 1954 General Conference which authorized its Director-General to extend full co-operation to the United Nations in atomic energy matters, with special reference to 'the urgent study of technical questions such as those involved in the effects of radioactivity on life in general, and to the dissemination of objective information concerning all aspects of the peaceful utilization of atomic energy; to study, and if necessary, to propose measures of international scope to facilitate the use of radioisotopes in research and industry'. UNESCO's first action under this resolution was to call a meeting of a committee of experts from twelve nations to study the establishment of a system of standards and regulations for the preparation, distribution, transport and utilization of radioactive isotopes and tracer molecules

  7. SIMBOL RAMA DAN EPOS RAMAYANA BAGI RAJA DAN MASYARAKAT JAWA

    Directory of Open Access Journals (Sweden)

    Wachid Eko Purwanto

    2015-06-01

    Full Text Available Epos Ramayana merupakan epos kuno yang ditulis dalam tujuh kanda terdiri atas 24.000 sloka. Di Jawa epos Ramayana pertama kali muncul secara lengkap dalam bentuk relief di Candi Lara Jonggrang yang dibangun sekitar tahun 782 hingga 872 M. Epos tua yang hidup di masyarakat Jawa ini pastilah mempunyai ajaran. Tokoh Rama sebagai tokoh utama merupakan simbol paling utama dalam epos ini. Berkait dengan simbol ajaran, tokoh Rama dalam epos Ramayana Jawa mempunyai fungsi bagi Raja Jawa dan masyarakat Jawa. Bagi raja simbol tokoh Rama memiliki tiga fungsi utama. Pertama sebagai fungsi spiritual. Kedua adalah fungsi legitimasi kekuasaan. Ketiga adalah fungsi pencitraan. Adapun bagi masyarakat Jawa, simbol tokoh Rama memiliki dua fungsi utama. Pertama adalah fungsi spiritual. Kedua adalah fungsi filosofis.

  8. Accelerators for atomic energy research

    International Nuclear Information System (INIS)

    Shibata, Tokushi

    1999-01-01

    The research and educational activities accomplished using accelerators for atomic energy research were studied. The studied items are research subjects, facility operation, the number of master theses and doctor theses on atomic energy research using accelerators and the future role of accelerators in atomic energy research. The strategy for promotion of the accelerator facility for atomic energy research is discussed. (author)

  9. Atomic nucleus and elementary particles

    International Nuclear Information System (INIS)

    Zakrzewski, J.

    1976-01-01

    Negatively charged leptons and hadrons can be incorporated into atomic shells forming exotic atoms. Nucleon resonances and Λ hyperons can be considered as constituents of atomic nuclei. Information derived from studies of such exotic systems enriches our knowledge of both the interactions of elementary particles and of the structure of atomic nuclei. (author)

  10. Compilation of data from hadronic atoms

    International Nuclear Information System (INIS)

    Poth, H.

    1979-01-01

    This compilation is a survey of the existing data of hadronic atoms (pionic-atoms, kaonic-atoms, antiprotonic-atoms, sigmonic-atoms). It collects measurements of the energies, intensities and line width of X-rays from hadronic atoms. Averaged values for each hadronic atom are given and the data are summarized. The listing contains data on 58 pionic-atoms, on 54 kaonic-atoms, on 23 antiprotonic-atoms and on 20 sigmonic-atoms. (orig./HB) [de

  11. CP violation in atoms

    International Nuclear Information System (INIS)

    Barr, S.M.

    1992-01-01

    Electric dipole moments of large atoms are an excellent tool to search for CP violation beyond the Standard Model. These tell us about the electron EDM but also about CP-violating electron-nucleon dimension-6 operators that arise from Higgs-exchange. Rapid strides are being made in searches for atomic EDMs. Limits on the electron EDM approaching the values which would be expected from Higgs-exchange mediated CP violation have been achieved. It is pointed out that in this same kind of model if tan β is large the effects in atoms of the dimension-6 e - n operators may outweigh the effect of the electron EDM. (author) 21 refs

  12. US Atomic Energy Law

    International Nuclear Information System (INIS)

    1981-01-01

    This is a new volume follows in the series supplementing the volumes 11 and 12 published in 1965 and 1966, updating the collection of Federal Acts and Executive Orders of the President of the United States of America relating to atomic energy legislation. Since the publication of volumes 11 and 12, the US Atomic Energy Act of 1954 alone has been amended 25 times, mainly as a consequence of by the Nuclear Non-Proliferation Act and the Uranium Mill Tailings Radiation Control Act, both of 1978. The Atomic Energy Act of 1954 is supplemented by a selection of the most important Federal Acts, Executive Orders of the President and Resolutions of the Congress. (orig./HSCH) [de

  13. Atomic profits, no thanks

    International Nuclear Information System (INIS)

    Bartels, W.; Dietrich, K.; Moeller, H.; Speier, C.

    1980-01-01

    The authors deal with the following topics: The secret of nuclear energy; the atom programmes of Bonn; on some arguments of the present nuclear energy discussion; how socialist countries solve the problems of nuclear energy. From the socialist point of view they discuss sociological, ideological and moral reasons for a peaceful utilization of nuclear energy. Nevertheless they refuse Bonn's atom programme because the high finance's interests concerning profit and power make it a danger. The biggest danger is said to lie in the creation of a plutonium-industry and the militaristic abuse which would be connected with it. The socialist way of utilizing atomic energy is seen by them as a way with a high feeling of responsibility towards all people and towards a guaranteed energy supply. (HSCH) [de

  14. Controlling the atom

    International Nuclear Information System (INIS)

    Mazuzan, G.T.; Walker, J.S.

    1984-01-01

    The authors trace the early history of nuclear power regulation in the US. Focusing on the Atomic Energy Commission, they describe the role of other groups that figured in the development of regulatory policies, including the Congressional Joint Committee on Atomic Energy, other federal agencies, state governments, the nuclear industry, and scientific organizations. They consider changes in public perceptions of and attitudes toward atomic energy and the dangers of radiation exposure. The basic purpose of the book is to provide the Nuclear Regulatory Commission and the general public with information on the historical antecedents and background of regulatory issues so that there will be continuity in policy decisions. The book concludes with an annotated bibliography of selected references. 19 figures

  15. Rydberg atoms in strong fields

    International Nuclear Information System (INIS)

    Kleppner, D.; Tsimmerman, M.

    1985-01-01

    Experimental and theoretical achievements in studying Rydberg atoms in external fields are considered. Only static (or quasistatic) fields and ''one-electron'' atoms, i.e. atoms that are well described by one-electron states, are discussed. Mainly behaviour of alkali metal atoms in electric field is considered. The state of theoretical investigations for hydrogen atom in magnetic field is described, but experimental data for atoms of alkali metals are presented as an illustration. Results of the latest experimental and theoretical investigations into the structure of Rydberg atoms in strong fields are presented

  16. Atoms in Slovakia

    International Nuclear Information System (INIS)

    Danis, D.; Feik, K.; Florek, M.; Kmosena, J.; Chrapan, J.; Morovic, M.; Slugen, V.; Seliga, M.; Valovic, J.

    2006-01-01

    In this book the history of development of using of nuclear energy in the Slovak Republic as well as in the Czechoslovakia (before 1993 year) is presented. The aim of the book is to preserve the memory of the period when the creation and development of nuclear physics, technology, nuclear medicine, radioecology and energetics in Slovakia occurred - as witnessed by people who experienced this period and to adapt it to future generations. The Editorial board of the SNUS collected the views of 60 contributors and distinguished workers - Slovakian experts in nuclear science, education and technology. Calling upon a wide spectrum of experts ensured an objective historical description of the period. A huge amount of subjective views on recent decades were collected and supported by a wealth of photographic documentation. This created a synthesised reflection on the history of the 'atoms' in Slovakia. The book contains 15 tables, 192 black and white and 119 colour pictures from around the world and from places involved in the compilation of the study and with the study of atomic science in Slovakia. The main chapters are as follows: Atoms in the world, Atoms in Slovakia, Atoms in the educational system, Atoms in health services (Radiology, Nuclear medicine, Radiation protection, the Cyclotron centre of the Slovak Republic), Radioecology, Other applications of irradiation, Nuclear energetics (Electric energy in the second half of the 20 th century, NPP Bohunice, NPP Mochovce, the back-end of Nuclear energetics, Big names in Nuclear energetics in Slovakia), Chronology and an Appendix entitled 'Slovak companies in nuclear energetics'

  17. Keberlanjutan dan Perubahan Pakarena Paolle

    Directory of Open Access Journals (Sweden)

    Fifie Febryanti Sukman

    2014-11-01

    Full Text Available Kehadiran Tarian Paolle dalam masyarakat Bantaeng merupakan latar belakangkebiasaan yang mengikuti tradisi leluhur mereka yang dilakukan sejak zaman dahulumelalui upacara adat yang memiliki Paolle Dance di dalamnya. Perubahan dari segibentuk Tarian Paolle terletak pada seorang penari, tempat, dan kostum. Para penariPaolle hari ini juga berbeda dari penari pertama pada zaman Kerajaan Paolle. Sepertipada hari-hari tertentu, para penari Raya Paolle adalah gadis remaja yang masihdalam keadaan suci atau tidak menstruasi, di saat para penari menjadi orang tua,mereka memiliki banyak pengalaman hidup dalam menari, sebuah praktik yangpada awalnya merupakan milik kerajaan, yang dapat dipilih dan dilihat oleh publikdi lapangan. Kostum atau pakaian yang digunakan para penari adalah irisan hitambodo yang sangat tipis dan sekarang hal itu berubah menjadi merah. KeberlanjutanTarian Paolle di masa sekarang harus dilihat dalam pernikahan atau baby shower.Masyarakat Bantaeng masih menunjukkan tarian ini dalam siklus hidup, misalnya,dalam acara pernikahan, sunat atau hanya berfungsi sebagai hiburan Tarian Paolle. Continuities and Changes of Pakarena Paolle. The background presence of PaolleDance in Bantaeng societies is a habit that follows the customs of their ancestors whohave practiced them since the time immemorial through the traditional ceremony that hasPaolle Dance in it. Changes in terms of the shape of Paolle Dance depend on a dancer,a venue, and costumes. Today’s Paolle Dancers are also different from the first dancers inKingdom era of Paolle. On the days of the Kingdom Paolle, dancers were teenage girls whowere still in a state of purity or not menstruation, but now dancers are the parents becausethey have a lot of life experiences in dancing, a practice that was originally familiarizedin the kingdom can be seen by the public in the field. Costume outfit that used a very thinblack wedge of bodo now turns into red. Paolle Dance sustainability in the

  18. Positron-atom collisions

    International Nuclear Information System (INIS)

    Drachman, R.J.

    1984-01-01

    The past decade has seen the field of positron-atom collisions mature into an important sub-field of atomic physics. Increasingly intense positron sources are leading towards a situation in which electron and positron collision experiments will be on almost an equal footing, challenging theory to analyze their similarities and differences. The author reviews the advances made in theory, including dispersion theory, resonances, and inelastic processes. A survey of experimental progress and a brief discussion of astrophysical positronics is also included. (Auth.)

  19. Atomic Force Microscope

    Energy Technology Data Exchange (ETDEWEB)

    Day, R.D.; Russell, P.E.

    1988-12-01

    The Atomic Force Microscope (AFM) is a recently developed instrument that has achieved atomic resolution imaging of both conducting and non- conducting surfaces. Because the AFM is in the early stages of development, and because of the difficulty of building the instrument, it is currently in use in fewer than ten laboratories worldwide. It promises to be a valuable tool for obtaining information about engineering surfaces and aiding the .study of precision fabrication processes. This paper gives an overview of AFM technology and presents plans to build an instrument designed to look at engineering surfaces.

  20. Optically pumped atoms

    CERN Document Server

    Happer, William; Walker, Thad

    2010-01-01

    Covering the most important knowledge on optical pumping of atoms, this ready reference is backed by numerous examples of modelling computation for optical pumped systems. The authors show for the first time that modern scientific computing software makes it practical to analyze the full, multilevel system of optically pumped atoms. To make the discussion less abstract, the authors have illustrated key points with sections of MATLAB codes. To make most effective use of contemporary mathematical software, it is especially useful to analyze optical pumping situations in the Liouville spa

  1. Atomic cluster collisions

    Science.gov (United States)

    Korol, Andrey V.; Solov'yov, Andrey

    2013-01-01

    Atomic cluster collisions are a field of rapidly emerging research interest by both experimentalists and theorists. The international symposium on atomic cluster collisions (ISSAC) is the premier forum to present cutting-edge research in this field. It was established in 2003 and the most recent conference was held in Berlin, Germany in July of 2011. This Topical Issue presents original research results from some of the participants, who attended this conference. This issues specifically focuses on two research areas, namely Clusters and Fullerenes in External Fields and Nanoscale Insights in Radiation Biodamage.

  2. Pulsed atomic soliton laser

    International Nuclear Information System (INIS)

    Carr, L.D.; Brand, J.

    2004-01-01

    It is shown that simultaneously changing the scattering length of an elongated, harmonically trapped Bose-Einstein condensate from positive to negative and inverting the axial portion of the trap, so that it becomes expulsive, results in a train of self-coherent solitonic pulses. Each pulse is itself a nondispersive attractive Bose-Einstein condensate that rapidly self-cools. The axial trap functions as a waveguide. The solitons can be made robustly stable with the right choice of trap geometry, number of atoms, and interaction strength. Theoretical and numerical evidence suggests that such a pulsed atomic soliton laser can be made in present experiments

  3. Drets lingüístics i ordenament constitucional. Seguretat lingüística vs jerarquia lingüística. Un estudi comparat de Suïssa i Espanya

    OpenAIRE

    Tasa Fuster, Vicenta

    2016-01-01

    Aquesta tesi doctoral té com a objecte l’anàlisi comparat del tractament legal que reben les diferents llengües d’Espanya i de Suïssa en les constitucions i en la legislació respectives, tot considerant que Espanya i Suïssa són dos estats plurilingües i amb una organització territorial complexa. El treball és fet dins del Dret Constitucional; però té en compte també altres ciències socials, com ara la Ciència Política, la Teoria Política, anàlisi de les polítiques públiques o la sociolingüíst...

  4. Perubahan Eksternal, Soft Skills Dan Kurikulum Kesehatan

    Directory of Open Access Journals (Sweden)

    Elfindri Elfindri

    2010-11-01

    Full Text Available Tulisan ini menyoroti begitu pentingnya tingkah laku kesehatan rumah tangga ‘household health behavior’1 didorong dan direkayasa untuk meminimumkan efek dari persebaran virus. Sekiranya pengetahuan dan kesadaran akan hal ini rendah, maka untuk kasus negara berkembang seperti Indonesia, perkembangan berbagai jenis penyakit degeneratif akan semakin sulit dicegah. Meluasnya persoalan ini kemudian akan berdampak kepada semakin besarnya biaya pencegahannya, dan dampak dari kecepatan virus bisa berbahaya lebih besar lagi. Salah satu implikasi adalah pencegahan dapat dilakukan melalui perbaikan kurikulum pendidikan akan bahaya dari persebaran virus. AIDS, FLU Burung, Flu Babi, Demam Berdarah, dan sebagainya cukup memusingkan pelayanan kesehatan, termasuk insektisida. Pemutakhiran kurikulum tentunya bermanfaat untuk memajukan pendidikan kesehatan, khususnya pendidikan keperawatan, unsur soft skills sangat penting, selain dari perubahan kognitif.

  5. Kreativitas Desain Kuliner dan Sistem Inovasi Lokal

    Directory of Open Access Journals (Sweden)

    Yasraf Amir Pialang

    2016-02-01

    ABSTRAK   Pengembangan kreativitas pada sebuah kelompok, kelas sosial atau komunitas sangat ditentukan oleh modal yang diinvestasikan dalam ranah kreativitas: ekonomi, budaya, sim- bolik dan sosial. Penelitian ini adalah upaya untuk memahami kreativitas sebagai bagian dari ranah khusus sosial-budaya, yaitu ‘ranah kreativitas’. Dengan menggunakan metode etnografi, penelitian ini adalah upaya untuk menganalisis relasi antara ide-ide kreatif dan konteks sosial-budaya di mana ide-ide itu diproduksi. Melalui penelitian lapangan yang intensif terhadap komunitas kreatif lokal, penelitian ini menyimpulkan, bahwa produksi ide-ide kreatif sangat ditentukan oleh kelengkapan sub-sub ranah yang membangun ranah kreatif: ekspresi, produksi, diseminasi dan apresiasi. Berdasarkan ranah-ranah kreatif ini, tiga model sistem inovasi dapat diajukan: sistem terbuka, sistem liminal dan sistem tertu- tup.   Kata kunci: ide kreatif, ranah, inovasi, modal

  6. RADIKALISME DI INDONESIA: Antara Historisitas dan Antropisitas

    Directory of Open Access Journals (Sweden)

    Ahmad Asrori

    2017-02-01

    Full Text Available Studi ini mencoba menganalisis faktor-faktor yang mendorong munculnya radikalisme di Indonesia. Berdasarkan hasil penelitian ditemukan sekurang-kurangnya ada 3 faktor, yakni pertama, perkembangan di tingkat global, Kedua, penyebaran paham Wahabisme dan yang ketiga adalah kemiskinan. Situasi yang kacau di negara-negara Timur Tengah khususnya di Afghanistan, Palestina, Irak, Yaman, Mesir, Syiria, dan Turki, dipandang oleh kelompok-radikal sebagai akibat dari campur tangan Amerika, Israel, dan sekutunya. Pada saat yang sama, Masuknya faham Wahabisme yang mengagungkan budaya Islam ala Arab yang konservatif ke Indonesia telah ikut mendorong timbulnya kelompok eksklusif yang sering menuduh orang lain yang berada di luar kelompok mereka sebagai musuh, kafir dan boleh diperangi. Faktor ketiga adalah kemiskinan. Meski faktor ini tidak secara langsung berpengaruh terhadap merebaknya aksi radikalisme, namun perasaan sebagai elemen masyarakat yang termarjinalkan dapat menjadi faktor pendorong bagi seseorang untuk terjebak dalam proganda radikalisme.

  7. Kedudukan Musyawarah dan Demokrasi di Indonesia

    Directory of Open Access Journals (Sweden)

    Muhammad Hanafi

    2016-04-01

    Full Text Available Abstrak: Kedudukan Musyawarah dan Demokrasi di Indonesia. Negara Kesatuan Republik Indonesia (NKRI berdasarkan lintasan sejarah perjuangan, memiliki konstruksi kenegaraan satu-satunya di dunia yang bangsa terlahir dahulu, kemudian baru membentuk negara. Presiden pertama Republik Indonesia Ir. Soekarno menegaskan, bahwa Negara Kesatuan ialah Negara Kebangsaan. Tujuan Bangsa Indonesia terlahir, merdeka, dan membentuk negara memiliki satu cita-cita, Kehendak Untuk Mengangkat Harkat dan Martabat Hidup Rakyat Indonesia (Kedaulatan Rakyat Indonesia. Melalui analisis atas realitas kehidupan saat ini, Bangsa Indonesia telah hidup pada kondisi tatanan kehidupan seolah-olah sama dengan Negara Demokrasi, ialah negara dulu terbentuk baru bangsanya dilahirkan kemudian. Sehingga kedaulatan rakyat Indonesia yang berdasarkan prinsip musyawara-mufakat dan perwakilan belum mampu terealisasi. Sementara pelaksanaan demokrasi voting yang memiliki dasar liberalisme terus bergulir, sehingga kehidupan bangsa Indonesia semakin jauh dari cita-cita awal. DOI: 10.15408/jch.v1i2.2657

  8. DESAIN KOMUNIKASI VISUAL DAN PERILAKU KONSUMEN

    Directory of Open Access Journals (Sweden)

    Bagus Limandoko

    2000-01-01

    Full Text Available The word design is a word with different meanings. In the visual communication context it has became part of the team in the communication industry - the world of advertising%2C magazine and newspaper publishing%2C marketing and public relations%2C and%2C indeed%2C it has became one of the influential aspects to shape the behavior of a society and its economic development. Abstract in Bahasa Indonesia : Desain merupakan sebuah kata dengan banyak makna. Dalam konteks komunikasi visual%2C desain sudah menjadi bagian dari tim dalam industri komunikasi. Dunia advertising%2C publikasi majalah dan suratkabar%2C pemasaran dan public relations%2C dan yang pasti desain juga sudah menjadi salah satu aspek yang berpengaruh dalam membentuk perilaku suatu masyarakat dan perkembangan ekonominya. design%2C designer%2C visual communication design%2C behavior%2C consumer

  9. Isolasi Dan Identifikasi Terpenoid dari Fraksi n-Butanol Herba Lampasau (Diplazium esculentum Swartz

    Directory of Open Access Journals (Sweden)

    Maria Dewi Astuti

    2017-03-01

    Full Text Available Abstrak Telah dilakukan penelitian yang bertujuan untuk mengidentifikasi senyawa kimia yang diisolasi dari fraksi n-butanol ekstrak metanol herba lampasau (Diplazium esculentum Swartz. Ekstrak metanol diperoleh secara maserasi dan difraksinasi berturut-turut denganpetroleum eter, etil asetat, dan n-butanol. Fraksi n­-butanol difraksinasidengan kromatografi kolom dengan fase diam silika gel dihasilkan fraksi A, B, C, dan D. Fraksi B dimurnikan dengan kromatografi lapis tipis preparatif pada silika geldihasilkan isolat B1. Isolat B1 berupa padatan tidak berwarna danberfluoresensi putih di bawah lampu UV 366 nm. Panjang gelombang maksimum pada spektra UV  isolat B1 adalah 225 nm dan 272.5 nm yang menunjukkan adanya ikatan rangkap tak terkonjugasi. Spektra IR isolat B1 menunjukkan adanya gugus C=C, –OH, C=O lakton, –CO, C–H ulur, dan C–H tekuk. Spektra 1H-NMR isolat B1 menunjukkan sinyal proton pada ikatan rangkap, proton –OH, proton pada –CH2 yang terikat atom oksigen, serta proton gugus metil –CH3. Berdasarkan data spektra UV, IR, dan 1H-NMR maka isolat B1 disarankan sebagai turunan senyawa triterpenoid hopan-lakton. Kata kunci : diplazium esculentum Swartz, fraksi n-butanol, triterpenoid hopan-lakton  Abstract The research  aims to identify chemical compounds isolated fromn-butanol fraction methanol extract of lampasau herbs (Diplazium esculentum Swartz. The methanol extract was obtained by maceration and fractioned by petroleum ether, ethyl acetate, andn-butanol. N-butanol fraction was fractionated using column chromatography on silica gel produced fractions A, B, C, and D. Fraction B was purified by preparative thin layer chromatography on silica gel produced isolate B1. Isolate B1was colorless solid and has white fluorescent under UV lamp 366 nm. The maximum wavelength on UV spectra of B1 are 225 nm and 272,5 nm indicates the unconjugated double bond. IR spectra of B1 showed the vibration of C=C, –OH, C=O lactone, –CO, C

  10. Polarized atomic beams for targets

    International Nuclear Information System (INIS)

    Grueebler, W.

    1984-01-01

    The basic principle of the production of polarized atomic hydrogen and deuterium beams are reviewed. The status of the present available polarization, density and intensity are presented. The improvement of atomic beam density by cooling the hydrogen atoms to low velocity is discussed. The possible use of polarized atomic beams as targets in storage rings is shown. It is proposed that polarized atomic beams can be used to produce polarized gas targets with high polarization and greatly improved density

  11. PERMASALAHAN DAN POTENSI PESISIR DI KABUPATEN SAMPANG

    Directory of Open Access Journals (Sweden)

    Aries Dwi Siswanto

    2016-03-01

    Full Text Available SAMPANG’S COASTAL PROBLEMS AND POTENTIALS One area that has progressive economic value and environmental degradation possibility is a dynamic areas of coastal areas. These characteristics is interesting in the perspective of management and utilization of marine resources and fisheries. The rapid development of the Sampang regency required the government to focus and provide greater attention to minimize the ecological pressures that affect the carrying capacity of the environment, particularly in coastal areas. This study aims to gather information about the problem and the potential that exists in coastal areas of Sampang. Data taken by interviewing respondents lived in coastal communities during April 2015 and the results of the questionnaire were analyzed descriptively. The problems identified include land requirement, the overlapping use, the threat of pollution and environmental degradation, and zoning; whereas the potential that exists include salt, marine tourism, mariculture, and the development of industrial areas and ports. The potential problems identified in coastal areas and beaches in Sampang relatively identical to the Bangkalan. It needs a comprehensive solution to minimize the existing impact as well as efforts to optimize utilization to achieve integrated coastal zone management.Keywords: coastal, CZM, problem, potential, Sampang ABSTRAKSalah satu wilayah yang memiliki nilai ekonomi progresif sekaligus peluang degradasi lingkungan sehingga disebut daerah dinamis adalah wilayah pantai dan pesisir. Karakteristik ini menjadi sesuatu yang menarik dalam perspektif pengelolaan dan pemanfaatan sumberdaya kelautan dan perikanan. Pesatnya perkembangan tersebut menuntut pemerintah kabupaten Sampang untuk focus dan memberikan perhatian lebih besar sebagai upaya untuk meminimalkan tekanan ekologis yang berpengaruh terhadap daya dukung lingkungan, khususnya di wilayah pesisir. Penelitian ini bertujuan untuk mengumpulkan informasi

  12. KEPRIBADIAN SISWA DAN DISIPLIN BELAJAR SEBAGAI INTERVENING PENGARUH LINGKUNGAN KELUARGA DAN LINGKUNGAN SEKOLAH TERHADAP HASIL BELAJAR

    Directory of Open Access Journals (Sweden)

    Ajeng Febriyani

    2016-11-01

    Full Text Available Tujuan penelitian ini untuk menganalisis pengaruh langsung lingkungan keluarga dan lingkungan sekolah terhadap hasil belajar ekonomi maupun pengaruh tidak langsung melalui kepribadian siswa dan disiplin belajar. Populasi penelitian adalah seluruh siswa kelas XI IPS SMA Muhammadiyah sejumlah 152 siswa. Sampel yang diambil menggunakan rumus Slovin sebanyak 110 siswa. Metode pengumpulan data menggunakan angket dan dokumentasi. Metode analisis data adalah analisis deskriptif, analisis jalur, dan sobel test. Hasil penelitian menunjukkan bahwa (1 terdapat pengaruh positif dan signifikan lingkungan keluarga, lingkungan sekolah, kepribadian siswa serta disiplin belajar terhadap hasil belajar ekonomi, (2 terdapat pengaruh positif dan signifikan lingkungan keluarga dan lingkungan sekolah terhadap kepribadian siswa, (3 terdapat pengaruh positif dan signifikan lingkungan keluarga, lingkungan sekolah dan kepribadian siswa terhadap disiplin belajar, (4 kepribadian siswa secara signifikan memediasi pengaruh lingkungan keluarga dan lingkungan sekolah terhadap hasil belajar ekonomi, (5 disiplin belajar secara signifikan memediasi pengaruh lingkungan keluarga, lingkungan sekolah dan kepribadian siswa terhadap hasil belajar ekonomi. Berdasarkan hasil penelitian dapat disimpulkan bahwa kepribadian siswa dan disiplin belajar memediasi pengaruh lingkungan keluarga dan lingkungan sekolah terhadap hasil belajar ekonom. Saran yang dapat diberikan adalah pihak keluarga dan pihak sekolah mampu melakukan perbaikan kualitas lingkungan keluarga dan lingkungan sekolah untuk meningkatkan hasil belajar ekonomi. The purposes of this study were to analyze the direct effect of family and school environment for towards economics study result or or indirect effect through students’ personality and study discipline. The population in this research is The research \\ XI social grade in SMA Muhammadiyah Wonosobo with a total of 152 students. It used 110 students as the sample by

  13. Hubungan Antara Pengetahuan, Sikap, dan Perilaku Karyawan dengan Penerapan Manajemen Budaya Keselamatan dan Kesehatan Kerja

    Directory of Open Access Journals (Sweden)

    Endang Purnawati Rahayu

    2015-05-01

    Full Text Available Budaya K3 dipengaruhi oleh organisasi, individu, dan lingkungan kerja. Tujuan penelitian ini menganalisis hubungan pengetahuan, sikap dan perilaku karyawan dengan penerapan Budaya Keselamatan Dan Kesehatan (K3 di Bagian Produksi PT. Mustika Ratu. Penelitian ini menggunakan pendekatan kuantitatif jumlah sampel sebanyak 170 orang yang diambil secara simple random sampling. Hasil penelitian:  85,9% responden memiliki pengetahuan yang baik mengenai penerapan manajemen budaya K3, 80.6% bersikap baik dan 84.7% berperilaku baik pada penerapan budaya K3.  Penerapan manajemen budaya K3 memberikan hasil baik : 89,4 % sudah menerapkan manejemen budaya K3. Mengenai hubungan pengetahuan, sikap dan perilaku terhadap penerapan manajemen budaya K3, sub variabel yang diteliti memberikan hasil yang sama yaitu adanya hubungan yang bermakna. Hubungan pengetahuan terhadap penerapan manajemen budaya K3 (pValue < 0,001 dan Odd Ratio 9,133 (95% CI=3,143-26,539. Hubungan  sikap terhadap penerapan manajemen budaya K3 (Pvalue < 0,001 dan Odd Ratio= 9,286 (95% CI = 3,250 - 26,531, sedangkan hubungan perilaku terhadap penerapan manajemen budaya K3 (p value < 0,001 dan Odd Ratio=  5,956 (95% CI = 2,080 - 17,051. Temuan lainnya adalah tidak ada hubungan yang bermakna antara karakteristik responden dengan penerapan budaya K3. Saran: pihak manajemen harus melakukan monitoring dan harus memiliki komunikasi yang baik dengan karyawan, melatih dan melibatkan karyawan untuk meningkatkan upaya perusahaan pada pelaksanaan K3 dengan penerapan OSHAS 18001 sesuai Undang-Undang Nomor 1 Tahun 1970 dan PP (peraturan pemerintah nomor 50 pada tahun 2012.

  14. Komposisi Kimia, Kadar Albumin Dan Bioaktivitas Ekstrak Protein Ikan Gabus (Channa Striata Alam Dan Hasil Budidaya

    Directory of Open Access Journals (Sweden)

    Ekowati Chasanah

    2015-12-01

    Full Text Available Khasiat kesehatan ikan gabus (C. striata telah dikenal secara luas dan saat ini C. striata telah digunakan sebagai bahan baku industri produk suplemen. Tingginya permintaan akan produk suplemen tersebut menimbulkan masalah pada ketersediaan C. striata yang sebagian besar ditangkap dari sungai dan danau sebagai tempat hidupnya. Ikan gabus budidaya dipercaya memiliki kualitas tidak sebaik ikan gabus alam.Tujuan penelitian ini adalah untuk mendapatkan informasi mengenai komposisi kimia, termasuk albumin dan potensi ekstrak protein kasar ikan gabus alam dan hasil budidaya sebagai antioksidan dan anti hipertensi. Hasil analisis menunjukkan bahwa ikan gabus alam dan hasil budidaya memiliki kadar protein yang tidak berbeda secara nyata, tetapi berbeda pada kadar air, abu, dan lemak. Ikan gabus alam memiliki kadar lemak dan abu lebih rendah tetapi kadar air lebih tinggi dibanding ikan gabus budidaya. Ikan dari kedua sumber memiliki bagian yang dapat dimakan atau edible portion (EP sebesar 36%,dengan kadar mineral makro (Na, K, Ca dan mikro (Zn, Fe pada ikan hasil budidaya lebih tinggi dibanding kedua kelompok mineral pada ikan gabus alam. Kadar albumin ikan gabus alam lebih tinggi daripada kadar albumin ikan gabus budidaya. Namun demikian, hasil analisis asam amino menunjukkan bahwa ikan gabus hasil budidaya memiliki kuantitas asam amino yang lebih tinggi daripada ikan gabus alam. Asam amino non essensial dominan adalah alanin, asam aspartat, glisin, alloisoleusin, prolin, dan glutamin, sedangkan asam amino esensial didominasi oleh leusin, lisin, dan fenilalanin. Kedua ikan gabus yang diperoleh dari tempat yang berbeda tersebut memiliki bioaktivitas sebagai antioksidan yang lemah, namun berpotensi sebagai antihipertensi (penghambat Angiotensin Converting Enzyme (ACE dengan kekuatan 1/10 kekuatan kontrol obat hipertensi captopril.

  15. Komposisi Kimia, Kadar Albumin dan Bioaktivitas Ekstrak Protein Ikan Gabus (Channa striata Alam dan Hasil Budidaya

    Directory of Open Access Journals (Sweden)

    Ekowati Chasanah

    2015-12-01

    Full Text Available Khasiat kesehatan ikan gabus (C. striata telah dikenal secara luas dan saat ini C. striata telah digunakan sebagai bahan baku industri produk suplemen. Tingginya permintaan akan produk suplemen tersebut menimbulkan masalah pada ketersediaan C. striata yang sebagian besar ditangkap dari sungai dan danau sebagai tempat hidupnya. Ikan gabus budidaya dipercaya memiliki kualitas tidak sebaik ikan gabus alam.Tujuan penelitian ini adalah untuk mendapatkan informasi mengenai komposisi kimia, termasuk albumin dan potensi ekstrak protein kasar ikan gabus alam dan hasil budidaya sebagai antioksidan dan anti hipertensi. Hasil analisis menunjukkan bahwa ikan gabus alam dan hasil budidaya memiliki kadar protein yang tidak berbeda secara nyata, tetapi berbeda pada kadar air, abu, dan lemak. Ikan gabus alam memiliki kadar lemak dan abu lebih rendah tetapi kadar air lebih tinggi dibanding ikan gabus budidaya. Ikan dari kedua sumber memiliki bagian yang dapat dimakan atau edible portion (EP sebesar 36%,dengan kadar mineral makro (Na, K, Ca dan mikro (Zn, Fe pada ikan hasil budidaya lebih tinggi dibanding kedua kelompok mineral pada ikan gabus alam. Kadar albumin ikan gabus alam lebih tinggi daripada kadar albumin ikan gabus budidaya. Namun demikian, hasil analisis asam amino menunjukkan bahwa ikan gabus hasil budidaya memiliki kuantitas asam amino yang lebih tinggi daripada ikan gabus alam. Asam amino non essensial dominan adalah alanin, asam aspartat, glisin, alloisoleusin, prolin, dan glutamin, sedangkan asam amino esensial didominasi oleh leusin, lisin, dan fenilalanin. Kedua ikan gabus yang diperoleh dari tempat yang berbeda tersebut memiliki bioaktivitas sebagai antioksidan yang lemah, namun berpotensi sebagai antihipertensi (penghambat Angiotensin Converting Enzyme (ACE dengan kekuatan 1/10 kekuatan kontrol obat hipertensi captopril.

  16. Berpikir Rasional-Ilmiah dan Pendekatan Interdisipliner dan Multidisipliner dalam Studi Hukum Keluarga Islam

    Directory of Open Access Journals (Sweden)

    Khoiruddin Nasution

    2017-12-01

    Full Text Available This short article tries to explain how important it is to think rationally and scientifically, place the position of approachment in the Study of Islamic Family Law, also describe the use of Interdisciplinary and multidisciplinary approach to understand and practice the Islamic Family Law. In conclusion, there are three conclutions. First, students need to get used to think, write, speak and act rationallly and scientifically. The process can be carried out by integrating with the entire subjecy. Second,  needs a good and comprehensive understanding of approachment positions in the study of Islamic Family Law, both in relation to habituation of thinking, writing, speaking and acting rational and scientific as well as in effort to integrate and interconnect Islam and science. Third, it is necessary to habituate using an interdisciplinary and multidisciplinary approach to understand and observe all matters  that related to the Islamic Family Law.   [Tulisan singkat ini mencoba menjelaskan bagaimana pentingnya berpikir rasional dan ilmiah, meletakkan dimana posisi pendekatan dalam Studi Hukum Keluarga Islam, sekaligus menggambarkan penggunaan Pendekatan Interdisipliner dan Multidisipliner dalam memahami dan mengamalkan Hukum Keluarga Islam. Kesimpulannya ada tiga. Pertama, mahasiswa perlu dibiasakan berpikir, menulis, berbicara dan bentindak rasional dan ilmiah. Proses pembiasaannya dapat dilakukan secara terintegrasi dengan seluruh mata kuliah. Kedua, perlu pemahaman yang baik dan konprehensif bagaimana posisi pendekatan dalam studi Hukum Keluarga Islam, baik dalam kaitannya dengan pembiasaan berpikir, menulis, berbicara dan bentindak rasional dan ilmiah maupun dalam upaya integrasi dan/atau interkoneksi keilmuan. Ketiga, perlu pembiasaan menggunakan pendekatan interdisipliner dan multidisipliner dalam memahami dan mengamalkan segala persoalan yang berkaitan dengan Hukum Keluarga Islam.

  17. By Product Ternak Teknologi dan Aplikasinya

    OpenAIRE

    Said, Muhammad Irfan

    2015-01-01

    DAFTAR PUSTAKA Adventini, N., Muhayatun, D. D. Lestiani dan W.Y.N. Syahfitri. 2012. Analisis Mikronutrien dalam Daging, Limpa, dan Hati Sapi. Jurnal Medika. 38 (8), 580???586. Angelidaki, I., and B. K. Ahring. 2000. Methods for increasing the biogas potential from the recalcitrant organic matter contained in manure. Water Science Technology. 41 (3), 189-194. Anonim. 1974. Gelita-Instant-Gelatins Type 800 A Type 800 B. Gelatine-Information-Service. Deutsche Gelatine-Febrike...

  18. Diapers Bagi Kesehatan Bayi dan Lingkungan

    OpenAIRE

    Noriko, Nita

    2013-01-01

    Bayi yang berusia 0 sampai hingga 1 tahun termasuk golongan rentan, karena memiliki sistem kekebalan tubuh yang belum sempurna. Kekebalan tubuh yang dimiliki bayi adalah kekebalan pasif . Terpaparnya bayi terhadap antigen dapat terjadi melalui udara, air, makanan maupun perlengkapan yang digunakan seperti alas perlindungan (diapers) terhadap enupresis dan enkopresis. Diapers dikenal di Indonesia sejak tahun 1980 karena penggunaannya yang praktis dan mudah Penggunaan diapers menimbulkan ...

  19. Peut-on voyager dans le temps ?

    CERN Multimedia

    CERN. Geneva

    2008-01-01

    La possibilité de voyager dans le temps est régulièrement évoquée par les magazines scientifiques (et parfois même par les scientifiques). Elle est également le sujet de nombreux romans de science-fiction. Nous discuterons d’abord du sens qu’on peut donner à l’expression « voyager dans le temps », puis nous expliciterons ce que la physique contemporaine dit à ce propos.

  20. Bahasa Bali dan Pemertahanan Kearifan Lokal

    OpenAIRE

    Suardiana, I Wayan

    2012-01-01

    Bahasa Bali sebagai salah satu bahasa dan perekam budaya Bali sangat penting untuk dipelihara. Pemeliharaan bahasa Bali juga diharapkan untuk mempertahankan taksu Bali. Di Bali ada tingkatan(anggah-ungguhin basa) berbahasa yang menyebabkan terdapatnya klasifikasi sosial dalam masyarakat Bali. Kemampuan seseorang dalam menggunakan bahasa Bali memperlihatkan kedudukan sosial dan etika orang tersebut dalam berbahasa. Kemudian muncul pertanyaan ketika orang Bali berbicara dalam bahasa Bali tanp...

  1. Corak Etnik dan Dinamika Batik Pekalongan

    OpenAIRE

    Irfa'ina Rohana Salma

    2016-01-01

    ABSTRAKBatik Pekalongan mempunyai ciri khas atau karakter yang berbeda dengan batik dari daerah pesisir lainnya. Corak yang berbeda ini karena adanya pengaruh budaya dari etnis-etnis pembuat batik yang berdomisili di Pekalongan, yaitu etnis Jawa, etnis Cina dan etnis Belanda. Tulisan ini bertujuan untuk melakukan tinjauan dan mengkritisi lebih dalam ciri khas atau karakter corak dari batik yang dihasilkan para pembatik dari etnis yang berbeda di Pekalongan. Metode pendekatan yang dipakai yait...

  2. Strategi Pembelajaran Biologi Berbasis Kompetensi dan Konservasi

    Directory of Open Access Journals (Sweden)

    Saiful Ridlo

    2013-09-01

    Full Text Available AbstrakPembelajaran melibatkan interaksi dosen, mahasiswa, dan sumber belajar. Interaksi antara ketiganya membutuhkan strategi pembelajaran. Penelitian ini bertujuan menghasilkan strategi pembelajaran biologi di Jurusan Biologi Unnes yang telah berkomitmen mengaplikasikan kurikulum berbasis kompetensi dan konservasi dengan ciri pendekatan jelajah alam sekitar (JAS. Metodologi penelitian menggunakan pendekatan kualitatif. Informannya dosen dan mahasiswa yang mengajar dan belajar biologi umum, mikrobiologi, dan taksonomi hewan. Data yang diperoleh berupa deskripsi kegiatan belajar mengajar dan lesson study.  Data-data dianalisis kemudian dinarasikan. Hasil penelitian menunjukkan pembelajaran biologi dengan pendekatan berpusat pada siswa yang dikhususkan pada kegiatan penjelajahan alam sekitar dapat dilakukan menggunakan strategi yang berbasis pada cara belajar siswa aktif dan kooperatif. Strategi-strategi tersebut adalah pembelajaran kontekstual, pembelajaran partisipatif, dan pembelajaran inkuiri. AbstractLearning involves the interaction of lecturer, students, and learning resources. The interaction between them requires a learning strategy. This research aims to generate learning strategies of biology in the Department of Biology Unnes which has committed to apply the competence- and conservation-based curriculum of features the environmental exploration (JAS approach. The research methodology uses a qualitative approach. The informants are the faculty members and the students who, respectively, teach and learn biology, microbiology, and animal taxonomy subjects. The data obtained were in the form of description of learning activities and lesson studies. The data were then analyzed narratively. The results showed that the student-centered learning of environmental exploration may be conducted using active- and cooperative-based strategies. Examples of these strategies are contextual learning, participatory learning, and inquiry learning.

  3. KONSTRUKSI GENDER, HEGEMONI KEKUASAAN, DAN LEMBAGA PENDIDIKAN

    OpenAIRE

    Marhumah Marhumah

    2012-01-01

    AbstrakIsu gender adalah bagian dari persoalan sosial kemasyarakatan di Indonesia, yang persoalan utamanya  adalah kesenjangan mencolok antara laki-laki dan perempuan. Selama ini, sosialisasi gender adalah dengan cara mengedarkan pesan-pesan, wacana, nilai-nilai, norma-norma, kepercayaan dan model-model yang merepresentasikan kontruksi gender tertentu, yang dalam konsep Foucault sebagai diskursus (discourse). Dengan konsep wacana tersebut, sosialisasi gender mengandaikan adanya relasi pengeta...

  4. Desain Premi dan Manfaat Asuransi Deposito

    Directory of Open Access Journals (Sweden)

    Said Kelana Asnawi

    2009-05-01

    Full Text Available Paper ini memuat desain penentuan premi asuransi deposito dengan mempertimbangkan pinalti bagi perilaku moral hazard dan memberikan sanggahan teoritis terhadap pendapat yang meragukan kebaikan asuransi deposito. Sanggahan ini didasarkan pada desain premi jika mempertimbangkan pinalti bagi perilaku moral hazard. Sanggahan ini merujuk pada manfaat asuransi berupa penurunan penarikan serta laba bank yang positip dan manfaat sosial yang diperoleh pemerintah. Key Word: asuransi deposito, incentive compatible plan, moral hazard, camel rating, Option Theory-Jump Process, Benefit Sosial Pemerintah

  5. PRINSIP DAN KRITERIA PERIKLANAN DARI PERSPEKTIF ISLAM

    Directory of Open Access Journals (Sweden)

    Teuku Meldi Kesuma

    2012-06-01

    Full Text Available Advertising in marketing Islamic products must be believed and understood as an important part of marketing based on Islam which should not be separated. This paper examines the principles and criteria of the advertising in the perspective of Islam. It is caused by the increasing of the companies and institutions which are based on Islamic values such as Islamic financial institutions that promote its products the consumers. The important issues discussed in this paper is how the real of concepts, principles, and criteria of Islamic advertising? Therefore this paper is developing an advertising concept from the perspective of Islam and to know for sure whether the principles and criteria that should exist in advertising Islam. The methodology applied in this paper is through literature review by using content analysis. Hopefully, this study could develop an Islamic perspective advertisement concept in terms of principles and criteria. =========================================== Periklanan dalam memasarkan produk-produk Islam harus diyakini dan di pahami merupakan bahagian penting dalam pemasaran yang berdasarkan Islam yang tidak boleh dipisahkan. Tulisan ini mengkaji prinsip-prinsip dan kriteria periklanan dalam perspektif Islam. Hal ini disebabkan semakin ramai dan tingginya pertumbuhan perusahaan dan institusi yang berlandaskan nilai-nilai Islam seperti institusi keuangan Islam yang mempromosikan produk dan perkhidmatannya kepada orang ramai. Persoalan penting yang dibahas dalam kertas kerja ini adalah bagaimanakah bentuk konsep, prinsip dan kriteria periklanan Islam yang sebenarnya? Oleh karena itu tujuan kertas kerja ini adalah untuk membangun satu konsep periklanan dari perspektif Islam dan untuk mengenal pasti apakah prinsip-prinsip serta kriteria yang seharusnya ada dalam periklanan Islam. Metodologi kajian yang digunakan dalam kertas kerja ini adalah metode kepustakaan dengan menggunakan analisis isi. Kajian ini diharapkan dapat

  6. VCS-SSA Mainz Experiment. Measurement of the beam spin asymmetry in (e polarized p {yields} ep{gamma}) and (e polarized p {yields} ep{pi}{sup 0}). Final analysis - MEMO I

    Energy Technology Data Exchange (ETDEWEB)

    Fonvieille, H.; Bensafa, I. [LPC-Clermont-Fd, Universite Blaise Pascal, F-63170 Aubiere Cedex (France)

    2006-02-15

    This note gives details on the final analysis of the VCS-SSA experiment in terms of Beam Spin Asymmetry. It summarizes the changes between the first and second pass analysis. Then the measured asymmetry is presented for both channels e polarized p {yields} ep{gamma} and e polarized p {yields} ep{pi}{sup 0} including systematic studies. The final experimental result is briefly compared to some model predictions. (authors)

  7. Atomic collisions related to atomic laser isotope separation

    International Nuclear Information System (INIS)

    Shibata, Takemasa

    1995-01-01

    Atomic collisions are important in various places in atomic vapor laser isotope separation (AVLIS). At a vaporization zone, many atomic collisions due to high density have influence on the atomic beam characteristics such as velocity distribution and metastable states' populations at a separation zone. In the separation zone, a symmetric charge transfer between the produced ions and the neutral atoms may degrade selectivity. We have measured atomic excitation temperatures of atomic beams and symmetric charge transfer cross sections for gadolinium and neodymium. Gadolinium and neodymium are both lanthanides. Nevertheless, results for gadolinium and neodymium are very different. The gadolinium atom has one 5d electron and neodymium atom has no 5d electron. It is considered that the differences are due to existence of 5d electron. (author)

  8. Spatially resolved photoionization of ultracold atoms on an atom chip

    International Nuclear Information System (INIS)

    Kraft, S.; Guenther, A.; Fortagh, J.; Zimmermann, C.

    2007-01-01

    We report on photoionization of ultracold magnetically trapped Rb atoms on an atom chip. The atoms are trapped at 5 μK in a strongly anisotropic trap. Through a hole in the chip with a diameter of 150 μm, two laser beams are focused onto a fraction of the atomic cloud. A first laser beam with a wavelength of 778 nm excites the atoms via a two-photon transition to the 5D level. With a fiber laser at 1080 nm the excited atoms are photoionized. Ionization leads to depletion of the atomic density distribution observed by absorption imaging. The resonant ionization spectrum is reported. The setup used in this experiment is suitable not only to investigate mixtures of Bose-Einstein condensates and ions but also for single-atom detection on an atom chip

  9. Entrer dans les squats ouverts

    OpenAIRE

    2015-01-01

    Au cœur des métropoles françaises émergent ici et là des squats, lieux d’habitation et de création affranchis, tournés vers la ville et ses habitants. Vivre en squat constitue un mode de vie, un choix subversif, une forme de résistance au système, autant qu’un recours face aux difficultés sociales. Ce livre nous plonge dans les squats « ouverts » et saisit, par la sociologie, le quotidien de ces populations mouvantes et fortement hétérogènes. Il répond à des questions simples. Qui sont ces sq...

  10. INTERRELASI BAHASA, MATEMATIKA DAN STATISTIKA

    Directory of Open Access Journals (Sweden)

    Rofiatul Andawiyah

    2014-11-01

    Full Text Available Tulisan ini berupaya mengungkap keterkaitan antara bahasa, matematika, serta statistika dimana dalam konsep berpikir ilmiah bahasa menjadi core dalam praktik keduanya baik matematika maupun statistika. Terlebih bahasa menjadi sesuatu yang amat penting untuk membahasakan matematika serta statistika itu sendiri selanjutnya Matematika merupakan bahasa yang melambangkan serangkaian makna dari pernyataan yang ingin kita sampaikan. Matematika memberikan kemudahan kepada kita di dalam memberi simbol akan makna sesuatu. Sehingga apa yang sulit menjadi mudah dipahami. Sementara statistika pengembangan lebih lanjut dari matematika. Penggunaan statistika dalam kehidupan dewasa ini sangat membantu untuk melakukan penarikan kesimpulan dari permasalahan yang dihadapi atau untuk merencanakan masa depan yang baik. Peradaban yang dibangun manusia, disebabkan dia mampu melakukan penalaran. Penalaran menggunakan kecakapan penggunaan bahasa, matematika dan statistika sebagai pembantu mengambil kesimpulan.

  11. Agir dans l'espace

    OpenAIRE

    Albert, Frédéric; Allain, Sonia; Amalberti, René; Anderson, David I.; Aurnague, Michel; Baccino, Thierry; Baratgin, Jean; Barbu-Roth, Marianne; Beaudouin-Lafon, Michel; Beauvillain, Cécile; Berthoz, Alain; Beugnon, Guy; Bui, Marc; Bullier, Jean; Bullot, Nicolas J.

    2017-01-01

    Le traitement cognitif de l'espace par un être vivant se décompose en différentes phases : il perçoit l'espace – ce qui implique certains mécanismes de catégorisation et d'abstraction –, se le représente, conserve en mémoire cette représentation qu'il peut rappeler et utiliser pour conduire des actions adaptées et interagir de façon optimale avec l'environnement. Ce traitement ainsi défini a déjà fait l'objet d'un grand nombre de travaux dans le domaine des sciences de la vie et de la psychol...

  12. PENGATURAN SISTEM PENGAMAN RUMAH DAN PENGATURAN BEBAN LAMPU BERBASIS MIKROKONTROLER

    Directory of Open Access Journals (Sweden)

    Joko Firmansyah

    2015-09-01

    Penelitian ini menghasilkan suatu instrumen pengaman rumah dan pengaturan beban lampu yang memiliki menu open dan menu Set RTC sebagai menu pengatur sistem. Menu Open digunakan untuk mengatur akses pintu maupun lampu seperti saklar on/ off, sedangkan Menu Set RTC dapat digunakan untuk mengatur akses pintu maupun lampu sesuai keinginan pengguna dengan cara menseting nilai start dan nilai stop. Akses yang dapat diatur adalah akses pintu dan lampu dengan mode 24 jam. Pengaturan pada sistem ini belum dilengkapi dengan setting berdasarkan tanggal dan hari. Memori flash yang dibutuhkan untuk membentuk instrumen ini adalah 99,1% dari 16KByte dan memori eeprom sebesar 8,6% dari 512Byte

  13. DIALEKTIKA RADIKALISME DAN ANTI RADIKALISME DI PESANTREN

    Directory of Open Access Journals (Sweden)

    Thohir Yuli Kusmanto

    2015-06-01

    Upaya menentang segala bentuk radikalisme merupakan bagian dari reaksi anti radikalisme. Semangat anti radikalisme muncul sebagai bagian dari resistensi masyarakat. Radikalisme dan anti radikalisme saling berkaitan secara dialektis. Meski­pun keduanya merupakan sesuatu yang paradoks, namun selalu menyatu. Dialektika radikalisme dan anti radikalisme menarik ketika dilihat dalam kehidupan pesantren. Fenomena radikalisme Islam seringkali dihubungkan dengan masya­ra­kat pesantren di Indonesia. Beberapa kelompok masyarakat memahami radikal­isme tumbuh dari pesantren. Pandangan tersebut didasari oleh banyaknya pelaku radikalisme Islam dalam bentuk kekerasan alumni pesantren. Realitas tersebut bisa jadi benar dalam kasus tertentu, tetapi tidak bisa digeneralisasi. Penelitian ini ber­upaya menggali data pandangan pesantren tentang wacana dan praksis radikalisme dan anti radikalisme serta pola resistensinya. Hasil penelitian menunjukkan bahwa masyarakat pesantren menolak, menentang dan aktif membangun spirit anti radikalisme yang diwujud­kan dalam beberapa pola. Temuan penelitian tersebut merupakan sintesis dari tesis yang selama ini menjadi wacana masyarakat tentang radikalisme dan pesantren.

  14. INTERVENSI KOGNITIF DAN PENDEKATAN RANTAI NILAI DALAM PENINGKATAN PEMANFAATAN TEKNOLOGI INFORMASI DAN KOMUNIKASI DI USAHA KECIL DAN MENENGAH DI BANDUNG

    Directory of Open Access Journals (Sweden)

    Ari Widyanti

    2016-06-01

    Full Text Available Pemanfaatan teknologi informasi dan komunikasi (TIK di usaha kecil dan menengah (UKM di Indonesia masih pada tingkat yang belum sesuai harapan. Mempertimbangkan bahwa UKM di Indonesia banyak menyerap tenaga kerja dan menyumbang pendapatan nasional yang cukup besar, serta melihat bahwa pemanfaatan TIK di banyak industri besar telah membawa peningkatan performansi yang cukup signifikan,  peningkatan pemanfaatan TIK di UKM merupakan hal yang penting untuk dilakukan. Penelitian ini dilakukan dengan tujuan untuk memetakan tingkat pemanfaatan TIK di UKM dan mengaplikasikan intervensi kognitif dan pendekatan rantai nilai dalam meningkatkan pemanfaatan TIK di UKM. Pemetaan pemanfaatan TIK dilakukan melalui survey dengan menggunakan kuesioner terstruktur dan wawancara yang melibatkan 61 UKM di berbagai bidang di Bandung. Hasil pemetaan pemanfaatan TIK di UKM menunjukkan bahwa pemanfaatan TIK di UKM sebatas pada tujuan pemasaran produk dan sebatas pada penggunaan website. Kendala utama pemanfaatan TIK di UKM adalah faktor SDM terutama berkaitan dengan keterbatasan pengetahuan dan informasi. Berdasarkan hasil pemetaan, selanjutnya, intervensi dilakukan melalui edukasi/kampanye dengan materi mengenai rantai nilai pada 30 UKM yang bergerak di bidang fashion. Hasil intervensi menunjukkan bahwa level pengetahuan dan intensi/kemauan untuk menerapkan TIK di UKM selain untuk kepentingan pemasaran (misalnya untuk perancangan produk dan hubungan dengan pemasok semakin meningkat. Implikasi dari hasil penelitian ini dibahas lebih lanjut.       Abstract The use of information and communication technology (ICT in small and medium enterprise (SME in Indonesia is at low level. Considering that SME in Indonesia employ a lot of people and contribute to Gross Domestic Product (GDP as well as improve performance of industries,  coupled with low level of ICT use in Indonesian SME, ICT’ used in SME must be increased. Therefore, this study aims to map the use of ICT in

  15. Atomic physics through astrophysics

    International Nuclear Information System (INIS)

    Dalgarno, A.

    1987-01-01

    Astronomical environments encompass an extreme range of physical conditions of temperature, density, pressure and radiation fields and unusual situations abound. In this lecture, the author describes some of the objects found in the Universe and discussed the atomic processes that occur. 45 references, 8 figures

  16. Rutherford-Bohr atom

    Science.gov (United States)

    Heilbron, J. L.

    1981-03-01

    Bohr used to introduce his attempts to explain clearly the principles of the quantum theory of the atom with an historical sketch, beginning invariably with the nuclear model proposed by Rutherford. That was sound pedagogy but bad history. The Rutherford-Bohr atom stands in the middle of a line of work initiated by J.J. Thomson and concluded by the invention of quantum mechanics. Thompson's program derived its inspiration from the peculiar emphasis on models characteristic of British physics of the 19th century. Rutherford's atom was a late product of the goals and conceptions of Victorian science. Bohr's modifications, although ultimately fatal to Thomson's program, initially gave further impetus to it. In the early 1920s the most promising approach to an adequate theory of the atom appeared to be the literal and detailed elaboration of the classical mechanics of multiply periodic orbits. The approach succeeded, demonstrating in an unexpected way the force of an argument often advanced by Thomson: because a mechanical model is richer in implications than the considerations for which it was advanced, it can suggest new directions of research that may lead to important discoveries.

  17. Deep diode atomic battery

    International Nuclear Information System (INIS)

    Anthony, T.R.; Cline, H.E.

    1977-01-01

    A deep diode atomic battery is made from a bulk semiconductor crystal containing three-dimensional arrays of columnar and lamellar P-N junctions. The battery is powered by gamma rays and x-ray emission from a radioactive source embedded in the interior of the semiconductor crystal

  18. Atoms in Astronomy.

    Science.gov (United States)

    Blanchard, Paul A.

    This booklet is part of an American Astronomical Society curriculum project designed to provide teaching materials to teachers of secondary school chemistry, physics, and earth science. A Basic Topics section discusses atomic structure, emphasizing states of matter at high temperature and spectroscopic analysis of light from the stars. A section…

  19. Atomic energy and you

    International Nuclear Information System (INIS)

    1975-01-01

    The film discusses the peaceful applications of atomic energy in agriculture, engineering, industry and medicine. Shows exploration, prospecting and mining of uraninum ores at Larap, Camarines Norte and the study of geographical conditions of the site for the proposed Nuclear Power Plant in Bataan

  20. Discovery and the atom

    International Nuclear Information System (INIS)

    1989-01-01

    ''Discovery and the Atom'' tells the story of the founding of nuclear physics. This programme looks at nuclear physics up to the discovery of the neutron in 1932. Animation explains the science of the classic experiments, such as the scattering of alpha particles by Rutherford and the discovery of the nucleus. Archive film shows the people: Lord Rutherford, James Chadwick, Marie Curie. (author)

  1. Atomically resolved tissue integration.

    Science.gov (United States)

    Karlsson, Johan; Sundell, Gustav; Thuvander, Mattias; Andersson, Martin

    2014-08-13

    In the field of biomedical technology, a critical aspect is the ability to control and understand the integration of an implantable device in living tissue. Despite the technical advances in the development of biomaterials, the elaborate interplay encompassing materials science and biology on the atomic level is not very well understood. Within implantology, anchoring a biomaterial device into bone tissue is termed osseointegration. In the most accepted theory, osseointegration is defined as an interfacial bonding between implant and bone; however, there is lack of experimental evidence to confirm this. Here we show that atom probe tomography can be used to study the implant-tissue interaction, allowing for three-dimensional atomic mapping of the interface region. Interestingly, our analyses demonstrated that direct contact between Ca atoms and the implanted titanium oxide surface is formed without the presence of a protein interlayer, which means that a pure inorganic interface is created, hence giving experimental support to the current theory of osseointegration. We foresee that this result will be of importance in the development of future biomaterials as well as in the design of in vitro evaluation techniques.

  2. Atomic transport properties

    International Nuclear Information System (INIS)

    Freyss, M.

    2015-01-01

    As presented in the first chapter of this book, atomic transport properties govern a large panel of nuclear fuel properties, from its microstructure after fabrication to its behaviour under irradiation: grain growth, oxidation, fission product release, gas bubble nucleation. The modelling of the atomic transport properties is therefore the key to understanding and predicting the material behaviour under irradiation or in storage conditions. In particular, it is noteworthy that many modelling techniques within the so-called multi-scale modelling scheme of materials make use of atomic transport data as input parameters: activation energies of diffusion, diffusion coefficients, diffusion mechanisms, all of which are then required to be known accurately. Modelling approaches that are readily used or which could be used to determine atomic transport properties of nuclear materials are reviewed here. They comprise, on the one hand, static atomistic calculations, in which the migration mechanism is fixed and the corresponding migration energy barrier is calculated, and, on the other hand, molecular dynamics calculations and kinetic Monte-Carlo simulations, for which the time evolution of the system is explicitly calculated. (author)

  3. Experimental atomic physics

    International Nuclear Information System (INIS)

    Sellin, I.A.; Elston, S.B.; Forester, J.P.; Liao, K.H.; Pegg, D.J.; Peterson, R.S.; Thoe, R.S.; Hayden, H.C.; Griffin, P.M.

    1976-01-01

    The atomic structure and collision phenomena of highly stripped ions in the range Z = 6 to 35 were studied. Charge-transfer and multiple-electron-loss cross sections were determined. Absolute x-ray-production cross sections for incident heavy ions were measured. 10 figures, 1 table

  4. Transition probabilities for atoms

    International Nuclear Information System (INIS)

    Kim, Y.K.

    1980-01-01

    Current status of advanced theoretical methods for transition probabilities for atoms and ions is discussed. An experiment on the f values of the resonance transitions of the Kr and Xe isoelectronic sequences is suggested as a test for the theoretical methods

  5. Ludwig Boltzmann: Atomic genius

    Energy Technology Data Exchange (ETDEWEB)

    Cercignani, C. [Department of Mathematics, Politecnico di Milano (Italy)]. E-mail: carcer@mate.polimi.it

    2006-09-15

    On the centenary of the death of Ludwig Boltzmann, Carlo Cercignani examines the immense contributions of the man who pioneered our understanding of the atomic nature of matter. The man who first gave a convincing explanation of the irreversibility of the macroscopic world and the symmetry of the laws of physics was the Austrian physicist Ludwig Boltzmann, who tragically committed suicide 100 years ago this month. One of the key figures in the development of the atomic theory of matter, Boltzmann's fame will be forever linked to two fundamental contributions to science. The first was his interpretation of 'entropy' as a mathematically well-defined measure of the disorder of atoms. The second was his derivation of what is now known as the Boltzmann equation, which describes the statistical properties of a gas as made up of molecules. The equation, which described for the first time how a probability can evolve with time, allowed Boltzmann to explain why macroscopic phenomena are irreversible. The key point is that while microscopic objects like atoms can behave reversibly, we never see broken coffee cups reforming because it would involve a long series of highly improbable interactions - and not because it is forbidden by the laws of physics. (U.K.)

  6. Observational Evidence for Atoms.

    Science.gov (United States)

    Jones, Edwin R., Jr.; Childers, Richard L.

    1984-01-01

    Discusses the development of the concept of atomicity and some of the many which can be used to establish its validity. Chemical evidence, evidence from crystals, Faraday's law of electrolysis, and Avogadro's number are among the areas which show how the concept originally developed from a purely philosophical idea. (JN)

  7. Coherent atomic spectroscopy

    International Nuclear Information System (INIS)

    Garton, W.R.S.

    1988-01-01

    The Argonne Spectroscopy Laboratory, initiated and advanced over several decades by F.S. Tomkins and M. Fred, has been a major international facility. A range of collaborative work in atomic spectroscopy is selected to illustrate advances in experimental physics which have been made possible by combination of the talents of Tomkins and Fred with the unique facilities of the Argonne Laboratory. (orig.)

  8. Spectra of alkali atoms

    International Nuclear Information System (INIS)

    Santoso, Budi; Arumbinang, Haryono.

    1981-01-01

    Emission spectra of alkali atoms has been determined by using spectrometer at the ultraviolet to infra red waves range. The spectra emission can be obtained by absorption spectrophotometric analysis. Comparative evaluations between experimental data and data handbook obtained by spark method were also presented. (author tr.)

  9. Atomic Particle Detection

    Energy Technology Data Exchange (ETDEWEB)

    Hellman, Hal

    1970-01-01

    This booklet tells how scientists observe the particles and electromagnetic radiation that emerges from an atomic nucleus. The equipment used falls into two general categories: counters which count each particle as it passes by, and track detectors, which make a photographic record of the particle's track.

  10. Atomic Physics 16: Sixteenth International Conference on Atomic Physics. Proceedings

    International Nuclear Information System (INIS)

    Baylis, W.E.; Drake, G.W.

    1999-01-01

    These proceedings represent papers presented at the 16th International Conference on Atomic Physics held in Windsor, Ontario, Canada, in August, 1998. The topics discussed included a wide array of subjects in atomic physics such as atom holography, alignment in atomic collisions, coulomb-interacting particles, muon experiments, x-rays from comets, atomic electron collisions in intense laser fields, spectroscopy of trapped ions, and Bose-Einstein condensates. This conference represents the single most important meeting world wide on fundamental advances in atomic physics. There were 30 papers presented at the conference,out of which 4 have been abstracted for the Energy, Science and Technology database

  11. Pengaruh Marketing Mix Dan Brand Image Terhadap Customer Satisfaction Dan Customer Loyalty Di Restoran X Surabaya

    OpenAIRE

    Wijaya, Kevin; Sutejo, Andrew Robby Darmawan

    2017-01-01

    Tujuan dilakukannya penelitian ini adalah untuk mengetahui pengaruh Marketing Mix dan Brand Image yang dijalankan oleh restoran X Surabaya terhadap kepuasan konsumen dan loyalitas konsumen. Penelitian ini menggunakan penelitian quantitatif, sampel yang diperoleh dari pengisian kuesioner oleh 100 konsumen yang pernah makan di restoran X. Dengan menggunakan metode analisa Partial Least Square, hasil penelitian menunjukkan bahwa marketing mix mempunyai pengaruh positif significant terhadap kepua...

  12. KONTRIBUSI HUMAN CAPITAL dan CUSTOMER CAPITAL DALAM MENGGAPAI KINERJA CAFÉ dan RESTO di SURABAYA

    Directory of Open Access Journals (Sweden)

    Gendut Sukarno

    2016-11-01

    Berdasarkan hasil pengolahan data diketemukan bahwa 1 human capital mampu memberikan kontribusi yang berarti terhadap customer capital. 2 Customer capital mampu memberikan kontribusi yang berarti terhadap kinerja café dan resto di Surabaya, 3 human capital mampu memberikan kontribusi yang berarti terhadap kinerja café dan resto di Surabaya.

  13. POTENSI TAMAN NASIONAL BOGANI NANI WARTABONE, PERMASALAHAN DAN KONSERVASI PADA TINGKAT PENGEMBANGAN DAN PENGAWASAN

    Directory of Open Access Journals (Sweden)

    Femmy Roosje Kawuwung

    2010-03-01

    Full Text Available Taman Nasional Bogani Nani Wartabone sebelumnya bernama Dumoga Bone. Nani Wartabone seorang pahlawan yang terkenal di daerah Gorontalo, untuk mengenang pahlawan tersebut maka namanya diabadikan pada nama Taman Nasional. Pada tahun 1982 luas 300.000 hektar dinyatakan Menteri Pertanian. Ditunjuk Menteri Kehutanan, SK No. 731/Kpts-II/1992 luas 287.115 hektar. Propinsi Gorontalo dengan ketinggian tempat 50 – 2.000 meter dpl. Posisi 1o– 4o LS, 120o – 124o BT. Permasalahan; terjadinya fragmentasi, perladangan berpindah, pertanian, illegal logging, pemukiman, pertambangan, dan pencurian spesies flora dan fauna. Tujuan mengetahui potensi Taman Nasional Bogani Nani Wartabone, permasalahan dan upaya konservasi.Potensi Taman Nasional Bogani Nani Wartabone adalah; Flora terdiri dari 400 jenis pohon, 241 jenis tumbuhan tinggi, 120 jenis efifit dan terdapat 24 jenis anggrek. Tumbuhan endemik yaitu; palem matayangan, kayu hitam dan bunga bangkai(Amophaphallus compamulatus. Tumbuhan yang umum adalah cempaka, kenanga, agates, dan tanaman hias.Taman Nasional Bogani Nani Wartabone memiliki 24 jenis mamalia, 64 jenis aves, 11 jenis reptile. Mamalia (satwa endemik : monyet hitam/yaki (Macaca nigra, Monyet Dumoga Bone, babirusa, kelelawar bone, kus-kus besar (Palanger ursinus, anoa kecil (B.quarlesi. Di Taman Nasional Bogani Nani Wartabone tercatat 200 – 225 jenis burung. Reptil : ular kobra, king kobra (N. hammah, ular belang, katak pohon (Rhacophorus monticola, ikan : ikan mas (Cyprinus carpio, bekicot (Achatina fulica. Upaya konservasi adalah pada tingkat pengembangan dan pengawasan. Dalam upaya konservasi harus ada kerja sama dari pemerintah dan masyarakat sekitar kawasan.

  14. Perancangan dan Implementasi Autonomous Landing Menggunakan Behavior-Based dan Fuzzy Controller pada Quadcopter

    Directory of Open Access Journals (Sweden)

    Fadjri Andika Permadi

    2012-09-01

    Full Text Available Perkembangan teknologi sistem kendali pesawat sayap berputar (copter semakin pesat salah satunya pada pesawat berbaling-baling empat (quadcopter. Landing merupakan bagian tersulit dalam penerbangan quadcopter. Ukuran quadcopter yang kecil mengakibatkan susahnya pengendalian kestabilan dan kecepatan turun.Cara mengatasi permasalahan ini adalah dengan autonomous landing yang menggunakan algoritma kendali behavior-based (berbasis perilaku. Tugas akhir ini merancang dan mengimplementasikan algoritma kendali behavior-based (berbasis perilaku pada proses autonomous landing quadcopter dan kontroler PD (Proporsional, Diferensial pada untuk  kestabilan sudut roll dan pitch, sedangkan untuk jarak landing menggunakan kontroler logika fuzzy. Pada Tugas Akhir ini, didapatkan nilai parameter kontroler PD roll dan kontroler PD pitch dari hasil tuning terstruktur pada simulasi Kp=500 dan Kd=30. Sedangkan kendali landing menggunakan kontroler logika fuzzy dengan parameter Ke=4 Kde=175 dan Ku=1 pada simulasi dapat melakukan proses landing selama 8 detik dari ketinggian 3 meter. Respon hasil implementasi pada quadcopter belum sesuai dengan hasil simulasi. Proses landing pada implementasi lebih cepat dengan waktu 3.5 detik dari ketinggian 2 meter, selain itu koreksi sudut roll dan sudut pitch masih terhadapat error +/-3º.

  15. Otomatisasi Pelayanan Binatu Berbasis Raspberry Pi Untuk Meningkatkan Efektivitas Dan Efisiensi Kegiatan Operasional Dan Pelayanan Binatu

    Directory of Open Access Journals (Sweden)

    Al Habsyi Yesa

    2017-01-01

    Full Text Available Bisnis binatu (laundry atau bisnis jasa cuci pakaian merupakan bisnis yang menggiurkan saat sekarang ini. Proses layanan binatu umumnya terdiri dari pendaftaran, pengolahan, dan pengambilan pakaian. Proses ini memiliki banyak kekurangan yaitu pendaftaran manual tidak efektif dan efisien, pengolahan pakaian hanya diketahui oleh penyedia layanan binatu, dan pelanggan tidak mengetahui pakaian telah selesai. Ditengah persaingan bisnis yang begitu ketat, pelayanan konsumen merupakan suatu hal yang sangat penting. Penyedia jasa dituntut untuk berinovasi untuk menyediakan layanan jasa yang efektif dan efisien. Oleh karena itu pada penelitian ini merancang dan merealisasikan otomatisasi pelayanan binatu berbasis raspberry pi. Sistem ini menggunakan timbangan digital berbasis load cell, teknologi radio frequency identification (RFID sebagai masukan data otomatis, Raspberry Pi sebagai pusat dari pengolahan basis data (database, dan webserver sebagai pusat informasi bagi pelanggan. Hasil penelitian menghasilkan beberapa kesimpulan. Timbangan digital memiliki eror rata-rata 0,88 %, metode RFID dapat memasukan data pelanggan secara otomatis dengan metode pengambilan nomor identitas jenis hex 8 digit, Raspberry Pi dapat mengakomodasi aplikasi yang efektif dan efisien untuk menyimpan data pelanggan secara otomatis dengan pemakaian CPU rata-rata 5%, dan webserver yang digunakan dapat menyediakan informasi layanan binatu bagi pelanggan.

  16. Atomic bomb injury: radiation

    Energy Technology Data Exchange (ETDEWEB)

    Dunham, C L; Cronkite, E P; Le Roy, G V; Warren, S

    1959-01-01

    This document contains 3 reports. In the first report, the clinical diagnosis and treatment of radiation syndrome in survivors of the atomic explosions in Hiroshima and Nagasaki are described. The syndrome of acute radiation injury is applied to the symptom complex, or diseased state, which results from exposure of the whole body to the initial nuclear radiation of an atomic bomb. It is applied to injuries of the skin and subcutaneous tissues resulting from x-radiation or from contact with radioactive material. Internal radiation injury may result from the selective deposition, such as in bone or thyroid, of radioactive material that has been inhaled or absorbed through the gastrointestinal tract or wounds. Radiation syndrome is classified as very severe, severe, and mild. In the second report, a brief discussion is presented on the question of genetic effects in atomic bomb survivors in Hiroshima and Nagasaki. In the third report, a study was carried out on 205 4-1/2 year old children who had been exposed to the atomic bomb blast during the first half of intra-uterine life. Correlation between head size and mental development of the child with distance from the hypocenter, symptoms of radiation effect and type of shielding of the mother is discussed. The conclusion drawn from the present study is that central nervous system defects can be produced in the fetus by atomic bomb radiation, provided that exposure occurs within approximately 1200 meters of the hypocenter and that no effective shielding, such as concrete, protects the fetus from direct irradiation.

  17. HARMONISASI, INTEGRASI DESA PAKRAMAN DENGAN DESA DINAS YANG MULTI ETNIK DAN MULTIAGAMA MENGHADAPI PERGESERAN, PELESTARIAN, DAN KONFLIK DI BALI

    Directory of Open Access Journals (Sweden)

    Dewa Bagus Sanjaya

    2014-02-01

    Full Text Available Penelitian etnografi ini bertujuan untuk menganalisis hubungan desa dinas dan desa pakraman, dan integrasi masyarakat di Provinsi Bali. Penelitian ini melibatkan prajuru desa pakraman, masyarakat Hindu, dan masyarakat non-Hindu. Penentuan subjek penelitian dengan menggunakan teknik puposive. Data dikumpulkan dengan wawancara, observasi dan pencatatan dokumen. Data dianalisis secara kualitatif. Hasil penelitian menunjukkan bahwa desa pakraman dan desa dinas berada dalam kondisi harmonis, sehingga memunculkan ungkapan “satu badan dua kepala”, sekaligus sebagai wujud integrasi masyarakat. Desa pakraman melaksanakan tugas di bidang agama, adat, dan budaya,sedangkan desa dinas di bidang administrasi.

  18. Trapped atoms along nanophotonic resonators

    Science.gov (United States)

    Fields, Brian; Kim, May; Chang, Tzu-Han; Hung, Chen-Lung

    2017-04-01

    Many-body systems subject to long-range interactions have remained a very challenging topic experimentally. Ultracold atoms trapped in extreme proximity to the surface of nanophotonic structures provides a dynamic system combining the strong atom-atom interactions mediated by guided mode photons with the exquisite control implemented with trapped atom systems. The hybrid system promises pair-wise tunability of long-range interactions between atomic pseudo spins, allowing studies of quantum magnetism extending far beyond nearest neighbor interactions. In this talk, we will discuss our current status developing high quality nanophotonic ring resonators, engineered on CMOS compatible optical chips with integrated nanostructures that, in combination with a side illuminating beam, can realize stable atom traps approximately 100nm above the surface. We will report on our progress towards loading arrays of cold atoms near the surface of these structures and studying atom-atom interaction mediated by photons with high cooperativity.

  19. TANTANGAN INTERKONEKSI SAINS DAN AGAMA DI IAIN SUNAN AMPEL

    Directory of Open Access Journals (Sweden)

    Muhammad Fahmi

    2013-11-01

    Full Text Available Tulisan ini berusaha mengeksplorasi konsep interkoneksi keilmuan agama dan umum melalui integrated twin towers di IAIN Sunan Ampel beserta tantangan yag melingkupinya. Pengembangan epistemologi integrated twin towers yang berupaya menginterkoneksikan keilmuan agama dan umum dengan grand design yang sedang digodok oleh para petinggi IAIN Sunan Ampel baru sebatas asumsi, dan tetap rentan mengandung resiko dan penuh tantangan. Asumsinya adalah keilmuan agama dan umum yang integratif-interkonektif, dan resikonya adalah keilmuan agama dan umum yang semakin dikotomis dengan simbol menara kembar. Sementara itu tantangannya adalah ego SDM ilmu agama dan umum. Meskipun penuh resiko dan tantangan, namun upaya integrasi-interkoneksi keilmuan agama dan umum melalui epistemologi integrated twin towers perlu terus dilakukan. Asumsi keilmuan yang integratif-interkonektif melalui epistemologi integrated twin towers harus dikawal dengan perangkat sistem yang mendukung realisasinya. Apabila tidak melalui pengawalan sistem, yang terjadi bisa sebaliknya, bukan keilmuan yang integratif tetapi keilmuan yang semakin dikotomis antara agama dan umum, karena ada pelambangan berupa simbol menara kembar keilmuan, dimana keilmuan agama ada pada menara tersendiri dan keilmuan umum ada pada menara tersendiri. Bentuk pengawalan sistem yang ada bisa berupa seleksi penerimaan tenaga dosen atau karyawan yang mana dalam perekrutan harus dipastikan calon tenaga dosen atau karyawan adalah orang-orang yang mempunyai pemahaman keagamaan dan umum serta bidang yang akan digelutinya secara cukup. Jadi materi soal yang dijadikan acuan tes harus juga bersifat integratif.

  20. Hantaran Sinyal Leptin dan Obesitas: Hubungannya dengan Penyakit Kardiovaskuler

    Directory of Open Access Journals (Sweden)

    David Limanan

    2013-11-01

    Full Text Available Diperkirakan saat ini jumlah orang dengan obesitas melebihi 250 juta orang, yaitu 7% dari populasi orang dewasa di dunia. Mortalitas obesitas erat hubungannya dengan sindrom metabolik yang merupakan kelainan metabolik meliputi obesitas, resistensi insulin, gangguan toleransi glukosa, abnormalitas trigliserida dan hemostasis, disfungsi endotel dan hipertensi. Leptin dihasilkan adiposit dan merupakan anggota dari adipositokin; berperan dalam hantaran sinyal hormon jaringan adiposa. Kelainan leptin maupun reseptornyadapat menyebabkan seseorang mengalami obesitas, metabolik sindrom, diabetes dan penyakit kardiovaskuler. Kompleks leptin-reseptor mengaktifkan sistem transduksi sinyal, yang paling dominan adalah jalur janus kinase-signal transducer and activator of transcription-3 (JAK-STAT3, kemudian phospatidyl inositol 3- kinase (PI3K, mitogen-activated protein kinase (MAPK, 5’adenosine monophosphate-activated protein kinase (AMPK, dan mammalian target of rapamycin (mTOR. Jalur leptin-associated PI3K dengan ERK cascade berperan penting dalam proliferasi kardiomiosit dan melindungi jantung dari ischemia reperfusion injury. ERK1/2 mengaktifkan target gen seperti c-fos dan egr-1 yang berperan dalam proliferasi dan diferensiasi. Nuclear factor κB diduga sebagai target jalur p38 dan JNK MAPK. Faktor transkripsi inu berperan pentingdalam mengatur transkripsi sitokin proinflamasi seperti tumor necrosis factor (TNF-α dan interleukin (IL-1β. Leptin dapat meningkatkan pembentukan reactive oxygen species (ROS sel endotel pembuluh darah dan menstimulasi sekresi TNF-α dan IL-6 yang merupakan promotor hipertensi dan aterosklerosis.Kata Kunci: obesitas, leptin, sistem kardiovaskuler