WorldWideScience

Sample records for atom ssa dan

  1. Penentuan Kadar Logam Kadmium Cd ) Dan Logam Zinkum ( Zn ) Dalam Black Liquor Pada Industri Pulp Proses Kraft Dari Toba Pulp Lestari Dengan Metode Spektrofotometri Serapan Atom ( Ssa)

    OpenAIRE

    Elisa

    2011-01-01

    The analysis of Cadmium ( Cd ) and Zinkum ( Zn ) in Black liquor of pulp kraft proces Toba Pulp Lestari ( TPL ) Has been carried out. The sample was taken from tank strong Black Liquor in a purposif. Nitrace acid was used in the destruction of the liquor and then analysed with Atomic Absorption Spectrofometry method (SSA) at 228,80 nm wavelength of Cadmium and 213,90 nm wavelength of Zincum. From the researce it was found that the concent of Cadmium ( Cd ) and Zincum ( Zn ) were 3.5 mg/L and ...

  2. La représentation SSA: sémantique, analyses et implémentation dans GCC

    OpenAIRE

    Pop, Sebastian

    2006-01-01

    The Static Single Assignment (SSA) language is one of the intermediate representations commonly used in industrial compilers. However, there was little interest from the static program analysis community in this intermediate representation due to the weak formal grounds of the SSA. This thesis presents a denotational semantics of the SSA language, allowing formal definitions of static analyses on the SSA language based on the classical abstract interpretation framework. From a practical point...

  3. Analisa Unsur Hara Mg dalam Daun Kelapa Sawit dengan Metode Spektrofotometri Serapan Atom (SSA) untuk meningkatkan Produksi Buah pada Tanaman Kelapa Sawit (Elaeis guineensis Jacq.)

    OpenAIRE

    Fazariyani, Xerra

    2015-01-01

    Telah dilakukan analisa pengujian unsur hara magnesium (Mg) dalam daun pada tanaman kelapa sawit di Pusat Penelitian Kelapa Sawit (PPKS) Medan. Nilai unsur hara Magnesium (Mg) yang diukur dengan menggunakan larutan pengekstrak asam asetat (H2SO4) kemudian diukur dengan menggunakan Spektrofotometer Serapan Atom (SSA). Dari hasil pengukuran diperoleh nilai unsur hara magnesium yang rendah (defesiensi). Kadar hara magnesium (Mg) daun yang diperoleh pada umumnya sekitar 17 – 23 % Mg.

  4. Analisis Kandungan Timbal (Pb) dan Kadmium (Cd), dalam Cacing Tanah Secara Spektrofotometri Serapan Atom (SSA)

    OpenAIRE

    Ulfa, Syarifah Fitria

    2011-01-01

    Earthworm is an invertebrate animal which often consumed as food or medicine. The toxic effect of earthworm is the ability of their body to accumulate heavy metal from soil in quite high concentration. The purpose of this research is to determine the heavy metal accumulation in earthworms that live in trash habitat. Sample is taken from three different trash habitat. They are dry trash, wet trash and leaves trash. Three earthworm species analyzed are Megascolex sp., Drawida sp., and Pontos...

  5. Penetapan Kadar Pb Pada Air Sungai Yang Dialiri Limbah Pertambangan Bijih Emas Di Kabupaten Madina Secara Spektrofotometri Serapan Atom (SSA)

    OpenAIRE

    Sari, Putri Ledang

    2013-01-01

    Liquid waste is waste in liquid form generated by industrial activities and allegedly dumped into the environment can pollute the environment. The purpose of this study was to determine levels of Pb contained in gold ore mining waste water and Batang Gadis river in MADINA quality standard or not. Samples were taken from 4 locations namely inlet and outlet gold ore mining wastes, upstream and downstream Batang Gadis river. Determination of lead (Pb) atomic absorption spectrophotometry perfo...

  6. Penetapan Kadar Cu Pada Air Sungai Yang Dialiri Limbah Pertambangan Bijih Emas Di Kabupaten MADINA Secara Spektrofotometri Serapan Atom (SSA)

    OpenAIRE

    Lubis, Irma Yusnita

    2013-01-01

    Liquid waste is waste in liquid form generated by industrial activities and allegedly dumped into the environment can pollute the environment. The purpose of this study was to determine levels of Cu contained in gold ore mining waste water and Batang Gadis river in MADINA quality standard or not. Samples were taken from 4 locations namely inlet and outlet gold ore mining wastes, upstream and downstream Batang Gadis river. Determination of copper (Cu) atomic absorption spectrophotometry per...

  7. SSA Disability Claim Data

    Data.gov (United States)

    Social Security Administration — The dataset includes fiscal year data for initial claims for SSA disability benefits that were referred to a state agency for a disability determination. Specific...

  8. PERANCANGAN DAN PEMBUATAB ALAT UKUR KADAR KROM DALAM AIR DENGAN MENGGUNAKAN PRINSIP SPEKTROSKOPI SERAPAN ATOM

    Directory of Open Access Journals (Sweden)

    Tin Yunis Mahfudloh, Mohammad Tirono

    2012-04-01

    Full Text Available Air adalah bahan yang berperan penting dalam berbagai aspek kehidupan manusia. Air steril dengan kandungan mineral yang cukup dan tidak terpolusi dapat berperan sebagai cairan yang menata keseimbangan tubuh. Apabila air yang dikosumsi manusia telah tercemar oleh sampah dan limbah industri yang mengandung zat-zat kimia/logam berat yang bersifat racun akan berbahaya Seperti kromium/krom dengan kode kimiawi Cr. Penelitian dilakukan untuk membuat alat ukur kadar krom dalam air dengan metode absorpsi dengan instrumen fotometri. Alat ukur kadar krom dalam air menggunakan prinsip spektroskopi serapan atom terdiri dari 2 sistem, yaitu sistem optik dan sistem elektronik. Sistem optik terdiri dari lampu halogen, filter cahaya dengan panjang gelombang 520.4, kuvet dan sensor photodioda. Sedangkan sistem elektronik terdiri dari ADC 0804, MCU AT89S51 dan LCD.  Prinsip keja alat ini adalah cahaya polikromatis yang dipancarkan oleh lampu halogen akan melewati filter sehingga cahaya polikromatis akan bersifat monokromatis. Cahaya akan melewati air dengan kadar krom 0% untuk mereset reagen dan pelarut kemudian dideteksi oleh sensor sehingga menghasilkan data I0. Setelah dideteksi air  akan bergeser ke atas dan sensor bergeser kebelakang untuk mendeteksi sampel yang mempunyai kadar krom tertentu dan menghasilkan data I1. Di dalam sampel ini terjadi penyerapan intensitas cahaya oleh atom krom. Kemudian data I0 dan I1 akan diolah oleh MCU AT89S51 dan ditampilkan pada LCD. Sampel yang digunakan adalah larutan H2O dengan K2Cr2O7 sebanyak 10 sampel dengan variasi kadar 0%, 1%, 1.5%, 2%, 2.5%, 3%, 3.5%, 4%, 4.5%, dan 5%. Larutan krom diperoleh dengan cara mengencerkan 10gr K2Cr2O7 dalam 100ml H2O sehingga didapatkan K2Cr2O7 10% sebagai larutan stok, selanjutnya untuk mendapatkan K2Cr2O7 dengan kadar tertentu, maka diambil dari larutan stok kemudian diencerkan sampai volume 25 ml sesuai dengan rumus M1 V1 =M 2 V2 Hasil pegujian pada sistem elektronik menunjukkan

  9. Dicty_cDB: SSA230 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA230 (Link to dictyBase) - - - Contig-U04338-1 SSA230E (Link to Original site) SSA...230F 286 SSA230Z 485 SSA230P 771 SSA230E 683 Show SSA230 Library SS (Link to library) Clone ID SSA...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA2-B/SSA230Q.Seq.d/ Representative seq. ID SSA...230E (Link to Original site) Representative DNA sequence >SSA230 (SSA230Q) /CSM/SS/SSA2-B/SSA...degsntehsikeiinhvfqkdkdllylisvaedpitfpssaisavvvsetlkaierkhks ilinranlknlgvqnvkallgxgnhvgeavikaar*ksyslsggweg

  10. Dicty_cDB: SSA690 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA690 (Link to dictyBase) - G20257 DDB0214823 Contig-U16029-1 SSA...690F (Link to Original site) SSA690F 609 - - - - - - Show SSA690 Library SS (Link to library) Clone ID SSA...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA6-D/SSA690Q.Seq.d/ ...Representative seq. ID SSA690F (Link to Original site) Representative DNA sequence >SSA690 (SSA690Q) /CSM/SS/SSA6-D/SSA...nallslkkvlklfstklldl*--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA690 (SSA

  11. Dicty_cDB: SSA130 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA130 (Link to dictyBase) - - - Contig-U14356-1 SSA130P (Link to Original site) SSA...130F 308 SSA130Z 423 SSA130P 731 - - Show SSA130 Library SS (Link to library) Clone ID SSA... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-B/SSA130Q.Seq.d/ Representative seq. ID SSA...130P (Link to Original site) Representative DNA sequence >SSA130 (SSA130Q) /CSM/SS/SSA1-B/SSA1...qxkxqlxhxp--- ---*hdasgltkanppliknfskspfs*li*itpglssailgtwflatpkiplapgsvtn caflsl*mvwcgdnnekvnkslvadasvaknll

  12. Dicty_cDB: SSA384 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA384 (Link to dictyBase) - - - Contig-U12139-1 SSA384P (Link to Original site) SSA...384F 743 SSA384Z 553 SSA384P 1296 - - Show SSA384 Library SS (Link to library) Clone ID SSA...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA3-D/SSA384Q.Seq.d/ Representative seq. ID SSA...384P (Link to Original site) Representative DNA sequence >SSA384 (SSA384Q) /CSM/SS/SSA3-D/SSA...ghqrylcshcrktwqlqfty tasqpgthqkiidmamngvgcratarimgvglntilrhlknsgrsr*praysravtsssa rkwtnsgamsglnraxlavlrv*qsp

  13. SSA State Agency Workload Data

    Data.gov (United States)

    Social Security Administration — The dataset is revised and expanded from 4 to 71 data fields. It includes monthly data from October 2000 onwards for SSA disability cases that were referred to the...

  14. Instabilités transverses et auto-organisation dans un nuage d'atomes froids. Gap labelling dans les quasi-cristaux bidimensionnels

    OpenAIRE

    Camara, Abdoulaye

    2015-01-01

    Dans ce mémoire de thèse, je rapporte les résultats des études réalisées durant ces trois dernières années à l'Institut Non Linéaire de Nice. D'une part, je présente nos expériences de miroir de rétro-action conduisant à la formation spontanée de patterns dans la section transversale d'un faisceau laser (pompe) traversant le centre d'un nuage d'atomes froids de 87Rb et rétro-réfléchi par un miroir placé à une distance du nuage. Dans ces expériences nous discernons trois types de mécanismes de...

  15. Dicty_cDB: SSA568 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA568 (Link to dictyBase) - - - Contig-U04420-1 SSA568E (Link to Original site) SSA...568F 423 SSA568Z 348 SSA568P 771 SSA568E 423 Show SSA568 Library SS (Link to library) Clone ID SSA...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-C/SSA568Q.Seq.d/ Representative seq. ID SSA...568E (Link to Original site) Representative DNA sequence >SSA568 (SSA568Q) /CSM/SS/SSA5-C/SSA...ces producing significant alignments: (bits) Value SSA568 (SSA568Q) /CSM/SS/SSA5-C/SSA568Q.Seq.d/ 529 e-149

  16. Dicty_cDB: SSA445 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA445 (Link to dictyBase) - - - Contig-U13900-1 SSA445E (Link to Original site) SSA...445F 425 SSA445Z 650 SSA445P 1075 SSA445E 982 Show SSA445 Library SS (Link to library) Clone ID SSA...inal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA4-B/SSA445Q.Seq.d/ Representative seq. ID SSA...445E (Link to Original site) Representative DNA sequence >SSA445 (SSA445Q) /CSM/SS/SSA4-B/SSA...uences producing significant alignments: (bits) Value SSA445 (SSA445Q) /CSM/SS/SSA4-B/SSA

  17. Dicty_cDB: SSA625 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA625 (Link to dictyBase) - - - Contig-U04437-1 SSA625F (Link to Original site) SSA...625F 672 - - - - - - Show SSA625 Library SS (Link to library) Clone ID SSA625 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA6-B/SSA625Q.Seq.d/ Representative seq. ID SSA62...5F (Link to Original site) Representative DNA sequence >SSA625 (SSA625Q) /CSM/SS/SSA6-B/SSA625Q.Seq.d/ CAAAC...niymlvmah*vlkqlqn*leylmlirvvklifmnmlhcinllif ymptf*pmtvivvvqltlkkfteh*vhldlifhltlliyfs*kphhvvmv*ssa

  18. Dicty_cDB: SSA871 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA871 (Link to dictyBase) - - - Contig-U15063-1 SSA871P (Link to Original site) SSA...871F 197 SSA871Z 507 SSA871P 704 - - Show SSA871 Library SS (Link to library) Clone ID SSA... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA8-C/SSA871Q.Seq.d/ Representative seq. ID SSA...871P (Link to Original site) Representative DNA sequence >SSA871 (SSA871Q) /CSM/SS/SSA8-C/SSA8...ng significant alignments: (bits) Value SSA871 (SSA871Q) /CSM/SS/SSA8-C/SSA871Q.Seq.d/ 1176 0.0 CHD325 (CHD3

  19. Dicty_cDB: SSA802 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA802 (Link to dictyBase) - - - Contig-U02290-1 SSA802P (Link to Original site) SSA...802F 312 SSA802Z 481 SSA802P 793 - - Show SSA802 Library SS (Link to library) Clone ID SSA... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA8-A/SSA802Q.Seq.d/ Representative seq. ID SSA...802P (Link to Original site) Representative DNA sequence >SSA802 (SSA802Q) /CSM/SS/SSA8-A/SSA8...nificant alignments: (bits) Value SSA802 (SSA802Q) /CSM/SS/SSA8-A/SSA802Q.Seq.d/

  20. Dicty_cDB: SSA472 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA472 (Link to dictyBase) - - - Contig-U01956-1 SSA472F (Link to Original site) SSA...472F 540 - - - - - - Show SSA472 Library SS (Link to library) Clone ID SSA472 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA4-C/SSA472Q.Seq.d/ Representative seq. ID SSA47...2F (Link to Original site) Representative DNA sequence >SSA472 (SSA472Q) /CSM/SS/SSA4-C/SSA472Q.Seq.d/ TAAAA... 854 0.0 SSC507 (SSC507Q) /CSM/SS/SSC5-A/SSC507Q.Seq.d/ 854 0.0 SSA650 (SSA650Q) /CSM/SS/SSA6-C/SSA650Q.Seq.d/ 854 0.0 SSA472 (SSA

  1. Dicty_cDB: SSA511 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA511 (Link to dictyBase) - - - - SSA511Z (Link to Original site) - - SSA...511Z 455 - - - - Show SSA511 Library SS (Link to library) Clone ID SSA511 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-A/SSA...511Q.Seq.d/ Representative seq. ID SSA511Z (Link to Original site) R...epresentative DNA sequence >SSA511 (SSA511Q) /CSM/SS/SSA5-A/SSA511Q.Seq.d/ XXXXXXXXXXTTTTACGATGATGAATATTNTAT

  2. Dicty_cDB: SSA812 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA812 (Link to dictyBase) - - - Contig-U16229-1 SSA812Z (Link... to Original site) - - SSA812Z 313 - - - - Show SSA812 Library SS (Link to library) Clone ID SSA812 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA8-A/SSA812Q.Seq.d/ Representative seq. ID SSA81...2Z (Link to Original site) Representative DNA sequence >SSA812 (SSA812Q) /CSM/SS/SSA8-A/SSA812Q.Seq.d/ XXXXX...KDVNAGTAVTLLSDGNSEFTKKIGLEMDGKAXLLGED RSQRYAMILDSGVVKHLAVEEGGKFDVSSAEAILKQL*t*nqs

  3. Dicty_cDB: SSA563 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA563 (Link to dictyBase) - - - - SSA563E (Link to Original site) - - - - - - SSA...563E 383 Show SSA563 Library SS (Link to library) Clone ID SSA563 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-C/SSA...563Q.Seq.d/ Representative seq. ID SSA563E (Link to Original site) R...epresentative DNA sequence >SSA563 (SSA563Q) /CSM/SS/SSA5-C/SSA563Q.Seq.d/ GATTCAGAAAAAATTAAAAAAGCCAGAGATTTT

  4. Dicty_cDB: SSA604 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA604 (Link to dictyBase) - - - Contig-U12705-1 SSA604F (Link to Original site) SSA...604F 585 - - - - - - Show SSA604 Library SS (Link to library) Clone ID SSA604 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA6-A/SSA604Q.Seq.d/ Representative seq. ID SSA60...4F (Link to Original site) Representative DNA sequence >SSA604 (SSA604Q) /CSM/SS/SSA6-A/SSA604Q.Seq.d/ AGAAT...w*qkrfgrskrchl*rgfcfcktkwfnfc gssaktgenveeaf--- Homology vs CSM-cDNA Score E Sequences producing significant

  5. Dicty_cDB: SSA249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available utative transporter protein SSA662 (ssa662) mRNA, complete cds. 40 9e-04 2 AC1155...SS (Link to library) SSA249 (Link to dictyBase) - - - Contig-U07966-1 - (Link to Original site) SSA...249F 236 - - - - - - Show SSA249 Library SS (Link to library) Clone ID SSA249 (Link to dicty...iol.tsukuba.ac.jp/CSM/SS/SSA2-C/SSA249Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >SSA249 (SSA249Q) /CSM/SS/SSA2-C/SSA249Q.Seq.d/ ACTTATCGTCACAATTC

  6. Dicty_cDB: SSA520 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA520 (Link to dictyBase) - - - Contig-U14093-1 SSA520Z (Link... to Original site) - - SSA520Z 473 - - - - Show SSA520 Library SS (Link to library) Clone ID SSA520 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-A/SSA520Q.Seq.d/ Representative seq. ID SSA52...0Z (Link to Original site) Representative DNA sequence >SSA520 (SSA520Q) /CSM/SS/SSA5-A/SSA520Q.Seq.d/ XXXXX...INDNDKDGDRK ITRDEVLQRFTEQGAEDPELITDSIFRQMDLDRDGVITCDEIKEFNRKKKFSFLKSSAPK Q*krnitnsplfemffcf*ir***n*mysfif*ik

  7. Dicty_cDB: SSA280 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA280 (Link to dictyBase) - - - Contig-U10122-1 SSA280Z (Link... to Original site) - - SSA280Z 582 - - - - Show SSA280 Library SS (Link to library) Clone ID SSA280 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA2-D/SSA280Q.Seq.d/ Representative seq. ID SSA28...0Z (Link to Original site) Representative DNA sequence >SSA280 (SSA280Q) /CSM/SS/SSA2-D/SSA280Q.Seq.d/ XXXXX...Frames) Frame A: ---mfrpiawvpvpiivcghygcggvaasfatpglglflywfsflgislsnlpnlssa*f nwkpfffspl*ikcrrplypfg*pppfafc

  8. Dicty_cDB: SSA134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA134 (Link to dictyBase) - - - Contig-U16443-1 SSA134F (Link to Original site) SSA...134F 590 - - - - - - Show SSA134 Library SS (Link to library) Clone ID SSA134 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-B/SSA134Q.Seq.d/ Representative seq. ID SSA13...4F (Link to Original site) Representative DNA sequence >SSA134 (SSA134Q) /CSM/SS/SSA1-B/SSA134Q.Seq.d/ TTTTA...XXXXXXXXXX sequence update 1998. 7.31 Translated Amino Acid sequence LDDRSVEFDYLVINSGSSYNSPFKESSVVSSARANTLRE

  9. Dicty_cDB: SSA770 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA770 (Link to dictyBase) - - - - SSA770F (Link to Original site) SSA...770F 172 - - - - - - Show SSA770 Library SS (Link to library) Clone ID SSA770 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA7-C/SSA...770Q.Seq.d/ Representative seq. ID SSA770F (Link to Original site) R...epresentative DNA sequence >SSA770 (SSA770Q) /CSM/SS/SSA7-C/SSA770Q.Seq.d/ ATTTATTCTTTATCGAATATCATAATTAAAAGA

  10. Dicty_cDB: SSA826 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA826 (Link to dictyBase) - - - Contig-U00472-1 SSA826Z (Link... to Original site) - - SSA826Z 395 - - - - Show SSA826 Library SS (Link to library) Clone ID SSA826 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA8-B/SSA826Q.Seq.d/ Representative seq. ID SSA82...6Z (Link to Original site) Representative DNA sequence >SSA826 (SSA826Q) /CSM/SS/SSA8-B/SSA826Q.Seq.d/ XXXXX...cmlessltpptinphrnq*ndhhgtvhitn*shspkitstth*tfgdlyr fkskssakcfpigskin*nvkkhwydd*ii

  11. Dicty_cDB: SSA286 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA286 (Link to dictyBase) - - - - SSA286Z (Link to Original site) - - SSA...286Z 495 - - - - Show SSA286 Library SS (Link to library) Clone ID SSA286 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA2-D/SSA...286Q.Seq.d/ Representative seq. ID SSA286Z (Link to Original site) R...epresentative DNA sequence >SSA286 (SSA286Q) /CSM/SS/SSA2-D/SSA286Q.Seq.d/ XXXXXXXXXXTAGCTCACAACTTTCATACTTTT

  12. Dicty_cDB: SSA248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA248 (Link to dictyBase) - - - Contig-U13424-1 - (Link to Original site) - - SSA...248Z 500 - - - - Show SSA248 Library SS (Link to library) Clone ID SSA248 (Link to dicty...iol.tsukuba.ac.jp/CSM/SS/SSA2-B/SSA248Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >SSA248 (SSA248Q) /CSM/SS/SSA2-B/SSA248Q.Seq.d/ XXXXXXXXXXTTTAGAT...nk*kkikxnkl*iy*k*kk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA248 (SSA

  13. Dicty_cDB: SSA675 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA675 (Link to dictyBase) - - - Contig-U03270-1 SSA675E (Link... to Original site) - - - - - - SSA675E 650 Show SSA675 Library SS (Link to library) Clone ID SSA675 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA6-D/SSA675Q.Seq.d/ Representative seq. ID SSA67...5E (Link to Original site) Representative DNA sequence >SSA675 (SSA675Q) /CSM/SS/SSA6-D/SSA675Q.Seq.d/ GTTTT...id sequence FDDDLASKLKQVEINLVNQTVEALLEENKSLKQENEFLKDRIMQFRVEIEKKTSSIRNSK DSTSQFNRLTQSISPSSAIDITQSMTSGLDIPKVT

  14. Dicty_cDB: SSA432 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA432 (Link to dictyBase) - - - Contig-U01120-1 SSA432F (Link to Original site) SS...A432F 290 - - - - - - Show SSA432 Library SS (Link to library) Clone ID SSA432 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA4-B/SSA432Q.Seq.d/ Representative seq. ID SSA43...2F (Link to Original site) Representative DNA sequence >SSA432 (SSA432Q) /CSM/SS/SSA4-B/SSA432Q.Seq.d/ GTAAA...LRGANLHKANLIG VNLKGANFDIRTVSSR*f*kkkni*fni*iqlqyiy--- Translated Amino Acid seque

  15. Dicty_cDB: SSA104 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA104 (Link to dictyBase) - - - Contig-U15035-1 SSA104E (Link to Original site) SSA...104F 622 SSA104Z 490 SSA104P 1112 SSA104E 744 Show SSA104 Library SS (Link to library) Clone ID SSA...inal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-A/SSA104Q.Seq.d/ Representative seq. ID SSA...104E (Link to Original site) Representative DNA sequence >SSA104 (SSA104Q) /CSM/SS/SSA1-A/SSA...TLPK*k*kkkkkkkkk kkkkkkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA104 (SSA

  16. Dicty_cDB: SSA348 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA348 (Link to dictyBase) ssa348 - - Contig-U16217-1 SSA348E ...(Link to Original site) SSA348F 650 SSA348Z 416 SSA348P 1066 SSA348E 1046 Show SSA348 Library SS (Link to library) Clone ID SSA...348 (Link to dictyBase) Atlas ID ssa348 NBRP ID - dictyBase ID - Link to Contig Contig-U1...6217-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA3-B/SSA348Q....Seq.d/ Representative seq. ID SSA348E (Link to Original site) Representative DNA sequence >SSA348 (SSA348Q) /CSM/SS/SSA3-B/SSA

  17. Safety precautions in atomic pile control (1962); Securite dans le controle des piles atomiques (1962)

    Energy Technology Data Exchange (ETDEWEB)

    Furet, J. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1962-07-01

    We have been led to study the problem of safety in atomic pile control as a result of our participation on the one hand in the planning of C.E.A. atomic piles, and on the other hand in the pile safety sub omission considering atomic pile safety of operational or planned C.E.A. piles. We have thus had to consider the wishes occurring in piles during their operation and also their behaviour in the dynamic state The present work deals mainly with the importance of intrinsic safety devices, with the influence of reactivity variations on the power fluctuations during accidental operation, and with the development of robust and reliable safety appliances. The starting p accident has been especially studied both for low-flux piles where a compromise is necessary between the response time of the safety appliances and the statistical fluctuations and for high lux piles where xenon poisoning has an effect on the lower limit of the velocity of reactivity liberation. The desirability has been stressed of automation as a safety factor in atomic pile control. The details required for an understanding of the diagrams of the apparatus are given. (author) [French] Nous avons aborde le probleme de la securite dans le controle des piles atomiques a la suite de notre participation d'une part aux avant rojets de piles atomiques du CE.A. et d'autre part a l'examen au sein de la sous ommission de surete des piles, de la securite des piles du CE.A. en fonctionnement ou en projet. Nous avons ete amenes a nous interesser alors aux risques encourus par les piles pendant leur fonctionnement et par la meme a leur comportement en regime dynamique. Ce travail traite principalement de l'importance des securites intrinseques, de l'influence des variations de reactivite sur les evolutions de puissance en regime d'accident et du developpement d'appareillages de securite robustes et de fonctionnement tres sur. L'accident de demarrage a ete particulierement

  18. Dicty_cDB: SSA365 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA365 (Link to dictyBase) - G20758 DDB0185325 Contig-U04375-1 SSA...365E (Link to Original site) - - - - - - SSA365E 349 Show SSA365 Library SS (Link to library) Clone ID SSA...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA3-C/SSA365Q.Seq.d/ ...Representative seq. ID SSA365E (Link to Original site) Representative DNA sequence >SSA365 (SSA365Q) /CSM/SS/SSA3-C/SSA...core E Sequences producing significant alignments: (bits) Value SSA365 (SSA365Q) /CSM/SS/SSA3-C/SSA365Q.Seq.

  19. Dicty_cDB: SSA421 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA421 (Link to dictyBase) - - - Contig-U04342-1 SSA421E (Link... to Original site) - - - - - - SSA421E 481 Show SSA421 Library SS (Link to library) Clone ID SSA421 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA4-A/SSA421Q.Seq.d/ Representative seq. ID SSA42...1E (Link to Original site) Representative DNA sequence >SSA421 (SSA421Q) /CSM/SS/SSA4-A/SSA421Q.Seq.d/ AACAT...quences producing significant alignments: (bits) Value SSA421 (SSA421Q) /CSM/SS/SSA4-A/SSA421Q.Seq.d/ 761 0.

  20. Dicty_cDB: SSA496 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA496 (Link to dictyBase) - G20766 DDB0205487 Contig-U04407-1 SSA...496F (Link to Original site) SSA496F 583 - - - - - - Show SSA496 Library SS (Link to library) Clone ID SSA...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA4-D/SSA496Q.Seq.d/ ...Representative seq. ID SSA496F (Link to Original site) Representative DNA sequence >SSA496 (SSA496Q) /CSM/SS/SSA4-D/SSA...s producing significant alignments: (bits) Value SSA496 (SSA496Q) /CSM/SS/SSA4-D/SSA496Q.Seq.d/ 1110 0.0 VSE

  1. Dicty_cDB: SSA191 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA191 (Link to dictyBase) - G00581 DDB0191101 Contig-U16278-1 SSA...191E (Link to Original site) - - - - - - SSA191E 743 Show SSA191 Library SS (Link to library) Clone ID SSA...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-D/SSA191Q.Seq.d/ ...Representative seq. ID SSA191E (Link to Original site) Representative DNA sequence >SSA191 (SSA191Q) /CSM/SS/SSA1-D/SSA...lue SSC884 (SSC884Q) /CSM/SS/SSC8-D/SSC884Q.Seq.d/ 1273 0.0 SSA191 (SSA191Q) /CSM/SS/SSA1-D/SSA191Q.Seq.d/ 1

  2. Dicty_cDB: SSA438 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA438 (Link to dictyBase) - - - Contig-U15032-1 SSA438Z (Link... to Original site) - - SSA438Z 635 - - - - Show SSA438 Library SS (Link to library) Clone ID SSA438 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA4-B/SSA438Q.Seq.d/ Representative seq. ID SSA43...8Z (Link to Original site) Representative DNA sequence >SSA438 (SSA438Q) /CSM/SS/SSA4-B/SSA438Q.Seq.d/ XXXXX...gnificant alignments: (bits) Value SSF826 (SSF826Q) /CSM/SS/SSF8-B/SSF826Q.Seq.d/ 1195 0.0 SSA438 (SSA438Q) /CSM/SS/SSA4-B/SSA

  3. Dicty_cDB: SSA649 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA649 (Link to dictyBase) - - - Contig-U14313-1 SSA649Z (Link... to Original site) - - SSA649Z 355 - - - - Show SSA649 Library SS (Link to library) Clone ID SSA649 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA6-C/SSA649Q.Seq.d/ Representative seq. ID SSA64...9Z (Link to Original site) Representative DNA sequence >SSA649 (SSA649Q) /CSM/SS/SSA6-C/SSA649Q.Seq.d/ XXXXX...SM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA649 (SSA649Q) /CSM/SS/SSA6-C/SSA

  4. Dicty_cDB: SSA265 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA265 (Link to dictyBase) - - - Contig-U15010-1 SSA265F (Link to Original site) SSA...265F 355 - - - - - - Show SSA265 Library SS (Link to library) Clone ID SSA265 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA2-C/SSA265Q.Seq.d/ Representative seq. ID SSA26...5F (Link to Original site) Representative DNA sequence >SSA265 (SSA265Q) /CSM/SS/SSA2-C/SSA265Q.Seq.d/ CAAAG...SM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA265 (SSA265Q) /CSM/SS/SSA2-C/SSA

  5. Dicty_cDB: SSA413 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA413 (Link to dictyBase) - - - Contig-U16181-1 SSA413F (Link to Original site) SSA...413F 522 - - - - - - Show SSA413 Library SS (Link to library) Clone ID SSA413 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA4-A/SSA413Q.Seq.d/ Representative seq. ID SSA41...3F (Link to Original site) Representative DNA sequence >SSA413 (SSA413Q) /CSM/SS/SSA4-A/SSA413Q.Seq.d/ TAAAC...SSF702 (SSF702Q) /CSM/SS/SSF7-A/SSF702Q.Seq.d/ 613 e-174 SSA413 (SSA413Q) /CSM/SS/SSA4-A/SSA

  6. Dicty_cDB: SSA894 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA894 (Link to dictyBase) - - - Contig-U16275-1 SSA894Z (Link... to Original site) - - SSA894Z 440 - - - - Show SSA894 Library SS (Link to library) Clone ID SSA894 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA8-D/SSA894Q.Seq.d/ Representative seq. ID SSA89...4Z (Link to Original site) Representative DNA sequence >SSA894 (SSA894Q) /CSM/SS/SSA8-D/SSA894Q.Seq.d/ XXXXX... Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA894 (SSA894Q) /CSM/SS/SSA8-D/SSA

  7. Dicty_cDB: SSA315 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA315 (Link to dictyBase) - - - Contig-U04364-1 SSA315Z (Link... to Original site) - - SSA315Z 620 - - - - Show SSA315 Library SS (Link to library) Clone ID SSA315 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA3-A/SSA315Q.Seq.d/ Representative seq. ID SSA31...5Z (Link to Original site) Representative DNA sequence >SSA315 (SSA315Q) /CSM/SS/SSA3-A/SSA315Q.Seq.d/ XXXXX... SSM282 (SSM282Q) /CSM/SS/SSM2-D/SSM282Q.Seq.d/ 589 e-167 SSA315 (SSA315Q) /CSM/SS/SSA3-A/SSA315Q.Seq.d/ 589

  8. Dicty_cDB: SSA793 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA793 (Link to dictyBase) - - - Contig-U14071-1 SSA793Z (Link... to Original site) - - SSA793Z 446 - - - - Show SSA793 Library SS (Link to library) Clone ID SSA793 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA7-D/SSA793Q.Seq.d/ Representative seq. ID SSA79...3Z (Link to Original site) Representative DNA sequence >SSA793 (SSA793Q) /CSM/SS/SSA7-D/SSA793Q.Seq.d/ XXXXX...(SSF811Q) /CSM/SS/SSF8-A/SSF811Q.Seq.d/ 878 0.0 SSA793 (SSA793Q) /CSM/SS/SSA7-D/SSA793Q.Seq.d/ 878 0.0 SSG18

  9. Dicty_cDB: SSA345 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA345 (Link to dictyBase) - G20757 DDB0206062 Contig-U04372-1 SSA...345F (Link to Original site) SSA345F 257 - - - - - - Show SSA345 Library SS (Link to library) Clone ID SSA...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA3-B/SSA345Q.Seq.d/ ...Representative seq. ID SSA345F (Link to Original site) Representative DNA sequence >SSA345 (SSA345Q) /CSM/SS/SSA3-B/SSA...E Sequences producing significant alignments: (bits) Value SSA345 (SSA345Q) /CSM/SS/SSA3-B/SSA

  10. Dicty_cDB: SSA832 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA832 (Link to dictyBase) - G23600 DDB0233770 Contig-U04479-1 SSA...832Z (Link to Original site) - - SSA832Z 457 - - - - Show SSA832 Library SS (Link to library) Clone ID SSA...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA8-B/SSA832Q.Seq.d/ ...Representative seq. ID SSA832Z (Link to Original site) Representative DNA sequence >SSA832 (SSA832Q) /CSM/SS/SSA8-B/SSA...roducing significant alignments: (bits) Value SSA832 (SSA832Q) /CSM/SS/SSA8-B/SSA832Q.Seq.d/ 458 e-128 SFK35

  11. Dicty_cDB: SSA591 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA591 (Link to dictyBase) - - - Contig-U13413-1 SSA591Z (Link... to Original site) - - SSA591Z 607 - - - - Show SSA591 Library SS (Link to library) Clone ID SSA591 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-D/SSA591Q.Seq.d/ Representative seq. ID SSA59...1Z (Link to Original site) Representative DNA sequence >SSA591 (SSA591Q) /CSM/SS/SSA5-D/SSA591Q.Seq.d/ XXXXX...0 SSF123 (SSF123Q) /CSM/SS/SSF1-A/SSF123Q.Seq.d/ 963 0.0 SSA591 (SSA591Q) /CSM/SS/SSA5-D/SSA591Q.Seq.d/ 963

  12. Dicty_cDB: SSA680 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA680 (Link to dictyBase) - - - Contig-U04448-1 SSA680Z (Link... to Original site) - - SSA680Z 387 - - - - Show SSA680 Library SS (Link to library) Clone ID SSA680 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA6-D/SSA680Q.Seq.d/ Representative seq. ID SSA68...0Z (Link to Original site) Representative DNA sequence >SSA680 (SSA680Q) /CSM/SS/SSA6-D/SSA680Q.Seq.d/ XXXXX...ucing significant alignments: (bits) Value SSA680 (SSA680Q) /CSM/SS/SSA6-D/SSA680

  13. Dicty_cDB: SSA153 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA153 (Link to dictyBase) - - - Contig-U10248-1 SSA153F (Link to Original site) SSA...153F 463 - - - - - - Show SSA153 Library SS (Link to library) Clone ID SSA153 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-C/SSA153Q.Seq.d/ Representative seq. ID SSA15...3F (Link to Original site) Representative DNA sequence >SSA153 (SSA153Q) /CSM/SS/SSA1-C/SSA153Q.Seq.d/ ATTTG...ficant alignments: (bits) Value SSA153 (SSA153Q) /CSM/SS/SSA1-C/SSA153Q.Seq.d/ 918 0.0 SSH468 (SSH468Q) /CSM

  14. Dicty_cDB: SSA821 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA821 (Link to dictyBase) - - - Contig-U04477-1 SSA821F (Link to Original site) SSA...821F 298 - - - - - - Show SSA821 Library SS (Link to library) Clone ID SSA821 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA8-A/SSA821Q.Seq.d/ Representative seq. ID SSA82...1F (Link to Original site) Representative DNA sequence >SSA821 (SSA821Q) /CSM/SS/SSA8-A/SSA821Q.Seq.d/ CAGTT...producing significant alignments: (bits) Value SSA821 (SSA821Q) /CSM/SS/SSA8-A/SSA821Q.Seq.d/ 585 e-166 SSK4

  15. Dicty_cDB: SSA339 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA339 (Link to dictyBase) - - - Contig-U14696-1 SSA339F (Link to Original site) SSA...339F 482 - - - - - - Show SSA339 Library SS (Link to library) Clone ID SSA339 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA3-B/SSA339Q.Seq.d/ Representative seq. ID SSA33...9F (Link to Original site) Representative DNA sequence >SSA339 (SSA339Q) /CSM/SS/SSA3-B/SSA339Q.Seq.d/ ATTTT.../SSM403Q.Seq.d/ 737 0.0 SSA339 (SSA339Q) /CSM/SS/SSA3-B/SSA339Q.Seq.d/ 737 0.0 VH

  16. Dicty_cDB: SSA628 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA628 (Link to dictyBase) - - - Contig-U13975-1 SSA628F (Link to Original site) SSA...628F 689 - - - - - - Show SSA628 Library SS (Link to library) Clone ID SSA628 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA6-B/SSA628Q.Seq.d/ Representative seq. ID SSA62...8F (Link to Original site) Representative DNA sequence >SSA628 (SSA628Q) /CSM/SS/SSA6-B/SSA628Q.Seq.d/ AAAAA...SM6-B/SSM646Q.Seq.d/ 1314 0.0 SSA628 (SSA628Q) /CSM/SS/SSA6-B/SSA628Q.Seq.d/ 1314 0.0 SSG772 (SSG772Q) /CSM/

  17. Dicty_cDB: SSA306 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA306 (Link to dictyBase) - - - Contig-U12249-1 SSA306Z (Link... to Original site) - - SSA306Z 612 - - - - Show SSA306 Library SS (Link to library) Clone ID SSA306 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA3-A/SSA306Q.Seq.d/ Representative seq. ID SSA30...6Z (Link to Original site) Representative DNA sequence >SSA306 (SSA306Q) /CSM/SS/SSA3-A/SSA306Q.Seq.d/ XXXXX...nyl Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA306 (SSA306Q) /CSM/SS/SSA3-A/SSA

  18. Dicty_cDB: SSA536 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA536 (Link to dictyBase) - - - Contig-U16093-1 SSA536Z (Link... to Original site) - - SSA536Z 653 - - - - Show SSA536 Library SS (Link to library) Clone ID SSA536 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-B/SSA536Q.Seq.d/ Representative seq. ID SSA53...6Z (Link to Original site) Representative DNA sequence >SSA536 (SSA536Q) /CSM/SS/SSA5-B/SSA536Q.Seq.d/ XXXXX...y vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA536 (SSA536Q) /CSM/SS/SSA5-B/SSA

  19. Dicty_cDB: SSA585 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA585 (Link to dictyBase) - - - Contig-U01910-1 SSA585F (Link to Original site) SSA...585F 399 - - - - - - Show SSA585 Library SS (Link to library) Clone ID SSA585 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-D/SSA585Q.Seq.d/ Representative seq. ID SSA58...5F (Link to Original site) Representative DNA sequence >SSA585 (SSA585Q) /CSM/SS/SSA5-D/SSA585Q.Seq.d/ ATCAA...K546Q) /CSM/SS/SSK5-B/SSK546Q.Seq.d/ 448 e-125 SSA585 (SSA585Q) /CSM/SS/SSA5-D/SSA585Q.Seq.d/ 448 e-125 SFA2

  20. Dicty_cDB: SSA362 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA362 (Link to dictyBase) - - - Contig-U16560-1 SSA362Z (Link... to Original site) - - SSA362Z 549 - - - - Show SSA362 Library SS (Link to library) Clone ID SSA362 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA3-C/SSA362Q.Seq.d/ Representative seq. ID SSA36...2Z (Link to Original site) Representative DNA sequence >SSA362 (SSA362Q) /CSM/SS/SSA3-C/SSA362Q.Seq.d/ XXXXX...es producing significant alignments: (bits) Value SSA362 (SSA362Q) /CSM/SS/SSA3-C/SSA362Q.Seq.d/ 1027 0.0 SS

  1. Dicty_cDB: SSA582 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA582 (Link to dictyBase) - - - Contig-U16540-1 SSA582F (Link to Original site) SSA...582F 680 - - - - - - Show SSA582 Library SS (Link to library) Clone ID SSA582 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-D/SSA582Q.Seq.d/ Representative seq. ID SSA58...2F (Link to Original site) Representative DNA sequence >SSA582 (SSA582Q) /CSM/SS/SSA5-D/SSA582Q.Seq.d/ TGTAA...nificant alignments: (bits) Value SSA582 (SSA582Q) /CSM/SS/SSA5-D/SSA582Q.Seq.d/

  2. Dicty_cDB: SSA706 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA706 (Link to dictyBase) - G20773 DDB0206442 Contig-U04454-1 SSA...706F (Link to Original site) SSA706F 345 - - - - - - Show SSA706 Library SS (Link to library) Clone ID SSA...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA7-A/SSA706Q.Seq.d/ ...Representative seq. ID SSA706F (Link to Original site) Representative DNA sequence >SSA706 (SSA706Q) /CSM/SS/SSA7-A/SSA...s CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA706 (SSA706Q) /CSM/SS/SSA7-A/SSA

  3. Dicty_cDB: SSA188 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA188 (Link to dictyBase) - - - Contig-U14470-1 SSA188F (Link to Original site) SSA...188F 647 - - - - - - Show SSA188 Library SS (Link to library) Clone ID SSA188 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-D/SSA188Q.Seq.d/ Representative seq. ID SSA18...8F (Link to Original site) Representative DNA sequence >SSA188 (SSA188Q) /CSM/SS/SSA1-D/SSA188Q.Seq.d/ GGACA...core E Sequences producing significant alignments: (bits) Value SSA188 (SSA188Q) /CSM/SS/SSA1-D/SSA188Q.Seq.

  4. Dicty_cDB: SSA261 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA261 (Link to dictyBase) - G02045 DDB0235194 Contig-U04344-1 SSA...261F (Link to Original site) SSA261F 301 - - - - - - Show SSA261 Library SS (Link to library) Clone ID SSA...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA2-C/SSA261Q.Seq.d/ ...Representative seq. ID SSA261F (Link to Original site) Representative DNA sequence >SSA261 (SSA261Q) /CSM/SS/SSA2-C/SSA...I4-B/SSI429Q.Seq.d/ 436 e-122 SSA261 (SSA261Q) /CSM/SS/SSA2-C/SSA261Q.Seq.d/ 436 e-122 VSH479 (VSH479Q) /CSM

  5. Dicty_cDB: SSA449 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA449 (Link to dictyBase) - - - Contig-U12270-1 SSA449E (Link... to Original site) - - - - - - SSA449E 372 Show SSA449 Library SS (Link to library) Clone ID SSA449 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA4-C/SSA449Q.Seq.d/ Representative seq. ID SSA44...9E (Link to Original site) Representative DNA sequence >SSA449 (SSA449Q) /CSM/SS/SSA4-C/SSA449Q.Seq.d/ TAAAC...*ilkk kkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA449 (SSA449Q) /CSM/SS/SSA4-C/SSA

  6. Dicty_cDB: SSA182 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA182 (Link to dictyBase) - - - Contig-U12256-1 SSA182F (Link to Original site) SSA...182F 640 - - - - - - Show SSA182 Library SS (Link to library) Clone ID SSA182 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-D/SSA182Q.Seq.d/ Representative seq. ID SSA18...2F (Link to Original site) Representative DNA sequence >SSA182 (SSA182Q) /CSM/SS/SSA1-D/SSA182Q.Seq.d/ AAATA...producing significant alignments: (bits) Value SSA182 (SSA182Q) /CSM/SS/SSA1-D/SSA182Q.Seq.d/ 1269 0.0 SSJ38

  7. Dicty_cDB: SSA402 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA402 (Link to dictyBase) - - - Contig-U11996-1 SSA402Z (Link... to Original site) - - SSA402Z 556 - - - - Show SSA402 Library SS (Link to library) Clone ID SSA402 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA4-A/SSA402Q.Seq.d/ Representative seq. ID SSA40...2Z (Link to Original site) Representative DNA sequence >SSA402 (SSA402Q) /CSM/SS/SSA4-A/SSA402Q.Seq.d/ XXXXX... Score E Sequences producing significant alignments: (bits) Value SSA402 (SSA402Q) /CSM/SS/SSA4-A/SSA402Q.Se

  8. Digitalisation in atomic pile control (1962); La digitalisation dans le controle des piles atomiques (1962)

    Energy Technology Data Exchange (ETDEWEB)

    Furet, J. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1962-07-01

    A brief survey is first given of the general theorems of Boodle's algebra and of sequence systems using D.A. Huffmans theory. Some indications are then given concerning the setting-up and the operation of digital computers and also of the principal codes used in digital techniques. It is then shown how digitalisation in atomic pile control makes it possible to use new techniques having the following advantages in particular: greater working safety, a higher degree of centralisation, and suppression of the linear elements. A few examples are given of the application of these techniques to control, particularly with respect to the measurement of the neutronic power and of the period and also of course, to the treatment of the data and the sequence automatisms. The advantage of using digital techniques in the shutdown channels is also examined. Finally a review is given of the technology and the viability of the control devices used. (author) [French] On rappelle d'abord ici les theoremes generaux de l'algebre de Boole et des systemes a sequences en s'appuyant sur la theorie de D.A. Huffmann. On donne ensuite quelques indications sur l'agencement et le fonctionnement des calculateurs digitaux ainsi que les principaux codes utilises dans les techniques digitales. On montre alors comment la digitalisation dans le controle des piles atomiques permet d'utiliser de nouvelles techniques presentant principalement les avantages suivants: securite de fonctionnement plus grande, centralisation plus elevee et suppression des elements lineaires. Un certain nombre d'exemples sont donnes sur l'application de ces techniques au controle, particulierement en ce qui concerne la mesure de la puissance neutronique, de la periode et aussi bien entendu du traitement des informations et des automatismes a sequences. On analyse aussi l'avantage de l'utilisation des techniques digitales dans les chaines de securite. Enfin, un apercu est donne

  9. Dicty_cDB: SSA729 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA729 (Link to dictyBase) - G00595 DDB0206564 Contig-U01523-1 SSA...729P (Link to Original site) SSA729F 302 SSA729Z 503 SSA729P 805 - - Show SSA729 Library SS (Link to library) Clone ID SSA...ontig-U01523-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA7-B/SSA...729Q.Seq.d/ Representative seq. ID SSA729P (Link to Original site) Representative DNA sequence >SSA729 (SSA729Q) /CSM/SS/SSA...kl Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA729 (SSA

  10. Dicty_cDB: SSA396 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA396 (Link to dictyBase) - - - Contig-U16441-1 SSA396F (Link to Original site) SSA...396F 698 - - - - - - Show SSA396 Library SS (Link to library) Clone ID SSA396 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA3-D/SSA396Q.Seq.d/ Representative seq. ID SSA39...6F (Link to Original site) Representative DNA sequence >SSA396 (SSA396Q) /CSM/SS/SSA3-D/SSA396Q.Seq.d/ ATTCT...s CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA396 (SSA396Q) /CSM/SS/SSA

  11. Dicty_cDB: SSA662 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available putative transporter protein SSA662 (ssa662) mRNA, complete cds. 1267 0.0 4 AC115576 |AC115576.1 Dictyostel...SS (Link to library) SSA662 (Link to dictyBase) - G03081 DDB0185065 Contig-U07966-1 SSA...662P (Link to Original site) SSA662F 470 SSA662Z 664 SSA662P 1134 - - Show SSA662 Library SS (Link to library) Clone ID SSA...Contig-U07966-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA6-C/SSA...662Q.Seq.d/ Representative seq. ID SSA662P (Link to Original site) Representative DNA sequence >SSA662 (SSA662Q) /CSM/SS/SSA

  12. Dicty_cDB: SSA716 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA716 (Link to dictyBase) - - - Contig-U11768-1 SSA716P (Link to Original site) SSA...716F 257 SSA716Z 405 SSA716P 662 - - Show SSA716 Library SS (Link to library) Clone ID SSA... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA7-A/SSA716Q.Seq.d/ Representative seq. ID SSA...716P (Link to Original site) Representative DNA sequence >SSA716 (SSA716Q) /CSM/SS/SSA7-A/SSA7...fhqlqlvfkkkkkkifkniyi**in rriffffyskkkkkkkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA

  13. Dicty_cDB: SSA204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA204 (Link to dictyBase) - - - Contig-U14136-1 SSA204F (Link to Original site) SSA...204F 277 - - - - - - Show SSA204 Library SS (Link to library) Clone ID SSA204 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA2-A/SSA204Q.Seq.d/ Representative seq. ID SSA20...4F (Link to Original site) Representative DNA sequence >SSA204 (SSA204Q) /CSM/SS/SSA2-A/SSA204Q.Seq.d/ AAAAT...vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA484 (SSA484Q) /CSM/SS/SSA

  14. Dicty_cDB: SSA484 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA484 (Link to dictyBase) - - - Contig-U14136-1 SSA484F (Link to Original site) SSA...484F 277 - - - - - - Show SSA484 Library SS (Link to library) Clone ID SSA484 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA4-D/SSA484Q.Seq.d/ Representative seq. ID SSA48...4F (Link to Original site) Representative DNA sequence >SSA484 (SSA484Q) /CSM/SS/SSA4-D/SSA484Q.Seq.d/ ATAAT...vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA484 (SSA484Q) /CSM/SS/SSA

  15. Dicty_cDB: SSA703 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA703 (Link to dictyBase) - - - Contig-U16244-1 SSA703F (Link to Original site) SSA...703F 277 - - - - - - Show SSA703 Library SS (Link to library) Clone ID SSA703 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA7-A/SSA703Q.Seq.d/ Representative seq. ID SSA70...3F (Link to Original site) Representative DNA sequence >SSA703 (SSA703Q) /CSM/SS/SSA7-A/SSA703Q.Seq.d/ TTTAT...vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA703 (SSA703Q) /CSM/SS/SSA

  16. Dicty_cDB: SSA514 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA514 (Link to dictyBase) - - - Contig-U16397-1 - (Link to Original site) SSA...514F 382 - - - - - - Show SSA514 Library SS (Link to library) Clone ID SSA514 (Link to dicty...iol.tsukuba.ac.jp/CSM/SS/SSA5-A/SSA514Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >SSA514 (SSA514Q) /CSM/SS/SSA5-A/SSA514Q.Seq.d/ GTGTTTTAGTTGTTGGT...ng catheps... 74 2e-12 BT057383_1( BT057383 |pid:none) Salmo salar clone ssal-evf

  17. Dicty_cDB: SSA674 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA674 (Link to dictyBase) - - - - SSA674P (Link to Original site) SSA674F 517 SSA...674Z 442 SSA674P 959 - - Show SSA674 Library SS (Link to library) Clone ID SSA674 (Link ...to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA...6-D/SSA674Q.Seq.d/ Representative seq. ID SSA674P (Link to ...Original site) Representative DNA sequence >SSA674 (SSA674Q) /CSM/SS/SSA6-D/SSA674Q.Seq.d/ TTTTTTTTTTTTTTTTT

  18. Dicty_cDB: SSA118 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA118 (Link to dictyBase) - - - Contig-U14989-1 SSA118F (Link to Original site) SSA...118F 575 - - - - - - Show SSA118 Library SS (Link to library) Clone ID SSA118 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-A/SSA118Q.Seq.d/ Representative seq. ID SSA11...8F (Link to Original site) Representative DNA sequence >SSA118 (SSA118Q) /CSM/SS/SSA1-A/SSA118Q.Seq.d/ CGGAC...qfslfvssif slislvlvqt--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA118 (SSA

  19. Dicty_cDB: SSA210 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA210 (Link to dictyBase) ssa210 - - Contig-U04334-1 SSA210F ...(Link to Original site) SSA210F 105 - - - - - - Show SSA210 Library SS (Link to library) Clone ID SSA210 (Li...nk to dictyBase) Atlas ID ssa210 NBRP ID - dictyBase ID - Link to Contig Contig-U04334-1 Original site URL h...ttp://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA2-A/SSA210Q.Seq.d/ Representative seq. ID SSA...210F (Link to Original site) Representative DNA sequence >SSA210 (SSA210Q) /CSM/SS/SSA2-A/SSA210Q.Se

  20. Dicty_cDB: SSA774 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA774 (Link to dictyBase) - G00598 DDB0229401 Contig-U14168-1 SSA...774E (Link to Original site) SSA774F 896 SSA774Z 908 SSA774P 1804 SSA774E 909 Show SSA774 Library SS (Li... Contig Contig-U14168-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA7-D/SSA...774Q.Seq.d/ Representative seq. ID SSA774E (Link to Original site) Representative DNA sequence >SSA774 (SSA...774Q) /CSM/SS/SSA7-D/SSA774Q.Seq.d/ AATACACACATAAGAACACAGAGGANAAATGAGNTAATAATAATAAGATATTTCAATTTA

  1. Dicty_cDB: SSA112 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA112 (Link to dictyBase) - G20740 DDB0189738 Contig-U04308-1 SSA...112E (Link to Original site) SSA112F 568 SSA112Z 585 SSA112P 1153 SSA112E 585 Show SSA112 Library SS (Li... Contig Contig-U04308-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-A/SSA...112Q.Seq.d/ Representative seq. ID SSA112E (Link to Original site) Representative DNA sequence >SSA112 (SSA...112Q) /CSM/SS/SSA1-A/SSA112Q.Seq.d/ AAAGCTCATTTACATTCATTTAAACATCATGCATCATCAGTTAATGGAATTTTACTTGGT

  2. Dicty_cDB: SSA135 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA135 (Link to dictyBase) - - - Contig-U04314-1 SSA135F (Link to Original site) SSA...135F 531 - - - - - - Show SSA135 Library SS (Link to library) Clone ID SSA135 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-B/SSA135Q.Seq.d/ Representative seq. ID SSA13...5F (Link to Original site) Representative DNA sequence >SSA135 (SSA135Q) /CSM/SS/SSA1-B/SSA135Q.Seq.d/ AAAGA...omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA135 (SSA

  3. Dicty_cDB: SSA386 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA386 (Link to dictyBase) - G01158 DDB0203604 Contig-U04380-1 SSA...386E (Link to Original site) SSA386F 612 SSA386Z 577 SSA386P 1189 SSA386E 655 Show SSA386 Library SS (Li... Contig Contig-U04380-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA3-D/SSA...386Q.Seq.d/ Representative seq. ID SSA386E (Link to Original site) Representative DNA sequence >SSA386 (SSA...386Q) /CSM/SS/SSA3-D/SSA386Q.Seq.d/ CACCGGTTGGAGCTTACTAAATTAGGTAAAGAAATATCTAGAAAAAAAATAAAAAAAATA

  4. Dicty_cDB: SSA623 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA623 (Link to dictyBase) - - - Contig-U12232-1 SSA623F (Link to Original site) SSA...623F 621 - - - - - - Show SSA623 Library SS (Link to library) Clone ID SSA623 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA6-A/SSA623Q.Seq.d/ Representative seq. ID SSA62...3F (Link to Original site) Representative DNA sequence >SSA623 (SSA623Q) /CSM/SS/SSA6-A/SSA623Q.Seq.d/ TTCAA...vvlvvlnsqallkni*qklsy--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA623 (SSA

  5. Dicty_cDB: SSA863 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA863 (Link to dictyBase) - - - Contig-U14496-1 - (Link to Original site) - - SSA...863Z 436 - - - - Show SSA863 Library SS (Link to library) Clone ID SSA863 (Link to dicty...iol.tsukuba.ac.jp/CSM/SS/SSA8-C/SSA863Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >SSA863 (SSA863Q) /CSM/SS/SSA8-C/SSA863Q.Seq.d/ XXXXXXXXXXAGATTCA...ore E Sequences producing significant alignments: (bits) Value SSA863 (SSA863Q) /CSM/SS/SSA8-C/SSA863Q.Seq.d

  6. Dicty_cDB: SSA452 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA452 (Link to dictyBase) - G20763 DDB0185811 Contig-U04397-1... - (Link to Original site) SSA452F 433 - - - - - - Show SSA452 Library SS (Link to library) Clone ID SSA452 ...l site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA4-C/SSA452Q.Seq.d/ Repres...entative seq. ID - (Link to Original site) Representative DNA sequence >SSA452 (SSA452Q) /CSM/SS/SSA4-C/SSA4...ng significant alignments: (bits) Value SSA452 (SSA452Q) /CSM/SS/SSA4-C/SSA452Q.Seq.d/ 383 e-105 SLD553 (SLD

  7. Dicty_cDB: SSA765 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA765 (Link to dictyBase) - - - Contig-U16394-1 SSA765Z (Link... to Original site) - - SSA765Z 154 - - - - Show SSA765 Library SS (Link to library) Clone ID SSA765 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA7-C/SSA765Q.Seq.d/ Representative seq. ID SSA76...5Z (Link to Original site) Representative DNA sequence >SSA765 (SSA765Q) /CSM/SS/SSA7-C/SSA765Q.Seq.d/ XXXXX...htriyay*k*k*kkknnv*n*k Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA765 (SSA

  8. Dicty_cDB: SSA854 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA854 (Link to dictyBase) ssa854 - - Contig-U16352-1 SSA854F ...(Link to Original site) SSA854F 249 - - - - - - Show SSA854 Library SS (Link to library) Clone ID SSA854 (Li...nk to dictyBase) Atlas ID ssa854 NBRP ID - dictyBase ID - Link to Contig Contig-U16352-1 Original site URL h...ttp://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA8-C/SSA854Q.Seq.d/ Representative seq. ID SSA...854F (Link to Original site) Representative DNA sequence >SSA854 (SSA854Q) /CSM/SS/SSA8-C/SSA854Q.Se

  9. Dicty_cDB: SSA572 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA572 (Link to dictyBase) - - - Contig-U11935-1 SSA572F (Link to Original site) SSA...572F 580 - - - - - - Show SSA572 Library SS (Link to library) Clone ID SSA572 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-C/SSA572Q.Seq.d/ Representative seq. ID SSA57...2F (Link to Original site) Representative DNA sequence >SSA572 (SSA572Q) /CSM/SS/SSA5-C/SSA572Q.Seq.d/ ATGAA...ASSVIDTFLAPGSPLLNVV IHGHYLETAFNS--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA572 (SSA

  10. Dicty_cDB: SSA448 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA448 (Link to dictyBase) - G02048 DDB0219255 Contig-U14699-1 SSA...448E (Link to Original site) SSA448F 528 SSA448Z 654 SSA448P 1182 SSA448E 724 Show SSA448 Library SS (Li... Contig Contig-U14699-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA4-B/SSA...448Q.Seq.d/ Representative seq. ID SSA448E (Link to Original site) Representative DNA sequence >SSA448 (SSA...448Q) /CSM/SS/SSA4-B/SSA448Q.Seq.d/ AAAAAATATTATTAAAAAAAAAAAAAAAAAAAATGTTTGATTATTTTTTCGGTAGTAAAA

  11. Dicty_cDB: SSA477 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA477 (Link to dictyBase) - - - Contig-U15494-1 - (Link to Original site) SSA...477F 419 - - - - - - Show SSA477 Library SS (Link to library) Clone ID SSA477 (Link to dicty...iol.tsukuba.ac.jp/CSM/SS/SSA4-D/SSA477Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >SSA477 (SSA477Q) /CSM/SS/SSA4-D/SSA477Q.Seq.d/ ATAAAAAATGGTTCAAA... alignments: (bits) Value SSA477 (SSA477Q) /CSM/SS/SSA4-D/SSA477Q.Seq.d/ 813 0.0 VSJ385 (VSJ385Q) /CSM/VS/VS

  12. Dicty_cDB: SSA746 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA746 (Link to dictyBase) - G20777 DDB0188220 Contig-U16307-1 SSA...746E (Link to Original site) SSA746F 316 SSA746Z 496 SSA746P 812 SSA746E 775 Show SSA746 Library SS (Lin...Contig Contig-U16307-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA7-B/SSA...746Q.Seq.d/ Representative seq. ID SSA746E (Link to Original site) Representative DNA sequence >SSA746 (SSA...746Q) /CSM/SS/SSA7-B/SSA746Q.Seq.d/ AAATAATTTCCCATCAGGTTTATTAGATAATGAAACGAGAGAAGCTGTAGATTTCATGGT

  13. Dicty_cDB: SSA316 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA316 (Link to dictyBase) - - - Contig-U01085-1 SSA316E (Link... to Original site) - - - - - - SSA316E 461 Show SSA316 Library SS (Link to library) Clone ID SSA316 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA3-A/SSA316Q.Seq.d/ Representative seq. ID SSA31...6E (Link to Original site) Representative DNA sequence >SSA316 (SSA316Q) /CSM/SS/SSA3-A/SSA316Q.Seq.d/ CTTAA...KENEEKNK*nhqlflflf*ik*iilinn Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA316 (SSA

  14. Dicty_cDB: SSA516 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA516 (Link to dictyBase) - - - Contig-U16310-1 SSA516F (Link to Original site) SSA...516F 680 - - - - - - Show SSA516 Library SS (Link to library) Clone ID SSA516 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-A/SSA516Q.Seq.d/ Representative seq. ID SSA51...6F (Link to Original site) Representative DNA sequence >SSA516 (SSA516Q) /CSM/SS/SSA5-A/SSA516Q.Seq.d/ GTTTT...nificant alignments: (bits) Value VFC149 (VFC149Q) /CSM/VF/VFC1-C/VFC149Q.Seq.d/ 1348 0.0 SSA516 (SSA

  15. Dicty_cDB: SSA109 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA109 (Link to dictyBase) - - - Contig-U01494-1 | Contig-U15574-1 SSA...109P (Link to Original site) SSA109F 307 SSA109Z 571 SSA109P 878 - - Show SSA109 Library SS (Link to library) Clone ID SSA...94-1 | Contig-U15574-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-A/SSA...109Q.Seq.d/ Representative seq. ID SSA109P (Link to Original site) Representative DNA sequence >SSA109 (SSA...109Q) /CSM/SS/SSA1-A/SSA109Q.Seq.d/ ATGATTAATATATTAAAGGACATTCTTTATAAATCATATAGCTATTTAGCATTTCCTTTT

  16. Dicty_cDB: SSA676 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA676 (Link to dictyBase) - - - Contig-U09438-1 SSA676Z (Link... to Original site) - - SSA676Z 579 - - - - Show SSA676 Library SS (Link to library) Clone ID SSA676 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA6-D/SSA676Q.Seq.d/ Representative seq. ID SSA67...6Z (Link to Original site) Representative DNA sequence >SSA676 (SSA676Q) /CSM/SS/SSA6-D/SSA676Q.Seq.d/ XXXXX...mvplhlqmvn*krlmil kisfklqlfnnllek Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA676 (SSA

  17. Dicty_cDB: SSA220 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA220 (Link to dictyBase) - - - Contig-U16278-1 SSA220Z (Link... to Original site) - - SSA220Z 485 - - - - Show SSA220 Library SS (Link to library) Clone ID SSA220 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA2-A/SSA220Q.Seq.d/ Representative seq. ID SSA22...0Z (Link to Original site) Representative DNA sequence >SSA220 (SSA220Q) /CSM/SS/SSA2-A/SSA220Q.Seq.d/ XXXXX...y system >> prediction for SSA220 is nuc 5' end seq. ID - 5' end seq. - Length of 5' end seq. - 3' end seq. ID SSA

  18. Dicty_cDB: SSA242 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA242 (Link to dictyBase) - G00584 DDB0206451 Contig-U04342-1 SSA...242E (Link to Original site) SSA242F 327 SSA242Z 501 SSA242P 828 SSA242E 622 Show SSA242 Library SS (Lin...Contig Contig-U04342-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA2-B/SSA...242Q.Seq.d/ Representative seq. ID SSA242E (Link to Original site) Representative DNA sequence >SSA242 (SSA...242Q) /CSM/SS/SSA2-B/SSA242Q.Seq.d/ CAAAAAAATGGGACATGATATTAAAGCAATTATAGGTTTTTCTTGCGCATTTGCAGTTGG

  19. Dicty_cDB: SSA147 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA147 (Link to dictyBase) - G02039 DDB0235198 Contig-U13986-1 SSA...147P (Link to Original site) SSA147F 576 SSA147Z 686 SSA147P 1262 - - Show SSA147 Library SS (Link to library) Clone ID SSA...Contig-U13986-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-B/SSA...147Q.Seq.d/ Representative seq. ID SSA147P (Link to Original site) Representative DNA sequence >SSA147 (SSA147Q) /CSM/SS/SSA...1-B/SSA147Q.Seq.d/ ATTCATTCATACATTTAATCAAACAATGAATTCTACTCGTAATATCATTTCATTAGTTCG TCGTTAT

  20. Dicty_cDB: SSA612 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA612 (Link to dictyBase) - - - Contig-U15745-1 SSA612F (Link to Original site) SSA...612F 500 - - - - - - Show SSA612 Library SS (Link to library) Clone ID SSA612 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA6-A/SSA612Q.Seq.d/ Representative seq. ID SSA61...2F (Link to Original site) Representative DNA sequence >SSA612 (SSA612Q) /CSM/SS/SSA6-A/SSA612Q.Seq.d/ CTAAT...nqvvlitlvtnqptkrythlkmytyfkkkk--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA612 (SSA

  1. Improvements to the Psi-SSA representation

    OpenAIRE

    De Ferriere, Francois

    2007-01-01

    Published in proceedings for the workshop "Software and Compilers for Embedded Systems (SCOPES) 2007" Modern compiler implementations use the Static Single Assignment representation as a way to efficiently implement optimizing algorithms. However this representation is not well adapted to architectures with a predicated instruction set. The Psi-SSA representation extends the SSA representation such that standard SSA algorithms can be easily adapted to an architecture with a fully predicate...

  2. Improvements to the Psi-SSA representation

    CERN Document Server

    De Ferriere, Francois

    2007-01-01

    Modern compiler implementations use the Static Single Assignment representation as a way to efficiently implement optimizing algorithms. However this representation is not well adapted to architectures with a predicated instruction set. The Psi-SSA representation extends the SSA representation such that standard SSA algorithms can be easily adapted to an architecture with a fully predicated instruction set. A new pseudo operation, the Psi operation, is introduced to merge several conditional definitions into a unique definition.

  3. Dicty_cDB: SSA672 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA672 (Link to dictyBase) - - - Contig-U12249-1 SSA672E (Link... to Original site) - - - - - - SSA672E 573 Show SSA672 Library SS (Link to library) Clone ID SSA672 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA6-C/SSA672Q.Seq.d/ Representative seq. ID SSA67...2E (Link to Original site) Representative DNA sequence >SSA672 (SSA672Q) /CSM/SS/SSA6-C/SSA672Q.Seq.d/ ATTAT....Seq.d/ 1104 0.0 SSF809 (SSF809Q) /CSM/SS/SSF8-A/SSF809Q.Seq.d/ 1104 0.0 SSF627 (SSF627Q) /CSM/SS/SSF6-B/SSF627Q.Seq.d/ 1104 0.0 SSA

  4. Dicty_cDB: SSA166 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA166 (Link to dictyBase) - - - Contig-U14969-1 SSA166F (Link to Original site) SSA...166F 455 - - - - - - Show SSA166 Library SS (Link to library) Clone ID SSA166 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-C/SSA166Q.Seq.d/ Representative seq. ID SSA16...6F (Link to Original site) Representative DNA sequence >SSA166 (SSA166Q) /CSM/SS/SSA1-C/SSA166Q.Seq.d/ GCAAG... (bits) Value VSK402 (VSK402Q) /CSM/VS/VSK4-A/VSK402Q.Seq.d/ 137 2e-31 SSL708 (SSL708Q) /CSM/SS/SSL7-A/SSL708Q.Seq.d/ 137 2e-31 SSA

  5. Dicty_cDB: SSA276 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA276 (Link to dictyBase) - - - Contig-U16482-1 SSA276E (Link... to Original site) - - - - - - SSA276E 433 Show SSA276 Library SS (Link to library) Clone ID SSA276 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA2-D/SSA276Q.Seq.d/ Representative seq. ID SSA27...6E (Link to Original site) Representative DNA sequence >SSA276 (SSA276Q) /CSM/SS/SSA2-D/SSA276Q.Seq.d/ AAAGA...73 |pid:none) Salmo salar clone HM5_1670 ribosom... 145 6e-34 BT049913_1( BT049913 |pid:none) Salmo salar clone ssa

  6. Dicty_cDB: SSA586 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA586 (Link to dictyBase) - - - Contig-U16350-1 SSA586F (Link to Original site) SSA...586F 286 - - - - - - Show SSA586 Library SS (Link to library) Clone ID SSA586 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-D/SSA586Q.Seq.d/ Representative seq. ID SSA58...6F (Link to Original site) Representative DNA sequence >SSA586 (SSA586Q) /CSM/SS/SSA5-D/SSA586Q.Seq.d/ ATCAA...it*swswsw--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA

  7. Dicty_cDB: SSA269 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA269 (Link to dictyBase) - - - Contig-U16244-1 SSA269Z (Link... to Original site) - - SSA269Z 504 - - - - Show SSA269 Library SS (Link to library) Clone ID SSA269 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA2-C/SSA269Q.Seq.d/ Representative seq. ID SSA26...9Z (Link to Original site) Representative DNA sequence >SSA269 (SSA269Q) /CSM/SS/SSA2-C/SSA269Q.Seq.d/ XXXXX...letal 4.0 %: vacuolar 4.0 %: plasma membrane >> prediction for SSA269 is cyt 5' end seq. ID - 5' end seq. -

  8. Dicty_cDB: SSA584 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA584 (Link to dictyBase) - - - Contig-U16382-1 SSA584F (Link to Original site) SSA...584F 581 - - - - - - Show SSA584 Library SS (Link to library) Clone ID SSA584 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-D/SSA584Q.Seq.d/ Representative seq. ID SSA58...4F (Link to Original site) Representative DNA sequence >SSA584 (SSA584Q) /CSM/SS/SSA5-D/SSA584Q.Seq.d/ TTTTT...QKSKSHQLTQNNLRSTSECEI CQVFVSKLESYI--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA

  9. Dicty_cDB: SSA213 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA213 (Link to dictyBase) - - - Contig-U16397-1 SSA213Z (Link... to Original site) - - SSA213Z 537 - - - - Show SSA213 Library SS (Link to library) Clone ID SSA213 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA2-A/SSA213Q.Seq.d/ Representative seq. ID SSA21...3Z (Link to Original site) Representative DNA sequence >SSA213 (SSA213Q) /CSM/SS/SSA2-A/SSA213Q.Seq.d/ XXXXX...lkk*k*k**flivk k Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA

  10. Dicty_cDB: SSA154 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA154 (Link to dictyBase) - - - Contig-U16544-1 SSA154E (Link... to Original site) - - - - - - SSA154E 255 Show SSA154 Library SS (Link to library) Clone ID SSA154 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA1-C/SSA154Q.Seq.d/ Representative seq. ID SSA15...4E (Link to Original site) Representative DNA sequence >SSA154 (SSA154Q) /CSM/SS/SSA1-C/SSA154Q.Seq.d/ ATTTT...( C46264 ) thioredoxin 3 - slime mold (Dictyostelium discoid... 55 6e-07 BT057388_1( BT057388 |pid:none) Salmo salar clone ssa

  11. Dicty_cDB: SSA728 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA728 (Link to dictyBase) - G20776 DDB0168231 Contig-U14313-1 SSA...728P (Link to Original site) SSA728F 316 SSA728Z 474 SSA728P 790 - - Show SSA728 Library SS (Link to library) Clone ID SSA...ontig-U14313-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA7-B/SSA...728Q.Seq.d/ Representative seq. ID SSA728P (Link to Original site) Representative DNA sequence >SSA728 (SSA728Q) /CSM/SS/SSA...lated Amino Acid sequence (All Frames) Frame A: mmssani*nr*nksnnifkn*lnrfsplkrislknynqqlngiknykiqlnsslkeiqrk

  12. Dicty_cDB: SSA531 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA531 (Link to dictyBase) - - - Contig-U16448-1 SSA531Z (Link... to Original site) - - SSA531Z 597 - - - - Show SSA531 Library SS (Link to library) Clone ID SSA531 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-B/SSA531Q.Seq.d/ Representative seq. ID SSA53...1Z (Link to Original site) Representative DNA sequence >SSA531 (SSA531Q) /CSM/SS/SSA5-B/SSA531Q.Seq.d/ XXXXX...8270 ) hypothetical protein - slime mold (Dictyostelium ... 37 0.55 AF054615_1( AF054615 |pid:none) Fragaria x ananassa

  13. Dicty_cDB: SSA529 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA529 (Link to dictyBase) - - - Contig-U16448-1 SSA529E (Link... to Original site) - - - - - - SSA529E 552 Show SSA529 Library SS (Link to library) Clone ID SSA529 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA5-B/SSA529Q.Seq.d/ Representative seq. ID SSA52...9E (Link to Original site) Representative DNA sequence >SSA529 (SSA529Q) /CSM/SS/SSA5-B/SSA529Q.Seq.d/ AGAAA... mold (Dictyostelium ... 37 0.45 AF054615_1( AF054615 |pid:none) Fragaria x ananassa cellulase (Cel... 36 0.

  14. The Case for GEO Hosted SSA Payloads

    Science.gov (United States)

    Welsch, C.; Armand, B.; Repp, M.; Robinson, A.

    2014-09-01

    Space situational awareness (SSA) in the geosynchronous earth orbit (GEO) belt presents unique challenges, and given the national importance and high value of GEO satellites, is increasingly critical as space becomes more congested and contested. Space situational awareness capabilities can serve as an effective deterrent against potential adversaries if they provide accurate, timely, and persistent information and are resilient to the threat environment. This paper will demonstrate how simple optical SSA payloads hosted on GEO commercial and government satellites can complement the SSA mission and data provided by Space-Based Space Surveillance (SBSS) and the Geosynchronous Space Situational Awareness Program (GSSAP). GSSAP is built by Orbital Sciences Corporation and launched on July 28, 2014. Analysis performed for this paper will show how GEO hosted SSA payloads, working in combination with SBSS and GSSAP, can increase persistence and timely coverage of high value assets in the GEO belt. The potential to further increase GEO object identification and tracking accuracy by integrating SSA data from multiple sources across different viewing angles including GEO hosted SSA sources will be addressed. Hosting SSA payloads on GEO platforms also increases SSA mission architecture resiliency as the sensors are by distributed across multiple platforms including commercial platforms. This distributed architecture presents a challenging target for an adversary to attempt to degrade or disable. We will present a viable concept of operations to show how data from hosted SSA sensors could be integrated with SBSS and GSSAP data to present a comprehensive and more accurate data set to users. Lastly, we will present an acquisition approach using commercial practices and building on lessons learned from the Commercially Hosted Infra Red Payload CHIRP to demonstrate the affordability of GEO hosted SSA payloads.

  15. Dicty_cDB: SSA705 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA705 (Link to dictyBase) - - - Contig-U03274-1 SSA705P (Link to Original ... w*syir*ye*igw**w*ffn* ffrsncns*yrsirtiq*flcks*sfsh*nts *nts titwfyepk*lftnes*ikik*ic slk Homology vs CSM-cD ... NA Score E Sequences producing significant alignments : (bits) Value SSA705 (SSA705Q) /CSM/SS/SSA7-A/SSA7 ...

  16. Dicty_cDB: SSA336 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6F (Link to Original site) Representative DNA sequence >SSA336 (SSA336Q) /CSM/SS/SSA3-B/SSA336Q.Seq.d/ CTACTTGGATGTTTCAAATAATATTTTAT...CAATTGTACCAAATAATTTGAAGGCGTTGAT CACGTTGAATATCTCGTATAATTCAATCCAGTCATTTGGAAACGCAACTATTTTATTGCC AGCATTGCAGGA...GTTGATATACACTCATAATAAGGTGAGCATTTTCCCCACAGAGATATT GGAGTTGCGTACCTTGAGAATATTGAAT...TTGGCAGGCAACCGTTTGAATTATCTCCCTGA CGAGATCTCGCATTTGGCAGGCACATTGGTTGAGTTGAATATCTCGGATAATGTATTCAC ATCGTTTCCAACACCAAT...TGTTCATTGACTTCATTTGATTTCGATCTTTCACAATTAACTAACCTTCAAGA GATTTATCTATCAGAGAATAGAAT

  17. Register allocation for programs in SSA Form

    OpenAIRE

    Hack, Sebastian

    2007-01-01

    This book investigates register allocation for programs in static single-assignment form. Its main result is that the interference graphs of SSA-form programs are chordal. This gives the compiler precise knowledge over the register demand and allows for separating spilling, assignment and coalescing. For each of these phases, we present methods specially tailored to the SSA setting and provide a first evaluation.

  18. The colour potentials of SSA-containing mortar

    OpenAIRE

    Kappel, Annemette; Ottosen, Lisbeth M.; Kirkelund, Gunvor Marie; Bache, Anja Margrethe; Goltermann, Per

    2015-01-01

    This paper reports an experimental study of aesthetical qualities of mortar containing sewage sludgeash (SSA). SSA is the residue produced at water treatment plants where incineration of the sludge is applied in order to decrease volume and to prevent pathogens from spreading. Today SSA is with a few exceptions landfilled and thus, wasted.The purpose of the experiments was to examine the influence of SSA and how it affected the colour of mortar samples. SSA was ground in 6 different intervals...

  19. Atomes de Rydberg et cavités : observation de la décohérence dans une mesure quantique

    OpenAIRE

    Dreyer, Jochen

    1997-01-01

    Dans ce mémoire nous présentons l'observation de la décohérence dans une situation simple, modélisant une mesure quantique idéale. Nous exploitons l'interaction entre un champ micro-onde confiné dans une cavité ne contenant que quelques photons et un atome de Rydberg circulaire. Elle crée un état de superposition quantique qui implique simultanément deux états du champ de phases macroscopiquement différentes. La décohérence, i. e. la transformation de la superposition initialement cohérente e...

  20. Dicty_cDB: SSA537 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA537 (Link to dictyBase) - - - Contig-U15621-1 SSA537P (Link to Original ... vviyqlvihpflpklclvig*mlvllilalkvvanttnkl*ilqnklcnf mis *lhsllfgliklyh*lnvhilchs*mkfkilfalmklil*is**lqlqclp ...

  1. BMDS/SSA Integrated Sensing Demonstration (BISD)

    Science.gov (United States)

    Turner, T.; Springford, K.; Grimaldi, L.

    2011-09-01

    This demonstration is intended to provide a near-term prototype, leave-behind capability for integrating Ballistic Missile Defense System (BMDS) ground sensors for use in the Space Situational Awareness (SSA) mission. Closed-loop tasking and cueing capability will be implemented, and a demonstration of net-centric space data dissemination using the BMDS sensors will be undertaken using various SSA mission threads. The demonstration is designed to highlight the implications of modifying software and/or hardware at the BMDS command and control node so that cost, risk, and schedule for an operational implementation can be fully understood. Additionally, this demonstration is intended to assess the impacts to both mission areas as a multi-mission, non-traditional sensor capability is integrated into the SSA mission. A successful demonstration will have many leave-behind capabilities and first-of-its-kind achievements to include: a) an extensible SSA operational prototype configuration for BMDS X-Band radars such as AN/TPY-2 and Sea-Based X-Band (SBX) b) a prototype SSA tasking and cueing capability between the Joint Functional Component Command for Space (JFCC Space) Joint Space Operations Center (JSpOC) and the Command, Control, Battle Management, and Communications (C2BMC) Experimental Laboratory (X-Lab), extensible to the Combatant Commands (COCOMS), and out to BMDS sensors c) a capability for a twoway, net-centric, interface for JSpOC space operations, to include translation from net-centric communications to legacy systems and d) processing of BMDS X-Band Radar tracks in the Space Defense Operations Center (SPADOC).

  2. The colour potentials of SSA-containing mortar

    DEFF Research Database (Denmark)

    Kappel, Annemette; Ottosen, Lisbeth M.; Kirkelund, Gunvor Marie;

    2015-01-01

    This paper reports an experimental study of aesthetical qualities of mortar containing sewage sludgeash (SSA). SSA is the residue produced at water treatment plants where incineration of the sludge is applied in order to decrease volume and to prevent pathogens from spreading. Today SSA is with a...

  3. Dicty_cDB: SSA545 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA545 (Link to dictyBase) - - - - SSA545F (Link to Original site) SSA545F ... 5 Y17830_6( Y17830 |pid:none) Pseudomonas sp. BW13 mercury ... resistanc... 253 2e-66 DQ174113_1( DQ174113 |pid:n ...

  4. Penetapan Kadar Kalium, Natrium dan Magnsium pada Semangka (Citrullus vulgaris, Schard) secara Spektrofotometri Serapan Atom.

    OpenAIRE

    Saraan, Sri Muftri Diani

    2012-01-01

    Watermelon is a tropical fruit which is favoured by people cause of it tastes crisp and sweet. Some informed that this fruit can decrease blood pressure cause of its potassium content. The aim of this research is to have a quantitative levels of potassium, sodium and magnesium in yellow and red watermelon’s fruit flesh, also in seed and seedless watermelon. Quantitative analysis is done by atomic absorption spectrophotometer with acetylene-air flame. Potassium, sodium and magnesium are qua...

  5. Penetapan Kadar Kalsium, Kalium, Dan Natrium Dalam Buah Sirsak (Annona Muricata L) Secara Spektrofotometri Serapan Atom

    OpenAIRE

    Luthvia

    2015-01-01

    Soursop is fruits that is quite popular because of it tastes sweet acidity. It contains many important elements that needed by the body, that are carbohydrate, protein, fat, vitamins, and minerals such as calcium, potassium, magnesium, sodium, phosphorus, iron, and zinc. The purpose of this research was to know the level of calcium, potassium, and sodium in soursop. The determination of these metal was done by using atomic absorption spectrophotometry with the wavelength at 422.7 nm for calci...

  6. Analisa Kadar Unsur Zn Dan Cu Pada Kopi Bubuk (Coffea spp.) Dengan Metode Spektrofotometri Serapan Atom

    OpenAIRE

    Mutiara

    2011-01-01

    The research done on the metal content of Zn and Cu from the coffee powder. Samples analyzed are ground coffee with coffee powder factory industry industrial households are analyzed each week for a month. Measurement of Zn and Cu metal concentrations in ground coffee is done by using basah.Pelarut dekstruksi method used was HNO 3 (p) and H 2 SO 4 (p) and pengoksidasinya H 2 O 2 30% and then analyzed by Atomic Absorption Sepektrofotometer on specific λ = 213.9 nm (Zn) and specific λ = 324.8 ...

  7. SSA-Caterpillar in Group Anonymity

    CERN Document Server

    Tavrov, Dan

    2011-01-01

    Nowadays, it is a common practice to protect various types of statistical data before publishing them for different researches. For instance, when conducting extensive demographic surveys such as national census, the collected data should be at least depersonalized to guarantee proper level of privacy preservation. In practice, even more complicated methods of data protection need to be used. All these methods can be generally divided into two classes. The first ones aim at providing individual data anonymity, whereas the other ones are focused on protecting information about a group of respondents. In this paper, we propose a novel technique of providing group anonymity in statistical data using singular spectrum analysis (SSA).Also, we apply SSA to defining hidden patterns in demographic data distribution.

  8. The Josephson effect in atomic contacts; Effect Josephson dans les contacts atomiques

    Energy Technology Data Exchange (ETDEWEB)

    Chauvin, M

    2005-11-15

    The Josephson effect appears when a weak-link establishes phase coherence between two superconductors. A unifying theory of this effect emerged in the 90's within the framework of mesoscopic physics. Based on two cornerstone concepts, conduction channels and Andreev reflection, it predicts the current-phase relation for the most basic weak-link: a single conduction channel of arbitrary transmission. This thesis illustrates this mesoscopic point of view with experiments on superconducting atomic size contacts. In particular, we have focused on the supercurrent peak around zero voltage, put into evidence the ac Josephson currents in a contact under constant bias voltage (Shapiro resonances and photon assisted multiple Andreev reflections), and performed direct measurements of the current-phase relation. (author)

  9. Événement et trauma dans Doctor Atomic de John Adams

    Directory of Open Access Journals (Sweden)

    Mathieu Duplay

    2011-04-01

    Full Text Available This article is based on the hypothesis that, by investigating the question of trauma, psychoanalysis has made an innovative contribution to the debate surrounding the concept of event, not so much because of the points explicitly made by Freud and his successors as because the ambiguities, contradictions, and aporias which characterize their discourse reveal some of the previously unseen difficulties inherent in such a discussion. Thus, the writer argues that a theory and/or poetics of event, however alien to the Freudian tradition, would benefit greatly by paying close attention to the lessons it teaches in this respect. John Adams’s 2005 opera Doctor Atomic, written in collaboration with Peter Sellars, is a case in point, not only because it deals with one of the most violent traumas in 20th‑century history—namely the nuclear test conducted at Los Alamos prior to the bombing of Hiroshima and Nagasaki—but also because, in addition to offering a potent meditation on the unthinkable, it reveals that all events, be they historical or aesthetic, call for new and as yet unformulated modes of thought ; as psychoanalysis suggests (sometimes in spite of itself, this is a clear sign of their traumatic nature.Cet article s’appuie sur l’hypothèse que le travail mené par la psychanalyse sur la notion de trauma jette un éclairage novateur sur la question de l’événement, et cela moins en raison des thèses tour à tour avancées que parce que les ambiguïtés, les revirements et les apories qui caractérisent le discours de Freud et de ses successeurs révèlent quelques‑unes des difficultés jusque-là inaperçues que cette problématique soulève ; c’est pourquoi, suppose‑t‑on, toute pensée et toute esthétique de l’événement, si étrangères soient‑elles à la tradition freudienne, ne peuvent aujourd’hui que gagner à méditer les enseignements dont elle est porteuse sur ce point. L’exemple de Doctor Atomic (2005

  10. KANDUNGAN LOGAM BERAT PADA AIR DAN SEDIMEN DI PERAIRAN SOCAH DAN KWANYAR KABUPATEN BANGKALAN

    Directory of Open Access Journals (Sweden)

    Wahyu Andy Nugraha

    2009-10-01

    Full Text Available Logam berat sangat berbahaya bagi biota laut maupun trofik level diatasnya. Penelitian ini bertujuan untuk mengetahui kandungan logam berat di perairan Socah dan Kwanyar kabupaten Bangkalan. Penelitian ini dilaksanakan selama 3 bulan. Pengambilan sampel air menggunakan botol sampel, sedangkan pengambilan sampel sedimen menggunakan grab sampler. Sampel kemudian dianalisa dengan spektrofotometer serapan atom (SSA. Hasil menunjukkan bahwa kandungan logam berat Cd, Cu, Pb, dan Hg pada air di perairan Socah dan Kwanyar masih dibawah ambang batas baku mutu air laut, sedangkan kandungan logam berat di sedimen melebihi ambang batas baku mutu air laut untuk biota laut. Secara umum, kandungan logam berat di sedimen lebih tinggi dari pada kandungan logam berat di air. Kata Kunci : Logam berat, Pencemaran, Spektrophotometer  HEAVY METALS CONTENTS IN WATER AND SEDIMENT IN KWANYAR AND SOCAH WATER, BANGKALANHeavy metals are very dangerous for marine life as well as the trophic level above. This study aims to determine the content of heavy metals in the waters Socah and Kwanyar Bangkalan. This study was conducted over 3 months. Water sampled using a sample bottle, while sediment samples was taken using a grab sampler. The sample was then analyzed by atomic absorption spectrophotometer (AAS. Results showed that the content of heavy metals Cd, Cu, Pb and Hg in the water in the Socah and Kwanyar waters still below the seawater quality standard limits, whereas the heavy metal content in sediments exceeded the water quality standard for marine sea. In general, the content of heavy metals in sediment is higher than on the water.Keywords: Heavy metals, Pollution, AAS

  11. The Aesthetical quality of SSA-containing mortar and concrete

    DEFF Research Database (Denmark)

    Kappel, Annemette; Kirkelund, Gunvor Marie; Ottosen, Lisbeth M.;

    2014-01-01

    global CO2 emission, the advantage of replacing cement with a secondary resource as SSA is obvious. The focus of previous conducted research has mainly been on the chemical, mechanical properties and environmental consequences attached to the use of SSA in construction materials.(Cyr et al., 2007) Thus...... saturated red brown colour. SSA shows potential for colouring concrete, and if the aesthetical aspects such as colour are taken into account at an early...

  12. Dicty_cDB: SSA683 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA683 (Link to dictyBase) - - - Contig-U15499-1 SSA683E (Link to Original ... AE014309 |AE014309.1 Homo sapiens chromosome 13q34 schizophrenia ... region contig 1 section 6 of 11 of the complete se ...

  13. Dicty_cDB: SSA351 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA351 (Link to dictyBase) - - - Contig-U07980-1 SSA351Z (Link to Original ... WO20090... 37 0.56 EU276418_1( EU276418 |pid:none) Olive ... flounder iridovirus strain O... 36 0.96 AB043979_1 ...

  14. Arctic Region Space Weather Customers and SSA Services

    DEFF Research Database (Denmark)

    Høeg, Per; Kauristi, Kirsti; Wintoft, Peter;

    and communication can be established without errors resulting from Space Weather effects. An ESA project have identified and clarified, how the products of the four ESA Space Weather Expert Service Centres (SWE) in the ESA Space Situational Awareness Programme (SSA), can contribute to the requirements of SSA...

  15. Atoms

    Institute of Scientific and Technical Information of China (English)

    刘洪毓

    2007-01-01

    Atoms(原子)are all around us.They are something like the bricks (砖块)of which everything is made. The size of an atom is very,very small.In just one grain of salt are held millions of atoms. Atoms are very important.The way one object acts depends on what

  16. Atoms

    International Nuclear Information System (INIS)

    Completed by recent contributions on various topics (atoms and the Brownian motion, the career of Jean Perrin, the evolution of atomic physics since Jean Perrin, relationship between scientific atomism and philosophical atomism), this book is a reprint of a book published at the beginning of the twentieth century in which the author addressed the relationship between atomic theory and chemistry (molecules, atoms, the Avogadro hypothesis, molecule structures, solutes, upper limits of molecular quantities), molecular agitation (molecule velocity, molecule rotation or vibration, molecular free range), the Brownian motion and emulsions (history and general features, statistical equilibrium of emulsions), the laws of the Brownian motion (Einstein's theory, experimental control), fluctuations (the theory of Smoluchowski), light and quanta (black body, extension of quantum theory), the electricity atom, the atom genesis and destruction (transmutations, atom counting)

  17. Analisa Kadar Ion Besi, Kadmium Dan Kalsium Dalam Air Minum Kemasan Galon Dan Air Minum Kemasan Galon Isi Ulang Dengan Metode Spektrofotometri Serapan Atom

    OpenAIRE

    Susanti, Widia

    2010-01-01

    The analysis of iron, cadmium and calcium ion in drinking water has been carried out. The samples analyzed are drinking water packaging gallons from official agencies and drinking water packaging refill gallons. The water was distributed with tank from the mountains and the wells drilled. Samples were analyzed every week for a month. Water samples was added with HNO3 (c) and analyzed by using atomic absorption spectrophotometer. The concentration of iron, cadmium and calcium was determined wi...

  18. Adding the "Local" Layer to the SSA Picture

    Science.gov (United States)

    Zaman, F.; Duckett, M.

    2012-09-01

    The heritage of Space Situational Awareness (SSA) has been limited to Earth based observation of space to support collision avoidance and space object identification. In part, this has led to reliance on multiple CONUS locations for optical and non-optical ground based observation. It has also led to the specialization of many fields and industries, which are highlighted at conferences like AMOS through discussion of state-of-the-art of observation capabilities. This paradigm alone no longer addresses the current needs for situational awareness of space assets in the changing space culture. Events in recent years have shown that space based sensing capabilities are increasingly critical as complements to ground based radar and optical systems. The SSA community would be better served by adopting the concept of "local" SSA and proliferating technologies to accomplish this. The traditional definition of SSA would expand to encompass an understanding of the immediate natural and manmade environment of the satellite. Multiple insights would be enabled, including baseline trending to support anomaly identification and resolution, catastrophic failure investigation, and anomaly and/or failure attribution. Additionally, protection measures could potentially be enabled to ensure space asset availability. Moving forward with a combination of traditional SSA and "local" SSA capabilities would allow a potential "global" SSA picture to be developed. This enhanced understanding would consist of ground observations in addition to the satellite's "first person" perspective. The potential for an exponentially increased comprehension of SSA is created by this powerful combination. The first step toward demonstrating this combination of SSA knowledge has been achieved with data from the SASSA Technology Demonstration.

  19. The colour potentials of SSA-containing mortar

    DEFF Research Database (Denmark)

    Kappel, Annemette; Ottosen, Lisbeth M.; Kirkelund, Gunvor Marie;

    2015-01-01

    few exceptions landfilled and thus, wasted.The purpose of the experiments was to examine the influence of SSA and how it affected the colour of mortar samples. SSA was ground in 6 different intervals and added to mortar mixes by replacing 20% of the cement. An additional focus was to examine the...... possibilities to accentuate the colours of the hardened mortar by using paper cuttings in the production of the samples. The result of the experiments showed that a colour scale can be developed from ground SSA, and that paper may have the potential of providing divers textural qualities when it is used in...

  20. TiSSA eelkonverents doktorantidele Tallinnas / Koidu Saame

    Index Scriptorium Estoniae

    Saame, Koidu

    2010-01-01

    Tallinna Ülikoolis toimunud TiSSA doktorantide eelkonverentsist 22.-24. aug. 2010.a. Doktorantide ettekannetest. Esinesid: Hans-Uwe Otto, Andriy Yuryev, Tiina Naarits, Ivar Tröner, Koidu Saame, Maija Jäppinen, Janissa Miettinen

  1. Dicty_cDB: SSA503 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA503 (Link to dictyBase) - - - Contig-U14087-1 SSA503Z (Link to Original ... 25-26.3. 34 0.026 5 Z69678 |Z69678.1 D.schiavazzii satellite ... DNA (clone bdopvu2). 48 0.12 1 Z69669 |Z69669.1 D. ... schiavazzii satellite ... DNA (clone vetpvu1). 48 0.12 1 AC068775 |AC068775. ...

  2. Dicty_cDB: SSA566 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA566 (Link to dictyBase) - - - Contig-U03802-1 SSA566E (Link to Original ... FJ941827_1( FJ941827 |pid:none) Hemibarbus mylodon manganese ... super... 214 4e-60 BC075257_1( BC075257 |pid:none) ... 59 AF242310_1( AF242310 |pid:none) Euphorbia esula manganese ... superoxi... 217 4e-59 BT082354_1( BT082354 |pid:no ...

  3. Dicty_cDB: SSA313 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA313 (Link to dictyBase) - - - Contig-U14026-1 SSA313F (Link to Original ... 5', mRNA sequence. 40 0.98 2 AI980138 |AI980138.1 pat .pk0013.d11 chicken activated T cell cDNA Gallus ga ... llus cDNA clone pat .pk0013.d11 5' similar to ENHANCER OF RUDIMENTARY P ...

  4. The colour potentials of SSA-containing mortar:the long version

    OpenAIRE

    Kappel, Annemette; Ottosen, Lisbeth M.; Kirkelund, Gunvor Marie; Bache, Anja Margrethe; Goltermann, Per

    2015-01-01

    This paper reports an experimental study of aesthetical qualities of mortar containing sewage sludgeash (SSA). SSA is the residue produced at water treatment plants where incineration of the sludge is applied in order to decrease volume and to prevent pathogens from spreading. Today SSA is with a few exceptions landfilled and thus, wasted.The purpose of the experiments was to examine the influence of SSA and how it affected the colour of mortar samples. SSA was ground in 6 different intervals...

  5. Atomes une exploration visuelle de tous les éléments connus dans l'univers

    CERN Document Server

    Gray, Theodore

    2013-01-01

    Quelle est leur température critique ? Qu'est-ce que la masse atomique, la densité d'un matériau, l'ordre de remplissage des électrons ? Cet ouvrage invite avec pédagogie et humour à un passionnant voyage au pays des éléments, à partir de leur tableau périodique universel. Soutenue par une exploration visuelle qui montre l'élément à l'état pur mais aussi ses composés et ses applications les plus caractéristiques dans la vie quotidienne, cette approche pratique offre une combinaison parfaite de science chimique et de photographies, qui séduira les lecteurs les plus avertis comme tous les autres habitants sensibles de l'univers.

  6. Dosage du mercure dans le gaz naturel par absorption atomique sans flammes Mercury Titration in Natural Gas by Flameless Atomic Absorption

    Directory of Open Access Journals (Sweden)

    La Villa F.

    2006-11-01

    Full Text Available Cet article présente la méthode mise au point par l'Institut Français du Pétrole pour déterminer par absorption atomique sans flamme, les traces de mercure métallique contenu dans un gaz naturel. La méthode d'analyse nécessite une extraction du mercure soit sous forme d'ion mercurique en faisant passer le gaz dans une solution oxydante, soit sous forme d'amalgame avec de l'or ou de l'argent. Le premier mode opératoire s'applique aux échantillons dont la concentration en mercure est supérieure à I ttg/Nm3, le second pour des concentrations inférieures à 5 pg/Nm3. Les seuils de détection sont respectivement 10 ng (en solution et 0,3 ng (en amalgame. La répétabilité pour 100 ng de mercure (en amalgame est de ± 7% pour une probabilité de.95 %. En conclusion, dans un échantillon de gaz naturel, compte tenu du volume des prélèvements effectués, il est possible de détecter des concentrations de l'ordre du nanogramme de mercure par mètre cube de gaz. This article describes the method developed by IFP using flameless atomic absorption to determine metallic mercury traces in a natural gas. The analyst method requires a mercury extraction either in the form of mercuric ions by making the gas pass through an oxidizing solution or in the form of an amalgam with gold or silver. The former operating method applies ta samples having a mercury concentration greater than I !ag/Nm3, and the latter for concentrations smaller than 5 (-Lg/Nm3. Detection thresholds are respectively 10 ng (in solution and 0.3 ng (in amalgam. The repeatability for 100 ng of mercury (in amalgam is ± 7 % with a probability of 95%. To conclude, in a sample of natural gas, considering the volume of the samples taken, it is possible ta detect concentrations in the vicinity of one nanogrom of mercury per cubic meter of gas.

  7. DAN PIENAAR GUN PARK LAUNCHES MUSEUM INTO 21ST CENTURY

    Directory of Open Access Journals (Sweden)

    C. Monick

    2012-02-01

    Full Text Available On 14 February 1992 there occurred the official opening of the Dan Pienaar Gun Park at the South African National Museum of Military History. The Gun Park is a newly completed exhibition area created by roofing and repairing the central courtyard between the exhibition's main halls. Lt Gen G L Meiring, SSA, SO, officially opened the Dan Pienaar Gun Park. The statue of Maj Gen D H ('Dan' Pienaar was officially unveiled by his widow (now Mrs Norma Seuffert. Maj Gen Pienaar's children, Fay, Barry and Nelia, were also present, in addition to a very wide representation of the Pienaar family.

  8. 20 CFR 422.705 - When SSA employees may listen-in to or record telephone conversations.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false When SSA employees may listen-in to or record... ORGANIZATION AND PROCEDURES Use of SSA Telephone Lines § 422.705 When SSA employees may listen-in to or record telephone conversations. SSA employees may listen-in to or record telephone conversations on SSA...

  9. Clinical and Pathological Roles of Ro/SSA Autoantibody System

    Directory of Open Access Journals (Sweden)

    Ryusuke Yoshimi

    2012-01-01

    Full Text Available Anti-Ro/SSA antibodies are among the most frequently detected autoantibodies against extractable nuclear antigens and have been associated with systemic lupus erythematosus (SLE and Sjögren's syndrome (SS. Although the presence of these autoantibodies is one of the criteria for the diagnosis and classification of SS, they are also sometimes seen in other systemic autoimmune diseases. In the last few decades, the knowledge of the prevalence of anti-Ro/SSA antibodies in various autoimmune diseases and symptoms has been expanded, and the clinical importance of these antibodies is increasing. Nonetheless, the pathological role of the antibodies is still poorly understood. In this paper, we summarize the milestones of the anti-Ro/SSA autoantibody system and provide new insights into the association between the autoantibodies and the pathogenesis of autoimmune diseases.

  10. Preliminary approach of the MELiSSA loop energy balance

    Science.gov (United States)

    Poulet, Lucie; Lamaze, Brigitte; Lebrun, Jean

    Long duration missions, such as the establishment of permanent bases on the lunar surface or the travel to Mars, require a huge amount of life support consumables (e.g. food, water and oxygen). Current rockets are at the moment unable to launch such a mass from Earth. Consequently Regenerative Life Support Systems are necessary to sustain long-term manned space mission to increase recycling rates and so reduce the launched mass. Thus the European and Canadian research has been concentrating on the MELiSSA (Micro-Ecological Life Support System Alternative) project over the last 20 years. MELiSSA is an Environmental Controlled Life Support System (ECLSS), i.e. a closed regenerative loop inspired of a lake ecosystem. Using light as a source of energy, MELiSSA's goal is the recovery of food, water and oxygen from CO2 and organic wastes, using microorganisms and higher plants. The architecture of a ECLSS depends widely on the mission scenario. To compare several ECLSS architectures and in order to be able to evaluate them, ESA is developing a multi criteria evaluation tool: ALISSE (Advanced LIfe Support System Evaluator). One of these criteria is the energy needed to operate the ECLSS. Unlike other criteria like the physical mass, the energy criterion has not been investigated yet and needs hence a detailed analysis. It will consequently be the focus of this study. The main objective of the work presented here is to develop a dynamic tool able to estimate the energy balance for several configurations of the MELiSSA loop. The first step consists in establishing the energy balance using concrete figures from the MELiSSA Pilot Plant (MPP). This facility located at the Universitat Autonoma de Barcelona (UAB) is aimed at the ground demonstration of the MELiSSA loop. The MELiSSA loop is structured on several subsystems; each of them is characterized by supplies, exhausts and process reactions. For the purpose of this study (i.e. a generic tool) the solver EES (Engineering

  11. Study of atomic jumps in quasi-crystals; Etude des sauts atomiques dans les quasi-cristaux

    Energy Technology Data Exchange (ETDEWEB)

    Lyonnard, S

    1997-05-07

    The terminology phason used in quasicrystals to refer to atomic jumps. The study of the hopping process is important for the understanding of many basic issues in quasi-crystallography: structure, stability, diffusion, phase transitions between quasicrystals and approximants, mechanical properties. Quasi-elastic neutron scattering allows to find the characteristics of each elementary jump: chemical species involves, relaxation times, activation energies, jump distances and orientations. We performed a series of experiments in the perfect icosahedral phases AlFeCu and AlMnPd, on both powders and single domain samples, using time-of-flight, backscattering and triple axis spectrometers. We evidenced the existence of very fast phason hopping, and studied about ten different atomic jumps. An unusual temperature dependence has been found systematically: each process is assisted by a thermally activated mechanism. The assistance process has to be determined case by case, but the more plausible explanation invokes assistance by phonons or phason clouds. Moreover, the dependence of the quasi elastic signal as a function of the momentum transfer shows that the jumps are local and do not give rise to any long-range diffusion. Phason hopping mainly corresponds to the atom moving forwards and backwards between two energetically equivalent sites. Finally, we have been able to show that the jumps occur along the various quasi-crystalline symmetry axes. (author) 91 refs.

  12. Dicty_cDB: SSA107 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA107 (Link to dictyBase) - G00577 DDB0191426 Contig-U01493-1 | Contig-U12 ... BC157942_1( BC157942 |pid:none) Mus musculus gene model ... 98, (NCBI)... 87 1e-15 AK144411_1( AK144411 |pid:n ...

  13. 20 CFR 411.630 - Is SSA's decision final?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Is SSA's decision final? 411.630 Section 411.630 Employees' Benefits SOCIAL SECURITY ADMINISTRATION THE TICKET TO WORK AND SELF-SUFFICIENCY PROGRAM Ticket to Work Program Dispute Resolution Disputes Between Beneficiaries and Employment Networks §...

  14. 20 CFR 411.660 - Is SSA's decision final?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Is SSA's decision final? 411.660 Section 411.660 Employees' Benefits SOCIAL SECURITY ADMINISTRATION THE TICKET TO WORK AND SELF-SUFFICIENCY PROGRAM Ticket to Work Program Dispute Resolution Disputes Between Employment Networks and Program Managers §...

  15. 76 FR 41685 - Electronic Substitutions for Form SSA-538

    Science.gov (United States)

    2011-07-15

    ... From the Federal Register Online via the Government Publishing Office SOCIAL SECURITY ADMINISTRATION 20 CFR Part 416 RIN 0960-AH02 Electronic Substitutions for Form SSA-538 AGENCY: Social Security... our use of electronic case processing at the initial and reconsideration levels of our...

  16. Dicty_cDB: SSA127 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA127 (Link to dictyBase) - G01153 DDB0231348 Contig-U04312-1 SSA127E (Lin ... olus coccineus cDNA 5' similar to Split hand/Split foot ... 1, mRNA sequence. 48 8e-07 2 CA910641 |CA910641.1 ... olus coccineus cDNA 5' similar to Split hand/Split foot ... 1, mRNA sequence. 44 1e-05 2 BM885320 |BM885320.1 ... ar to TR:Q13437 Q13437 DELETED IN SPLIT HAND/SPLIT FOOT ... 1 ;, mRNA sequence. 40 4e-04 3 CA800884 |CA800884. ... ar to TR:Q13437 Q13437 DELETED IN SPLIT HAND/SPLIT FOOT ... 1 ;, mRNA sequence. 40 5e-04 3 AV860852 |AV860852. ...

  17. On the Complexity of Spill Everywhere under SSA Form

    CERN Document Server

    Bouchez, Florent; Rastello, Fabrice

    2007-01-01

    Compilation for embedded processors can be either aggressive (time consuming cross-compilation) or just in time (embedded and usually dynamic). The heuristics used in dynamic compilation are highly constrained by limited resources, time and memory in particular. Recent results on the SSA form open promising directions for the design of new register allocation heuristics for embedded systems and especially for embedded compilation. In particular, heuristics based on tree scan with two separated phases -- one for spilling, then one for coloring/coalescing -- seem good candidates for designing memory-friendly, fast, and competitive register allocators. Still, also because of the side effect on power consumption, the minimization of loads and stores overhead (spilling problem) is an important issue. This paper provides an exhaustive study of the complexity of the ``spill everywhere'' problem in the context of the SSA form. Unfortunately, conversely to our initial hopes, many of the questions we raised lead to NP-...

  18. ANALISIS KARAKTERISASI VIBRASI MOLEKUL SENYAWA ORGANIK FENOL, ASAM AKSALAT DAN ETIL ASETAT SECARA SPEKTOSKOPI INFRA MERAH

    OpenAIRE

    Bannu, S.Si., M.Si.

    2005-01-01

    Telah dilakukan penelitian Analisis Karakterisasi Vibrasi Melekul Senayawa Organik Fenol, Asam Oksalat dan Etil Asetat. Hasil Penelitian yang diamati : 1) frekuensi serapan vibrasi untuk masing-masing ikatan antar atom pada molekul Fenol, Asam Oksalat dan Etil Asetat; 2) konstanta gaya pada molekul Fenol, Asam Oksalat dan Etil Asetat; 3) panjang ikatan antar Atom; 4) konstanta tak harmonik ikatan antar atom; dan 5) energi disosiasi iktan antar atom. Karakterisasi dari ke tiga senyawa men...

  19. Spray Atomization Models in Engine Applications, from Correlations to Direct Numerical Simulations Modèles de spray dans les applications moteur, des corrélations aux simulations numériques directes

    Directory of Open Access Journals (Sweden)

    Dos Santos F.

    2011-09-01

    Full Text Available Sprays are among the very main factors of mixture formation and combustion quality in almost every (IC engine. They are of great importance in pollutant formation and energy efficiency although adequate modeling is still on development. For many applications, validation and calibration of models are still an open question. Therefore, we present an overview of existing models and propose some trends of improvement. Models are classified in zero dimensional and dimensional classes ranging from simple formulations aimed at close-to-real-time applications to complete detailed description of early atomization stages. Les sprays sont parmi les principaux facteurs de qualite, dans la formation du melange et la combustion, dans un grand nombre de moteurs (a combustion interne. Ils sont de toute premiere importance dans la formation de polluants et l’efficacite energetique, bien qu’une modelisation adequate soit encore en developpement. Pour un grand nombre d’applications, la validation et la calibration de ces modeles demeurent une question ouverte. Aussi, presentons-nous un apercu des modeles existants et proposons quelques voies d’amelioration. Les modeles sont classes en nondimensionnels et dimensionnels allant de formules simples dediees a des applications proches du temps reel a des descriptions detaillees des premiers stades de l’atomisation.

  20. BOREAS TE-1 SSA-Fen Soil Profile Nutrient Data

    Science.gov (United States)

    Papagno, Andrea; Anderson, Darwin; Newcomer, Jeffrey A. (Editor); Hall, Forrest G. (Editor)

    2000-01-01

    The BOREAS TE-1 team collected various data to characterize the soil-plant systems in the BOREAS SSA. Particular emphasis was placed on nutrient biochemistry, the stores and transfers of organic carbon, and how the characteristics were related to measured methane fluxes. The overall traniect in the Prince Albert National Park (Saskatchewan, Canada) included the major plant communities and related soils that occurred in that section of the boreal forest. Soil physical, chemical, and biological measurements along the transect were used to characterize the static environment, which allowed them to be related to methane fluxes. Chamber techniques were used to provide a measure of methane production/uptake. Chamber measurements coupled with flask sampling were used to determine the seasonality of methane fluxes. This particular data set contains soil profile measurements of various nutrients at the SSA-Fen site. The data were collected from 23-May to 21-Oct- 1994. The data are stored in tabular ASCII files. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).

  1. 20 CFR 411.330 - How will SSA evaluate an EN's performance?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false How will SSA evaluate an EN's performance? 411.330 Section 411.330 Employees' Benefits SOCIAL SECURITY ADMINISTRATION THE TICKET TO WORK AND SELF-SUFFICIENCY PROGRAM Employment Networks § 411.330 How will SSA evaluate an EN's performance? (a) We...

  2. MELiSSA Food Characterization general approach and current status

    Science.gov (United States)

    Weihreter, Martin; Chaerle, Laury; Secco, Benjamin; Molders, Katrien; van der Straeten, Dominique; Duliere, Eric; Pieters, Serge; Maclean, Heather; Dochain, Denis; Quinet, Muriel; Lutts, Stanley; Graham, Thomas; Stasiak, Michael; Rondeau Vuk, Theresa; Zheng, Youbin; Dixon, Mike; Laniau, Martine; Larreture, Alain; Timsit, Michel; Aronne, Giovanna; Barbieri, Giancarlo; Buonomo, Roberta; Veronica; Paradiso, Roberta; de Pascale, Stafania; Galbiati, Massimo; Troia, A. R.; Nobili, Matteo; Bucchieri, Lorenzo; Page, Valérie; Feller, Urs; Lasseur, Christophe

    Higher plants play an important role in closed ecological life support systems as oxygen pro-ducers, carbon dioxide and water recyclers, and as a food source. For an integration of higher plant chambers into the MELiSSA (Micro Ecological Life Support System Alternative) loop, a detailed characterization and optimization of the full food production and preparation chain is needed. This implies the prediction and control of the nutritional quality of the final products consumed by the crew, the prediction of the wastes quality and quantity produced along the chain for further waste treatment (MELiSSA waste treatment) and the optimization of overall efficiencies. To reach this goal several issues have to be studied in an integrated manner: the physiological responses of crops to a range of environmental parameters, crop yield efficiencies and respective ratio and composition of edible and inedible biomass, the processability and storability of the produced food and last but not least composition of wastes in view of further degradation (fiber content). Within the Food Characterization (FC) project several compar-ative plant growth bench tests were carried out to obtain preliminary data regarding these aspects. Four pre-selected cultivars of each of the four energy-rich crops with worldwide usage -wheat, durum wheat, potato and soybean -were grown under well-characterized environmental conditions. The different cultivars of each species are screened for their performance in view of a closed loop application by parameter ranking. This comprises the characterization of edi-ble/inedible biomass ratio, nutritional quality, processability and overall performance under the specific conditions of hydroponic cultivation and artificial illumination. A second closely linked goal of the FC project is to develop a mechanistic physiological plant model, which will ease the integration of higher plants compartments in the MELiSSA concept by virtue of its predictive abilities

  3. Formal Verification of an SSA-based Middle-end for CompCert

    OpenAIRE

    Barthe, Gilles; Demange, Delphine; Pichardie, David

    2011-01-01

    CompCert is a formally verified compiler that generates compact and efficient PowerPC, ARM and x86 code for a large and realistic subset of the C language. However, CompCert foregoes using Static Single Assignment (SSA), an intermediate representation that allows for writing simpler and faster optimizers, and that is used by many compilers. In fact, it has remained an open problem to verify formally an SSA-based compiler middle-end. We report on a formally verified, SSA-based, middle-end for ...

  4. Anti-TNFa treatment in patients with rheumatoid arthritis and anti-Ro/SSA antibodies

    OpenAIRE

    Airò, P; R. Gorla; M. Vianelli; M. Frassi; Danieli, E; F. Franceschini; I. Cavazzana; Cattaneo, R

    2011-01-01

    Objective: To analyse clinical efficacy, onset of new autoantibodies or symptoms of autoimmune disease in patients affected by rheumatoid arthritis with anti-Ro/SSA treated with anti-TNFa agents. Methods: Six anti-Ro/SSA positive subjects with RA were studied every six months until 24th month of treatment in order to detect ANA titer (IFI), anti-dsDNA (Farr), anti-cardiolipin and anti-beta2glycoprotein I (ELISA), anti-ENA (CIE). The titre of anti-Ro/SSA were analysed by ELISA. Four patients w...

  5. Lyman continuum leaking AGN in the SSA22 field

    CERN Document Server

    Micheva, Genoveva; Inoue, Akio K

    2016-01-01

    Subaru/SuprimeCam narrowband photometry of the SSA22 field reveals the presence of four Lyman continuum (LyC) candidates among a sample of 14 AGN. Two show offsets and likely have stellar LyC in nature or are foreground contaminants. The remaining two LyC candidates are Type I AGN. We argue that the average LyC escape fraction of high redshift quasars is not likely to be unity, as often assumed in the literature. From direct measurement we obtain the average LyC-to-UV flux density ratio and ionizing emissivity for a number of AGN classes and find it at least a factor of two lower than values obtained assuming f_esc = 1. Comparing to recent Ly{\\alpha} forest measurements, AGNs at redshift z\\sim3 make up at most \\sim20% and as little as 3% of the total ionizing budget. Our results suggest that AGNs are unlikely to dominate the ionization budget of the Universe at high redshifts.

  6. VBA SSA Acc To Fed Rec Online (SAFRO) - Also known as Veterans Benefit Administration Query (VBAQ).

    Data.gov (United States)

    Social Security Administration — The purpose of this query is to provide SSA field office personnel with real-time access to military discharge data from the VA BIRLS database. This information is...

  7. Pengaruh Konsentrasi H2SO4 Dan HCL Pada Zeolit Alam Teraktivasi Serta PH Larutan Terhadap Adsorbsi Logam Kobal (Co) DAN Nikel (N) Dalam Larutan Standar Dengan Metode Spektrofotometri Serapan Atom

    OpenAIRE

    Rivan

    2012-01-01

    The influence of variations in concentrate H2SO4 and HCl of natural zeolite most activated on adsorbtion of the metal cobalt (Co) and nickel (Ni) in the standard solution by Atomic Absorption Spectrophotometric method has been studied. In the activation process of natural zeolites assessed by concentrate effect’s of H2SO4 and HCl which is 1.0, 2.0, 3.0, 4.0, and 5.0 N for each one. Into a standard solution of cobalt (Co) and nickel (Ni) was added 5 grams of natural zeolites that have been ac...

  8. Isolated anti-Ro/SSA thrombocytopenia: a rare feature of neonatal lupus

    OpenAIRE

    Ayadi, Imene Dahmane; Hamida, Emira Ben; Boukhris, Mohamed Riadh; Bezzine, Ahlem; Chaouachi, Sihem; Marrakchi, Zahra

    2015-01-01

    We report a rare case of isolated thrombocytopenia related to anti-Ro/SSA antibodies. The mother was followed for unlabeled familial thrombocytopenia. The mother had positive anti-Ro/SSA antibodies. She was asymptomatic without skin lesions or other criteria neither of systemic lupus erythematosus nor other connective tissue disease. Pregnancy was uneventful. The postnatal examination was normal. On the first day of life, blood cells count showed thrombocytopenia at 40 x 109/L. Within the sec...

  9. Modeling the future of knowledge economy: evidence from SSA and MENA countries

    OpenAIRE

    Asongu, Simplice A

    2013-01-01

    This paper projects the future of knowledge economy (KE) in SSA and MENA countries using the four components of the World Bank’s Knowledge Economy Index (KEI): economic incentive, education, ICTs and innovation. The empirical evidence provides the speeds of integration as well as the time necessary to achieve full integration. Findings broadly indicate SSA and MENA countries with low levels in KE will catch-up their counterparts with higher levels in a horizon of 4 to 7.5 years.

  10. Banking Efficiency and Financial Development in Sub-Saharan Africa (SSA)

    OpenAIRE

    Sandrine Kablan

    2009-01-01

    This study assesses the determinants of banking system efficiency in sub-Saharan Africa (SSA) and asks what, besides the degree of efficiency, explains the low level of financial development in the region. It uses stochastic frontier analysis to measure efficiency and a generalized method of moments system to explain financial development. SSA banks are found to be generally cost-efficient, with some differences across sub-regions. Among the determinants of efficiency, Return On Equity and no...

  11. GillespieSSA: Implementing the Gillespie Stochastic Simulation Algorithm in R

    Directory of Open Access Journals (Sweden)

    Mario Pineda-Krch

    2008-02-01

    Full Text Available The deterministic dynamics of populations in continuous time are traditionally described using coupled, first-order ordinary differential equations. While this approach is accurate for large systems, it is often inadequate for small systems where key species may be present in small numbers or where key reactions occur at a low rate. The Gillespie stochastic simulation algorithm (SSA is a procedure for generating time-evolution trajectories of finite populations in continuous time and has become the standard algorithm for these types of stochastic models. This article presents a simple-to-use and flexible framework for implementing the SSA using the high-level statistical computing language R and the package GillespieSSA. Using three ecological models as examples (logistic growth, Rosenzweig-MacArthur predator-prey model, and Kermack-McKendrick SIRS metapopulation model, this paper shows how a deterministic model can be formulated as a finite-population stochastic model within the framework of SSA theory and how it can be implemented in R. Simulations of the stochastic models are performed using four different SSA Monte Carlo methods: one exact method (Gillespie's direct method; and three approximate methods (explicit, binomial, and optimized tau-leap methods. Comparison of simulation results confirms that while the time-evolution trajectories obtained from the different SSA methods are indistinguishable, the approximate methods are up to four orders of magnitude faster than the exact methods.

  12. Retrieval of snow Specific Surface Area (SSA) from MODIS data in mountainous regions

    Science.gov (United States)

    Mary, A.; Dumont, M.; Dedieu, J.-P.; Durand, Y.; Sirguey, P.; Milhem, H.; Mestre, O.; Negi, H. S.; Kokhanovsky, A. A.

    2012-05-01

    This study describes a method to retrieve snow specific surface area (SSA) from satellite radiance reasurements in mountainous terrain. It aims at comparing different retrieval methods and at addressing topographic corrections of reflectance, namely slope and aspect of terrain and multiple reflections on neighbouring slopes. We use an iterative algorithm to compute reflectance from radiance of the MODerate resolution Imaging Spectrometer (MODIS) with a comprehensive correction of local illumination with regards to topography. The retrieved SSA is compared to the results of the snowpack model Crocus, fed by driving data from the SAFRAN meteorological analysis, over a large domain in the French Alps. We compared SSA retrievals with and without topographic or anisotropy correction, and with a spherical or non-spherical snow reflectance model. The topographic correction enables SSA to be retrieved in better agreement with those from SAFRAN-Crocus. The root mean square deviation is 10.0 m2 kg-1 and the bias is -0.6 m2 kg-1, over 3829 pixels representing seven different dates and snow conditions. The standard deviation of MODIS retrieved data, larger than the one of SAFRAN-Crocus estimates, is responsible for half this RMSD. It is due to the topographic classes used by SAFRAN-Crocus. In addition, MODIS retrieved data show SSA gradients with elevation and solar exposition, physically consistent and in good agreement with SAFRAN-Crocus.

  13. Retrieval of snow Specific Surface Area (SSA from MODIS data in mountainous regions

    Directory of Open Access Journals (Sweden)

    A. Mary

    2012-05-01

    Full Text Available This study describes a method to retrieve snow specific surface area (SSA from satellite radiance reasurements in mountainous terrain. It aims at comparing different retrieval methods and at addressing topographic corrections of reflectance, namely slope and aspect of terrain and multiple reflections on neighbouring slopes. We use an iterative algorithm to compute reflectance from radiance of the MODerate resolution Imaging Spectrometer (MODIS with a comprehensive correction of local illumination with regards to topography. The retrieved SSA is compared to the results of the snowpack model Crocus, fed by driving data from the SAFRAN meteorological analysis, over a large domain in the French Alps. We compared SSA retrievals with and without topographic or anisotropy correction, and with a spherical or non-spherical snow reflectance model. The topographic correction enables SSA to be retrieved in better agreement with those from SAFRAN-Crocus. The root mean square deviation is 10.0 m2 kg−1 and the bias is −0.6 m2 kg−1, over 3829 pixels representing seven different dates and snow conditions. The standard deviation of MODIS retrieved data, larger than the one of SAFRAN-Crocus estimates, is responsible for half this RMSD. It is due to the topographic classes used by SAFRAN-Crocus. In addition, MODIS retrieved data show SSA gradients with elevation and solar exposition, physically consistent and in good agreement with SAFRAN-Crocus.

  14. Point defects and irradiation in oxides: simulations at the atomic scale; Defauts ponctuels et irradiation dans les oxydes: simulation a l'echelle atomique

    Energy Technology Data Exchange (ETDEWEB)

    Crocombette, J.P

    2005-12-15

    The studies done by Jean-Paul Crocombette between 1996 and 2005 in the Service de Recherches de Metallurgie Physique of the Direction de l'Energie Nucleaire in Saclay are presented in this Habilitation thesis. These works were part of the material science researches on the ageing, especially under irradiation, of oxides of interest for the nuclear industry. In this context simulation studies at the atomic scale were performed on two elementary components of ageing under irradiation : point defects and displacement cascades ; using two complementary simulation techniques : ab initio electronic structure calculations and empirical potential molecular dynamics. The first part deals with point defects : self defects (vacancies or interstitials) or hetero-atomic dopants. One first recalls the energetics of such defects in oxides, the specific features of defects calculations and the expected accuracy of these calculations. Then one presents the results obtained on uranium dioxide, oxygen in silver and amorphous silica. The second part tackles the modelling of disintegration recoil nuclei in various?displacement cascades created by crystalline matrices for actinide waste disposal. Cascade calculations give access to the amorphization mechanisms under irradiation of these materials. One thus predicts that the amorphization in zircon takes place directly in the tracks whereas in lanthanum zirconate, the amorphization proceeds through the accumulation of point defects. Finally the prospects of these studies are discussed. (author)

  15. Hipersensitif Dentin dan Perawatannya

    OpenAIRE

    Valda, Zilby Rebeca

    2011-01-01

    Hipersensitif dentin digambarkan sebagai rasa sakit yang berlangsung pendek dan tajam akibat adanya rangsangan terhadap dentin yang terpapar. Rangsangan tersebut antara lain taktil atau sentuhan, uap, kimiawi dan rangsangan panas. Rasa sakit yang terjadi pada hipersensitif dentin akan mempengaruhi kenyamanan dan fungsi rongga mulut dan bila tidak dirawat maka akan menimbulkan defisiensi nutrisi pada penderita. Terkikisnya lapisan enamel yang menutupi gigi dan tersingkapnya permukaan akar m...

  16. Phase separation in Al-Zr-Sc alloys: from atomic jumps to ordered precipitates growth; Separation de phase dans les alliages Al-Zr-Sc: du saut des atomes a la croissance de precipites ordonnes

    Energy Technology Data Exchange (ETDEWEB)

    Clouet, E

    2004-07-01

    Zirconium and scandium addition to aluminium alloys leads to the formation of ordered precipitates. This study aims to a better understanding of precipitation kinetics thanks to an approach combining atomic and mesoscopic models. An experimental work has been undertaken too so as to characterize by transmission electron microscopy Al{sub 3}Zr kinetics of precipitation. We mainly focus on the nucleation stage and, in this purpose, an atomic model lying on a rigid lattice has been built for Al-Zr-Sc system allowing us to study precipitation with kinetic Monte Carlo simulations. While keeping the vacancy exchange mechanism for diffusion, we introduce multi-site interactions going thus beyond a simple pair interaction model, and test the influence of these interactions on kinetics of precipitation. The comparison between Monte Carlo simulations and classical nucleation theory shows that mesoscopic models can lead to a good description of the nucleation stage of Al{sub 3}Zr and Al{sub 3}Sc as long as the order tendency of the system has been taken into account to calculate input parameters of these models. For the ternary Al-Zr-Sc system, atomic simulations allow a better understanding of the precipitation kinetic path. It is then possible to extend the field of classical nucleation theory so as to model nucleation in a ternary alloy where the stoichiometry of the precipitates is unknown. (author)

  17. RFI suppression in SAR based on filtering interpretation of SSA and fast implementation

    Science.gov (United States)

    Wang, Xiaoyu; Yu, Weidong; Qi, Xiangyang; Liu, Yue

    2012-12-01

    Synthetic aperture radar (SAR) has proven to be a powerful remote sensing instrument for underground and obscured object detection. However, SAR echoes are often contaminated by radio frequency interferences (RFI) from multiple broadcasting stations. Essentially, RFI suppression problem is one-dimensional stationary time series denoising problem. This article proposed a novel RFI suppression algorithm based on singular spectral analysis (SSA) from a linear invariant systems perspective. It can be seen that SSA algorithm has an equivalence relation with finite impulse response (FIR) filter banks. Besides, this article first introduce two approximated methods which can remarkably speed up spectral decomposition--Nyström method and Column-Sampling approximation--to obtain the coefficients of above SSA-FIR-filter. Simulation results and imaging results of measured data have proved the efficiency and validity of this algorithm.

  18. Pengaruh Variasi Waktu Ultrasonikasi dan Waktu Tahan Hydrothermal terhadap Struktur dan Konduktivitas Listrik Material Graphene

    Directory of Open Access Journals (Sweden)

    Muhammad Junaidi

    2014-03-01

    Full Text Available Graphene merupakan satu lapis atom karbon yang mengalami hibridisasi sp2 membentuk struktur heksagonal 2D. Graphene memiliki potensi besar untuk aplikasi nanoelectronic materials. Penelitian ini bertujuan menganalisis waktu ultrasonikasi dan hidrothermal terbaik untuk mensintesis Graphene. Graphene disintesis dengan metode reduksi Grafit Oksida (GO. Grafit dioksidasi membentuk GO dengan modifikasi metode Hummer. GO diultrasonikasi dengan variasi waktu 60, 90 dan 120 menit. Kemudian proses reduksi GO dilakukan secara kimia dengan penambahan serbuk Zn dan teknik hidrothermal 200 oC dengan variasi waktu tahan 12, 18 dan 24 jam. Analisis morfologi dan struktur graphene dilakukan dengan pengujian SEM dan XRD. Pengujian Iodine Number untuk mengetahui kemampuan graphene menyerap Iodin. Pengujian FTIR untuk mengetahui gugus fungsi yang terbentuk  pada GO dan Graphene. Pengujian Four Point Probe Test (FPP untuk mengukur konduktivitas listrik Graphene. Hasil analsis menunjukkan bahwa graphene hasil ultrasonikasi 120 menit dan Holding 12 jam memiliki struktur Single Layer Graphene (SLG dengan konduktivitas listrik terbaik 0.0105 S/m

  19. Ultracold lithium-6 atoms in the BEC-BCS crossover: experiments and the construction of a new apparatus; Atomes de lithium-6 ultra froids dans la transition BEC-BCS: experiences et construction d'un montage experimental

    Energy Technology Data Exchange (ETDEWEB)

    Teichmann, M

    2007-09-15

    We use a fermionic gas of Lithium-6 as a model system to study superfluidity. The limiting cases of superfluidity are Bose-Einstein condensation (BEC) and superconductivity, described by the theory by Bardeen, Cooper and Schrieffer (BCS). In Lithium-6 gases, we can explore the whole range between the two cases, known as the BEC-BCS crossover, using a Feshbach resonance. We study the change of the momentum distribution of the gas in this cross-over and compare to theoretical models. We also investigate the hydrodynamic expansion, characteristic for a superfluid gas. We observe a sudden change of the ellipticity of the gas close to the transition to the superfluid phase. Moreover, we localized heteronuclear Feshbach resonances between {sup 6}Li and {sup 7}Li. We are currently constructing a second generation of the experimental setup. An new laser system, based on high power laser diodes, was developed. Changes in the vacuum chamber, including a complete reconstruction of the Zeeman slower, have increased the atomic flux, allowing us to increase the repetition rate of our experiment. Modifications of the geometry of the magnetic traps lead to a higher number of trapped atoms. (author)

  20. 76 FR 12398 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Bureau of the Public Debt (BPD...

    Science.gov (United States)

    2011-03-07

    ... to support our administration of the prescription drug subsidy program. The MDB File system of... ADMINISTRATION Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Bureau of the Public Debt (BPD))--Match Number 1304 AGENCY: Social Security Administration (SSA) . ACTION: Notice of a renewal of...

  1. 78 FR 51264 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of the Treasury...

    Science.gov (United States)

    2013-08-20

    ... Special Veterans Benefit (SSR), SSA/OASSIS 60-0103, as published at 71 FR 1795 (January 11, 2006). SSA... information with respect to unearned income from the IRMF, Treas./IRS 22.061, as published at 77 FR 47946-947... requirements of the Privacy Act, as amended. Kirsten J. Moncada, Executive Director, Office of Privacy...

  2. 77 FR 74913 - Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA...

    Science.gov (United States)

    2012-12-18

    ... ADMINISTRATION Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA)/Office of Personnel Management (OPM))--Match Number 1307 AGENCY: Social Security Administration. ACTION...-certification of eligibility for the Extra Help with ] Medicare Prescription Drug Plan Costs program (Extra...

  3. The Adsorption Capacity, Pore Structure, and Thermal Behavior of the Modified Clay Containing SSA

    Directory of Open Access Journals (Sweden)

    Haijun Lu

    2016-01-01

    Full Text Available Sewage sludge ash (SSA was created by burning municipal sludge. The potential of clay containing 1 or 3 or 5% SSA was assessed for use as a landfill liner-soil material. Batch adsorption, low temperature N2 adsorption, and TG-DTA tests were performed to evaluate the adsorption capacity, micropore structure, thermostability, and components of soils under Cr(VI and Pb(II chemical solutions. With the increasing amount of SSA in modified clay, the adsorption capacity of Cr(VI and Pb(II to the modified clay increases gradually. After absorption, the pore size of modified clay ranges from 2 nm to 8 nm. With the increasing amount of absorption, the pore volume decreases and the specific surface area increases. With the increasing of adsorption concentration of Cr(VI and Pb(II, the mass loss percentage of modified clay increases to 23.4% and 12.6%, respectively. The modified clay containing SSA may be used as a good barrier material to attenuate contamination of Cr(VI and Pb(II in landfills.

  4. Infeksi Cacing dan Alergi

    OpenAIRE

    Selfi Renita Rusdji

    2015-01-01

    AbstrakInfeksi cacing masih merupakan masalah kesehatan di Indonesia dan negara berkembang lainnya. Penyakit ini sering terjadi di daerah dengan higienisitas dan sanitasi yang masih kurang. Respon imun tubuh host terhadap cacing ini mirip dengan respon tubuh terhadap penyakit alergi. Respon pada penyakit kecacingan dan alergi ini merupakan respon Thelper2 yaitu diferensiasi dan polariasasi sel limfosit T lebih dominan pada Th2. Pada kenyataannya, ditinjau dari segi epidemiologi, penyakit keca...

  5. Anti-TNFa treatment in patients with rheumatoid arthritis and anti-Ro/SSA antibodies

    Directory of Open Access Journals (Sweden)

    P. Airò

    2011-09-01

    Full Text Available Objective: To analyse clinical efficacy, onset of new autoantibodies or symptoms of autoimmune disease in patients affected by rheumatoid arthritis with anti-Ro/SSA treated with anti-TNFa agents. Methods: Six anti-Ro/SSA positive subjects with RA were studied every six months until 24th month of treatment in order to detect ANA titer (IFI, anti-dsDNA (Farr, anti-cardiolipin and anti-beta2glycoprotein I (ELISA, anti-ENA (CIE. The titre of anti-Ro/SSA were analysed by ELISA. Four patients were diagnosed as overlap RA/SS. Results: Six female patients (mean age 58ys, SD 9.8ys, with long-standing RA (mean 7ys, range 5-22 ys were treated with anti-TNFa agents for a mean of 31 months (SD: 20.4 m: 4 with Infliximab and 2 with Etanercept. All the patients showed a significant reduction of DAS until 24th month (p<0.006 with stability of sicca symptoms. The titer of ANA and anti-Ro/SSA was stable, while 4 subjects developed anti-dsDNA at low titer within 6-12 months. One patient withdrawn the treatment, because of lupus-like features; another one, with HCV hepatitis, interrupted Etanercept because of elevation of liver enzymes. No anticardiolipin or antibeta2GPI antibodies were detected. One subject with RA-SS also presented a primary biliary cirrhosis: clinical and histological features of cholangitis remained stable during Etanercept treatment. Conclusions: Anti-TNFa treatment showed good efficacy and safety in anti-Ro/SSA positive patients with RA. Anti-ds- DNA antibodies at low titer appeared in most patients while the onset of lupus-like disease could be considered a rare event also in RA patients with a rich autoimmune repertoire.

  6. MELiSSA Pilot Plant: A facility for ground demonstration of a closed life support system

    Science.gov (United States)

    Godia, Francesc; Fossen, Arnaud; Peiro, Enrique; Gerbi, Olivier; Dussap, Gilles; Leys, Natalie; Arnau, Carolina; Milian, Ernest

    MELiSSA (Micro Ecological Life Support System Alternative) is an international collaborative effort focused on the development of a Life Support System for long-term Space missions. The goals of the MELiSSA loop are the recovery of food, water and oxygen from wastes, i.e. CO2 and organic wastes, using light as a source of energy. It is conceived as a series of compartments, each one performing a specific function within this cycle, inspired in the terrestrial ecological systems. Each one of the compartments is colonized with specific bacteria or higher plants depending on its dedicated function. Therefore, its design and operational conditions should guarantee that only a given specific biological activity takes place in each compartment. Moreover, this has to be done in a controlled manner, both at the subsystems level (i.e., compartments) and at the overall system level (i.e., complete loop). In order to achieve the complete operation of such a Closed Ecological System, in a first step each compartment has to be developed at individual level, and its operation demonstrated under its associated control law. In a second step, the complete loop needs to be integrated by the connection of the different compartments in the gas, loop and solid phases. An extensive demonstration of MELiSSA loop under terrestrial conditions is a mandatory step in the process of its adaptation to space. This is the main goal of the MPP. The demonstration scenario for the MPP is the respiration equivalent of a human being, and production of 20 percent of the diet of one person. To serve this goal, the different compartments of the MELiSSA loop have been designed and sized at the pilot scale level, and further characterized. Nowadays, the focus of the MELiSSA Pilot Plant is on the integration of its compartments. To this end, the integration challenge is concentrated in three compartments devoted to the following functions: nitrification (Compartment 3, an axenic co-culture of Nitrosomonas

  7. Nonlinear time series analysis of vibration data from a friction brake: SSA, PCA, and MFDFA

    International Nuclear Information System (INIS)

    We use the methodology of singular spectrum analysis (SSA), principal component analysis (PCA), and multi-fractal detrended fluctuation analysis (MFDFA), for investigating characteristics of vibration time series data from a friction brake. SSA and PCA are used to study the long time-scale characteristics of the time series. MFDFA is applied for investigating all time scales up to the smallest recorded one. It turns out that the majority of the long time-scale dynamics, that is presumably dominated by the structural dynamics of the brake system, is dominated by very few active dimensions only and can well be understood in terms of low dimensional chaotic attractors. The multi-fractal analysis shows that the fast dynamical processes originating in the friction interface are in turn truly multi-scale in nature

  8. Dynamique quantique dans les potentiels lumineux

    OpenAIRE

    Thommen, Quentin

    2004-01-01

    La dynamique quantique dans un potentiel périodique a fait l'objet de nombreuses études depuis les travaux de Bloch, dans les années 30, portant sur la dynamique des électrons dans un solide cristalisé. Cette dynamique est expérimentalement observable à l'aide d'atomes refroidis. L'utilisation de potentiels optiques permet de synthétiser, de façon très souple, des formes variées de potentiels, périodique, stationnaire ou dépendant du temps. Outre la grande variété de potentiels accessibles, l...

  9. Rapid assessment of populations trends of invasive species: Singular Spectrum Analysis (SSA)

    OpenAIRE

    DANA, ED

    2010-01-01

    Singular Spectrum Analysis (SSA) is a powerful analytical approach for biodi-versity management. Its main advan-tages are due to its intuitive processing and visualization, since mathematical workflow is conceptually similar to the widely accepted Principal Components Analysis. Detailed analyses of popula-tion trends with mathematical tools are often difficult to achieve for managers by a number of reasons (large numbers or areas monitored, large number of species, insufficient statistics ski...

  10. Transverse Myelitis Associated with Anti-Ro (SSA) Autoantibodies: A Record of Two Cases

    OpenAIRE

    Melikyan, G.; Abdelrahman, M. H.; A. D’Suoza; Akhtar, N; Elzouki, A. N.; Hammoudeh, M.

    2012-01-01

    Transverse myelitis (TM) is an inflammatory process involving a restricted area of the spinal cord. The usual dramatic presentation makes TM a medical emergency. Early detection and aggressive therapy are required in order to improve the prognosis. The association of this unique clinical phenotype and autoantibody provides circumstantial evidence that an autoimmune aetiology might be involved. We describe two cases of TM associated with anti-Ro (SSA) autoantibodies without connective tissue d...

  11. A case study of high sea salt aerosol (SSA) concentrations as a hazard to aviation

    OpenAIRE

    Tighe, Tony

    2015-01-01

    Abstract: On the night of 2nd January 2014 an aircraft on approach to Cork airport was required to abort a landing attempt due to sea salt aerosol (SSA) accretion on the windscreen. The salt reduced forward facing visibility to dangerously low levels. This was the first time such an incident was recorded by Irelands Air Accident Investigation Unit. This paper describes the meteorological conditions at the time of the aborted landing approach. Sea salt aerosol formation mechanisms are ela...

  12. Analisis Kebijakan dan Efektivitas Organisasi

    Directory of Open Access Journals (Sweden)

    Amir Syarifudin Kiwang

    2015-05-01

    Full Text Available Penerapan Peraturan Gubernur Nusa Tenggara Timur Nomor 8 Tahun 2011 tentang Organisasi dan Tata Kerja Unit Pelaksana Teknis Pendidikan dan Pelatihan Koperasi dan Usaha Mikro Kecil dan Menengah pada Dinas Koperasi dan Usaha Mikro Kecil dan Menengah Provinsi Nusa Tenggara Timur adalah dalam rangka untuk meningkatkan efektivitas kerja organisasi pada UPT Diklat Koperasi dan UMKM. Penelitian ini berusaha untuk melihat dampak kebijakan organisasi terhadap efektivitas organisasi dengan menggunakan enam elemen variabel dari kebijakan dan praktik manajemen. Keenam elemen tersebut adalah penetapan tujuan strategis, pencarian dan pemanfaatan sumber daya, lingkungan prestasi, proses komunikasi, kepemimpinan dan pengambilan keputusan, serta adaptasi dan inovasi organisasi. Penelitian kualitatif ini menggunakan pendekatan studi kasus. Teknik analisis data yang digunakan adalah analisis data model Miles dan Huberman, yang terdiri atas reduksi data, display/penyajian data, dan kesimpulan/verifikasi. Hasil penelitian menunjukkan bahwa efektivitas organisasi pada UPT Diklat koperasi dan UMKM belum berjalan secara baik, hal ini dapat dilihat dari beberapa hal antara lain, belum adanya tenaga spesialisasi pengelola diklat dan tenaga khusus (sarjana di bidang perkoperasian dan kondisi lingkungan kerja (lingkungan prestasi pada UPT Diklat koperasi dan UMKM yang belum efektif. Penempatan pegawai juga belum tepat, mutasi ke UPT Diklat Koperasi dan UMKM tidak memperhatikan latar belakang pendidikan dan spesialisasi/keahlian pegawai sehingga membutuhkan waktu dalam proses penyesuaian serta menurunkan jumlah pelaksanaan diklat dikarenakan keterbatasan alokasi dana.

  13. 76 FR 77238 - Submission for OMB Review; Comment Request; The SSA-NIH Collaboration to Improve the Disability...

    Science.gov (United States)

    2011-12-12

    ... Collaboration to Improve the Disability Determination Process: Validation of IRT-CAT Tools Summary: Under the... currently valid OMB control number. Proposed Collection: Title: The SSA-NIH Collaboration to Improve...

  14. Resolving Changing Chemical and Physical Properties of SSA Particle Types during Laboratory Phytoplankton Blooms using Online Single Particle Analysis

    Science.gov (United States)

    Sultana, C. M.; Prather, K. A.; Richardson, R.; Wang, X.

    2015-12-01

    Changes in the chemical composition of sea spray aerosols (SSA) can modify their climate-relevant properties. Recent studies have shown a diverse set of distinct SSA particle types, however there are conflicting reports on how and whether biological activity controls the organic fraction and mixing state of SSA. This study leverages an aerosol time-of-flight mass spectrometer to give an accounting of the temporally resolved mixing state of primary SSA (0.4 - 3 µm vacuum aerodynamic diameter), encompassing 97% of particles detected over the course of laboratory phytoplankton blooms. The influence of biological activity on the climate relevant properties of defined particle types is also investigated. Spatial chemical particle heterogeneity and particularly the surface chemical composition of particles are described along with particle type specific water-particle interactions. These online measurements in tandem with chemical composition could give new insight on the link between seawater chemistry, marine aerosols, and climate properties.

  15. Surviving space flight: case study on MELiSSA's CIII nitrifying compartment

    Science.gov (United States)

    Ilgrande, Chiara; Lasseur, Christophe; Mastroleo, Felice; Paille, Christel; Leys, Natalie; Morozova, Julia; Ilyin, Vyacheslav; Clauwaert, Peter; Christiaens, Marlies E. R.; Lindeboom, Ralph E. F.; Vlaeminck, Siegfried; Prat, Delphine; Arroyo, Jose M. C.; Conincx, Ilse; Van Hoey, Olivier; Roume, Hugo; Udert, Kai; Sas, Benedikt

    2016-07-01

    Space synthetic biology offers key opportunities for long-term space missions. Planets mining, terraformation, space medicine and Life Support technologies would all benefit from an integrative biological approach. However, space is a harsh environment for life: microgravity, temperature, UV and cosmic radiation can affect the health and functionality of microorganisms and plants, possibly preventing the optimal performance of the systems. The European Space Agency's Life Support System (MELiSSA) has been developed as a model for future long term Space missions and Space habitation. MELiSSA is a 5 compartment artificial ecosystem with microorganisms and higher, that aims at completely recycling gas, liquid and solid waste. In this study, the survival and functional activity after Lower Earth Orbit conditions of microbial nitrogen conversions, relevant for MELiSSA's CIII compartment, was tested. Synthetic communities containing Nitrosomonas europeae, Nitrosomonas ureae, Nitrobacter winogradskyi, Nitrospira moscoviensis and Cupriavidus pinatubonensis were exposed to the Lower Earth Orbit conditions of the International Space Station (ISS) for 7 days. Nitrosomonas europeae, Nitrobacter winogradskyi, Cupriavidus pinatubonensis, and three mixed communities (a urine nitrification sludge, a sludge containing aerobic ammonia oxidizing bacteria and anammox bacteria (OLAND), and an aquaculture sludge containing ammonia oxidizing archaea) were exposed to Lower Earth Orbit conditions for 44 days. Survival after both space flights was demonstrated because nitritation, nitratation, denitrification and anammox activity could be restored at a rate comparable to ground storage conditions. Our results validate the potential survival feasibility and suggest future space applications for N-related microorganisms.

  16. Substructure within the SSA22 protocluster at $z\\approx3.09$

    CERN Document Server

    Topping, Michael W; Steidel, Charles C

    2016-01-01

    We present the results of a densely sampled spectroscopic survey of the SSA22 protocluster at $z\\approx 3.09$. Our sample with Keck/LRIS spectroscopy includes 106 Ly$\\alpha$ Emitters (LAEs) and 40 Lyman Break Galaxies (LBGs) at $z=3.05-3.12$. These galaxies are contained within the $9'\\times9'$ region in which the protocluster was discovered, which also hosts the maximum galaxy overdensity in the SSA22 region. The redshift histogram of our spectroscopic sample reveals two distinct peaks, at $z=3.069$ (blue, 43 galaxies) and $z=3.095$ (red, 103 galaxies). Furthermore, objects in the blue and red peaks are segregated on the sky, with galaxies in the blue peak concentrating towards the western half of the field. These results suggest that the blue and red redshift peaks represent two distinct structures in physical space. Although the double-peaked redshift histogram is traced in the same manner by LBGs and LAEs, and brighter and fainter galaxies, we find that nine out of 10 X-ray AGNs in SSA22, and all seven sp...

  17. Clinical characteristics of children with positive anti-SSA/SSB antibodies.

    Science.gov (United States)

    Chen, Pei-Hsuan; Yang, Yao-Hsu; Lin, Yu-Tsan; Lee, Jyh-Hong; Wang, Li-Chieh; Yu, Hsin-Hui; Chiang, Bor-Luen

    2014-08-01

    This study aimed to characterize the manifestations of clinical symptoms and signs, primary rheumatic diseases, and other autoantibodies in pediatric patients with positive anti-SSA and/or anti-SSB antibodies. Subjects under age 18 with positive anti-SSA and/or anti-SSB antibodies were screened and enrolled in a tertiary hospital in Taiwan. Data were collected via medical records,including age, gender, onset of the primary rheumatic disease, clinical symptoms and signs, and the medication used. Schirmer test for Sjögren's syndrome (SS) screening was performed in all enrolled patients. Among twenty enrolled subjects, seventeen of them had systemic lupus erythematosus; four of them were diagnosed as SS with positive Schirmer test. In addition to antinuclear antibodies and anti-DNA antibodies, other common autoantibodies were anti-RNP antibodies (50 %) and anti-Sm antibodies(30 %). The most common symptoms were arthritis (60 %)followed by malar rash (40 %). In conclusion, we observed that a low proportion of childhood SS (4/20) exists in our patients with positive SSA and/or anti-SSB antibodies. It is suggested that clinicians should focus more on the clinical symptoms in these patients, rather than undertaking invasive diagnostic interventions to rule out Sjögren's syndrome. PMID:24077977

  18. Rapid assessment of populations trends of invasive species: Singular Spectrum Analysis (SSA

    Directory of Open Access Journals (Sweden)

    DANA, ED

    2010-01-01

    Full Text Available Singular Spectrum Analysis (SSA is a powerful analytical approach for biodi-versity management. Its main advan-tages are due to its intuitive processing and visualization, since mathematical workflow is conceptually similar to the widely accepted Principal Components Analysis. Detailed analyses of popula-tion trends with mathematical tools are often difficult to achieve for managers by a number of reasons (large numbers or areas monitored, large number of species, insufficient statistics skills, strong knowledge level in demographic analyses, etc.. SSA has been used since the 1970’s in signal processing to clarify signal vs. noisy information, but it has also been used in climate change analy-sis and other developmental areas. Be-sides, SSA is a rapid-learning method for technicians and managers with medium level of mathematical knowledge. Free software in Unix environment is avail-able. Unfortunately, no free and friendly software is available for Win-dows SO. Although R package may offer solutions for really advanced users, it does not fit real work situations for managers of biological invasions. Cater-pillar (Gistat Group, Ltd is by now, the best option found by the author in terms of price, facility for results inter-pretation and time consumed in learn-ing. The main disadvantage is the poor content of tutorial files

  19. Participation in global horticulture value chains:Implications for poverty alleviation in the Sub-Saharan Africa (SSA) region

    OpenAIRE

    Afari-Owusu, Elizabeth

    2014-01-01

    There are approximately one billion people predominantly in Asia and sub-Saharan Africa (SSA) who live in extreme poverty because they are adversely linked to the process of globalization and not optimally integrated in global value chains. In the SSA region, agriculture is the main occupation where most of the rural population are employed and earn incomes. The horticulture sector a subset of agriculture is one of the value creating sectors where opportunities exist for the rural population ...

  20. Monte Carlo SSA to detect time-variable seasonal oscillations from GPS-derived site position time series

    Science.gov (United States)

    Xu, Chang; Yue, Dongjie

    2015-12-01

    We explore the capability of singular spectrum analysis (SSA) to extract time-variable seasonal oscillations from continual GPS observations and demonstrate the statistical assessment on the colored noise (in particular the first-order autoregressive AR(1) noise) using Monte Carlo SSA (MCSSA) methodology. We provide example applications to ~ 15-year vertical coordinate time series for 36 globally distributed International GNSS Service (IGS) sites. We find the SSA-filtered seasonal signals can easily pass the confidence interval and hypothesis tests of MCSSA. However, maximum likelihood estimate (MLE) results show that 72% of sites have their flicker noise amplitudes reduced after removing SSA-filtered annual signal, implying that the SSA-filtered seasonal signals may contain an artificial signal driven by colored noise. Therefore, the AR(1) null hypothesis noise model may be misleading in surrogate data tests for GPS seasonal signals. Moreover, comparison between SSA-filtered GPS annual signals and joint geophysical model predictions (non-tidal atmospheric loading + non-tidal ocean loading + hydrological loading) confirms that seasonal signals are resulting from a combination of mass loading and systematic error.

  1. Keratoacanthoma Dan Perawatannya

    OpenAIRE

    Indah Heriyanti

    2008-01-01

    Keratoacanthoma adalah suatu tumor jinak yang berasal dari jaringan epitel dan biasanya di jumpai pada permukaan kulit yang umumnya terjadi pada bagian kulit yang sering terkena sinar matahari dimana tumor ini dapat sembuh dengan spontan. Lesi ini biasanya berawal sebagai makula yang kecil yang berwarna merah dan kemudian menjadi papula yang kokoh dan bersisik pada permukaanya. Papul ini dengan cepat membesar selama 2 sampai 8 minggu. Pada awalnya berbentuk bulat atau oval,kokoh menonjol ...

  2. DEPRESI DAN GANGGUAN TIDUR

    Directory of Open Access Journals (Sweden)

    Wayan Eko Radityo

    2012-12-01

    Full Text Available Depresi merupakan gangguan mood berupa kesedihan yang intens, berlangsung dalamwaktu lama, dan mengganggu kehidupan normal yang insidennya semakin meningkatseiring dengan meningkatnya tekanan hidup. Tahun 2020, depresi diperkirakanmenempati urutan kedua penyakit di dunia. Gejala-gejala depresi terdiri dari gangguanemosi, gangguan kognitif, keluhan somatik, gangguan psikomotor, dan gangguanvegetatif. Salah satu gejala depresi yang muncul adalah gangguan tidur yang bisaberupa insomnia, bangun secara tiba-tiba, dan hipersomnia. Hal ini disebabkan olehgangguan neurotransmiter dan regulasi hormon. Selain sebagai gejala depresi, gangguantidur juga bisa merupakan penyebab depresi. Beberapa penelitian memberikanhubungan gangguan tidur dapat meningkatkan risiko depresi di kemudian hari.

  3. Utilisation and Further Development of Space Science Results in the ESA SSA Programme Space Weather Service Network

    Science.gov (United States)

    Glover, Alexi; Luntama, Juha-Pekka; Keil, Ralf

    2016-04-01

    ESA SSA Programme is approaching the end of its second period. Service development activities within the current period aim at advancing the SSA SWE Service Network from the initial utilisation of existing European assets toward development of these and new assets together with the associated coordination infrastructure necessary to provide consistently reliable services. The SSA SWE Service Network is based on a federated architecture where service provision is carried out by Expert Service Centres in the Programme Member States with overall coordination and helpdesk functions provided by a central node and coordination centre located at the Space Pole in Brussels, Belgium. The SSA SWE Service Network builds on the wealth of space weather expertise available within the Member States, and consequently, as the network continues to develop, emphasis will continue to be placed on building services based on demonstrated space science advances in key areas such as those highlighted by the COSPAR-ILWS Space Weather Roadmap, published in 2015. Activities supported by programmes including the ESA technology programmes, EC FP7 and H2020 have all demonstrated promising results, and the SSA SWE Network is actively investigating their potential application to SSA SWE Customer Requirements, and in many cases already adopting these as part of the suite of products provided via the Network to its registered users. This presentation will provide an overview of recent advances in the SSA SWE Service Network, emphasising the utilisation of scientific results within a pre-operational context. The presentation will show the layout of the federated Expert Service Centres, highlighting ongoing and upcoming service developments and provide a perspective on the service development plans for the next phase of the programme.

  4. The SSB-positive/SSA-negative antibody profile is not associated with key phenotypic features of Sjögren's syndrome

    DEFF Research Database (Denmark)

    Baer, Alan N; McAdams DeMarco, Mara; Shiboski, Stephen C;

    2015-01-01

    established SS, we compared anti-SSA/anti-SSB reactivity profiles against concurrent phenotypic features. We fitted logistic regression models to explore the association between anti-SSA/anti-SSB reactivity profile and each key SS phenotypic feature, controlling for potential confounders. RESULTS: Among 3297...... participants, 2061 (63%) had negative anti-SSA/anti-SSB, 1162 (35%) had anti-SSA with or without anti-SSB, and 74 (2%) anti-SSB alone. Key SS phenotypic features were more prevalent and had measures indicative of greater disease activity in those participants with anti-SSA, either alone or with anti-SSB, than......OBJECTIVE: To determine whether the Sjögren's syndrome B (SSB)-positive/Sjögren's syndrome A (SSA)-negative antibody profile is associated with key phenotypic features of SS. METHODS: Among registrants in the Sjögren's International Collaborative Clinical Alliance (SICCA) with possible or...

  5. Potential use of sewage sludge ash (SSA as a cement replacement in precast concrete blocks

    Directory of Open Access Journals (Sweden)

    Pérez-Carrión, M.

    2014-03-01

    Full Text Available The present study explored the technological feasibility of re-using sewage sludge ash (SSA as a Portland cement replacement in commercially manufactured pre cast concrete blocks. The blocks analysed were made to the guidelines laid down in Spain’s National Plan for Waste Water Treatment Plant Sludge, 2001–2006, and European Union specifications (CE marking for such products. Performance was compared in three families of blocks, with 0, 10 and 20% SSA. The findings proved that SSA is apt for pre cast concrete block manufacture and that, in addition to the economic and environmental benefits afforded, its use would improve certain of the properties of conventional block.El objetivo de esta investigación es estudiar el uso potencial de las cenizas de lodos de depuradora (CLD, como sustitución del cemento Portland en bloques de hormigón prefabricados, de forma que se pueda lograr una revalorización de este material de desecho mediante este procedimiento. La metodología utilizada en este trabajo se rige por las directrices del Plan Nacional Español de Lodos de Aguas Residuales de 2001–2006, y por las exigencias del Consejo Europeo (marcado CE, que es obligatorio para este tipo de productos. Se han utilizado dos niveles de sustitución de cemento (10% y 20%, y todos los resultados han sido referidos a las muestras control. Los resultados obtenidos muestran que es posible utilizar una sustitución parcial del cemento por CLD, en la fabricación de bloques de hormigón prefabricados, y por lo tanto, se pueden conseguir beneficios económicos y ambientales, así como la mejora de una serie de propiedades.

  6. Overview of Human-Centric Space Situational Awareness (SSA) Science and Technology (S&T)

    Science.gov (United States)

    Ianni, J.; Aleva, D.; Ellis, S.

    2012-09-01

    A number of organizations, within the government, industry, and academia, are researching ways to help humans understand and react to events in space. The problem is both helped and complicated by the fact that there are numerous data sources that need to be planned (i.e., tasked), collected, processed, analyzed, and disseminated. A large part of the research is in support of the Joint Space Operational Center (JSpOC), National Air and Space Intelligence Center (NASIC), and similar organizations. Much recent research has been specifically targeting the JSpOC Mission System (JMS) which has provided a unifying software architecture. This paper will first outline areas of science and technology (S&T) related to human-centric space situational awareness (SSA) and space command and control (C2) including: 1. Object visualization - especially data fused from disparate sources. Also satellite catalog visualizations that convey the physical relationships between space objects. 2. Data visualization - improve data trend analysis as in visual analytics and interactive visualization; e.g., satellite anomaly trends over time, space weather visualization, dynamic visualizations 3. Workflow support - human-computer interfaces that encapsulate multiple computer services (i.e., algorithms, programs, applications) into a 4. Command and control - e.g., tools that support course of action (COA) development and selection, tasking for satellites and sensors, etc. 5. Collaboration - improve individuals or teams ability to work with others; e.g., video teleconferencing, shared virtual spaces, file sharing, virtual white-boards, chat, and knowledge search. 6. Hardware/facilities - e.g., optimal layouts for operations centers, ergonomic workstations, immersive displays, interaction technologies, and mobile computing. Secondly we will provide a survey of organizations working these areas and suggest where more attention may be needed. Although no detailed master plan exists for human

  7. Substructure within the SSA22 Protocluster at z≈3.09

    Science.gov (United States)

    Topping, Michael W.; Shapley, Alice E.; Steidel, Charles C.

    2016-06-01

    We present the results of a densely sampled spectroscopic survey of the SSA22 protocluster at z ≈ 3.09. Our sample with Keck/LRIS spectroscopy includes 106 Lyα emitters (LAEs) and 40 Lyman break galaxies (LBGs) at z = 3.05–3.12. These galaxies are contained within the 9‧ × 9‧ region in which the protocluster was discovered, which also hosts the maximum galaxy overdensity in the SSA22 region. The redshift histogram of our spectroscopic sample reveals two distinct peaks, at z = 3.069 (blue; 43 galaxies) and z = 3.095 (red; 103 galaxies). Furthermore, objects in the blue and red peaks are segregated on the sky, with galaxies in the blue peak concentrating toward the western half of the field. These results suggest that the blue and red redshift peaks represent two distinct structures in physical space. Although the double-peaked redshift histogram is traced in the same manner by LBGs and LAEs, and brighter and fainter galaxies, we find that 9 out of 10 X-ray AGNs in SSA22, and all 7 spectroscopically confirmed giant Lyα “blobs,” reside in the red peak. We combine our data set with sparsely sampled spectroscopy from the literature over a significantly wider area, finding preliminary evidence that the double-peaked structure in redshift space extends beyond the region of our dense spectroscopic sampling. In order to fully characterize the three-dimensional structure, dynamics, and evolution of large-scale structure in the SSA22 overdensity, we require the measurement of large samples of LAE and LBG redshifts over a significantly wider area, as well as detailed comparisons with cosmological simulations of massive cluster formation. Based on data obtained at the W.M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California, and the National Aeronautics and Space Administration, and was made possible by the generous financial support of the W.M. Keck Foundation.

  8. Software SSA para a programação multi-local

    OpenAIRE

    Ana I Pereira; Fernandes, Edite M.G.P.

    2008-01-01

    O objectivo da programação multi-local é o de determinar todos os maximizantes globais e eventualmente alguns maximizantes locais de funções multi-modais, ou seja, funções objectivo que possuem maximizantes globais e locais. Neste âmbito, foi desenvolvido o software livre SSA, usando a linguagem C e ligações ao AMPL. Este software permite determinar todos os maximizantes globais e alguns locais que satisfazem determinadas condições. Serão apresentados alguns exemplos.

  9. Fisiologi dan Gangguan Keseimbangan Natrium, Kalium dan Klorida serta Pemeriksaan Laboratorium

    Directory of Open Access Journals (Sweden)

    Rismawati Yaswir

    2012-09-01

    Full Text Available AbstrakElektrolit adalah senyawa di dalam larutan yang berdisosiasi menjadi partikel yang bermuatan (ion positifatau negatif. Sebagian besar proses metabolisme memerlukan dan dipengaruhi oleh elektrolit. Konsentrasielektrolit yang tidak normal dapat menyebabkan banyak gangguan. Pemeliharaan tekanan osmotik dan distribusibeberapa kompartemen cairan tubuh manusia adalah fungsi utama empat elektrolit mayor, yaitu natrium (Na+,kalium (K+, klorida (Cl-, dan bikarbonat (HCO3-. Pemeriksaan keempat elektrolit mayor tersebut dalam klinisdikenal sebagai ”profil elektrolit. Natrium adalah kation terbanyak dalam cairan ekstrasel, kalium kation terbanyakdalam cairan intrasel dan klorida merupakan anion terbanyak dalam cairan ekstrasel. Jumlah natrium, kalium danklorida dalam tubuh merupakan cermin keseimbangan antara yang masuk terutama dari saluran cerna dan yangkeluar terutama melalui ginjal. Gangguan keseimbangan natrium, kalium dan klorida berupa hipo- dan hiper-. Hipoterjadibila konsentrasi elektrolit tersebut dalam tubuh turun lebih dari beberapa miliekuivalen dibawah nilai normaldan hiper- bila konsentrasinya meningkat diatas normal.Pemeriksaan laboratorium untuk menentukan kadarnatrium, kalium dan klorida adalah dengan metode elektroda ion selektif, spektrofotometer emisi nyala,spektrofotometer atom serapan, spektrofotometri berdasarkan aktivasi enzim, pemeriksaan kadar klorida denganmetode titrasi merkurimeter, dan pemeriksaan kadar klorida dengan metode titrasi kolorimetrik-amperometrik.Kata kunci: elektrolit, keseimbangan, gangguan keseimbanganAbstractElectrolyte is compound in condensation which is disociation become particle which is charged (ionnegative or positive. Most metabolism processes need and influenced by electrolyte. Electrolyte concentrationwhich abnormal can cause many troubles. Conservancy of osmotic pressure and distribution some human beingbody fluid compartment are especial function four major electrolyte, that is natrium (Na

  10. Characterizing the Space Debris Environment with a Variety of SSA Sensors

    Science.gov (United States)

    Stansbery, Eugene G.

    2010-01-01

    Damaging space debris spans a wide range of sizes and altitudes. Therefore no single method or sensor can fully characterize the space debris environment. Space debris researchers use a variety of radars and optical telescopes to characterize the space debris environment in terms of number, altitude, and inclination distributions. Some sensors, such as phased array radars, are designed to search a large volume of the sky and can be instrumental in detecting new breakups and cataloging and precise tracking of relatively large debris. For smaller debris sizes more sensitivity is needed which can be provided, in part, by large antenna gains. Larger antenna gains, however, produce smaller fields of view. Statistical measurements of the debris environment with less precise orbital parameters result. At higher altitudes, optical telescopes become the more sensitive instrument and present their own measurement difficulties. Space Situational Awareness, or SSA, is concerned with more than the number and orbits of satellites. SSA also seeks to understand such parameters as the function, shape, and composition of operational satellites. Similarly, debris researchers are seeking to characterize similar parameters for space debris to improve our knowledge of the risks debris poses to operational satellites as well as determine sources of debris for future mitigation. This paper will discuss different sensor and sensor types and the role that each plays in fully characterizing the space debris environment.

  11. Advantageous use of SSA technique to observe effects of thickness, antioxidant and oxygen in gamma irradiated low density polyethylene

    Energy Technology Data Exchange (ETDEWEB)

    Perez, C.J., E-mail: cjperez@fi.mdp.edu.ar [Research Institute of Material Science and Technology (INTEMA), National Research Council (CONICET), Engineering Faculty, Mar del Plata University, Av. J.B. Justo 4302, 7600 Mar del Plata (Argentina); Failla, M.D. [Planta Piloto de Ingenieria Quimica-PLAPIQUI (UNS-CONICET), Camino ' La Carrindanga' Km 7, 8000 Bahia Blanca (Argentina); Carella, J.M. [Research Institute of Material Science and Technology (INTEMA), National Research Council (CONICET), Engineering Faculty, Mar del Plata University, Av. J.B. Justo 4302, 7600 Mar del Plata (Argentina)

    2012-06-20

    Highlights: Black-Right-Pointing-Pointer Information from successive self-nucleation and annealing technique is analyzed. Black-Right-Pointing-Pointer Oxygen and antioxidants reduce crosslinking efficiency by reaction with free radicals. Black-Right-Pointing-Pointer Recognizable differences are obtained in samples irradiated at different atmospheres. - Abstract: Information obtained from successive self-nucleation and annealing (SSA) technique is analyzed, paying special attention to the observable effects of samples thickness and antioxidant and oxygen concentrations. Molecular structure changes for low density polyethylene (LDPE) samples, irradiated under three different atmospheres for doses between 33 and 222 kGy were analyzed, with emphasis on the changes of longer polymethylene crystallizable lengths. Antioxidant and oxygen concentrations were varied for samples of different thickness to study the effects on degradation. The changes in the molecular structure were followed simultaneously by SSA and Infrared spectroscopy (FTIR) via carbonyl group concentration. Preliminary quantifications of the SSA technique sensitivity are also advanced.

  12. Penyebab dan Penangannan Halotosis

    OpenAIRE

    Irmadani Anwar, Ayub

    2007-01-01

    Halitosis adau bau mulut adalah masalah kesehatan gigi dan mulut yang banyak dikeluhkan. Akibat yang dapat ditimbulkan oleh halitosis dapat bersifat psikososial seperti malu atau rendah diri, menghindari pergaulan, tidak bebas bicara, tidak ada rasa percaya diri.

  13. Ductal constriction during dexamethasone treatment in an anti-SSA-antibody-exposed fetus with signs of myocardial inflammation.

    Science.gov (United States)

    Talemal, Lauren; Olivieri, Laura; Krishnan, Anita

    2016-06-01

    This report describes the clinical course and multi-modality imaging findings in an anti-SSA-antibody-exposed fetus with suspected myocardial inflammation. Postnatal cardiac MRI - using fast acquisition, free-breathing with feed-and-swaddle technique - was used to evaluate for myocardial fibrosis/inflammation. This is the first published report, to our knowledge, of ductal constriction temporally associated with oral dexamethasone therapy in an anti-SSA-antibody-exposed fetus and of the use of this unique postnatal MRI protocol in this setting. PMID:27087593

  14. Dan Performer Mei Lanfang

    DEFF Research Database (Denmark)

    Risum, Janne

    The convention of performing female characters (dan characters) in Beijing opera, as practised by its most prominent male performer of female characters Mei Lanfang, and its and his cultural context and aesthetic aim......The convention of performing female characters (dan characters) in Beijing opera, as practised by its most prominent male performer of female characters Mei Lanfang, and its and his cultural context and aesthetic aim...

  15. 78 FR 48170 - Privacy Act of 1974; CMS Computer Match No. 2013-12; HHS Computer Match No. 1307; SSA Computer...

    Science.gov (United States)

    2013-08-07

    ..., published at 78 FR 8538 (Feb. 6, 2013) and 78 FR 32256 (May 29, 2013). The matching program will also be... Applications, SSA/ OEEAS, 60-0058, 75 FR 82121 (December 29, 2010), as amended 78 FR 40542 (July 5, 2013); Prisoner Update Processing System (PUPS), SSA/OPB, 60- 0269, 64 FR 11076 (March 8, 1999), as amended 72...

  16. Pembuatan Dan Karakterisasi Aspal Beton Berbasis Dreg Dan Grit

    OpenAIRE

    Newdesnetty Butarbutar

    2009-01-01

    Telah dilakukan penelitian tentang pembuatan dan karakterisasi aspal beton berbasis dreg dan grit. Penelitian ini dilakukan dengan metode pengadukan dengan menggunakan mixer beton, tujuan untuk memperoleh bahan aspal beton dari dreg dan grit untuk mengurangi volume pasir dengan variasi rasio pasir terhadap dreg dan grit adalah: 100 : 0 : 0; 90 : 5 : 5; 80 : 10 : 10; 70 : 15 : 15; 60 : 20 : 20; 50 : 25 : 25; 40 : 30 : 3; 30 : 35 : 35; 20 : 40 : 40; 10 : 45 : 45; 0 : 50 : 5...

  17. SISTEM BERBASIS PENGETAHUAN UNTUK KESEHATAN DAN PERAWATAN GIGI DAN MULUT

    OpenAIRE

    I Wayan Shandyasa

    2011-01-01

    Sistem berbasis pengetahuan untuk kesehatan dan perawatan gigi dan mulut ini merupakan sistem yang menghadirkan solusi penyakit dalam mengatasi masalah kesehatan gigi memberikan informasi perawatan untuk setiap masalah penyakit yang dihadapi. Sistem ini menyediakan fasilitas diagnosa penyakit untuk mengidentifikasi masalah kesehatan yang sedang dihadapi. Proses identifikasi dilakukan melalui interaksi tanya jawab antar sistem dengan user dan penginputan gejala penyakit. Metode penelusuran kes...

  18. PREFERENSI PEMBIAYAAN USAHA MIKRO DAN KECIL : PERSPEKTIF GENDER DAN ENTREPRENEURABILITY

    Directory of Open Access Journals (Sweden)

    Khaira Amalia Fachrudin

    2013-06-01

    Full Text Available Preferensi pembiayaan dalam perusahaan besar lebih didasarkan pada karakteristik perusahaan tersebut.  Namun dalam usaha mikro dan kecil hal ini mungkin berbeda dan bergantung pada karakteristik pemiliknya seperti gender dan entrepreneurability.   Perbedaan gender mungkin juga membedakan entrepreneurability dan dukungan yang diterima.  Penelitian ini akan menguji apakah terdapat perbedaan preferensi pembiayaan berdasarkan gender, entrepreneurability berdasarkan gender dan berdasarkan preferensi pembiayaan, serta perbedaan dukungan berdasarkan gender.  Sampel dari usaha mikro dan kecil yang bergerak dalam bidang kuliner  diuji dengan uji beda Independent Sample t Test dan kemudian dengan Crosstabulation untuk lebih memperinci hasilnya.  Hasil uji menunjukkan bahwa tidak terdapat perbedaan yang signifikan preferensi pembiayaan berdasarkan gender dan berdasarkan  entrepreneurability, namun entrepreneurability berbeda signifikan berdasarkan gender dan juga ditemukan bahwa dukungan moral, tenaga, dan modal yang diterima pemilik usaha pria dan wanita tidak berbeda signifikan (p value lebih kecil dari 0.05.   Hasil ini menunjukkan bahwa terdapat kesetaraan gender dalam pembiayaan usaha dan entrepreneurability lebih tinggi pada pria.  Pria pemilik usaha juga mendapatkan dukungan tenaga kerja yang lebih banyak daripada wanita.  Dukungan tenaga ini adalah salah satu bentuk  financial bootstrapping karena dapat mengurangi pembiayaan usaha

  19. WHIRL SSA: a New Optimization Infrastructure Based on High-level Intermediate Representation%WHIRL SSA:一种基于高级中间表示的优化结构

    Institute of Scientific and Technical Information of China (English)

    杨克峤; 李健; 胡益斌; 许铝才

    2012-01-01

    中间表示对编译器的性能、效率和可扩展性都起着决定性作用.0pen64编译器采用一种树型结构的中间表示WHIRL,能表示各种高级控制流结构,但不能显式的提供数据流信息.本文基于WHIRL对SSA(Static Single Assignment)进行扩展,提出了一个新的优化结构WHIRL SSA.WHIRL SSA通过将SSA信息标注在WHIRL节点上,显式的为数据流分析提供使用-定义(UD)信息.相比于传统的数据流信息构建方法,WHIRL SSA提供了更精确、有效的数据流信息.本文讨论了WHIRL SSA的设计与实现和基于WHIRL SSA的优化.%Intermediate Representation is a determining factor of the capability, efficiency, and scalability of compiler optimizations. WHIRL, the Intermediate Representation (IR) of Open64 compiler, is a tree-form IR. While capable of describing various high-level control flow structures, WHIRL IR doesn't provide explicit UD information. This paper presents an extension of Static Single Assignment (SSA) infrastructure to WHIRL. Compared to traditional DU manager, the WHIRL SSA provides more efficiently and precisely data flow information. The paper describes the design and implementation of the WHIRL SSA, and discusses its applications and future work.

  20. Infeksi Cacing dan Alergi

    Directory of Open Access Journals (Sweden)

    Selfi Renita Rusdji

    2015-01-01

    Full Text Available AbstrakInfeksi cacing masih merupakan masalah kesehatan di Indonesia dan negara berkembang lainnya. Penyakit ini sering terjadi di daerah dengan higienisitas dan sanitasi yang masih kurang. Respon imun tubuh host terhadap cacing ini mirip dengan respon tubuh terhadap penyakit alergi. Respon pada penyakit kecacingan dan alergi ini merupakan respon Thelper2 yaitu diferensiasi dan polariasasi sel limfosit T lebih dominan pada Th2. Pada kenyataannya, ditinjau dari segi epidemiologi, penyakit kecacingan dan penyakit alergi terdapat pada daerah yang sangat berbeda. Prevalensi penyakit alergi cenderung lebih banyak terjadi di daerah maju dengan higiene dan sanitasi yang baik. Keadaan ini menimbulkan pertanyaan apakah kecacingan mempunyai efek proteksi terhadap manifestasi klinis berbagai macam penyakit alergi. Hygiene hypothesis merupakan teori yang relevan dalam menjawab pertanyaan ini. Mekanisme yang dapat menerangkan fenomena ada adalah saturasi sel mast, penghambatan oleh IgG4 dan modified Th2 response.Kata kunci: infeksi cacing, alergi, respon Th2AbstractHelminthiasis is still unsolved problem in Indonesia and other developing countries. This disease is frequently occurred in poor personal hygiene and environmental sanitation. The human immune response to helminth infections is similar with response to allergic disease. These disease present T helper2 (Th2 response which characterized dominant differentiation and proliferation of Th2. In fact, epidemiology study shows that they are occurred in different type of region. High prevalence of allergic disease is found in modern country which is well established sanitation and good personal hygiene. This condition raises fundamental question whether helminthiasis is associated with protection against allergic disease. Hygiene hypothesis is a theory that can explain this phenomen. The mechanisms are mast cell saturation, IgG4 blocking and modified Th2.Keywords: helminthiasis, allergy, Th2 response

  1. 75 FR 18251 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Internal Revenue Service (IRS...

    Science.gov (United States)

    2010-04-09

    ..., published at 73 FR 13302 (March 12, 2008), using the same extract as the Disclosure of Information to... File) system of records, SSA/ORSIS 60-0321, originally published at 69 FR 77816 (December 28, 2004), and as revised at 71 FR 42159 (July 25, 2006). IRS extracts return information with respect...

  2. 20 CFR 411.321 - Under what conditions will SSA terminate an agreement with an EN due to inadequate performance?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Under what conditions will SSA terminate an agreement with an EN due to inadequate performance? 411.321 Section 411.321 Employees' Benefits SOCIAL SECURITY ADMINISTRATION THE TICKET TO WORK AND SELF-SUFFICIENCY PROGRAM Employment Networks § 411.321...

  3. 78 FR 37647 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Railroad Retirement Board (RRB...

    Science.gov (United States)

    2013-06-21

    ... Retirement, Survivor, and Pensioner Benefits System, last published on July 26, 2012 (75 FR 43727). We will... Veterans Benefits, SSA/ODSSIS, 60-0103, last published on January 11, 2006 (71 FR 1830). SVB data also... amended. Kirsten J. Moncada, Executive Director, Office of Privacy and Disclosure, Office of the...

  4. Diketene-based neat four-component synthesis of the dihydropyrimidinones and dihydropyridine backbones using silica sulfuric acid (SSA)

    Institute of Scientific and Technical Information of China (English)

    Sadegh Rostamnia; Kamran Lamei

    2012-01-01

    Heterocyclic skeleton building blocks to afford dihydropyrimidinones and dihydropyridines based on neat adducts of diketene,alcohols and aldehydes via silica sulfuric acid (SSA) catalyzed ring opening of diketene in four-c6mponent Biginelli-type and Hantzsch-type reactions are presented.

  5. 78 FR 40541 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA)-Match Number 1014

    Science.gov (United States)

    2013-07-05

    ... From the Federal Register Online via the Government Publishing Office SOCIAL SECURITY ADMINISTRATION Privacy Act of 1974, as Amended; Computer Matching Program (SSA)--Match Number 1014 AGENCY: Social... Management and Budget (OMB). The matching program will be effective as indicated below. ADDRESSES:...

  6. Toxicology Selective Toxicity dan Test

    OpenAIRE

    Mansyur

    2002-01-01

    Toxicology adalah pemahaman-pemahaman mengenai effek-effek bahan kimia yang merugikan bagi organisme. Dari definisi tersebut, jelas terdapat unsur-unsur bahan kimia dan organisme, dimana didalam kedua unsur-unsur ini terdapat istilah-istilah toksisitas dan animal test-test. Tulisan ini bermaskud membicarakan mengenai selective toxicity dan animal toxicity tetst. kedokteran-mansyur5

  7. Dan Johnson the mentor

    Science.gov (United States)

    McKinley, Richard

    2003-04-01

    I first met Dan Johnson in early 1975 as I was interviewing for an engineering job with Henning von Gierke's bioengineering and bionics laboratory at Wright-Patterson Air Force Base. From the very beginning Dan was always direct and forthright. Over the ensuing next 27 years my knowledge and respect of Dan constantly grew. This presentation will review Dan's technical and personal contributions while at the laboratory at Wright-Patterson Air Force Base. He was instrumental in the development of a national noise exposure criteria with the equal-energy-rule, an accurate single number hearing protector attenuation measure based on ``C-A,'' an impulse noise exposure criteria, a longitudinal study of hearing loss in children, development of noise dosimeters, and description of hearing damage risk from nonoccupational noise exposures such as disco's, bowling alleys, lawn mowers, and school buses. Dan has had a significant effect on my career. I and the many people who knew him at the laboratory miss him greatly.

  8. DanRIS

    DEFF Research Database (Denmark)

    Skou, Carl Verner

    2009-01-01

    Windows 2000/XP/Vista platform computerprogram til DanRIS indberetning baseret på indskrivning af klienter på CPR, klientsforløb, faseforløb, ASI EuropASI composite score beregninger. Udgave: 2.1.0.5 Udgivelsesdato: 01-01-2009......Windows 2000/XP/Vista platform computerprogram til DanRIS indberetning baseret på indskrivning af klienter på CPR, klientsforløb, faseforløb, ASI EuropASI composite score beregninger. Udgave: 2.1.0.5 Udgivelsesdato: 01-01-2009...

  9. Kondisi oral higiene dan karies gigi pada vegetarian dan non vegetarian di Maha Vihara Maitreya Medan

    OpenAIRE

    Prawira, Albert

    2011-01-01

    Perbedaan pola makan antara vegetarian dan non vegetarian dapat mempengaruhi kesehatan gigi dan mulut. Tujuan penelitian adalah untuk mengetahui kondisi oral higiene dan karies gigi pada umat vegetarian dan non vegetarian di Maha Vihara Maitreya Medan. Jenis penelitian adalah survei deskriptif. Sampel terdiri atas 74 vegetarian dan 65 non vegetarian. Pemeriksaan oral higiene dan karies gigi masing-masing menggunakan indeks OHIS Greene dan Vermillion dan indeks DMFT Klein, se...

  10. Parameterization of single-scattering albedo (SSA) and absorption Ångström exponent (AAE) with EC / OC for aerosol emissions from biomass burning

    Science.gov (United States)

    Pokhrel, Rudra P.; Wagner, Nick L.; Langridge, Justin M.; Lack, Daniel A.; Jayarathne, Thilina; Stone, Elizabeth A.; Stockwell, Chelsea E.; Yokelson, Robert J.; Murphy, Shane M.

    2016-08-01

    Single-scattering albedo (SSA) and absorption Ångström exponent (AAE) are two critical parameters in determining the impact of absorbing aerosol on the Earth's radiative balance. Aerosol emitted by biomass burning represent a significant fraction of absorbing aerosol globally, but it remains difficult to accurately predict SSA and AAE for biomass burning aerosol. Black carbon (BC), brown carbon (BrC), and non-absorbing coatings all make substantial contributions to the absorption coefficient of biomass burning aerosol. SSA and AAE cannot be directly predicted based on fuel type because they depend strongly on burn conditions. It has been suggested that SSA can be effectively parameterized via the modified combustion efficiency (MCE) of a biomass burning event and that this would be useful because emission factors for CO and CO2, from which MCE can be calculated, are available for a large number of fuels. Here we demonstrate, with data from the FLAME-4 experiment, that for a wide variety of globally relevant biomass fuels, over a range of combustion conditions, parameterizations of SSA and AAE based on the elemental carbon (EC) to organic carbon (OC) mass ratio are quantitatively superior to parameterizations based on MCE. We show that the EC / OC ratio and the ratio of EC / (EC + OC) both have significantly better correlations with SSA than MCE. Furthermore, the relationship of EC / (EC + OC) with SSA is linear. These improved parameterizations are significant because, similar to MCE, emission factors for EC (or black carbon) and OC are available for a wide range of biomass fuels. Fitting SSA with MCE yields correlation coefficients (Pearson's r) of ˜ 0.65 at the visible wavelengths of 405, 532, and 660 nm while fitting SSA with EC / OC or EC / (EC + OC) yields a Pearson's r of 0.94-0.97 at these same wavelengths. The strong correlation coefficient at 405 nm (r = 0.97) suggests that parameterizations based on EC / OC or EC / (EC + OC) have good predictive

  11. Pengembangan Potensi dan Pemanfaatan Bambu Sebagai Bahan Baku Konstruksi dan Industri di Sulawesi Selatan

    OpenAIRE

    Muin, Musrizal; Suhasman; Oka, Ngakan Putu; Putranto, Beta; Baharuddin; Millang, Syamsuddin

    2006-01-01

    Penelitian "Pengembangan Potensi dan Pemanfaatan Bambu Sebagai Bahan Baku Konstruksi dan Industri di Sulawesi Selatan" ini diperlukan untuk menunjang program-program pembangunan dan menignkatkan kesejahteraan masyarakat di Sulawesi Selatan. Secara khusus, penenlitian ini bertujuan untuk: (1) mengetahui potensi, letak, luas, sebaran, dan produktivitas tegakan bambu; (2) mengetahui pemanfaatan dan teknologi pengolahan bambu; (3) mengetahui keberadaan dan peran lembaga yang terkait dengan pengel...

  12. Observer Interface Analysis for Standardization to a Cloud Based Real-Time Space Situational Awareness (SSA)

    Science.gov (United States)

    Eilers, J.

    2013-09-01

    The interface analysis from an observer of space objects makes a standard necessary. This standardized dataset serves as input for a cloud based service, which aimed for a near real-time Space Situational Awareness (SSA) system. The system contains all advantages of a cloud based solution, like redundancy, scalability and an easy way to distribute information. For the standard based on the interface analysis of the observer, the information can be separated in three parts. One part is the information about the observer e.g. a ground station. The next part is the information about the sensors that are used by the observer. And the last part is the data from the detected object. Backbone of the SSA System is the cloud based service which includes the consistency check for the observed objects, a database for the objects, the algorithms and analysis as well as the visualization of the results. This paper also provides an approximation of the needed computational power, data storage and a financial approach to deliver this service to a broad community. In this context cloud means, neither the user nor the observer has to think about the infrastructure of the calculation environment. The decision if the IT-infrastructure will be built by a conglomerate of different nations or rented on the marked should be based on an efficiency analysis. Also combinations are possible like starting on a rented cloud and then go to a private cloud owned by the government. One of the advantages of a cloud solution is the scalability. There are about 3000 satellites in space, 900 of them are active, and in total there are about ~17.000 detected space objects orbiting earth. But for the computation it is not a N(active) to N problem it is more N(active) to N(apo peri) quantity of N(all). Instead of 15.3 million possible collisions to calculate a computation of only approx. 2.3 million possible collisions must be done. In general, this Space Situational Awareness System can be used as a

  13. MODAL MANUSIA DAN PRODUKTIVITAS

    Directory of Open Access Journals (Sweden)

    Erlinda Puspita Sari

    2014-03-01

    Full Text Available Modal manusia dianggap sebagai salah satu faktor penentu produktivitas. Modal manusia merupakan dimensi kualitatif dari sumberdaya manusia, seperti keahlian dan keterampilan, yang akan memengaruhi kemampuan produktif manusia tersebut. Dimensi kualitatif tersebut diperoleh melalui pendidikan, pelatihan dan kesehatan. Penelitian ini bertujuan untuk menganaliss efek dari modal manusia terhadap tingkat produktivitas di provinsi-provinsi di Indonesia. Dalam penelitian ini, tingkat pendidikan diukur dengan beberapa indikator, yaitu; angka melek huruf dan angka partisipasi murni tingkat SD, SMP maupun SMA. Tingkat kesehatan diukur dengan angka kematian bayi. Data yang digunakan adalah data panel dari 25 provinsi di Indonesia selama perioede 1996-2010 yang dianalisis dengan menggunakan Model Panel Data Fixed Effect. Hasil analisis menunjukkan bahwa modal manusia yang diukur dari tingkat pendidikan (APM dan tingkat kesehatan (AKB merupakan faktor yang berpengaruh dan signifikan untuk menjelaskan variasi produktivitas meskipun magnitude-nya lebih kecil dibandingkan dengan modal fisik. Hasil analisis juga menunjukkan bahwa variabel pendidikan memiliki magnitude yang lebih besar dibandingkan dengan variabel kesehatan. Human capital is regarded as one of the determining factors of productivity. Human capital is qualitative dimension of human resource which includes skills and knowledge. These qualitative dimensions are internalized through education, training and health. This study aimed to analyze the effect of human capital on productivity level across provinces in Indonesia. In this study, the level of education was measured by literacy and school enrollment rate (in primary, secondary and high school. The level of health was measured by infant mortality rate. The study employed a panel data of 25 provinces in Indonesia during the period of 1996-2010. Using fixed effect method, the result showed that secondary school enrollment rate and infant mortality

  14. Dislocations and elementary processes of plasticity in FCC metals: atomic scale simulations; Dislocations et processus elementaires de la plasticite dans les metaux CFC: apports des simulations a l'echelle atomique

    Energy Technology Data Exchange (ETDEWEB)

    Rodney, D

    2000-07-01

    We present atomic-scale simulations of two elementary processes of FCC crystal plasticity. The first study consists in the simulation by molecular dynamics, in a nickel crystal, of the interactions between an edge dislocation and glissile interstitial loops of the type that form under irradiation in displacement cascades. The simulations show various atomic-scale interaction processes leading to the absorption and drag of the loops by the dislocation. These reactions certainly contribute to the formation of the 'clear bands' observed in deformed irradiated materials. The simulations also allow to study quantitatively the role of the glissile loops in irradiation hardening. In particular, dislocation unpinning stresses for certain pinning mechanisms are evaluated from the simulations. The second study consists first in the generalization in three dimensions of the quasi-continuum method (QCM), a multi-scale simulation method which couples atomistic techniques and the finite element method. In the QCM, regions close to dislocation cores are simulated at the atomic-scale while the rest of the crystal is simulated with a lower resolution by means of a discretization of the displacement fields using the finite element method. The QCM is then tested on the simulation of the formation and breaking of dislocation junctions in an aluminum crystal. Comparison of the simulations with an elastic model of dislocation junctions shows that the structure and strength of the junctions are dominated by elastic line tension effects, as is assumed in classical theories. (author)

  15. Hazard Analysis for the Mark III Space Suit Assembly (SSA) Used in One-g Operations

    Science.gov (United States)

    Mitchell, Kate; Ross, Amy; Blanco, Raul; Wood, Art

    2012-01-01

    This Hazard Analysis document encompasses the Mark III Space Suit Assembly (SSA) and associated ancillary equipment. It has been prepared using JSC17773, "Preparing Hazard Analyses for JSC Ground Operation", as a guide. The purpose of this document is to present the potential hazards involved in ground (23 % maximum O2, One-g) operations of the Mark III and associated ancillary support equipment system. The hazards listed in this document are specific to suit operations only; each supporting facility (Bldg. 9, etc.) is responsible for test specific Hazard Analyses. A "hazard" is defined as any condition that has the potential for harming personnel or equipment. This analysis was performed to document the safety aspects associated with manned use of the Mark III for pressurized and unpressurized ambient, ground-based, One-g human testing. The hazards identified herein represent generic hazards inherent to all standard JSC test venues for nominal ground test configurations. Non-standard test venues or test specific configurations may warrant consideration of additional hazards analysis prior to test. The cognizant suit engineer is responsible for the safety of the astronaut/test subject, space suit, and suit support personnel. The test requester, for the test supported by the suit test engineer and suited subject, is responsible for overall safety and any necessary Test Readiness Reviews (TRR).

  16. Viable Biomass Sensor integration in the MELiSSA CI and CIII compartments

    Science.gov (United States)

    Duatis Juarez, Jordi; Peiro, Enrique; Bragos, Ramon

    Traditionally, the biomass quantity and quality in complex substrate reactor (e.g. activated sludge, high density, fixed bed,..) is determined off-line in laboratories. Within this study, the VIAMASS Sensor System, which uses Electrical Impedance Spectroscopy (EIS) techniques, has been tested for MELiSSA compartment CI and C III, the liquefying and the nitrifying compartment respectively. This sensor is able to measure viable cells on basis of an impedance spectroscopy measurement. The fact that viable biomass can be detected, distinguishes the sensor from classical biomass sensors used in wastewater treatment plants. Detection of viable biomass and composition of the biomass can be very useful for calibration and validation of biological models. The sensor can be used to detect toxicity in system leading to die-off of organisms. The technology developed initially for space applications has been adapted and will be also able to give overall information on the population distribution of cells, distinguishing what type of biomass is dominant (for example, bacteria or protozoa).

  17. BOREAS AFM-1 NOAA/ATDD Long-EZ Aircraft Flux data Over the SSA

    Science.gov (United States)

    Crawford, Timothy L.; Baldocchi, Dennis; Hall, Forrest G. (Editor); Knapp, David E. (Editor); Gunter, Laureen; Dumas, Ed; Smith, David E. (Technical Monitor)

    2000-01-01

    This data set contains measurements from the Airborne Flux and Meteorology (AFM)-1 National Oceanographic and Atmospheric Administration/Atmospheric Turbulence and Diffusion Division (NOAA/ATDD) Long-EZ Aircraft collected during the 1994 Intensive Field Campaigns (IFCs) at the southern study area (SSA). These measurements were made from various instruments mounted on the aircraft. The data that were collected include aircraft altitude, wind direction, wind speed, air temperature, potential temperature, water mixing ratio, U and V components of wind velocity, static pressure, surface radiative temperature, downwelling and upwelling total radiation, downwelling and upwelling longwave radiation, net radiation, downwelling and upwelling photosynthectically active radiation (PAR), greenness index, CO2 concentration, O3 concentration, and CH4 concentration. There are also various columns that indicate the standard deviation, skewness, kurtosis, and trend of some of these data. The data are stored in tabular ASCII files. The NOAA/ATDD Long-EZ aircraft flux data are available from the Earth Observing System Data and Information System (EOSDIS) Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC). The data files are available on a CD-ROM (see document number 20010000884).

  18. SPITZER OBSERVATIONS OF EXTENDED LYMAN-α CLOUDS IN THE SSA22 FIELD

    International Nuclear Information System (INIS)

    We present the results of a Spitzer IRAC and MIPS 24 μm study of extended Lyman-α clouds (or Lyman-α Blobs, LABs) within the SSA22 filamentary structure at z = 3.09. We detect 6/26 LABs in all IRAC filters, four of which are also detected at 24 μm, and find good correspondence with the 850 μm measurements of Geach et al. An analysis of the rest-frame ultraviolet, optical, near- and mid-infrared colors reveals that these six systems exhibit signs of nuclear activity (active galactic nucleus (AGN)) and/or extreme star formation. Notably, they have properties that bridge galaxies dominated by star formation (Lyman-break galaxies (LBGs)) and those with AGNs (LBGs classified as QSOs). The LAB systems not detected in all four IRAC bands, on the other hand, are, as a group, consistent with pure star-forming systems, similar to the majority of the LBGs within the filament. These results indicate that the galaxies within LABs do not comprise a homogeneous population, though they are also consistent with scenarios in which the gas halos are ionized through a common mechanism such as galaxy-scale winds driven by the galaxies within them, or gravitational heating of the collapsing cloud itself.

  19. Kitab kuning dan perempuan, perempuan dan kitab kuning

    OpenAIRE

    Bruinessen, M.M. van

    2007-01-01

    Kitab Kuning dan Emansipasi Perempuan: Konflik Budaya? Pengamatan-pengamatan Masdar mengenai kedudukan perempuan dalam diskursus (wacana, bahasan) dominan kitab kuning terasa tidak enak didengar tetapi memang sulit dibantah. Baik dalam penggunaan bahasa (yang sangat memihak kepada jenis mudzakkar) maupun pilihan aspek kehidupan perempuan yang dijadikan pokok bahasan kitab-kitab fiqh, terdapat bias yang begitu dalam dan transparan. Tolok ukur untuk segala hal ialah laki-laki, dan perbedaan ant...

  20. Simulation of the MELiSSA closed loop system as a tool to define its integration strategy

    Science.gov (United States)

    Poughon, Laurent; Farges, Berangere; Dussap, Claude-Gilles; Godia, Francesc; Lasseur, Christophe

    Inspired from a terrestrial ecosystem, MELiSSA (Micro Ecological Life Support System Alternative) is a project of closed life support system future long-term manned missions (Moon and Mars bases). Started on ESA in 1989, this 5 compartments concept has evolved following a mechanistic engineering approach for acquiring both theoretical and technical knowledge. In its current state of development the project can now start to demonstrate the MELiSSA loop concept at a pilot scale. Thus an integration strategy for a MELiSSA Pilot Plant (MPP) was defined, describing the different phases for tests and connections between compartments. The integration steps should be started in 2008 and be completed with a complete operational loop in 2015, which final objective is to achieve a closed liquid and gas loop with 100 Although the integration logic could start with the most advanced processes in terms of knowledge and hardware development, this logic needs to be completed by high politic of simulation. Thanks to this simulation exercise, the effective demonstrations of each independent process and its progressive coupling with others will be performed in operational conditions as close as possible to the final configuration. The theoretical approach described in this paper is based on mass balance models of each of the MELiSSA biological compartments which are used to simulate each integration step and the complete MPP loop itself. These simulations will help to identify criticalities of each integration steps and to check the consistencies between objectives, flows, recycling efficiencies and sizing of the pilot reactors. A MPP scenario compatible with the current knowledge of the operation of the pilot reactors was investigated and the theoretical performances of the system compared to the objectives of the MPP. From this scenario the most important milestone steps in the integration are highlighted and their behaviour can be simulated.

  1. Autoantibodies from mice exposed to Libby amphibole asbestos bind SSA/Ro52-enriched apoptotic blebs of murine macrophages

    International Nuclear Information System (INIS)

    Asbestos exposure is associated with increased autoimmune responses in humans. For example, in Libby, MT where significant asbestos exposure has occurred due to an asbestos-contaminated vermiculite mine near the community, residents have developed increased autoimmune responses compared to an unexposed population. However, the exact mechanism by which Libby amphibole asbestos generates autoimmune responses is unclear. A murine model of amphibole asbestos-induced autoimmunity was recently established, and one of the targets of the autoantibodies (AAs) was the SSA/Ro52 autoantigen. The purpose of this study was to determine whether the SSA/Ro52 autoantigen is exposed at the surface of cells as a result of asbestos exposure as a possible mechanism leading to antigenicity. Our results indicate that Libby asbestos induces apoptosis in murine macrophages as determined by phosphatidylserine exposure, cleavage of poly(ADP-ribose) polymerase and morphological changes such as nuclear condensation. Moreover, asbestos-induced apoptosis results in the formation of apoptotic cell surface blebs enriched in SSA/Ro52 as determined by confocal microscopy. Most importantly, apoptotic cell surface blebs are recognized by AAs from mice exposed to amphibole asbestos suggesting that these cell surface structures may be antigenic when presented in a pro-inflammatory context. This study supports the hypothesis that the induction of apoptosis plays a key role in environmentally induced autoimmunity through cell surface exposure of a known autoantigen

  2. Atrioventricular Conduction Delay in Fetuses Exposed to Anti-SSA/Ro and Anti-SSB/La Antibodies: A Magnetocardiography Study

    Directory of Open Access Journals (Sweden)

    Annette Wacker-Gußmann

    2012-01-01

    Full Text Available Background. The presence of anti-SSA/Ro and anti-SSB/La antibodies during pregnancy is associated with fetal congenital heart block (CHB, which is primarily diagnosed through fetal echocardiography. Conclusive information about the complete electrophysiology of the fetal cardiac conducting system is still lacking. In addition to echocardiography, fetal magnetocardiography (fMCG can be used. fMCG is the magnetic analogue of the fetal electrocardiogram (ECG. Patients and Methods. Forty-eight pregnant women were enrolled in an observational study; 16 of them tested positive for anti-SSA/Ro and anti-SSB/La antibodies. In addition to routine fetal echocardiography, fMCG was used. Fetal cardiac time intervals (fCTIs were extracted from the magnetic recordings by predefined procedures. ECGs in the neonates of the study group were performed within the first month after delivery. Results. The PQ segment of the fCTI was significantly prolonged in the study group (P=0.007, representing a delay of the electrical impulse in the atrioventricular (AV node. Other fCTIs were within normal range. None of the anti-SSA/Ro and/or anti-SSB/La fetuses progressed to a more advanced heart block during pregnancy or after birth. Conclusion. The study identified a low-risk population within antibody positive mothers, where PQ segment prolongation is associated with a lack of progression of the disease.

  3. BAHAYA RADIASI DAN CARA PROTEKSINYA

    Directory of Open Access Journals (Sweden)

    Badunggawa P

    2014-09-01

    Full Text Available Radiasi yang kita terima setiap saat, termasuk radiasi untuk tujuan kedokteran, mempunyai dampak positif dan negatif terhadap keselamatan manusia dan lingkungan. Dampak positif dari radiasi terhadap keselamatan manusia diantaranya adalah digunakan sebagai pengobatan dan dampak negatifnya adalah tergantung dari besar dosis yang diterima diantaranya adalah mulai dari mual, muntah, pusing-pusing, rambut rontok, menyebabkan kanker, diturunkan secara genetik, dan yang lebih berbahaya lagi adalah menyebabkan kematian. Oleh karena itu kita harus berhati-hati terhadap bahaya yang ditimbulkannya, baik terhadap pekerja radiasi maupun masyarakat umum termasuk pasien. Perlindungan terhadap bahaya yang ditimbulkan radiasi ini dikenal dengan istilah proteksi radiasi. Sehingga dosis yang diterima pertahun oleh pekerja atau masyarakat umum tidak melebihi batas dosis yang ditetapkan oleh Bapeten. Berbagai upaya telah dilakukan untuk meminimalkan bahaya tersebut sehingga pekerja dan pasien merasa aman melakukan dan dikenai tindakan medik.[medicina 2009;40:47-51].  

  4. Metode Pengukuran Saliva Dan Pemeriksaan Kelenjar Saliva

    OpenAIRE

    Deddy A. Simatupang

    2008-01-01

    Saliva merupakan cairan utama di rongga mulut yang dihasilkan oleh kelenjar saliva mayor dan minor. Saliva memiliki fungsi dan peranan penting dalam menjaga dan memelihara kesehatan secara umum. Kebiasaan bemafas melalui mulut, akibat terapi radiasi pada kepala dan leher, kemsakan saraf, obat-obatan, dan penyakit-penyakit tertentu dapat menyebabkan penurunan produksi saliva yang disebut dengan xerostomia atau mulut kering. Xerostomia dapat menyebabkan karies gigi, mukositis dan kandidiasi...

  5. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block

    OpenAIRE

    Fritsch, Christine; Hoebeke, Johan; Dali, Hayet; Isenberg, David A; Meyer, Olivier; Muller, Sylviane; Ricchiuti, Vincent

    2005-01-01

    Neonatal lupus erythematosus is a rare disorder caused by the transplacental passage of maternal autoantibodies. The 52-kDa Ro/SSA antigen (Ro52) ribonucleoprotein represents an antigenic target strongly associated with the autoimmune response in mothers whose children have neonatal lupus and cardiac conduction disturbances, mainly congenital heart block. The objective of this study was to identify putative Ro52/60-kDa Ro/SSA antigen (Ro60) epitopes associated with neonatal lupus and congenit...

  6. KINERJA Jurnal Bisnis dan Ekonomi

    OpenAIRE

    Pickering, Paul; Suprapto, Budi; Kufepaksi, Mahatma; Suhardjanto, Djoko; Ariani, D. Wahyu; Haryono, Tulus; Soeroso, Amiluhur

    2010-01-01

    1. Effects Of Relationship Marketing Upon Nz Micro-Enterprise Internationals Within The Asian Marketplace oleh Paul Pickering dan Russel P J Kingshott. 2. Service Recovery Strategy And Customer Satisfaction: Evidence From Hotel Industry In Yogyakarta-Indonesia oleh Budi Suprapto dan Galang Yunanto Hashym 3. Investor Overconfident Dalam Penilaian Saham: Perspektif Gender Dalam Eksperimen Pasar oleh Mahatma Kufepaksi 4. Pengaruh Corporate Governance, Etnis, Dan Latar Belakang Pendi...

  7. Dans la Trajectoire des Choses

    OpenAIRE

    Coupaye, Ludovic; Douny, Laurence

    2010-01-01

    Dans la trajectoire des choses. Comparaison des approches francophones et anglophones contemporaines en anthropologie des techniques. Dans cette introduction, les auteurs exposent les approches francophones et anglophones de l’étude des techniques et suggèrent que ces deux traditions ont traité d’enjeux comparables. Ils les resituent dans l’histoire des Sciences humaines et analysent leur place dans le champ anthropologique. Ils retracent les débats et les échanges qui les ont enrichies, part...

  8. PERBEDAAN PROSES PEMBELAJARAN DAN PRESTASI BELAJAR SISWA SD EKS-RSBI DAN SDSN DI DIY

    OpenAIRE

    Herjan Haryadi; Heri Retnawati

    2014-01-01

    Penelitian ini bertujuan untuk mengetahui perbedaan proses pembelajaran dan prestasi belajar siswa eks-RSBI dan SDSN di DIY pada mata pelajaran matematika, IPA dan Bahasa Indonesia. Penelitian ini merupakan studi penelitian komparasi. Populasi dalam penelitian ini adalah seluruh siswa kelas IV dan V SD eks-RSBI dan SDSN di DIY. Analisis data menggunakan (1) statistik deskriptif untuk mendeskripsikan proses penelitian dan menggambarkan mean dari data yang diperoleh; dan (2) statistik inferensi...

  9. DIVERSITAS DAN KERAPATAN MANGROVE, GASTROPODA DAN BIVALVIA DI ESTUARI PERANCAK, BALI

    OpenAIRE

    Susiana; Ali, Syamsu Alam; Rukminasari, Nita

    2011-01-01

    Penelitian ini bertujuan membandingkan diversitas dan kerapatan mangrove dengan kepadatan gastropoda dan bivalvia di mangrove alami dan rehabilitasi. Pengukuran ekosistem mangrove menggunakan transek kuadrat 10 m x 10 m. Kelimpahan dan kepadatan gastropoda dan bialvia menggunakan transek kuadrat berukuran 1 m x 1 m. Analisis nMDS, cluster untuk melihat hubungan karekteristik mangrove alami dan rehabilitasi dianalisis secara deskriptif dan analisis regresi untuk mendetermi...

  10. Hepatitis B dan Permasalahannya

    OpenAIRE

    Zain, Lukman Hakim

    2008-01-01

    Pada tahun 1965, Blumberg dan kawan- kawan di Philadelphia menemukan suatu antibodi pada pasien yang ditransfusi yang berasal dari suku Aborigin Australia, sehingga ant igen tersebut dikenal dengan nama Antigen Australia. Pada tahun 1977, Blumberg mendapat hadiah nobel untuk penemuannya itu. Sekarang antigen tersebut dikenal dengan nama hepatitis B surface antigen (HBsAg). Hepatitis B merupakan penyakit infeksi pada jaringan hati yang disebabkan oleh virus yang berasal da...

  11. ASIMETRI INFORMASI DAN UNDERPRICING

    Directory of Open Access Journals (Sweden)

    Tety Anggita Safitri

    2013-03-01

    Full Text Available Tujuan penelitian ini adalah untuk menguji pengaruh asimetri informasi terhadap underpricing. Penelitian ini menggunakan sampel 63 perusahaan yang melakukan penawaran umum perdana di Bursa Efek Indonesia dalam kurun waktu 2005-2010. Analisis data menggunakan regresi linier berganda, yaitu menguji proksi asimetri informasi yang terdiri atas ukuran perusahaan, umur perusahaan, proporsi saham yang ditawarkan kepada masyarakat, reputasi underwriter dan reputasi auditor terhadap underpricing. Hasil penelitian ini mengindikasikan bahwa reputasi underwriter dan reputasi auditor berpengaruh terhadap underpricing. Ukuran perusahaan, umur perusahaan dan proporsi saham yang ditawarkan tidak berpengaruh terhadap underpricing.The aim of this research is to examine the effect of assymetric information on underpricing. This research used a sample of 63 companies that make initial public offering on the Indonesia Stock Exchange in the period of 2005-2010. The data analysis is using multiple linear regression, which is testing the proxy of asymmetric information which consists of the firm size, the firm age, the proportion of shares offered to the public, underwriter reputation and auditor reputation on underpricing. This research indicates that underwriter reputation and auditor reputation have a significant effect on underpricing. The firm size, the firm age and the proportion of shares offered to the public have no significant effect on underpricing.

  12. Automatic, Rapid Replanning of Satellite Operations for Space Situational Awareness (SSA)

    Science.gov (United States)

    Stottler, D.; Mahan, K.

    An important component of Space Situational Awareness (SSA) is knowledge of the status and tasking of blue forces (e.g. satellites and ground stations) and the rapid determination of the impacts of real or hypothetical changes and the ability to quickly replan based on those changes. For example, if an antenna goes down (either for benign reasons or from purposeful interference) determining which missions will be impacted is important. It is not simply the set of missions that were scheduled to utilize that antenna, because highly expert human schedulers will respond to the outage by intelligently replanning the real-time schedule. We have developed an automatic scheduling and deconfliction engine, called MIDAS (for Managed Intelligent Deconfliction And Scheduling) that interfaces to the current legacy system (ESD 2.7) which can perform this replanning function automatically. In addition to determining the impact of failed resources, MIDAS can also replan in response to a satellite under attack. In this situation, additional supports must be quickly scheduled and executed (while minimizing impacts to other missions). Because MIDAS is a fully automatic system, replacing a current human labor-intensive process, and provides very rapid turnaround (seconds) it can also be used by commanders to consider what-if questions and focus limited protection resources on the most critical resources. For example, the commander can determine the impact of a successful attack on one of two ground stations and place heavier emphasis on protecting the station whose loss would create the most severe impacts. The system is currently transitioning to operational use. The MIDAS system and its interface to the legacy ESD 2.7 system will be described along with the ConOps for different types of detailed operational scenarios.

  13. Atom Chips

    CERN Document Server

    Folman, R; Cassettari, D; Hessmo, B; Maier, T; Schmiedmayer, J; Folman, Ron; Krüger, Peter; Cassettari, Donatella; Hessmo, Björn; Maier, Thomas

    1999-01-01

    Atoms can be trapped and guided using nano-fabricated wires on surfaces, achieving the scales required by quantum information proposals. These Atom Chips form the basis for robust and widespread applications of cold atoms ranging from atom optics to fundamental questions in mesoscopic physics, and possibly quantum information systems.

  14. Dislocation glide in Ni-Al solid solutions from the atomic scale up: a molecular dynamics study; Etude du glissement des dislocations dans la solution solide Ni-Al par simulation a l'echelle atomique

    Energy Technology Data Exchange (ETDEWEB)

    Rodary, E

    2003-01-01

    The glide of an edge dislocation in solid solutions is studied by molecular dynamics, at fixed temperature and imposed external stress. We have optimized an EAM potential for Ni(1 a 8% A1): it well reproduces the lattice expansion, local atomic order, stacking fault energy as a function of composition, as well as the elastic properties of the {gamma}' phase with L1{sub 2} structure. On increasing the stress, the dislocation is first immobile, then glides with a velocity proportional to the stress and the velocity saturates on reaching the transverse sound velocity. However, only beyond a static threshold stress, {sigma}{sub s}, does the dislocation glide a distance large enough to allow macroscopic shear; the linear part of the velocity-stress curve extrapolates to zero at a dynamical threshold stress, {sigma}{sub d}, The friction coefficient, and the threshold stresses ({sigma}{sub s} and {sigma}{sub d}), increase with the A1 concentration and decrease with temperature (300 and 500 K). Close to the critical shear stress, {sigma}{sub s}, the dislocation glide is analysed with a 'stop and go' model. The latter yields the flight velocity between obstacles, the mean obstacle density and the distribution of the waiting time on each obstacle as a function of stress, composition and temperature. The obstacle to the glide is proposed to be the strong repulsion between Al atoms brought into nearest neighbour position by the glide process, and not the dislocation-solute interaction. The microscopic parameters so defined are introduced into a micro-mechanical model, which well reproduces the known behaviour of nickel base solid solutions. (author)

  15. Antropologi dan Jaringannya di Indonesia

    OpenAIRE

    Jonris G. Purba

    2009-01-01

    Jika melihat tulisan ini sepintas dari judulnya, maka kita akan bertanya mengapa antropologi mempunyai jaringan. Di samping itu kita juga akan bertanya: jaringan seperti apa yang ada dalam antropologi itu? Bagaimana terbentuknya jaringan itu? Dan apa yang menjadi latar belakang munculnya jaringan antropologi tersebut? Serta apa saja manfaat dan kegiatan yang dilaksanakan dalam jaringan tersebut? ker-jul2006- (3)

  16. Dimensi Internal Control dan Internal Auditor dalam Acoountability dan Fraud Prevention

    OpenAIRE

    Kartini

    2012-01-01

    KARTINI. Dimensi Internal Control dan Internal Auditor dalam Acoountability dan Fraud Prevention, (dibimbing oleh Basri Hasanuddin sebagai promotor, Gagaring Pagalung dan Darwis Said sebagai ko-promotor) Penelitian ini bertujuan untuk mengetahui apakah dimensi internal control dan internal auditor berpengaruh signifikan terhadap accountability dan fraud prevention pada pemerintah provinsi. Metode peneltian ini termasuk explanatory research dengan unit analisis organisasi, yaitu satuan...

  17. Remodeling dan Repairing Vaskular pada Nefropati Hipertensif

    OpenAIRE

    Rasyid, Haerani; Wijaya, Johnson; Bakri, Syakib

    2011-01-01

    Latar Belakang: Ketidakseimbangan proses remodeling dan repairing vaskular diduga berperan penting pada kekakuan dan ketebalan vaskular yang akhirnya menyebabkan komplikasi hipertensi. Petanda dini komplikasi hipertensi pada ginjal adalah adanya mikroalbuminuria (MA). Tujuan Penelitian: Untuk mengetahui perbedaan konsentrasi TGF-??1 (sebagai petanda remodeling) dan VEGFR-2 (sebagai petanda repairing) pada subyek normotensi, hipertensi normoalbuminuria (NA) dan hipertensi MA. Metode: P...

  18. PENINGKATAN KUALITAS DAN PROSES PEMBUATAN BIODIESEL DARI BLENDING MINYAK KELAPA SAWIT (PALM OIL) DAN MINYAK KELAPA (COCONUT OIL) DAN BANTUAN GELOMBANG ULTRASONIK

    OpenAIRE

    Hantoro Satriadi; Favian Nafiega; W Widayat; Rheza Dipo

    2015-01-01

    Keterbatasan solar sebagai sumber energi bahan bakunya tidak dapat diperbaharui menuntut adanya bahan baku alternatif yang dapat diperbaharui dan ramah lingkungan untuk pembuatan biodiesel. Reaksi utama produksi biodiesel adalah esterifikasi dan transestirifikasi yang berlangsung lambat dan membutuhkan banyak katalis dan alkohol. Reaksi yang terjadi belum sempurna dan belum memenuhi standar SNI dan ASTM. Untuk memperbaiki mutu biodiesel serta menghasilkan yield maksimal, maka dilakukan blendi...

  19. Production characteristics of lettuce Lactuca sativa L. in the frame of the first crop tests in the Higher Plant Chamber integrated into the MELiSSA Pilot Plant

    Science.gov (United States)

    Tikhomirova, Natalia; Lawson, Jamie; Stasiak, Michael; Dixon, Mike; Paille, Christel; Peiro, Enrique; Fossen, Arnaud; Godia, Francesc

    Micro-Ecological Life Support System Alternative (MELiSSA) is an artificial closed ecosystem that is considered a tool for the development of a bioregenerative life support system for manned space missions. One of the five compartments of MELiSSA loop -Higher Plant Chamber was recently integrated into the MELiSSA Pilot Plant facility at Universitat Aut`noma deo Barcelona. The main contributions expected by integration of this photosynthetic compartment are oxygen, water, vegetable food production and CO2 consumption. Production characteristics of Lactuca sativa L., as a MELiSSA candidate crop, were investigated in this work in the first crop experiments in the MELiSSA Pilot Plant facility. The plants were grown in batch culture and totaled 100 plants with a growing area 5 m long and 1 m wide in a sealed controlled environment. Several replicates of the experiments were carried out with varying duration. It was shown that after 46 days of lettuce cultivation dry edible biomass averaged 27, 2 g per plant. However accumulation of oxygen in the chamber, which required purging of the chamber, and decrease in the food value of the plants was observed. Reducing the duration of the tests allowed uninterrupted test without opening the system and also allowed estimation of the crop's carbon balance. Results of productivity, tissue composition, nutrient uptake and canopy photosynthesis of lettuce regardless of test duration are discussed in the paper.

  20. Quantification of ion or atom transfer phenomena in materials implanted by nuclear methods; Quantification de phenomenes de transferts ioniques ou atomiques dans des materiaux implantes par la mise en oeuvre de methodes nucleaires

    Energy Technology Data Exchange (ETDEWEB)

    Oudadesse, Hassane [Clermont-Ferrand-2 Univ., 63 - Aubiere (France)

    1998-05-18

    Knowledge of transfer of the constituents of a system from regions of higher to lower concentration is of interest for implanted bio-materials. It allows determining the rate at which this material is integrated in a living material. To evaluate the ossification kinetics and to study the bio-functionality in corals of Ca and Sr, irradiations with a 10{sup 13} n.cm{sup -2}.s{sup -1} was performed, followed by the examination of changes in the localization of these elements. By using PIXE analysis method the distribution of Ca, P, Sr, Zn and Fe in the implant, bone and bone-implant interfaces were determined. Thus, it was shown that resorption of coral in sheep is achieved in 5 months after implantation and is identical to the cortical tissues 4 months after implantation in animals as for instance in hares. We have analyzed the tissues from around the prostheses extracted from patients. The samples were calcined and reduced to powder weighting some milligrams. We have adopted for this study the PIXE analysis method. The samples were irradiated by a proton beam of 3 MeV and about 400 {mu}m diameter. The results show the presence of the elements Ti, Fe, Cr, Ni or Zn according to the type of the implanted prosthesis. This dispersal of the metallic ions and atoms contaminate the tissues. The transfer factors translate the exchanges between bone and the implanted material. The solvatation phenomenon and the electric charge equilibrium explain the transfer order of cations Mg{sup 2+}, Ca{sup 2+} and Sr{sup 2+} and of the anion PO{sub 4}{sup 3-}. We have also determined these factors for the elements Ti, Cr and Ni. An original technique to study the bone bio-functionality was used. Use of phosphate derivatives labelled by {sup 99m}Tc allows obtaining information about the fixation of radioactive tracer. It was found that only after the eighth month at the implantation the neo-formed bone fixes the MDP (methyl diphosphate) labelled by {sup 99m}Tc in a similar way as in the

  1. Atomic energy

    CERN Multimedia

    1996-01-01

    Interviews following the 1991 co-operation Agreement between the Department of Atomic Energy (DAE) of the Government of India and the European Organization for Nuclear Research (CERN) concerning the participation in the Large Hadron Collider Project (LHC) . With Chidambaram, R, Chairman, Atomic Energy Commission and Secretary, Department of Atomic Energy, Department of Atomic Energy (DAE) of the Government of India and Professor Llewellyn-Smith, Christopher H, Director-General, CERN.

  2. Atom chips

    CERN Document Server

    Reichel, Jakob

    2010-01-01

    This book provides a stimulating and multifaceted picture of a rapidly developing field. The first part reviews fundamentals of atom chip research in tutorial style, while subsequent parts focus on the topics of atom-surface interaction, coherence on atom chips, and possible future directions of atom chip research. The articles are written by leading researchers in the field in their characteristic and individual styles.

  3. Construcción de mutantes de Salmonella enterica por inactivación de los genes invG/invE y ssaJ/ssaK de las islas de patogenicidad 1 y 2

    Directory of Open Access Journals (Sweden)

    Judith Velasco

    2010-10-01

    To understand the genetic basis of Salmonella pathogenicity mechanisms, various methods have been described to manipulate and generate mutant genomic DNA with specific characteristics. In this study we report the construction of mutants from several serotypes of S. enterica, substitution and inactivation of genes invG/invE in SPI-1 gene and ssaJ/ssaK in SPI-2 by the technique of phage λ Red recombinase, as described by Datsenko and Wanner (2000. The gene deletion in SPI-1 and SPI-2 encodes proteins involved in the formation of type III secretion systems responsible for the invasion and intracellular survival of S. enterica in the host cells. The results of this work will allow in vivo studies to evaluate the possible attenuation of virulence of the mutant strains, as well as to provide new insights into the genetic mechanisms involved in the pathogenesis of diseases caused by these bacteria. Moreover, this technique is recommended to efficiently generate mutants of different serotypes of S. enterica in order to study the chromosomal genes and their products. Key words: red recombinasa, mutation, pathogenicity islands, Salmonella enterica.

  4. KINERJA DAN EFISIENSI BANK PEMERINTAH (BUMN) DAN BUSN YANG GO PUBLIK DI INDONESIA

    OpenAIRE

    Sugeng Haryanto

    2012-01-01

    Penelitian ini menganalisis kinerja dan tingkat efisiensi bank-bank BUMN dan BUSN yang go Publik di Bursa Efek Indonesia.  Sample penelitian ini mengambil  tiga bank BUMN Bank BNI 46, Bank Mandiri dan Bank BRI)  dan tiga bank BUSN (Bank BCA, Bank Niaga dan Bank Panin) dengan periode analisis tahun 2005-2011. Varibael yang digunakan meliputi ROA, ROE, LAR. LDR, NPL dan BOPO. Tujuan dari penelitian ini adalah melihat dan menganalisis perbedaan kinerja antara Bank BUMN dan BUSN yang go public di...

  5. Kitab kuning dan perempuan, perempuan dan kitab kuning

    NARCIS (Netherlands)

    Bruinessen, M.M. van

    2007-01-01

    Kitab Kuning dan Emansipasi Perempuan: Konflik Budaya? Pengamatan-pengamatan Masdar mengenai kedudukan perempuan dalam diskursus (wacana, bahasan) dominan kitab kuning terasa tidak enak didengar tetapi memang sulit dibantah. Baik dalam penggunaan bahasa (yang sangat memihak kepada jenis mudzakkar) m

  6. Atomic polarizabilities

    Energy Technology Data Exchange (ETDEWEB)

    Safronova, M. S. [Department of Physics and Astronomy, University of Delaware, Newark, DE 19716 (United States); Mitroy, J. [School of Engineering, Charles Darwin University, Darwin NT 0909 (Australia); Clark, Charles W. [Joint Quantum Institute, National Institute of Standards and Technology and the University of Maryland, Gaithersburg, Maryland 20899-8410 (United States); Kozlov, M. G. [Petersburg Nuclear Physics Institute, Gatchina 188300 (Russian Federation)

    2015-01-22

    The atomic dipole polarizability governs the first-order response of an atom to an applied electric field. Atomic polarization phenomena impinge upon a number of areas and processes in physics and have been the subject of considerable interest and heightened importance in recent years. In this paper, we will summarize some of the recent applications of atomic polarizability studies. A summary of results for polarizabilities of noble gases, monovalent, and divalent atoms is given. The development of the CI+all-order method that combines configuration interaction and linearized coupled-cluster approaches is discussed.

  7. Atomic Physics

    CERN Document Server

    Foot, Christopher J

    2007-01-01

    This text will thoroughly update the existing literature on atomic physics. Intended to accompany an advanced undergraduate course in atomic physics, the book will lead the students up to the latest advances and the applications to Bose-Einstein Condensation of atoms, matter-wave inter-ferometry and quantum computing with trapped ions. The elementary atomic physics covered in the early chapters should be accessible to undergraduates when they are first introduced to the subject. To complement. the usual quantum mechanical treatment of atomic structure the book strongly emphasizes the experimen

  8. Atomic polarizabilities

    International Nuclear Information System (INIS)

    The atomic dipole polarizability governs the first-order response of an atom to an applied electric field. Atomic polarization phenomena impinge upon a number of areas and processes in physics and have been the subject of considerable interest and heightened importance in recent years. In this paper, we will summarize some of the recent applications of atomic polarizability studies. A summary of results for polarizabilities of noble gases, monovalent, and divalent atoms is given. The development of the CI+all-order method that combines configuration interaction and linearized coupled-cluster approaches is discussed

  9. An enhanced merger fraction within the galaxy population of the SSA22 protocluster at z ~ 3.1

    CERN Document Server

    Hine, N K; Alexander, D M; Lehmer, B D; Chapman, S C; Matsuda, Y

    2015-01-01

    The over-dense environments of protoclusters of galaxies in the early Universe z>2 are expected to accelerate the evolution of galaxies, with an increased rate of stellar mass assembly and black hole accretion compared to co-eval galaxies in the average density `field'. These galaxies are destined to form the passive population of massive systems that dominate the cores of rich clusters today. While signatures of accelerated growth of galaxies in the SSA22 protocluster z=3.1 have been observed, the mechanism driving this remain unclear. In this work we show an enhanced rate of galaxy-galaxy mergers could be responsible. We morphologically classify Lyman-break Galaxies (LBGs) in the SSA22 protocluster and compare these to those of galaxies in a typical density field at z=3.1 as either active mergers or non-merging using Hubble Space Telescope F814W imaging, probing the rest frame ultraviolet stellar emission. We measure a merger fraction of 48+/-10% for LBGs in the protocluster compared to 30+/-6% for the fiel...

  10. Atom interferometry

    International Nuclear Information System (INIS)

    We will first present a development of the fundamental principles of atom interferometers. Next we will discuss a few of the various methods now available to split and recombine atomic De Broglie waves, with special emphasis on atom interferometers based on optical pulses. We will also be particularly concerned with high precision interferometers with long measurement times such those made with atomic fountains. The application of atom interferometry to the measurement of the acceleration due to gravity will be detailed. We will also develop the atom interferometry based on adiabatic transfer and we will apply it to the measurement of the photon recoil in the case of the Doppler shift of an atomic resonance caused by the momentum recoil from an absorbed photon. Finally the outlook of future developments will be given. (A.C.)

  11. KOMPARASI HASIL BELAJAR SISWA DENGAN MEDIA MACROMEDIA FLASH DAN MICROSOFT POWERPOINT YANG DISAMPAIKAN MELALUI PENDEKATAN CHEMO-EDUTAINTMENT

    Directory of Open Access Journals (Sweden)

    Sigit Priatmoko

    2011-12-01

    Full Text Available Pendekatan chemo-edutainment (CET ditawarkan untuk membantu pemahaman siswa terhadap materi menggunakan media pembelajaran. Rumusan masalah penelitian adalah adakah perbedaan hasil belajar yang disampaikan melalui pendekatan CET dengan media Macromedia Flash  dan media Microsoft Powerpoint. Tujuan  penelitian  ini  untuk mengetahui perbedaan hasil belajar kimia pokok bahasan Struktur Atom, Sistem Periodik, dan Ikatan Kimia yang disampaikan melalui pendekatan CET dengan media Macromedia Flash dan media Microsoft Powerpoint. Populasi penelitian adalah siswa kelas XI IPA reguler semester I SMA N 1 Ungaran tahun pelajaran 2007/2008. Pengambilan sampel dilakukan dengan teknik random sampling, diperoleh kelas XI IPA-3 sebagai kelas eksperimen I dan kelas XI IPA-4 sebagai kelas eksperimen II. Analisis tahap awal dilakukan uji normalitas dan homogenitas populasi, diperoleh data nilai ketiga kelas terdistribusi normal dan homogen. Analisis  tahap  akhir meliputi  uji  normalitas,  uji  kesamaan  dua  varians,  dan  uji  hipotesis diperoleh data nilai hasil belajar kedua kelas sampel terdistribusi normal dan homogen, uji hipotesis diperoleh thitung= 2,6492 sedangkan ttabel = 1,66. Simpulan penelitian ini adalah ada perbedaan hasil belajar kimia siswa yang disampaikan melalui pendekatan CET dengan media Macromedia Flash dan media Microsoft Powerpoint pada pokok bahasan Struktur Atom, Sistem Periodik, dan Ikatan Kimia. Kata Kunci: chemo-edutainment, macromedia flash

  12. Obituary: Professor Paul Dan Cristea

    OpenAIRE

    Tabus, Ioan; Serpedin, Erchin; Astola, Jaakko

    2013-01-01

    Paul Dan Cristea, professor of Electrical Engineering and Computer Science at ‘Politehnica’ University of Bucharest died on 17 April 2013, following several years of bravely battling a perfidious illness.

  13. KINERJA Jurnal Bisnis dan Ekonomi

    OpenAIRE

    Kaaro, Hermeindito; Sukamulja, Sukmawati; Kusumastuti, Sri Yani; Krisnadewara, P. Didit; Lako, Andreas; Widiastuti, Theresia Diah; Ellitan, Lena; Priyogo, C. Jarot

    2004-01-01

    1. Kebangkrutan Versus Restrukturisasi:Evaluasi dan Prediksi Kelangsungan Hidup Perusahaan Pasca Krisis Keuangan 1997 oleh Hermeindito Kaaro 2. Morning LosSQS and Afternoon Price Volatility: Evidence of Jsksrts Stock Exchange oleh Sukmawati Sukamulja 3. Penentuan NilaiTukar: Pengujian Purchasing Power Parity diIndonesia oleh Sri Yani Kusumastuti 4. SurveiKinerja KoneksiInternet dan Kemampuan lnvestasi Warnet di Yogyakarta oleh P. Didit Krisnadewara 5. Peranan Corporate Str...

  14. Did the global financial crisis alter equilibrium adjustment dynamics between the US Fed rates and stock price volatility in the SSA region?

    OpenAIRE

    Phiri, Andrew

    2016-01-01

    In this paper we use the recently introduced MTAR model to examine whether equilibrium adjustment dynamics between the US fed rates and stock market volatility in 5 SSA countries have changed from periods before the globally financial crisis (1999-2007) to periods after the crisis (2009-2015). We find that this relationship existed for all 5 SSA exchange before the crisis and yet for only 3 exchanges after the crisis. Furthermore, there exists a negative co-relationship between the time serie...

  15. Ultraviolet radiation (UVR) induces cell-surface Ro/SSA antigen expression by human keratinocytes in vitro: a possible mechanism for the UVR induction of cutaneous lupus lesions

    Energy Technology Data Exchange (ETDEWEB)

    Jones, S.K. (Bristol Royal Infirmary (United Kingdom))

    1992-06-01

    Antinuclear antibodies are useful markers of connective tissue disease. In this study, UVB but not UVA induced the expression of Ro/SSA antigen on keratinocyte surfaces in vitro. This expression was also found with the extractable nuclear antigens RnP and Sm, but not with single or double-stranded DNA. The expression was prevented by blocking protein synthesis, suggesting that it was an active process. The results suggest that UVB exposure may result in the expression of Ro/SSA antigen on the surfaces of basal keratinocytes in vivo. This antigen could then bind circulating antibody leading to the cutaneous lesions in neonatal and subacute cutaneous lupus erythematosus. (Author).

  16. Ultraviolet radiation (UVR) induces cell-surface Ro/SSA antigen expression by human keratinocytes in vitro: a possible mechanism for the UVR induction of cutaneous lupus lesions

    International Nuclear Information System (INIS)

    Antinuclear antibodies are useful markers of connective tissue disease. In this study, UVB but not UVA induced the expression of Ro/SSA antigen on keratinocyte surfaces in vitro. This expression was also found with the extractable nuclear antigens RnP and Sm, but not with single or double-stranded DNA. The expression was prevented by blocking protein synthesis, suggesting that it was an active process. The results suggest that UVB exposure may result in the expression of Ro/SSA antigen on the surfaces of basal keratinocytes in vivo. This antigen could then bind circulating antibody leading to the cutaneous lesions in neonatal and subacute cutaneous lupus erythematosus. (Author)

  17. Schroedinger atom

    International Nuclear Information System (INIS)

    Features of an electrodynamical interpretation suggested by Schroedinger for the wave function are discribed. According to this conception electron charges are continuously distributed all over the volume of an atomic system. The proof is given that classical electrodynamics keeps its action inside atom. Schroedinger's atom has been shown to be the only model in which electrones do not lose their energy for emission when they move around nucleus. A significance of the distributed electron charge self-field is estimated. Practical applications of this conception have been noted including the new trend in quantum electrodynamics. Experimental and theoretical corroborations of the atom model with a continuous electron charge are adduced

  18. Atomic physics

    International Nuclear Information System (INIS)

    Research activities in atomic physics at Lawrence Berkeley Laboratory during 1976 are described. Topics covered include: experiments on stored ions; test for parity violation in neutral weak currents; energy conservation and astrophysics; atomic absorption spectroscopy, atomic and molecular detectors; theoretical studies of quantum electrodynamics and high-z ions; atomic beam magnetic resonance; radiative decay from the 23Po,2 levels of helium-like argon; quenching of the metastable 2S/sub 1/2/ state of hydrogen-like argon in an external electric field; and lifetime of the 23Po level of helium-like krypton

  19. EKSTRAKSI DAN SINTESIS NANOSILIKA BERBASIS PASIR BANCAR DENGAN METODE BASAH

    Directory of Open Access Journals (Sweden)

    Munasir .

    2013-11-01

    Full Text Available The Purification and synthesis nanosilika extracts from quartz sand base material taken Bancar Tuban area ( north of the Island of Java-Indonesia has been carried out in this study . Physically Tuban Bancar sand grains have a slightly rough shape and bright yellow. Sand Bancar has elements Si atoms (69 %Wt, and elements of the dominant impurity atoms is Ca (7.5 %Wt and K (4.8 %Wt. Diffraction pattern shows a dominant intesistas occurs at an angle (2Ɵ~26o the phase of quartz ( the most stable in nature. Size finely divided powder sand about 5-50 micrometers. Synthesis nanosilika based natural sand used wet method, which consists of two processes, namely: (1 sand powder processed by the hydrothermal method using alkaline compounds (NaOH with molarity 7M, to obtain a clear solution of sodium silicate (Na2O.xSiO2, and (2 a solution of sodium silicate acts as prcursor processed by co-precipitation method, sodium silicate solution was titrated with HCl 2 M (co-precipitation method to obtain a slurry silicite Si(OH4. The final product in the form of silica powder with amorphous and crystalline structures (quartz ; purity (%Wt Si reached 95.7 % and marfologi analysis showed that the SiO2 particles tend to form agglomeration and particle size of about ~ 58 nm Key words: nanosilica, bancar sands, amorphous, quartz   Abstrak Pemurnian, ekstrak dan sintesis nanosilika dari bahan dasar pasir kuarsa yang diambil di daerah Bancar Tuban (utara Pulau Jawa-Indonesia telah dilakukan pada penelitian ini. Secara fisik pasir  Bancar Tuban  mempunyai bentuk butiran agak kasar dan berwarna kuning cerah. Pasir Bancar mempunyai unsur atom Si (69%Wt, dan unsur atom pengotor dominan adalah Ca (7,5%wt dan K (4,8%wt. Pola difraksinya menunjukan intesistas dominan terjadi pada sudut (2 theta ~26o, fase quartz (paling stabil di alam. Ukuran serbuk pasir yang telah dihaluskan sekitar 5-50 mikrometer. Sintesis nanosilika berbasis pasir alam digunakan metode basah, yang

  20. Delineasi Model Tentatif Sistem Geotermal dan Interpretasi Komprehensif Berdasarkan Analisis Geofisika, Geokimia, dan Geologi

    OpenAIRE

    Makhrani, Makhrani

    2013-01-01

    Telah didelineasi model tentatif sistem geothermal berdasarkan interpretasi komprehensif dari analisis geofisika, geokimia dan geologi yang dapat memperlihatkan lebih jauh tentang sistem geothermal di daerah penelitian. Analisis geofisika dilakukan untuk zonasi bawah permukaan (overburden, claycap dan reservoar) dan penentuan fasa fluida reservoar. Pola aliran hidrotermal bawah permukaan ditentukan dari analisis geofisika dan geokimia, didukung oleh analisis geologi. D...

  1. Pengetahuan, Sikap Dan Perilaku Guru-Guru Sekolah Dasar Negeri Dan Swasta Tentang Kesehatan Gigi Dan Mulut Di Kota Medan

    OpenAIRE

    Chelladorai, Kalvina A/P

    2013-01-01

    Karies dan gingivitis merupakan masalah gigi dan mulut yang banyak dijumpai pada anak-anak di negara berkembang termasuk di Indonesia, dan cenderung meningkat pada setiap dasawarsa. Dalam media Indonesia diungkapkan bahwa 90% anak mengalami karies dan 80% menderita gingivitis. Karies gigi atau gigi berlubang adalah kerusakan struktur gigi sehingga terbentuknya lubang pada gigi. Gingivitis adalah penyakit infeksi yang disebabkan oleh plak yang menyebabkan gingiva mengalami keradangan, membengk...

  2. Studi EDTA dan asam p-t-butilkaliks[4]arena tetrakarboksilat pada analisis kalsium yang mengandung fosfat dengan metode AAS

    OpenAIRE

    paris, denesya natalia

    2014-01-01

    EDTA digunakan sebagai zat penopeng pada analisis kalsium yang mengandung fosfat dengan metode spektrofotometri serapan atom. Fosfat dan kalsium membentuk senyawa refractory sehingga terhalangi pembentukan atom-atom kalsium pada saat atomisasi. Penelitian ini bertujuan menentukan penambahan EDTA yang minimum diperlukan sebagai zat penopeng. Hasil penelitian menunjukkan EDTA 700 ppm pada pengukuran kalsium 5 ppm dapat mengurangi gangguan fosfat 5 ppm, sedangkan EDTA 7000 ppm pada pengukuran ka...

  3. Atomic physics

    CERN Document Server

    Born, Max

    1989-01-01

    The Nobel Laureate's brilliant exposition of the kinetic theory of gases, elementary particles, the nuclear atom, wave-corpuscles, atomic structure and spectral lines, electron spin and Pauli's principle, quantum statistics, molecular structure and nuclear physics. Over 40 appendices, a bibliography, numerous figures and graphs.

  4. KINERJA KEPALA SEKOLAH DALAM KEGIATAN BIMBINGAN DAN KONSELING

    Directory of Open Access Journals (Sweden)

    Abu Bakar M.Luddin

    2014-06-01

    Abstrak: Kinerja Kepala Sekolah dalam Kegiatan Bimbingan dan Konseling. Penelitian ini bertujuan mendeskripsikan kinerja kepala sekolah dalam pelaksanaan kegiatan bimbingan dan konseling. Penelitian dilaksanakan di SMU Negeri 2 Kota Binjai, dengan memergunakan rancangan deskriptif kualitatif. Subjek penelitian adalah kepala sekolah, koordinator bimbingan dan konseling, dan guru pembimbing. Data di­kumpulkan dengan observasi, wawancara mendalam, dan kajian dokumen, dan selanjutnya dianalisis sete­lah melalui proses triangulasi antarsubjek dan informasi. Temuan penelitian menunjukkan bahwa kinerja kepala sekolah terkait dengan pelaksanaan kegiatan bimbingan dan konseling masih belum sepenuhnya sebagaimana yang diharapkan. Kepala sekolah perlu meningkatkan kinerjanya dalam menjalankan fungsi koordinasi dan kepengawasan untuk mencapai kegiatan bimbingan dan konseling yang efektif.

  5. BOREAS HYD-8 DEM Data Over the NSA-MSA and SSA-MSA in the UTM Projection

    Science.gov (United States)

    Wang, Xue-Wen; Hall, Forrest G. (Editor); Knapp, David E. (Editor); Band, L. E.; Smith, David E. (Technical Monitor)

    2000-01-01

    The BOREAS HYD-8 team focused on describing the scaling behavior of water and carbon flux processes at local and regional scales. These DEMs were produced from digitized contours at a cell resolution of 100 meters. Vector contours of the area were used as input to a software package that interpolates between contours to create a DEM representing the terrain surface. The vector contours had a contour interval of 25 feet. The data cover the BOREAS MSAs of the SSA and NSA and are given in a UTM map projection. Most of the elevation data from which the DEM was produced were collected in the 1970s or 1980s. The data are stored in binary, image format files. The data files are available on a CD-ROM (see document number 20010000884) or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).

  6. New Collinear Twist-3 Analysis of Transverse SSA: Toward a Solution for the Sign-Mismatch Problem

    International Nuclear Information System (INIS)

    We present a new collinear twist-3 analysis of the transverse SSA AN at RHIC. We use the TMD Sivers/Collins function to fix some of the relevant collinear twist-3 functions and perform a fit of the RHIC data with other parameterized twist-3 functions. This allows us to keep the consistency among descriptions in pp collision, SIDIS, and e+e− annihilation and thus could provide a unified description of the spin asymmetries in the low- and high-PT processes. By taking into account the twist-3 fragmentation contribution, we show for the first time this contribution could be the main source of AN in pp↑ →hX and its inclusion could provide a solution for the sign-mismatch problem. (author)

  7. Doppler Shifts of Backscattering Fields from One Dimensional Linear and Nonlinear Oceanic Surface by SSA-II

    International Nuclear Information System (INIS)

    Based on the general framework of the second order small slope approximation (SSA-II), Doppler shifts of backscattered fields from linear and nonlinear hydrodynamic sea surfaces are predicted. Comparisons are performed at incidence angles varying from near-nadir to moderate-grazing for different radar frequencies. The predicted Doppler shifts for nonlinear hydrodynamic model are somewhat larger than the results corresponding to linear surface. Meanwhile, the dependences of the Doppler shifts on the wind speed and radar polarizations are also analyzed, and the comparisons are shown to confirm the sensitivities to the polarization and wind speed. At the same time, the results of the small perturbation method (SPM) and geometrical optics approximation (GO) are also presented for comparisons

  8. Diagnosis dan Penatalaksanaan Abses Septum Nasi

    OpenAIRE

    Bestari J. Budiman; Jon Prijadi

    2013-01-01

    AbstrakAbses septum nasi adalah terkumpulnya pus di antara tulang rawan dengan mukoperikondrium atau tulang septum dengan mukoperiosteum yang melapisinya. Abses septum dapat menyebabkan hidung pelana bahkan komplikasi intrakranial, sehingga diperlukan diagnosis dan tindakan yang tepat dan cepat. Telah dilaporkan satu kasus abses septum pada wanita umur 34 tahun dan telah dilakukan insisi dan eksplorasi abses dalam narkose umum.Kata kunci: Arial 9 Kata Kunci: Abses septum nasi, hematoma septum...

  9. ANALISIS PERBANDINGAN SPAP, IAS DAN SPKN

    OpenAIRE

    Maylia Pramono Sari

    2012-01-01

    Dalam mewujudkan Good Goveronance  akan dilakukan analisis perbandingan mengenai standar pemeriksaan nasional yaitu SPAP, ISA, dan SPKN untuk menemukan standar yang lebih tepat dan lebih lengkap untuk pemeriksaan sektor publik. Persamaan SPKN dan ISS  adalah tanggungjawab manajemen dan tanggungjawab auditor sedangkan perbedaannya adalah badan yang menerbitkannya. Perbedaan yang mendasar terletak pada karakter pemeriksaan BPK. Karakter tersebut adalah keharusan pemeriksa BPK untuk merancang ...

  10. 75 FR 30839 - Privacy Act of 1974; CMS Computer Match No. 2010-03, HHS Computer Match No. 1003, SSA Computer...

    Science.gov (United States)

    2010-06-02

    ...'' at 61 FR 6428-6435 (February 20, 1996), and OMB guidelines pertaining to computer matching at 54 FR..., published at 73 FR 13304 (March 12, 2008), and maintained at the Martinsburg Computing Center in Martinsburg... Beneficiary Record (MBR), SSA/OSR 60-0090, published at 71 FR. 1826 (January 11, 2006) and maintained at...

  11. TiSSA pleenum "Sotsiaaltöö kriisi ajal" : mida on sotsiaaltööl pakkuda ja kes saab sellest kasu? / Regina Lind

    Index Scriptorium Estoniae

    Lind, Regina

    2010-01-01

    22.-27. aug. 2010 toimus Tallinna Ülikoolis TiSSA doktorantide eelkonverents ja pleenum. Pleenumil peetud sotsiaalteadlaste ettekannetest. Esinesid: Holger Ziegler, Karin Böllert, Catrin Heite, Hans van Ewijk, Walter Lorenz, Mikko Mäntysaari, Heinz Sünker, Synnöve Karvinen-Niinikoski, Olga Borodkina

  12. From the ideas of «Caterpillar»-SSA and Box-Jenkins methods to decomposition method of forecasting and decomposition ANN

    OpenAIRE

    Щелкалин, Виталий Николаевич

    2011-01-01

    This paper presents an overview of the rapidly developing in recent years by the author in various fields of science and technology of modern mathematical models and methods based on joint usage of ideas of the “Caterpillar”-SSA and Box-Jenkins methods. The proposed by author models are a priority at present probabilistic and deterministic nonlinear decomposition models

  13. PERBEDAAN KUALITAS TIDUR DAN KUALITAS MIMPI ANTARA MAHASISWA LAKI-LAKI DAN MAHASISWA PEREMPUAN

    OpenAIRE

    Fuad Nashori, R. Rachmy Diana R. Rachmy Diana

    2012-01-01

    AbstrakPenelitian ini bertujuan untuk mengetahui perbedaan kualitas tidur dan kualitas mimpiantara mahasiswa pria dan mahasiswa wanita. Hipotesis yang diajukan adalah (a) adaperbedaan kualitas tidur antara mahasiswa laki-laki dan mahasiswa perempuan,mahasiswawanita memiliki kualitas tidur yang lebih tinggi dibanding mahasiswa laki-laki, dan (b) adaperbedaan kualitas mimpi antara mahasiswa laki-laki dan mahasiswa perempuan, mahasiswawanita memiliki kualitas mimpi yang lebih tinggi dibanding ma...

  14. Pengelolaan Pupuk Organik Dan Kalium Terhadap Pertumbuhan Dan Produksi Tanaman Rosela (Hibiscus sabdariffa L.)

    OpenAIRE

    Hutasoit, Christina

    2010-01-01

    CHRISTINA HUTASOIT: Pengelolaan Pupuk Organik dan Kalium terhadap Pertumbuhan dan Produksi Tanaman Rosela (Hibiscus sabdariffa L.), dibimbing oleh J. M. Sitanggang dan Sabar Ginting. Penelitian ini bertujuan Untuk mengetahui dosis pupuk Organik dan pupuk Kalium terhadap pertumbuhan dan produksi tanaman rosella (Hibiscus sabdariffa L.). Penelitian telah dilakukan di lahan percobaan Kelurahan Sempakata, Kecamatan Medan Selayang pada bulan Desember – April 2010 menggunakan Rancangan Acak Kelo...

  15. Hubungan Stress Dengan Penyakit Dan Perawatan Periodontal

    OpenAIRE

    Der, William

    2009-01-01

    Stress adalah istilah yang mendefenisikan reaksi psiko-fisiologis tubuh terhadap berbagai rangsangan emosional atau fisik yang mengganggu homeostasis, dan ditemukan dapat mengeksaserbasi hasil dari penyakit infeksi bakteri dan virus pada model hewan dan manusia. Stres telah lama dinyatakan sebagai suatu faktor predisposisi yang penting untuk Gingivitis Ulseratif Nekrotik Akut (GUNA). Banyak penelitian telah menunjukkan bahwa stres psikologis atau kondisi psikosomatik mendorong terjadinya peru...

  16. KOMPLIKASI, PENCEGAHAN DAN PENANGANAN EKSTRAVASASI AGEN KEMOTERAPI

    OpenAIRE

    I G A Mirah K; Putu Anda Tusta Adiputra

    2012-01-01

    Ekstravasasi agen kemoterapi ke jaringan sekitarnya merupakan kecelakaan yangdapat menyebabkan kerusakan jaringan progresif ireversibel dalam hitungan jamsampai hari. Manifestasi klinis ekstravasasi berupa nyeri, edema, eritema, danindurasi yang kemudian berkembang menjadi ulkus dan eschar hitam dankerusakan jaringan yang mendasarinya. Pencegahan terjadinya ekstravasasi dapatdilakukan dengan menggunakan pembuluh darah yang paten dan dengan aliranyang cepat dan tetap memperhatikan keluhan yang...

  17. PRINSIP DAN METODE ANALISIS RISIKO KESEHATAN LINGKUNGAN

    Directory of Open Access Journals (Sweden)

    Defriman Djafri

    2014-04-01

    Full Text Available Analisis risiko kesehatan lingkungan merupakan penilaian atau penaksiran risiko kesehatan yang bisa terjadi di suatu waktu pada populasi manusia berisiko. Kajian prediktif ini menghasilkan karakteristik risiko secara kuantitatif, pilihan-pilihan manajemen risiko dan strategi komunikasi untuk meminimalkan risiko tersebut. Data kualitas lingkungan yang bersifat agent specific dan site specific, karakteristik antropometri dan pola aktivitas populasi terpajan dibutuhkan untuk kajian ini.

  18. PRINSIP DAN METODE ANALISIS RISIKO KESEHATAN LINGKUNGAN

    OpenAIRE

    Defriman Djafri

    2014-01-01

    Analisis risiko kesehatan lingkungan merupakan penilaian atau penaksiran risiko kesehatan yang bisa terjadi di suatu waktu pada populasi manusia berisiko. Kajian prediktif ini menghasilkan karakteristik risiko secara kuantitatif, pilihan-pilihan manajemen risiko dan strategi komunikasi untuk meminimalkan risiko tersebut. Data kualitas lingkungan yang bersifat agent specific dan site specific, karakteristik antropometri dan pola aktivitas populasi terpajan dibutuhkan untuk kajian ini.

  19. MUTU SEKOLAH DAN BUDAYA PARTISIPASI STAKEHOLDERS

    Directory of Open Access Journals (Sweden)

    Nur Kholis

    2014-12-01

    Full Text Available Abstrak Penelitian ini memotret dan mengeksplor pemaknaan konsep sekolah bermutu, pengembangan budaya partisipasi, dan budaya sekolah, serta peran-peran yang dilakukan aktor dalam melakukan rekayasa sosial sekolah ke arah tercapainya sekolah bermutu di lembaga konfesional MIN Tegalasri. Penelitian ini merupakan penelitian kualitatif dengan pendekatan fenomenologi. Data dikumpulkan melalui wawancara mendalam, observasi, dan dokumentasi. Standar pengukuran keabsahan datanya adalah; derajat kepercayaan, keteralihan, kebergantungan dan kepastian. Ananlisis data dilakukan secara estafet mulai pengumpulan data, koleksi data, dan pemaknaan data. Penelitian ini menyimpulkan bahwa dua aspek mutu yang dicapai bidang akademik dan nonakademik; tingkat partisipasi mulai dari pimpinan, staf pendidik, staf kependidikan, peserta didik, komite sekolah, dan paguyuban kelas; budaya sekolah yang dikembangkan adalah konsolidasi internal-eksternal, mensinergikan potensi internal-eksternal, mendekatkan sekolah dengan masyarakat, bekerjasama dengan berbagai pihak, restrukturisasi dan revitalisasi komite sekolah dan paguyuban kelas, dan mengembangkan budaya bersih, indah dan nyaman; kepala sekolah merupakan aktor pengembangan budaya sekolah bermutu dan partisipasi stakeholders. Kata kunci: mutu sekolah, budaya partisipasi stakeholders

  20. Musisi Sekuler dan Gerejawi

    Directory of Open Access Journals (Sweden)

    Benny Cristovel

    2007-12-01

    Full Text Available Menjadi seorang musisi tidak sekedar bermain musik atau menyanyi saja. Ada jenjang-jenjang yang akan dilewatidalam dunia musik, yang pada akhirnya setiap musisi dihadapkan kepada tanggung jawab dalam dunia tersebut. Di jaman ini, jika jenjang seorang musisi sudah tahap profesional, maka musik dan bisnis merupakan hal yang tidak terpisahkan. Jadi tidak heran jika ada banyak orang yang memimpikan untuk berkarier dalam bidang musik, bahkan telah men1adicita-cita sejak kecil.Jadi penting bagi musisi gerejawi benar-benar "mengkotakkan dirinya" terhadap persepsi yang dianut oleh musisi sekuler, bukan mencampurkannya. Hal ini sangat esensial, karena musisi gerejawi bukan melayani manusia melainkan oleh anugerah Tuhan dipercayakan pekerjaan ini. Dengan demikian pelayanan sebagai musisi gerejawi tidak tercemar oleh persepsi dari dunia musik sekuler. Selain itu musisi gerejawi dapat merefleksikan Tuhan yang disembahnya kepada dunia sekuler, karena tujuan dari semua yang dilakukannya adalah untuk kemuliaan nama Tuhan.

  1. Contribution to the study of the {sup 31}P, {sup 1}H spin spin coupling constant N. M. R. in three co-ordinated phosphorus compounds. Influence of the bond orientation and of the nature of the substituent around the phosphorus atom; Contribution a l'etude des constantes de couplage {sup 31}P, {sup 1}H en R.M.N. dans les composes organo-phosphores tricoordines. Influence des facteurs geometriques et de la nature des substituants au niveau du phosphore

    Energy Technology Data Exchange (ETDEWEB)

    Robert, J.B. [Commissariat a l' Energie Atomique, Grenoble (France). Centre d' Etudes Nucleaires

    1969-07-01

    In order to investigate the influence of the configuration at the phosphorus atom and the influence of the substituents attached to the phosphorus atom on the J{sub PH} spin spin coupling constant, we have performed the NMR spectrum analysis of some three coordinated organo-phosphorus compounds. The studied coupling constants are {sup 3}J{sub PH} through P-O-C-H and P-C-C-H fragments and {sup 2}J{sub PH} through P-C-H fragment. The results clearly show that on the NMR time scale, in all the studied compounds (1,3,2-dioxaphospholanes, 1,3,2-dioxaphosphorinanes, 3-phospha-cyclopentene and 4-phosphorinanone) there is no inversion of the bonds around phosphorous. This conclusion held also for secondary phosphines. For a given geometry of the bonds joining the P and H atoms, and a given disposition of the bonds around the phosphorus atom, there is only a little influence of the nature of the substituents on the J{sub PH} spin coupling constants. The geometrical dependence of the {sup 3}J{sub PH} cannot be explained by a 'Karplus law'. There is an influence of the bond disposition around phosphorus. In the case of the {sup 2}J{sub P-C-H}, one can plot a curve {sup 2}J{sub P-C-H} = f({alpha}) (0{<=} {alpha} {<=} 180), {alpha} denote the dihedral angle of the two plane defined the first one by the P, C and H atoms, and the second one by the P-C bond together with the three-fold axis of the bond around phosphorus assuming a regular pyramidal arrangement. The function {sup 2}J{sub P-C-H} = f({alpha}) has two maxima, one for {alpha} = 0 degrees and the other for {alpha} = 180 degrees, and also a minimum for {alpha} = 110 degrees. (author) [French] Ce travail consiste en l'analyse par resonance magnetique nucleaire des constantes de couplage phosphore-proton dans des derives organo-phosphores tricoordines dans un double but: examen de la stabilite des liaisons au niveau du phosphore et etude de l'influence de la disposition des liaisons et de la nature de

  2. Pengaturan dan Pengawasan pada Bank Syariah

    Directory of Open Access Journals (Sweden)

    Ali Syukron

    2012-06-01

    Full Text Available Peran bank dalam melaksanakan tugas dan fungsinya perlu diatur secara baik dan benar. Hal ini bertujuan untuk menjaga kepercayaan nasabah terhadap aktivitas perbankan. Salah satu peraturan yang perlu dibuat untuk mengatur perbankan adalah peraturan mengenai permodalan bank yang berfungsi sebagai penyangga terhadap kemungkinan terjadinya kerugian. Tulisan ini merupakan studi pustaka dimana penulis mengelaborasi bagaimana pengaturan dan pengawasan pada bank syariah yang ada di berbagai negera. Dalam tulisan ini, penulis mengambil sampel negara Malaysia,  Pakistan, Kuwait, dan Inggris. Alasan memilih keempat negara tersebut karena Malaysia dan Kuwait memiliki kemiripan dengan Indonesia yang mengadopsi dual banking system.

  3. Preparation and characterization of PVA/SSA membranes with Al{sub 2}O{sub 3} nanoparticles for fuel cell applications; Preparacao de caracterizacao de membranas de PVAL/SSA na presenca de nanoparticulas de Al{sub 2}O{sub 3} para aplicacao em celulas de combustivel

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Paula N.; Pires, Alfredo T.N. [Grupo de Estudo em Materiais Polimericos - POLIMAT - UFSC, Florianopolis, SC (Brazil); Catarino, Margarida; Brandao, Lucia; Tanaka, Alfredo; Mendes, Adelio [Faculdade de Engenharia da Universidade do Porto, Porto (Portugal)

    2011-07-01

    In the present study, PVA/SSA membranes were prepared with and without the addition of Al{sub 2}O{sub 3} nanoparticles. Sulfosuccinic acid (SSA) was used as the crosslinking agent. Membranes were prepared with different amounts of SSA (26, 43 and 55 wt.%) and with 5 and 10 wt.% of nanoparticles. Crosslinking was performed at 90 degree C during 1.5 h. Membranes were analyzed by infrared spectroscopy, thermal analysis, water absorption, ion exchange capacity (IEC) and proton conductivity. The results showed that control of the crosslinking conditions, IEC value, water absorption and polymer structure are of significant importance to obtain a set of properties suitable for application in proton exchange membrane fuel cells. (author)

  4. Dramaturgies de l'humour dans le théâtre francophone contemporain : détachement et connivence face aux malaises dans l'identification chez Grumberg, Benaïssa et Pourveur

    OpenAIRE

    Castadot, Elisabeth

    2013-01-01

    This dissertation focuses on the role played by humor in the writing of three contemporary Francophone playwrights that investigate the process of identification: Jean-Claude Grumberg, a French and Jewish author, Slimane Benaissa, an Algerian bilingual playwright, and Paul Pourveur, a Belgian playwright who writes both in Dutch and French. Their works have each one a unique aesthetic, thematic and style, but these authors have in common a position of in-between, sharing different cultural aff...

  5. Padrões de imunofluorescência do fator antinuclear (FAN) em células HEp-2 de soros reagentes para anti-SSA/Ro Antinuclear antibodies (ANA) immunofluorescent pattern’s in HEp-2 cells on samples positive for anti-SSA/Ro

    OpenAIRE

    Priscila Schmidt Lora; Claudia Cilene Fernandes Correia Laurino; Adriana Estigarribia de Freitas; João Carlos T. Brenol; Odirlei Montecielo; Ricardo Machado Xavier

    2007-01-01

    OBJETIVO: avaliar os padrões de imunofluorescência do fator antinuclear (FAN) em soros reagentes para anticorpos anti-SSA/Ro e sua associação clínica. MÉTODO: foi realizado um estudo transversal retrospectivo, no qual foram revisadas as solicitações de anticorpos antiantígenos nucleares extraíveis (anti-ENA) encaminhadas ao SPC/HCPA no período de dois anos. Das solicitações com resultado positivo para anti-ENA identificou-se qual ou quais auto-anticorpos estavam envolvidos (anti-SSA/Ro, anti-...

  6. Atomic secrecy

    International Nuclear Information System (INIS)

    An article, The H-Bomb Secret: How We Got It, Why We're Telling It, by Howard Morland was to be published in The Progressive magazine in February, 1979. The government, after learning of the author's and the editors' intention to publish the article and failing to persuade them to voluntarily delete about 20% of the text and all of the diagrams showing how an H-bomb works, requested a court injunction against publication. Acting under the Atomic Energy Act of 1954, US District Court Judge Robert W. Warren granted the government's request on March 26. Events dealing with the case are discussed in this publication. Section 1, Progressive Hydrogen Bomb Case, is discussed under the following: Court Order Blocking Magazine Report; Origins of the Howard Morland Article; Author's Motives, Defense of Publication; and Government Arguments Against Disclosure. Section 2, Access to Atomic Data Since 1939, contains information on need for secrecy during World War II; 1946 Atomic Energy Act and its effects; Soviet A-Bomb and the US H-Bomb; and consequences of 1954 Atomic Energy Act. Section 3, Disputed Need for Atomic Secrecy, contains papers entitled: Lack of Studies on H-Bomb Proliferation; Administration's Position on H-Bombs; and National Security Needs vs Free Press

  7. Lõuka tuuliku restaureerimine / Dan Lukas

    Index Scriptorium Estoniae

    Lukas, Dan

    2005-01-01

    Hiiumaal Pühalepa vallas Vahtrepa külas Lõuka talu maadel asuva pukktuuliku ajaloost, restaureerimise käigust. Teostus: Dan Lukas. Muinsuskaitseline järelevalve: Tõnu Sepp, tema kommentaar. Ill.:pukktuuliku lõiked ja korruste plaanid, 7 värv. fotot

  8. Corner Office: Google's Dan Clancy

    Science.gov (United States)

    Albanese, Andrew Richard; Oder, Norman

    2009-01-01

    This article presents an interview with Dan Clancy, engineering director for Google Book Search. In this interview, Clancy talks about the pending Google Book Search settlement, involving millions of volumes digitized from libraries, which drew a lawsuit from the Association of American Publishers and the Authors Guild. He also discusses pricing,…

  9. MeLiSSA third compartment: a kinetic and stoichiometric study for Nitrosomonas europaea and Nitrobacter winogradskyi axenic cultures

    Science.gov (United States)

    Creuly, Catherine; Poughon, Laurent; Dussap, Claude-Gilles; Farges, Berangere

    2012-07-01

    As a part of a natural biological N-cycle, nitrification is one of the steps included in the conception of artificial ecosystems designed for extraterrestrial life support systems (LSS). In MELiSSA loop, which is based on carbon and nitrogen recycling, the non-edible part of the higher plants and the waste produced by the crew are collected in the liquefying compartment that degrades the chemically complex wastes into simpler building blocks (organic acids and CO2). The organic acids are eliminated in the second photoheterotrophic compartment letting an organic free medium mostly containing minerals and N-NH+4 nitrogen. The third compartment is in charge to re-oxidize N-NH+4 in order to make nitrogen usable by the following compartments. In MELiSSA, the constraint is to perform axenic cultures in order to fully control the genetic status of the culture and a thorough modelling for developing a control strategy of the compartment and of the loop, knowing that the reliability of the production of oxidized forms of nitrogen NO3- directly impacts the behaviour of the following compartments. Nitrification in aerobic environments is carried out by two groups of bacteria in co-cultures in a two-step process. The ammonia-oxidizing bacteria (Nitrosomonas europaea) realize the oxidation of ammonia to nitrite and the nitrite-oxidizing bacteria (Nitrobacter winogradskyi) the oxidation of nitrite to nitrate. In both cases, the bacteria achieve the oxidations to obtain an energy and reductant source for their growth and maintenance. Both groups use CO2 predominantly as their carbon source. They are typically found together in ecosystems and, consequently, nitrite accumulation is rare. This study concerns kinetic and mass balances studies of axenic cultures of Ns. europaea and Nb. winogradskyi in autotrophic conditions. The daily follow-up of these cultures is done using a new protocol involving flow cytometry and ionic chromatography. Nitrogen substrates and products are

  10. PENINGKATKAN MOTIVASI DAN HASIL BELAJAR BAHASA INDONESIA MENGGUNAKAN MODEL PEMBELAJARAN KREATIF DAN PRODUKTIF

    Directory of Open Access Journals (Sweden)

    Rini Ntowe Oya

    2014-01-01

    Full Text Available Penelitian ini bertujuan sebagai berikut: (1 mengetahui pelaksanaan model pembelajaran kreatif dan produktif dalam upaya peningkatan motivasi dan hasil belajar siswa kelas V SDN Bhayangkara pada mata pelajaran Bahasa Indonesia dan (2 mengetahui peningkatan hasil belajar siswa kelas V SDN Bhayangkara pada mata pelajaran Bahasa Indonesia setelah menggunakan model pembelajaran kreatif dan produktif. Penelitian ini merupakan Penelitian Tindakan Kelas yang  dilaksanakan dalam dua siklus. Hasil penelitian menunjukkan bahwa (1 pembelajaran bahasa Indonesia dengan menggunakan model pembelajaran kreatif dan produktif kelas V di SDN Bhayangkara untuk peningkatan motivasi dan hasil belajar siswa telah terlaksana dan dilakukan dengan tahapan yaitu: (1 tahap orientasi, (2 tahap eksplorasi, (3 tahap interpretasi, (4 tahap rekreasi, dan (5 tahap evaluasi. Hasil lembar observasi menunjukkan bahwa motivasi dan hasil belajar bahasa Indonesia di akhir Siklus II telah mencapai kategori sangat baik yaitu hasil observasi motivasi dan hasil belajar siswa 100%. (2 Peningkatan hasil belajar siswa dapat dilihat dari hasil belajar pada siklus 1 sebanyak 27 siswa atau 87,09% telah memenuhi KKM dan 4 siswa atau 12,91% belum memenuhi KKM. Setelah dilakukan perbaikan hasil belajar siswa pada siklus 2, jumlah siswa yang memenuhi KKM sebanyak 31 siswa atau 100%. Kata kunci: model pembelajaran kreatif dan produktif, motivasi, dan hasil belajar.

  11. Pengaruh Citra Merek dan Reputasi Perusahaan Terhadap Keputusan Pembelian Smartphone Samsung pada Mahasiswa Fakultas Ekonomi dan Bisnis Universitas Sumatera Utara

    OpenAIRE

    Tarigan, Roy Marthin

    2015-01-01

    Penelitian ini bertujuan untuk mengetahui dan menganalisis seberapa besar pengaruh citra merek dan reputasi perusahaan terhadap pengambilan keputusan pembelian smartphone Samsung pada mahasiswa Fakultas Ekonomi dan Bisnis Universitas Sumatera Utara. Penelitian ini dilaksanakan di Fakultas Ekonomi dan Bisnis Universitas Sumatera Utara. Metode penelitian yang digunakan yakni dengan metode observasi, kuesioner dan studi kepustakaan yang dilakukan secara sistematik berdasarkan tujuan penelit...

  12. PEMBINAAN DAN PENGEMBANGAN USAHA KECIL

    Directory of Open Access Journals (Sweden)

    Sentot Harman Glendoh

    2001-01-01

    Full Text Available Small business as an economic activity of society on a small scale, has a central role in the economy of Indonesia. Although the economic crisis has created a great disturbance in the live of large and middle-size business, apparently small business continues to function well in the lower levels of the economy. The main role of small business is: 1 use excess labor; 2 as a producer of goods and services at reachable prices for the lower economic levels of society; 3 as a potential producer of foreign exchange because of the success of this type of industry in producing non-oil commodities for export. Remembering that the role of small business is large and has great influence on the lower economic levels of society, it is quite necessary to pay attention to the development of this sector. Abstract in Bahasa Indonesia : Usaha kecil sebagai kegiatan ekonomi rakyat berskala kecil memiliki peran sentral dalam perekonomian Indonesia. Walaupun krisis ekonomi telah memporakporandakan kehidupan bidang usaha besar dan menengah, ternyata usaha kecil tetap tegar dan berjalan marak dikawasan kehidupan ekonomi tingkat bawah. Peran pokok usaha kecil ini adalah: (1 sebagai penyerap tenaga kerja, (2 sebagai penghasil barang dan jasa pada tingkat harga yang terjangkau bagi kebutuhan rakyat banyak yang berpenghasilan rendah, (3 sebagai penghasil devisa negara yang potensial kerena keberhasilannya dalam meproduksi komoditi ekspor non migas. Mengingat peran usaha kecil tersebut sangat besar andilnya bagi negara dan masyarakat kecil dilapisan bawah, maka pembinaan dan pengembangannya sangat perlu diperhatikan. Kata kunci: pembinaan, pengembangan, usaha kecil.

  13. Atomic theories

    CERN Document Server

    Loring, FH

    2014-01-01

    Summarising the most novel facts and theories which were coming into prominence at the time, particularly those which had not yet been incorporated into standard textbooks, this important work was first published in 1921. The subjects treated cover a wide range of research that was being conducted into the atom, and include Quantum Theory, the Bohr Theory, the Sommerfield extension of Bohr's work, the Octet Theory and Isotopes, as well as Ionisation Potentials and Solar Phenomena. Because much of the material of Atomic Theories lies on the boundary between experimentally verified fact and spec

  14. Padrões de imunofluorescência do fator antinuclear (FAN em células HEp-2 de soros reagentes para anti-SSA/Ro Antinuclear antibodies (ANA immunofluorescent pattern’s in HEp-2 cells on samples positive for anti-SSA/Ro

    Directory of Open Access Journals (Sweden)

    Priscila Schmidt Lora

    2007-02-01

    Full Text Available OBJETIVO: avaliar os padrões de imunofluorescência do fator antinuclear (FAN em soros reagentes para anticorpos anti-SSA/Ro e sua associação clínica. MÉTODO: foi realizado um estudo transversal retrospectivo, no qual foram revisadas as solicitações de anticorpos antiantígenos nucleares extraíveis (anti-ENA encaminhadas ao SPC/HCPA no período de dois anos. Das solicitações com resultado positivo para anti-ENA identificou-se qual ou quais auto-anticorpos estavam envolvidos (anti-SSA/Ro, anti-SSB/La, anti-RNP, anti-Sm, anti-Scl-70, bem como os padrões de imunofluorescência do FAN e os quadros clínicos dos pacientes anti-SSA/Ro positivo. As técnicas usadas para detecção e identificação foram FAN por imunofluorescência indireta (IFI em células HEp-2 e anti-ENA por hemaglutinação. RESULTADOS: das 392 solicitações analisadas 90 eram anti-ENA positivo. Houve um predomínio do sexo feminino (94% (86/91 e a idade média foi de 42 anos. O anti-SSA/Ro foi o mais freqüente (67,8% (61/90, sendo que todas as amostras anti-SSA/Ro positivas eram positivas para o FAN. O padrão de imunofluorescência nuclear pontilhado fino foi o predominante (68,9% (42/61 nos pacientes com anti-SSA/Ro positivo, e o quadro clínico mais encontrado foi de lúpus eritematoso sistêmico, em 50,8% (31/61 dos pacientes. CONCLUSÃO: o teste de FAN por IFI utilizando células HEp-2 é um bom método de triagem para detecção de auto-anticorpos anti-SSA/Ro, apresentando maior associação com o padrão nuclear pontilhado fino. Diferente do que tem sido descrito na literatura, não encontramos nenhuma amostra de pacientes com anti-SSA/Ro que tenham apresentado FAN falso-negativo na IFI. Pelo menos na nossa experiência, esses dados questionam o custo-efetividade da solicitação de rotina desse exame em pacientes FAN negativo pelo teste de IFI.OBJECTIVE: to evaluate the pattern at immunofluorescence of the antinuclear antibodies (ANA detected by the indirect

  15. INDUSTRIALISASI DAN TANTANGANNYA PADA SEKTOR PENDIDIKAN

    Directory of Open Access Journals (Sweden)

    Arif Unwanullah

    2015-10-01

    Full Text Available Abstrak: Industrialisasi dan Tantangannya pada Sektor Pendidikan. Sumbangan pendidikan dalam perubahan dan pembangunan masa lalu telah bergeser dengan kemajuan teknoekonomi dan komunikasi. Perubahan yang terjadi telah menggeser tatanan kehidupan dan pandangan masyarakat. Materialisme, kapitalisme, efisiensi, dan efektivitas telah menjadi tujuan dan semangat hidup. Pergeseran pandangan masyarakat telah mengubah pula pandangan keberhasilan dan mutu pendidikan, di mana pendidikan diukur dari keberhasilan dalam keterserapan lulusan dalam dunia kerja, oleh karenanya pendidikan dianalisis dari karakteristik sebagai investasi (capital-investment. Pergeseran makna dan tanggung jawab pendidikan mendorong dunia pendidikan melakukan pembaruan dengan alternatif: membangun pembaruan penalaran warganya menuju pemerdekaan dan pendewasaan, pendidikan dilaksanakan secara komprehensif dan bekerjasama dengan semua pihak secara kemitraan, dan membangun visi pendidikan secara komprehensif dan simultan dengan semua pihak. Kata kunci: perubahan sosial, materialistik, modernisasi dan kapitalis Abstract: Industrialization and its education Sector challenges. Contribution of education has shifted with the progress of technology, economy, and communication. The changes have shifted the society's views. Materialism, capitalism, efficiency, and effectiveness have become of interest and enthusiasm for life. The shift has changed society's view, i.e. the view of success and quality of education, in which education is measured from a rate of the absorption of graduates into labor market, therefore education is analyzed from the characteristics of an investment (capital-investment. A shift in meaning and responsibility of education encourages the education sector to create reformation through these following alternatives: creating new thoughts towards liberation and maturation, implementing education comprehensively and cooperating with all parties in partnership, and creating

  16. Atoms as Qed bound atoms

    International Nuclear Information System (INIS)

    The relevance of Quantum Electrodynamics (Qed) in contemporary atomic structure theory is reviewed. Recent experimental advances allow both the production of heavy ions of high charge as well as the measurement of atomic properties with a precision never achieved before. The description of heavy atoms with few electrons via the successive incorporation of one, two, etcetera photons in a rigorous manner and within the bound state Furry representation of Qed is technically feasible. For many-electron atoms the many-body (correlation) effects are very important and it is practically impossible to evaluate all the relevant Feynman diagrams to the required accuracy. Thus, it is necessary to develop a theoretical scheme in which the radiative and nonradiative effects are taken into account in an effective way making emphasis in electronic correlation. Preserving gauge invariance, and avoiding both continuum dissolution and variational collapse are basic problems that must be solved when using effective potential methods and finite-basis representations of them. In this context, we shall discuss advances and problems in the description of atoms as Qed bound states. (Author)

  17. Les immigrants dans les regions metropolitaines de recensement au Canada

    OpenAIRE

    Schellenberg, Grant

    2004-01-01

    Dans ce rapport, on examine les facteurs des immigrants dans les regions metropolitaines de recensement (RMR) au Canada, les repercussions sur les services publics offerts dans les regions urbaines et les caracteristiques de l'emploi des immigrants.

  18. ALMA Deep Field in SSA22: A concentration of dusty starbursts in a z=3.09 protocluster core

    CERN Document Server

    Umehata, H; Kohno, K; Ivison, R J; Alexander, D M; Geach, J; Hatsukade, B; Hughes, D H; Ikarashi, S; Kato, Y; Izumi, T; Kawabe, R; Kubo, M; Lee, M; Lehmer, B; Makiya, R; Matsuda, Y; Nakanishi, K; Saito, T; Smail, I; Yamada, T; Yamaguchi, Y; Yun, M

    2015-01-01

    We report the results of $1^{\\prime}.5 \\times3^{\\prime}$ mapping at 1.1~mm with the Atacama Large Millimeter/submillimeter Array (ALMA) toward the central region of the $z=3.09$ SSA22 protocluster. By combining our source catalog with archival spectroscopic redshifts, we find that eight submillimeter galaxies (SMGs) with flux densities, $S_{\\rm 1.1~mm}=0.7-6.4$~mJy ($L_{\\rm IR}\\sim10^{12.1}-10^{13.1}L_\\odot$) are at $z=3.08-3.10$. Not only are these SMGs members of the protocluster but they in fact reside within the node at the junction of the 50 Mpc-scale filamentary three-dimensional structure traced by Lyman-$\\alpha$ emitters (LAEs) in this field. The eight SMGs account for a star formation rate density (SFRD) $\\sim$10 $M_\\odot$ yr$^{-1}$ Mpc$^{-3}$ in the node, which is two orders of magnitudes higher than the global SFRD at this redshift. We find that four of the eight SMGs host a X-ray luminous active galactic nuclei (AGN). Our results suggest that the vigorous star formation activity and the growth of ...

  19. Effects of the Extraterrestrial Environment on Plants: Recommendations for Future Space Experiments for the MELiSSA Higher Plant Compartment

    Directory of Open Access Journals (Sweden)

    Silje A. Wolff

    2014-05-01

    Full Text Available Due to logistical challenges, long-term human space exploration missions require a life support system capable of regenerating all the essentials for survival. Higher plants can be utilized to provide a continuous supply of fresh food, atmosphere revitalization, and clean water for humans. Plants can adapt to extreme environments on Earth, and model plants have been shown to grow and develop through a full life cycle in microgravity. However, more knowledge about the long term effects of the extraterrestrial environment on plant growth and development is necessary. The European Space Agency (ESA has developed the Micro-Ecological Life Support System Alternative (MELiSSA program to develop a closed regenerative life support system, based on micro-organisms and higher plant processes, with continuous recycling of resources. In this context, a literature review to analyze the impact of the space environments on higher plants, with focus on gravity levels, magnetic fields and radiation, has been performed. This communication presents a roadmap giving directions for future scientific activities within space plant cultivation. The roadmap aims to identify the research activities required before higher plants can be included in regenerative life support systems in space.

  20. Lightning potential forecast over Nanjing with denoised sounding-derived indices based on SSA and CS-BP neural network

    Science.gov (United States)

    Wang, Jun; Sheng, Zheng; Zhou, Bihua; Zhou, Shudao

    2014-02-01

    The method of using the back propagation neural network improved by cuckoo search algorithm (hereafter CS-BP neural network) to forecast lightning occurrence from sounding-derived indices over Nanjing is presented. The general distribution features of lightning activities over Nanjing area are summarized and analyzed first. The sounding data of 156 thunderstorm days and 164 fair-weather days during the years 2007-2012 are used to calculate the values of sounding-derived indices. The indices are pre-filtered using singular spectrum analysis (hereafter SSA) as preprocessing technique and 4 most pertinent indices (namely CAPE, K, JI and SWEAT) are determined as inputs of CS-BP network by a linear bivariate analysis and selection algorithm. The cases of 2007-2010 are used to train CS-BP network and the cases of 2011-2012 are used as an independent sample to test the forecast performance. Some statistical skill score parameters (namely POD, SAR, CSI, et.al.) indicate that the CS-BP model excels in lightning forecasting and has a better performance compared with the traditional BP neural network and linear multiregression method.

  1. TRANSFORMASI ORGANISASIONAL DAN MSDM: HAMBATAN DAN IMPLIKASINYA PADA REKRUTMEN DAN SELEKSI

    Directory of Open Access Journals (Sweden)

    Licen Indahwati Darsono

    2002-01-01

    Full Text Available Rapid change of environment is an external force that causes the organization to transform. Fundamentally, the main purpose of the transformation is to change the organizational structure to be more flexible and competitive with fewer hierarchial levels, managers, and employees. The transformation needs to be radical, causing resistance from the organization's members. Their resistance can cause the transformation to fail, therefore organization must find ways to lessen this resistance. First, organization must learn about the diversity of its members' cultures and values. Second, organization must build its own organizational culture which can support the success of the transformation, by communicating it with the members of the organization. To support organizational culture building efforts, it needs changes in human resources practices, especially recruitment and selection. Abstract in Bahasa Indonesia : Perubahan yang cepat dalam lingkungan merupakan kekuatan eksternal yang mengakibatkan transformasi dalam sebuah organisasi. Pada dasarnya, tujuan utama dari transformasi tersebut adalah merubah struktur organisasi agar menjadi lebih fleksibel dan mampu bersaing, dengan tingkat structural yang sedikit, serta jumlah manajer dan karyawan yang lebih kecil. Transformasi tersebut harus menyeluruh, dan hal ini dapat menyebabkan resistensi dari para anggota organisasi yang memperhambat perubahan tersebut. Resistensi itu bisa menyebabkan perubahan tersebut batal, oleh karena itu organisasi harus mencari jalan untuk mengurangi hambatan-hambatan tersebut. Pertama, organisasi harus belajar keanekaragaman dari budaya dan nilai anggotanya. Kedua, organisasi harus mengembangkan budaya organisasi sendiri melalui komunikasi yang baik dengan anggotanya. Untuk mendukung usaha mengembangkan budaya organisasi, harus ada perubaban pada kebijakan sumber daya manusia, terutama dalam rekrutmen dan seleksi karyawan. Kata kunci: transformasi, resistensi, budaya

  2. Function of SSA subfamily of Hsp70 within and across species varies widely in complementing Saccharomyces cerevisiae cell growth and prion propagation.

    Directory of Open Access Journals (Sweden)

    Deepak Sharma

    Full Text Available BACKGROUND: The cytosol of most eukaryotic cells contains multiple highly conserved Hsp70 orthologs that differ mainly by their spatio-temporal expression patterns. Hsp70s play essential roles in protein folding, transport or degradation, and are major players of cellular quality control processes. However, while several reports suggest that specialized functions of Hsp70 orthologs were selected through evolution, few studies addressed systematically this issue. METHODOLOGY/PRINCIPAL FINDINGS: We compared the ability of Ssa1p-Ssa4p from Saccharomyces cerevisiae and Ssa5p-Ssa8p from the evolutionary distant yeast Yarrowia lipolytica to perform Hsp70-dependent tasks when expressed as the sole Hsp70 for S. cerevisiae in vivo. We show that Hsp70 isoforms (i supported yeast viability yet with markedly different growth rates, (ii influenced the propagation and stability of the [PSI(+] and [URE3] prions, but iii did not significantly affect the proteasomal degradation rate of CFTR. Additionally, we show that individual Hsp70 orthologs did not induce the formation of different prion strains, but rather influenced the aggregation properties of Sup35 in vivo. Finally, we show that [URE3] curing by the overexpression of Ydj1p is Hsp70-isoform dependent. CONCLUSION/SIGNIFICANCE: Despite very high homology and overlapping functions, the different Hsp70 orthologs have evolved to possess distinct activities that are required to cope with different types of substrates or stress situations. Yeast prions provide a very sensitive model to uncover this functional specialization and to explore the intricate network of chaperone/co-chaperone/substrates interactions.

  3. Monitoring Dan Analisis Kadar Aluminium (Al) Dan Besi (Fe) Pada Pengolahan Air Minum Pdam Tirtanadi Sunggal

    OpenAIRE

    Alwin Parulian

    2009-01-01

    Telah dilakukan penelitian berupa monitoring dan analisis kadar logam-logam Aluminium (Al) dan Besi (Fe) dalam sampel air yang diperoleh dari proses pengolahan air minum PDAM Tirtanadi Sunggal. Sampel air diambil dari empat titik yaitu: Air sungaiBelawan, air di clarifier, air di reservoar dan air limbah. Pemantauan dilakukan selama empat bulan mulai bulan Januari 2009 sampai April 2009. Kadar logam Aluminium dan Besi yang terdapat dalam sampel air tersebut dianalisis dengan menggunakan alat ...

  4. KESESUAIAN BERAT BADAN DAN TINGGI BADAN TERHADAP ESTIMASI BERAT BADAN DAN TINGGI BADAN PADA ETNIS MANDAR

    OpenAIRE

    Nurfadilla; Citrakesumasari; Syam, Aminuddin

    2015-01-01

    Data berat badan dan tinggi badan sangat diperlukan dalam penilaian status gizi dan penentuan kebutuhan zat gizi pasien. Penelitian ini bertujuan mengetahui kesesuaian (koefisien korelasi) antara BBA dengan estimasi BB berdasarkan LiLA dan TBA dengan estimasi TB berdasarkan tinggi lutut, dan rentang lengan pada usia dewasa etnis mandar. Jenis penelitian adalah penelitian deskriptif numerik dengan desain cross sectional. Teknik sampling menggunakan systematic random sampling, sebanyak 111 oran...

  5. Bruxims Dan Pengaruhnya Pada Wajah Dan Mulut Anak

    OpenAIRE

    Ringan Mariana Sitepu

    2008-01-01

    Bruxism merupakan salah satu kebiasaan buruk yang dilakukan anak. Kebiasaan ini biasanya dilakukan selama tidur tanpa disadari oleh anak. Suara bising yang ditimbulkan oleh kekuatan grinding biasanya didengar oleh orang tua atau orang yang menemani anak tidur. Awalnya bruxism tidak memberi pengaruh terhadap gigi tetapi selalu menimbulkan sakit kepala dan kelelahan otot pada miofasial ketika bangun tidur pada pagi hari, Rasa sakit pada kepala inilah yang sering dikeluhkan oleh anak pender...

  6. Soilless cultivation of soybean for Bioregenerative Life-Support Systems: a literature review and the experience of the MELiSSA Project - Food characterisation Phase I.

    Science.gov (United States)

    Paradiso, R; De Micco, V; Buonomo, R; Aronne, G; Barbieri, G; De Pascale, S

    2014-01-01

    Higher plants play a key role in Bioregenerative Life-Support Systems (BLSS) for long-term missions in space, by regenerating air through photosynthetic CO2 absorption and O2 emission, recovering water through transpiration and recycling waste products through mineral nutrition. In addition, plants could provide fresh food to integrate into the crew diet and help to preserve astronauts' wellbeing. The ESA programme Micro-Ecological Life-Support System Alternative (MELiSSA) aims to conceive an artificial bioregenerative ecosystem for resources regeneration, based on both microorganisms and higher plants. Soybean [Glycine max (L.) Merr.] is one of the four candidate species studied for soilless (hydroponic) cultivation in MELiSSA, because of the high nutritional value of the seeds. Within the MELiSSA programme - Food characterisation Phase I, the aim of the research carried out on soybean at the University of Naples was to select the most suitable European cultivars for cultivation in BLSS. In this context, a concise review on the state-of-the-art of soybean cultivation in space-oriented experiments and a summary of research activity for the preliminary theoretical selection and subsequent agronomical evaluation of four cultivars will be presented in this paper. PMID:23889907

  7. ANALISIS PERBEDAAN CITRA MRI BRAIN PADA SEKUENT1SE DAN T1FLAIR

    Directory of Open Access Journals (Sweden)

    Nursama Heru Apriantoro

    2015-10-01

    Full Text Available MRI adalah bagian dari ilmu kedokteran untuk mediagnosa kelainan organ dengan memanfaatkan medan magnet dan pergerakan proton atom hidrogen. Salah satu pemeriksaan MRI adalah pemeriksaan brain. Pemeriksaan MRI brain dapat dilakukan T1 weighted image Spin Echo (T1 SE atau T1 Fluid Attenuated Inversion Recovery (T1 FLAIR. Kajian dilakukan untuk menentukan perbedaan T1 SE dan T1 FLAIR dari segi citra berdasarkan nilai Rasio Signal terhadap Noise (SNR dengan MRI GE Type Signa HD xt 1.5 Tesla. Penelitian menggunakan pendekatan kuantitatif.  20 pasien  telah diambil pada pemeriksaan MRI brain pada potongan axial, dengan parameter T1 SE potongan axial dengan parameter Time Repetition (TR 700 ms, Time Echo (TE 20 ms, Field of View (FOV 240 mm, Slice Thickness 5,0 mm, Spacing 1,0 mm, Number of Excitations (NEX 1, Phase 224, dan total slice 20. T1 FLAIR  parameter TR 3000 ms, TE 13,9 ms, TI 920 ms, FOV 240 mm, slice thickness 5,0 mm, spacing 1,0 mm,   NEX 1, phase 224, dan total slice 20. SNR dihitung pada anatomi brain meliputi CSF (Cerebro Spinal Fluid, White Matter dan Gray Matter. Hasil penelitian kedua sequence tersebut menunjukkan bahwa sequence T1 SE lebih baik daripada sequence T1 FLAIR.

  8. Pembelajaran Kooperatif TAI dan Game Puzzle dalam Meningkatkan Motivasi Belajar dan Pemahaman Konsep Matematika

    Directory of Open Access Journals (Sweden)

    Any Herawati

    2014-06-01

    Full Text Available Penelitian ini mendeskripsikan rancangan dan pelaksanaan pembelajaran kooperatif Team Assisted Individualized (TAI dan game puzzle dalam meningkatkan motivasi belajar dan pemahaman konsep fungsi komposisi dan fungsi invers di SMA Negeri 3 Malang. Penelitian ini merupakan pene-litian tindakan kelas dengan pendekatan mix research, yang terjadi dalam tiga siklus. Subjek penelitian yang digunakan dalam penelitian ini adalah siswa kelas XI IPA 1 pada semester genap tahun pelajaran 2011/2012 SMA Negeri 3 Malang yang berjumlah 33 siswa, terdiri dari 13 siswa laki-laki dan 20 siswa perempuan. Data berupa motivasi belajar dan pemahaman konsep belajar siswa. Hasil penelitian me-nunjukkan bahwa pembelajaran kooperatif TAI dan game puzzle dapat meningkatkan motivasi belajar dan pemahaman konsep matematika, dan pembelajaran tersebut terbagi dalam sembilan tahap, yaitu (1 tahap persiapan yang meliputi persiapan materi, menentukan skor dasar, dan pembentukan kelompok, (2 tahap penyajian materi, (3 tahap belajar individual, (4 tahap belajar kelompok, (5 tahap diskusi kelas, (6 tahap tes individu, (7 penerapan bahan ajar game puzzle, (8 tahap penghargaan ke-lompok, dan (9 guru memberi tes akhir (ulangan harian sesuai dengan kompetensi yang ditentukan. Motivasi belajar siswa meningkat dari siklus ke siklus, respon siswa terhadap pembelajaran kooperatif TAI dan game puzzle adalah sangat positif. Kata kunci: pembelajaran kooperatif TAI, motivasi belajar, game puzzle, pemahaman konsep

  9. PENAPISAN DAN APLIKASI PROBIOTIK UNTUK PENGENDALIAN PENYAKIT STREPTOCOCCOSIS DAN LACTOCOCCOSIS PADA IKAN NILA (Oreochromis niloticus)

    OpenAIRE

    Azis, Hasni Y.; Anshary, Hilal; Latama, Gunarto; -, Sriwulan

    2015-01-01

    Isolasi dan identifikasi bakteri asam laktat yang memiliki potensi antibakteri terhadap bakteri penyebab penyakit streptococcosis/Lactococcosis dari usus ikan Lele Clarias gariepinus dan ikan gabus Ophiocephalus striatus telah dilakukan untuk mengatasi penyakit tersebut pada ikan nila Oreochromis niloticus. Sebanyak masing- masing 20 ekor ikan lele dan ikan gabus dibedah secara aseptic dengan mengambil bag...

  10. PERBEDAAN KUALITAS TIDUR DAN KUALITAS MIMPI ANTARA MAHASISWA LAKI-LAKI DAN MAHASISWA PEREMPUAN

    Directory of Open Access Journals (Sweden)

    Fuad Nashori, R. Rachmy Diana R. Rachmy Diana

    2012-11-01

    Full Text Available AbstrakPenelitian ini bertujuan untuk mengetahui perbedaan kualitas tidur dan kualitas mimpiantara mahasiswa pria dan mahasiswa wanita. Hipotesis yang diajukan adalah (a adaperbedaan kualitas tidur antara mahasiswa laki-laki dan mahasiswa perempuan,mahasiswawanita memiliki kualitas tidur yang lebih tinggi dibanding mahasiswa laki-laki, dan (b adaperbedaan kualitas mimpi antara mahasiswa laki-laki dan mahasiswa perempuan, mahasiswawanita memiliki kualitas mimpi yang lebih tinggi dibanding mahasiswa laki-laki.Alat ukur yang digunakan dalam penelitian ini adalah Skala Kualitas Tidur danSkala Kualitas Mimpi. Alat ukur Skala Kualitas Tidur dan Skala Kualitas Mimpidirumuskan berdasarkan teori kualitas tidur yang disusun oleh penulis. Subjek penelitian iniadalah 319 mahasiswa Universitas Islam Indonesia Yogyakarta, yang berasal dari delapanfakultas (psikologi, kedokteran, matematika dan ilmu pengetahuan, teknologi industri, teksniksipil dan perencanaan, ilmu agama islam, hukum, dan ekonomi.Hasil penelitian menunjukkan (a ada perbedaan kualitas tidur antara mahasiswa priadan wanita; mahasiswa wanita memiliki kualitas tidur yang lebih tinggi dibanding mahasiswalaki-laki, dan (b tidak ada perbedaan kualitas mimpi antara mahasiswa pria dan wanita.Kata kunci:    kualitas tidur, kualitas mimpi, jenis kelamin

  11. Dayak Punan: Eksploitasi Gaharu dan Ancaman Subsistensi

    OpenAIRE

    Marahalim Siagian

    2009-01-01

    Studi lapangan ini melihat subsistensi masyarakat Dayak Punan di interior hutan Kalimantan Timur (Kaltim) yang terisolasi, di mana gaharu (Aquilaria becacariana) merupakan hasil hutan utama yang diperdagangkan dan merupakan produk yang terintegrasi dengan pasar internasional. Tingginya harga dan permintaan pasar menyebabkan gaharu terus dieksploitasi. Akibat eksploitasi gaharu yang terus-menerus, gaharu menjadi sangat langka dan pencaharian Punan mulai terancam. ker-jul2006- (1)

  12. KOMPLIKASI, PENCEGAHAN DAN PENANGANAN EKSTRAVASASI AGEN KEMOTERAPI

    Directory of Open Access Journals (Sweden)

    I G A Mirah K

    2012-12-01

    Full Text Available Ekstravasasi agen kemoterapi ke jaringan sekitarnya merupakan kecelakaan yangdapat menyebabkan kerusakan jaringan progresif ireversibel dalam hitungan jamsampai hari. Manifestasi klinis ekstravasasi berupa nyeri, edema, eritema, danindurasi yang kemudian berkembang menjadi ulkus dan eschar hitam dankerusakan jaringan yang mendasarinya. Pencegahan terjadinya ekstravasasi dapatdilakukan dengan menggunakan pembuluh darah yang paten dan dengan aliranyang cepat dan tetap memperhatikan keluhan yang disampaikan pasien. Setiaptenaga kesehatan yang akan menangani pasien kanker dengan kemoterapi, dituntutmemiliki pengetahuan mengenai ekstravasasi agen kemoterapi yang bergunadalam meningkatkan pelayanan pada pasien dan mengurangi morbiditas.

  13. Des paysans dans la jungle

    OpenAIRE

    Krauskopff, Gisèle

    2003-01-01

    Cet article décrit les techniques de piégeage au filet utilisées par les Tharu. paysans qui vivent dans la forêt paludéenne du Terai. La chasse, comme la pêche, se pratique sans effusion de sang. Lorsqu'ils s'adressent aux esprits de la malemort, responsables de la plupart des maladies, les prêtres utilisent des techniques rituelles différentes selon la « catégorie du paysage » à laquelle les esprits sont associés, site habité ou forêt. « Dans la forêt », le prêtre, installé sur ses ma...

  14. Violence dans l’appareil

    OpenAIRE

    Bégin, Richard

    2008-01-01

    Dans une communauté médiatique comme la nôtre, de plus en plus fondée sur l’accessibilité de l’information (Youtube), l’économie des télé-réalités (Loft Story) et les diverses marques d’authenticité (Facebook), l’image s’échange et se monnaie davantage qu’elle ne se manifeste et ne se révèle à l’esprit. En d’autres termes, l’image dans l’hypermodernité occidentale perd constamment de sa force évocatrice au “profit” des seuls pouvoirs de la représentation et de la communication. L’image ainsi ...

  15. Dan Gospodnji. Povijest i teologija

    OpenAIRE

    Pažin, Zvonko; Reponj, Tea

    2016-01-01

    Autori donose povijesno-teološki prikaz slavljenja kršćanske nedjelje kao dana Gospodnjega od samih početaka do danas. Iako je prva jezgra kršćana bila sastavljena od Židova, kod kojih je bilo vrlo snažno naglašeno svetkovanje subote kao dana posvećenog Bogu i dana odmora, ipak su kršćani – pa i oni iz židovstva – od samih početaka slavili nedjelju kao dan Kristova uskrsnuća i kao dan euharistije u kojoj se ostvaruje vazmeno otajstvo Kristove smrti i uskrsnuća. Tek s Konstantinom je od 321...

  16. Perhitungan Dan Analisa Bandwidth Voip

    OpenAIRE

    Jaya, Wisan

    2010-01-01

    Voice over Internet Protocol (VoIP) adalah teknologi yang mampu melewatkan trafik suara, video dan data yang berbentuk paket melalui jaringan IP. Jaringan IP sendiri adalah merupakan jaringan komunikasi data yang berbasis paket switch, jadi dalam bertelepon menggunakan jaringan IP atau Internet. Dengan bertelepon menggunakan VoIP, banyak keuntungan yang dapat diambil diantaranya adalah dari segi biaya jelas lebih murah dari tarif telepon tradisional karena jaringan IP bersifat global, sehi...

  17. Gene transcript analysis blood values correlate with {sup 68}Ga-DOTA-somatostatin analog (SSA) PET/CT imaging in neuroendocrine tumors and can define disease status

    Energy Technology Data Exchange (ETDEWEB)

    Bodei, L. [European Institute of Oncology, Division of Nuclear Medicine, Milan (Italy); Kidd, M.; Modlin, I.M.; Drozdov, I. [Wren Laboratories, Branford, CT (United States); Prasad, V. [Charite University Hospital, Department of Nuclear Medicine, Berlin (Germany); Severi, S.; Paganelli, G. [Istituto Scientifico Romagnolo per lo Studio e la Cura dei Tumori (IRST) IRCCS, Nuclear Medicine and Radiometabolic Units, Meldola (Italy); Ambrosini, V. [S. Orsola-Malpighi University Hospital, Nuclear Medicine, Bologna (Italy); Kwekkeboom, D.J.; Krenning, E.P. [Erasmus Medical Center Rotterdam, Nuclear Medicine Department, Rotterdam (Netherlands); Baum, R.P. [Zentralklinik Bad Berka, THERANOSTICS Center for Molecular Radiotherapy and Imaging, Bad Berka (Germany)

    2015-08-15

    Precise determination of neuroendocrine tumor (NET) disease status and response to therapy remains a rate-limiting concern for disease management. This reflects limitations in biomarker specificity and resolution capacity of imaging. In order to evaluate biomarker precision and identify if combinatorial blood molecular markers and imaging could provide added diagnostic value, we assessed the concordance between {sup 68}Ga-somatostatin analog (SSA) positron emission tomography (PET), circulating NET gene transcripts (NETest), chromogranin A (CgA), and Ki-67 in NETs. We utilized two independent patient groups with positive {sup 68}Ga-SSA PET: data set 1 ({sup 68}Ga-SSA PETs undertaken for peptide receptor radionuclide therapy (PRRT), as primary or salvage treatment, n = 27) and data set 2 ({sup 68}Ga-SSA PETs performed in patients referred for initial disease staging or restaging after various therapies, n = 22). We examined the maximum standardized uptake value (SUV{sub max}), circulating gene transcripts, CgA levels, and baseline Ki-67. Regression analyses, generalized linear modeling, and receiver-operating characteristic (ROC) analyses were undertaken to determine the strength of the relationships. SUV{sub max} measured in two centers were mathematically evaluated (regression modeling) and determined to be comparable. Of 49 patients, 47 (96 %) exhibited a positive NETest. Twenty-six (54 %) had elevated CgA (χ{sup 2} = 20.1, p < 2.5 x 10{sup -6}). The majority (78 %) had Ki-67 < 20 %. Gene transcript scores were predictive of imaging with >95 % concordance and significantly correlated with SUV{sub max} (R {sup 2} = 0.31, root-mean-square error = 9.4). The genes MORF4L2 and somatostatin receptors SSTR1, 3, and 5 exhibited the highest correlation with SUV{sub max}. Progressive disease was identified by elevated levels of a quotient of MORF4L2 expression and SUV{sub max} [ROC-derived AUC (R {sup 2} = 0.7, p < 0.05)]. No statistical relationship was identified

  18. Gene transcript analysis blood values correlate with 68Ga-DOTA-somatostatin analog (SSA) PET/CT imaging in neuroendocrine tumors and can define disease status

    International Nuclear Information System (INIS)

    Precise determination of neuroendocrine tumor (NET) disease status and response to therapy remains a rate-limiting concern for disease management. This reflects limitations in biomarker specificity and resolution capacity of imaging. In order to evaluate biomarker precision and identify if combinatorial blood molecular markers and imaging could provide added diagnostic value, we assessed the concordance between 68Ga-somatostatin analog (SSA) positron emission tomography (PET), circulating NET gene transcripts (NETest), chromogranin A (CgA), and Ki-67 in NETs. We utilized two independent patient groups with positive 68Ga-SSA PET: data set 1 (68Ga-SSA PETs undertaken for peptide receptor radionuclide therapy (PRRT), as primary or salvage treatment, n = 27) and data set 2 (68Ga-SSA PETs performed in patients referred for initial disease staging or restaging after various therapies, n = 22). We examined the maximum standardized uptake value (SUVmax), circulating gene transcripts, CgA levels, and baseline Ki-67. Regression analyses, generalized linear modeling, and receiver-operating characteristic (ROC) analyses were undertaken to determine the strength of the relationships. SUVmax measured in two centers were mathematically evaluated (regression modeling) and determined to be comparable. Of 49 patients, 47 (96 %) exhibited a positive NETest. Twenty-six (54 %) had elevated CgA (χ2 = 20.1, p < 2.5 x 10-6). The majority (78 %) had Ki-67 < 20 %. Gene transcript scores were predictive of imaging with >95 % concordance and significantly correlated with SUVmax (R 2 = 0.31, root-mean-square error = 9.4). The genes MORF4L2 and somatostatin receptors SSTR1, 3, and 5 exhibited the highest correlation with SUVmax. Progressive disease was identified by elevated levels of a quotient of MORF4L2 expression and SUVmax [ROC-derived AUC (R 2 = 0.7, p < 0.05)]. No statistical relationship was identified between CgA and Ki-67 and no relationship with imaging parameters was evident. 68Ga-SSA

  19. EFEK PENAMBAHAN KAFEIN, HEPARIN DAN CALSIUM IONOPHORE TERHADAP PENINGKATAN KUALITAS SEMEN KAMBING BOER HASIL PEMISAHAN KROMOSOM X DAN Y

    OpenAIRE

    Sutomo Syawal, S.Pt.

    2005-01-01

    Tujuan penelitian ini yaitu untuk membandingkan kualitas semen kabing Boer hasil pemisahan kromosom X dan Y dengan penambahan kafein, heparin dan calsium ionophore. Rancangan yang digunakan adalah Rancangan Acak Lengkap (RAL) pola faktorial 2 x 3 x 6 dengan 3 kali ulangan. Faktor pertama adalah medium pemisah (10% dan 30%), faktor kedua penambahan kafein (0,1,2 dan 4 mM/L), heparin (0,1,2 dan 4 IU/mL) dan calsium ionophore (0,0,1,0,2 dan 0,4 mm/L ) dan faktor ketiga adalah lama penyimpanan (1...

  20. Condensation locale de l'hydrogène dans le chrome

    OpenAIRE

    P. PERETTO; Teisseron, G.; Berthier, J.

    1983-01-01

    Des expériences de corrélation angulaire perturbées effectuées sur des noyaux de hafnium actifs dilués dans une matrice de chrome montrent que la sonde peut piéger plusieurs atomes d'hydrogène. Cet effet est expliqué par l'influence de l'impureté de hafnium qui transforme localement le caractère répulsif des interactions entre atomes d'hydrogène dissous dans le chrome en une interaction très attractive. L'amas d'hydrogène subit une transformation à la température T ≃ 550 K. La transition est ...

  1. ANALISIS TINGKAT KEPUASAN DAN HARAPAN PASEN TERHADAP PELAYANAN PUSKESMAS DAN RUMAH SAKIT DAERAH PROVINSI DIY

    Directory of Open Access Journals (Sweden)

    Sunarto Sunarto

    2010-10-01

    Full Text Available Kepuasan merupakan perasaan seseorang mengenai kesenangan atau kekecewaan sebagai hasil membandingkan antara kinerja dan harapan. Jumlah kunjungan Puskesmas tahun 2007 sebesar 3.094.027 pasien yang terdiri dari 3.076442 rawat jalan dan 17.585 rawat inap. Penelitian untuk mengentahui gambaran tingkat kepuasan dan untuk mengetahui perbedaan tingkat kepuasan dan harapan pasien yang mendapatkan pelayanan Puskemas dan rumah sakit menurut wilayah Kabupatet / Kota di Propinsi DIY Penelitian ini merupakan penelitian deskriptif analitik dengan menggunakan rancangan cros sectional. Instrumen penelitian yang digunakan adalah kuisioner dengan 35 item pernyataan yang diambil dari atribut-atribut SERVQUAL dalam 5 dimensi. Total sampel untuk lima Kabupaten Kota sebanyak 1000, masing-masing Kabupaten Kota 200. Penelitian ini dilakukan terhadap pasien yang menerima pelayanan kesehatan di Puskesmas dan Rumah Sakit Daerah di Kabupaten-Kota Daerah Istimewa Yogyakarta. Penilaian tingkat kepuasan pasien ketika mereka berobat ke Puskesmas dan Rumah Sakit di Propinsi DIY, dengan menggunakan skala O sampai 4. Hasilnya adalah dimensi tangibles, rata-rata kepuasan pasien (2,96 cukup dan harapan pasien (3,38 pada dimensi reliability, rata-rata kepuasan pasien (3,01 bagus dan harapan pasien (3,40. Pada dimensi responsiveness, rata-rata kepuasan pa-sien (3,07 bagus dan harapan pasien (3,42. Dimensi assurance, rata-rata kepuasan pasien (3, 1 0 bagus dan harapan pasien (3 ,42. pada dimensi emphaty, rata-rata kepuasan pasien (3,02 bagus dan harapan pasien (3,35. Hasil uji statistik didapatkan nilai p > 0.05, berarti pada alpha 5%, dapat disimpulkan bahwa tidak terdapat perbedaan tingkat kepuasan diantara kelima wilayah kabupaten/kota di DIY. Penilaian tingkat kepuasan pasien, ketika mereka berkunjung ke Puskesmas dan Rumah Sakit di DIY secara rata-rata bagus dan tidak ada perbedaan tingkat kepuasan menurut wilayah Kabupaten-Kota di Propinsi DIY. Kata Kunci : Kepuasan, harapan

  2. Exotic atoms

    International Nuclear Information System (INIS)

    The experiments use a solid hydrogen layer to form muonic hydrogen isotopes that escape into vacuum. The method relies on transfer of the muon from protium to either a deuteron or a triton. The resulting muonic deuterium or muonic tritium will not immediately thermalize because of the very low elastic cross sections, and may be emitted from the surface of the layer. Measurements which detect decay electrons, muonic x-rays, and fusion products have been used to study the processes. A target has been constructed which exploits muonic atom emission in order to learn more about the energy dependence of transfer and muon molecular formation

  3. Atomic Clocks

    Science.gov (United States)

    Wynands, Robert

    Time is a strange thing. On the one hand it is arguably the most inaccessible physical phenomenon of all: both in that it is impossible to manipulate or modify—for all we know—and in that even after thousands of years mankind's philosophers still have not found a fully satisfying way to understand it. On the other hand, no other quantity can be measured with greater precision. Today's atomic clocks allow us to reproduce the length of the second as the SI unit of time with an uncertainty of a few parts in 1016—orders of magnitude better than any other quantity. In a sense, one can say [1

  4. Single atom measurement and atomic manipulation using atomic force microscope

    International Nuclear Information System (INIS)

    This paper explains studies to measure atomic force as the force linking an atom and atom, using an atomic force microscope (AFM). First, it describes the principle and device configuration of AFM, and as an example of the atomic force measurement of Si atoms on the surface of Si(111)-(7x7), it describes the technique to measure atomic force using AFM, as well as the uncertainty of probe tip against atomic force. In addition, it describes the following items on the measurement results of chemical bonding force: (1) chemical bonding force vs physical force and chemical bonding force vs current on the surface of Si(111)-(7x7), (2) chemical bonding force and element dependence on the surface of Si/Sn(111)-(√3x√3), (3) atomic manipulation based on AMF, and (4) relationship between atomic manipulation and the size of chemical bonding force with a probe. (A.O.)

  5. DIAGNOSIS DAN PENATALAKSANAAN KATUP URETRA POSTERIOR

    OpenAIRE

    Putu Primeriana Nugiaswari; Gede Wirya Kusuma Duarsa; Sri Maliawan

    2012-01-01

    Katup uretra posterior merupakan penyebab utama kesakitan, kematian, dan kerusakanginjal berkelanjutan pada anak-anak. Kelainan ini berupa lipatan mukosa abnormalkongenital pada uretra pars prostatika yang menyerupai membran tipis yangmenghambat drainase kandung kemih. Katup uretra posterior mayoritas didiagnosis saatprenatal melalui penggunaan ultrasonografi maternal. Tingkat keparahan dan derajatobstruksi yang disebabkan oleh kelainan ini tergantung pada konfigurasi dari membranobstruktif d...

  6. PERUBAHAN, KEBUDAYAAN, DAN AGAMA: PERSPEKTIF ANTROPOLOGI KEKUASAAN

    Directory of Open Access Journals (Sweden)

    Wa Ode Sifatu

    2015-06-01

    Full Text Available Perubahan, kebudayaan, dan agama, merupakan temayang menarik untuk dikaji secara antropologis mengingatmasyarakat Negara Kesatuan Republik Indonesia (NKRImerupakan masyarakat majemuk dalam segala aspekkehidupan. Bagaimana perubahan, kebudayaan, dan agamamenjadi sumber konflik dalam kehidupan berasyarakat diIndonesia. Tulisan ini menelusuri kedudukan perubahan,kekuasaan, dan agama melalui penelusuran kepustakaanuntuk memahami nilai analitis yang bersifat heuristikdalam konteks antropologi kekuasaan.Sejak keberadaan manusia di muka bumi,manusia selalu bertanya tentang asal-usul keberadaannya,kehidupannya, dan keberadaannya nanti setelah kematian.Manusia berupaya menjawab pertanyaan tersebutmelalui berbagai cara di antaranya melalui agama danilmu pengetahuan. Namun agama menyediakan surgadan neraka, serta ilmu pengetahuan melahirkan berbagaikemudahan dan efek samping yang menimbulkan kerugianbagi manusia sehingga manusia selalu diselimuti olehperasaan takut. Dalam kondisi seperti itu, banyak pihakyang karena kekuasaannya mengklaim kelompoknyasebagai ahli surga sedangkan kelompok lain adalah ahlineraka.

  7. DETERMINAN TRUE DISCOUNT DAN MARKET REACTIONS PENAWARAN SAHAM

    OpenAIRE

    Muniya Alteza

    2013-01-01

    Abstrak: Determinan True Discount dan Market Reactions Penawaran Saham. Penelitian ini bertujuan menguji beberapa variabel sebagai determinan initial return penawaran saham perdana. Initial return dihitung dalam dua komponen, true discount dan market reaction. Determinan true discount dan market reactions dipilih berdasarkan hipotesis asimetri informasi dan hipotesis aftermarket liquidity. Total sampel yang dikumpulkan mencakup 40 penawaran saham perdana periode 2005-2008. Teknik analisis dat...

  8. DAMPAK PENGGUNAAN PENGUKUR KINERJA DAN EVALUASI DALAM KEMAMPUAN STRATEGIS ORGANISASI

    OpenAIRE

    Ewing Yuvisa Ibrani

    2014-01-01

    Penelitian ini bertujuan untuk menguji apakah peran pengukuran kinerja dapat memfasilitasi keputusan dan hubungannya dengan evaluasi umpan balik dan umpan kedepan serta dapat mempengaruhi kemampuan dalam menghasilkan kemampuan baru sehingga dapat mempengaruhi hasil kinerja SBU. Penelitian ini dilakukan pada 88 Perusahaan dibidang industri kimia di Serang dan Cilegon, Banten, dengan objek penelitian adalah manajer produksi dan manajer pemasaran. Penelitian ini menggunakan metode penelitian sur...

  9. Risiko Hukum Dan Bisnis Perusahaan Tanpa Corporate Social Responsibility

    OpenAIRE

    Jaswinderjit

    2011-01-01

    Corporate Social Responsibility (CSR) adalah komitmen perusahaan atau dunia bisnis untuk berkontribusi dalam pengembangan ekonomi yang berkelanjutan dengan memperhatikan tanggung jawab sosial dan perusahaan dan menitikberatkan pada keseimbangan antara perhatian terhadap aspek ekonomi, sosial, dan lingkungan. Pokok permasalahan yang akan dibahas dalam skripsi ini mengenai cara suatu perusahaan di dalam memandang CSR, konteks pelaksanaan CSR di Indonesia, dan risiko hukum dari suatu perusahaan ...

  10. KARAKTERISASI SIMPLISIA DAN EKSTRAK DAUN STROBILANTHUS CRISPUS

    Directory of Open Access Journals (Sweden)

    Ani Isnawati

    2012-10-01

    Full Text Available Khasiat obat tradisional disebabkan oleh adanya senyawa kimia yang  dikandungnya. Bahan baku obat dari hasil pertanian atau kumpulan tumbuhan liar tentunya kandungan kimianya tidak dapat dijamin selalu konstan (ajeg karena adanya variabel bibit, tempat tumbuh, iklim, kondisi (umur dan cara panen. Kandungan senyawa kimia yang bertanggung jawab terhadap respon biologis harus mempunyai spesifikasi kimia, yaitu informasi  komposisi (jenis dan kadar. 0leh karena itu penetapan karakterisasi suatu simplisia dan ekstrak perlu dilakukan guna menjamin bahwa bahan suatu produk obat tradisional dapat diketahui mutunya. Karakterisasi dilakukan terhadap Tanaman Strobilanthus crispus (BL, yaitu simplisia bagian daun dan ekstrak 50% tanaman tersebut. Karakterisasi simplisa meliputi : penetapan kadar abu, kadar abu larut air, kadar abu tidak larut asam, kadar sari larut air, kadar sari larut asam, dan kadar air secar·a destilasi. Cara penetapan diatas dilakukan sesuai prosedur yang Ielah ditetapkan MMI, 1979. Sedangkan karakterisasi ekstrak mencakup : karakterisasi non spesifik yang meliputi penetapan bobot  jenis, kadar air, kadar sisa pelarut, kadar abu dan karakterisasi spesifik yang mencakup  pemeriksaan·senyawa yang terlarut dalam pelarut air dan etanol, pola kromatografi dengan cara KLT-densitometri, pemeriksaan golongan kimia ekstrak dan penetapan kadar zat kimia. Hasil penetapan karakterisasi simplisia menunjukkan spesifikasi tidak sesuai dengan yang dipersyaratkan MMI, hanya penetapan sari larut etanol yang memenuhi persyaratan. Penetapan karakterisasi ekstrak etanol 50% menunjukkan tidak terdapat etanol dalam ekstrak, kadar air 13,3 %; bobot jenis 1,262%, senyawa terlarut dalam pelarut air 95,06%, senyawa terlarut dalam pelarut etanol 18,69 % dan kadar flavonoid  17,59 % serta  profil  kromatogram komponen utama fraksi heksan, Khloroform dan etanol.

  11. Atom Skimmers and Atom Lasers Utilizing Them

    Science.gov (United States)

    Hulet, Randall; Tollett, Jeff; Franke, Kurt; Moss, Steve; Sackett, Charles; Gerton, Jordan; Ghaffari, Bita; McAlexander, W.; Strecker, K.; Homan, D.

    2005-01-01

    Atom skimmers are devices that act as low-pass velocity filters for atoms in thermal atomic beams. An atom skimmer operating in conjunction with a suitable thermal atomic-beam source (e.g., an oven in which cesium is heated) can serve as a source of slow atoms for a magneto-optical trap or other apparatus in an atomic-physics experiment. Phenomena that are studied in such apparatuses include Bose-Einstein condensation of atomic gases, spectra of trapped atoms, and collisions of slowly moving atoms. An atom skimmer includes a curved, low-thermal-conduction tube that leads from the outlet of a thermal atomic-beam source to the inlet of a magneto-optical trap or other device in which the selected low-velocity atoms are to be used. Permanent rare-earth magnets are placed around the tube in a yoke of high-magnetic-permeability material to establish a quadrupole or octupole magnetic field leading from the source to the trap. The atoms are attracted to the locus of minimum magnetic-field intensity in the middle of the tube, and the gradient of the magnetic field provides centripetal force that guides the atoms around the curve along the axis of the tube. The threshold velocity for guiding is dictated by the gradient of the magnetic field and the radius of curvature of the tube. Atoms moving at lesser velocities are successfully guided; faster atoms strike the tube wall and are lost from the beam.

  12. KONSTRUKSI DETERMINAN DALAM FRASA NOMINA BAHASA PRANCIS DAN BAHASA INDONESIA

    Directory of Open Access Journals (Sweden)

    Roswita Lumban Tobing

    2012-06-01

    Full Text Available Artikel ini bertujuan untuk memaparkan konstruksi determinan pada frasa nomina bahasa Perancis dan bahasa Indonesia. Analisis yang digunakan adalah analisis kontrastif. Hasil analisis menunjukkan bahwa nomina bahasa Perancis memiliki jenis kelamin (maskulin/feminin dan jumlah (tunggal/jamak. Gender dan jumlah dalam bahasa Prancis memiliki aturan konkordansi yang dapat memengaruhi bentuk dan makna nomina. Dalam bahasa Indonesia, meskipun nomina memiliki konsep gender tunggal dan jamak, jenis dan jumlah dalam bahasa Indonesia tidak muncul secara eksplisit. Bentuk ini hanya ditandai dengan karakteristik semantik tertentu yang dapat menunjukkan jenis kelamin, bentuk tunggal, dan bentuk jamak.

  13. The Virtual Observatory Service TheoSSA: Establishing a Database of Synthetic Stellar Flux Standards II. NLTE Spectral Analysis of the OB-Type Subdwarf Feige 110

    Science.gov (United States)

    Rauch, T.; Rudkowski, A.; Kampka, D.; Werner, K.; Kruk, J. W.; Moehler, S.

    2014-01-01

    Context. In the framework of the Virtual Observatory (VO), the German Astrophysical VO (GAVO) developed the registered service TheoSSA (Theoretical Stellar Spectra Access). It provides easy access to stellar spectral energy distributions (SEDs) and is intended to ingest SEDs calculated by any model-atmosphere code, generally for all effective temperatures, surface gravities, and elemental compositions. We will establish a database of SEDs of flux standards that are easily accessible via TheoSSA's web interface. Aims. The OB-type subdwarf Feige 110 is a standard star for flux calibration. State-of-the-art non-local thermodynamic equilibrium stellar-atmosphere models that consider opacities of species up to trans-iron elements will be used to provide a reliable synthetic spectrum to compare with observations. Methods. In case of Feige 110, we demonstrate that the model reproduces not only its overall continuum shape from the far-ultraviolet (FUV) to the optical wavelength range but also the numerous metal lines exhibited in its FUV spectrum. Results. We present a state-of-the-art spectral analysis of Feige 110. We determined Teff =47 250 +/- 2000 K, log g=6.00 +/- 0.20, and the abundances of He, N, P, S, Ti, V, Cr, Mn, Fe, Co, Ni, Zn, and Ge. Ti, V, Mn, Co, Zn, and Ge were identified for the first time in this star. Upper abundance limits were derived for C, O, Si, Ca, and Sc. Conclusions. The TheoSSA database of theoretical SEDs of stellar flux standards guarantees that the flux calibration of astronomical data and cross-calibration between different instruments can be based on models and SEDs calculated with state-of-the-art model atmosphere codes.

  14. An extremely dense group of massive galaxies at the centre of the protocluster at z = 3.09 in the SSA22 field

    Science.gov (United States)

    Kubo, M.; Yamada, T.; Ichikawa, T.; Kajisawa, M.; Matsuda, Y.; Tanaka, I.; Umehata, H.

    2016-01-01

    We report the discovery of an extremely dense group of massive galaxies at the centre of the protocluster at z = 3.09 in the SSA22 field from near-infrared spectroscopy conducted with the multi-object infrared camera and spectrograph (MOIRCS) on the Subaru Telecope. The newly discovered group comprises seven galaxies confirmed at zspec ≈ 3.09 within 180 kpc, including five massive objects with the stellar masses larger than 1010.5 M⊙ and is associated with a bright submillimetre source SSA22-AzTEC14. The dynamical mass of the group estimated from the line-of-sight velocity dispersion of the members is Mdyn ˜ 1.6 ± 0.3 × 1013 M⊙. Such a dense group is expected to be very rare at high redshift, as we have found only a few comparable systems in large-volume cosmological simulations. Such rare groups in simulations are hosted in collapsed haloes with Mvir = 1013.4-1014.0 M⊙ and evolve into the brightest cluster galaxies (BCGs) of the most massive clusters at present. The observed AzTEC14 group at z = 3.09 is therefore very likely to be a proto-BCG in the multiple merger phase. The observed total stellar mass of the group is 5.8^{+5.1}_{-2.0}× 10^{11} M_{⊙}, which suggests that over half the stellar mass of its descendant had been formed by z = 3. Moreover, we have identified over two members for each of the four Lyα blobs (LABs) using our new spectroscopic data. This verifies our previous argument that many of the LABs in the SSA22 protocluster associated with multiple developed stellar components.

  15. Desain Dan Analisis Perhitungan Roda Pendaratan Pesawat Tanpa Awak

    OpenAIRE

    Aulia, T. Muhammad Rinaldi

    2015-01-01

    Landing gear merupakan struktur pesawat yang berfungsi menahan beban statis pesawat dan juga beban dinamis ketika pesawat melakukan pendaratan. Dalam mendesain landing gear dilakukan pemilihan jenis landing gear dan dilakukan analisis perhitungan pada tiap komponen landing gear yang meliputi pusat gravitasi, tinggi pesawat, wheel base, wheel track, dan roda. Desain dan analisis perhitungan dilakukan dengan metode studi pustaka dimana setiap desain dan perhitungan didasarkan pada literatur pu...

  16. PENGARUH RELIGIUSITAS DAN ETIKA KERJA ISLAMI TERHADAP MOTIVASI KERJA

    OpenAIRE

    Fauzan Fauzan; Irma Tyasari

    2015-01-01

    Penelitian ini bertujuan untuk mengetahui apakah ada pengaruh antara religiustas dan etika kerja islami terhadap motivasi kerja. Dugaan awal, religiustas dan etika kerja islami berpengaruh terhadap motivasi kerja. Subjek penelitian ini adalah para guru di SMP yang dikelola oleh LP Ma’arif Kota Malang. Penelitian ini menggunakan kuesioner adaptasi dan modifikasi skala Islamic Work Ethics yang dkembangkan oleh Abbas Ali ( 1987) dan skala religiusitas yang dikembangkan oleh Glock dan Stark (1996...

  17. RELASI RATING OBLIGASI DAN MARKET INDEKS PASAR MODAL INDONESIA

    OpenAIRE

    Amirah -

    2010-01-01

    Tujuan dari penelitian ini adalah untuk menguji pengaruh perubahan rating obligasi baik saat di upgrade dan downgrade pada kepekaan hubungan antara return saham dan return pasar. Selain itu, penelitian ini menguji pengaruh perubahan rating obligasi terhadap intercept dan koefisien dalam model. Purposive sampling digunakan sebagai metode sampling dengan persyaratan semua penerbitan saham dan obligasi diambil dari Bursa Efek Indonesia pada 2000-2007 dan regresi linier sederhana dengan variabel ...

  18. ANALISIS KOMPARATIF KINERJA KEUANGAN DAN PREDIKSI KEBANGKRUTAN PERUSAHAAN TELEKOMUNIKASI

    OpenAIRE

    Gen Norman T

    2013-01-01

    Penelitian ini bertujuan untuk mengungkapkan perbandingan kinerja keuangan dan prediksi kebangkrutan pada dua perusahaan layanan jasa telekomunikasi (PT Bakrie Telecom, Tbk. dan PT Mobile-8 Telecom, Tbk.) dibandingkan dengan perusahaan layanan jasa telekomunikasi lainnya yang lebih mapan, seperti PT Telkom Tbk., PT Indosat Tbk., dan PT XL Axiata Tbk. PT Bakrie Telecom, Tbk. dan PT Mobile-8 Telecom, Tbk. masih baru dan relatif belum teruji, sehingga sangat menarik untuk dilakukan p...

  19. KONSTRUKSI DETERMINAN DALAM FRASA NOMINA BAHASA PRANCIS DAN BAHASA INDONESIA

    OpenAIRE

    Roswita Lumban Tobing

    2012-01-01

    Artikel ini bertujuan untuk memaparkan konstruksi determinan pada frasa nomina bahasa Perancis dan bahasa Indonesia. Analisis yang digunakan adalah analisis kontrastif. Hasil analisis menunjukkan bahwa nomina bahasa Perancis memiliki jenis kelamin (maskulin/feminin) dan jumlah (tunggal/jamak). Gender dan jumlah dalam bahasa Prancis memiliki aturan konkordansi yang dapat memengaruhi bentuk dan makna nomina. Dalam bahasa Indonesia, meskipun nomina memiliki konsep gender tunggal dan jamak, jenis...

  20. UJI POTENSI Gliocladium sp TERHADAP PERTUMBUHAN DAN PRODUKSI TANAMAN TOMAT

    OpenAIRE

    Lina Herlina

    2013-01-01

    AbstrakMikroorganisme tanah seperti Gliocladium sp dapat bertindak sebagai dekomposer dan juga sebagai agen pengendali hayati patogen tanaman hal ini memberikan harapan untuk mengurangi penggunaan pupuk dan fungisida sintetik. Tujuan penelitian untuk menguji potensi biofertililzer Gliocladium sp terhadap pertumbuhan dan produksi buah tomat. Variabel bebas yaitu bioferlizer Gliocladium sp  dengan dosis (g/tanaman) 0,50, 100, 150, dan 200 .Variabel tergantung adalah pertumbuhan dan produksi tan...

  1. Analisis Komparatif Asertifitas Dan Harga Diri Mahasiswa Laki-Laki Dan Perempuan Pada Fakultas Ekonomi Universitas Sumatera Utara Medan

    OpenAIRE

    Anggoro Trianto Sudiro

    2008-01-01

    Anggoro Trianto Sudiro. Analisis Komparatif Asertifitas dan Harga Diri Mahasiswa Laki-laki dan Perempuan pada Fakultas Ekonomi Universitas Sumatera Utara Medan. Dibimbing oleh Prof. Dr. Ritha F. Dalimunthe, SE, MSi, Dra. Friska Sipayung, MSi, Dra. Lucy Anna, MS dan Dra, Nisrul Irawati, MBA. Tujuan dari penelitian ini adalah untuk mengetahui apakah terdapat perbedaan Asertifitas dan Harga Diri antara mahasiswa laki-laki dan mahasiswa perempuan pada Fakultas Ekonomi Universitas Sumatera Utara. ...

  2. PENGARUH PROSES PENGERINGAN DAN IMOBILISASI TERHADAP AKTIVITAS DAN KESTABILAN ENZIM BROMELAIN DARI BUAH NENAS (Ananas comosus (L) Merr)

    OpenAIRE

    ISHAK, MEILTY CHRISTY

    2012-01-01

    Meilty Christy Ishak (G61108260). Pengaruh Proses Pengeringan dan Imobilisasi Terhadap Aktivitas dan Kestabilan Enzim Bromelain dari Buah Nenas (Ananas comosus (L) Merr) (Di Bawah Bimbingan Februadi Bastian dan Amran Laga). RINGKASAN Enzim bromelain merupakan enzim protease dari buah nenas, enzim ini memiliki sifat seperti enzim rennin (renat), papain, dan fisin. Tujuan dari penelitian ini adalah untuk mengetahui pengaruh proses pengeringan enzim terhadap aktivitas enzim, dan untuk men...

  3. Tanggap Pertumbuhan Dan Produksi Tanaman Jagung Manis (Zea mays Saccharata Sturt.) Terhadap Pemberian Pupuk Anorganik Cair Dan Umur Pemangkasan Daun

    OpenAIRE

    Sianipar, Rimna Regina

    2012-01-01

    Tanaman jagung yang masuk ke Indonesia belum dapat dipastikan, tetapi pendapat umum menyatakan bahwa tanaman ini masuk ke Indonesia sekitar 3-4 abad yang lalu oleh orang-orang Portugis dan Spanyol melalui India dan Tiongkok. Pertanaman jagung di Indonesia terutama terdapat di Jawa, Madura dan Sulawesi. Hingga saat ini tanaman jagung merupakan tanaman makanan yang penting di daerah tropis dan subtropis. Luas pertanaman jagung di dunia menempati urutan ke-3 setelah tanaman gandum dan padi ...

  4. Perbedaan Kadar Malondialdehide dan Tromboksan B2 pada Remaja dengan Dismenore dan Tanpa Dismenore

    OpenAIRE

    Berliana Irianti; Ermawati .; Arni Amir

    2015-01-01

    Abstrak Penyebab dismenore belum semuanya diketahui, ada dugaan peningkatan proses peroksida lipid yang akan mengaktivasi mediator inflamasi pada endometrium yang menimbulkan rasa nyeri haid (dismenore). Tujuan penelitian ini adalah menentukan perbedaan kadar malondialdehide dan tromboksan B 2  pada dismenore dan tanpa dismenore. Studi observasional ini menggunakan desain potong lintang komparatif. Subjek penelitian terdiri dari dua kelompok yaitu 23 remaja dismenore dan 23 remaja tanpa disme...

  5. Perbandingan Konflik Peran Jender Dan Seksisme Laki-Laki Suku Bangsa Batak, Minangkabau Dan Jawa

    OpenAIRE

    Meutia Nauly

    2007-01-01

    Persepektif laki-laki perlu dicermati dalam konteks ketidak-adilan jender sebab komunitas ini pun ternyata bagian dari korban ketidak-adilan jender tersebut. Peningkatan kemampuan ekonomi, emosi dan sosial dari perempuan di satu sisi memerlukan pengembangan identitas baru laki-laki, antara lain memperbesar bagiannya dalam hal pengasuhan dan perawatan, sehingga perempuan tidak dibebani berlebihan dan laki-laki memiliki kebanggaan akan peran sebagai ayah, oleh Meutia Nauly

  6. Penskalaan Butir Format Respons Pilihan dan Respons Bebas Berdasarkan Model Rasch dan Partial Credit

    Directory of Open Access Journals (Sweden)

    Eko Hariadi

    2007-06-01

    Full Text Available Penelitian melihat pengaruh jumlah parameter butir, kategori respons bebas (RB, pengaruh sampel terhadap akurasi estimasi parameter kemampuan untuk menghasilkan estimasi yang stabil dan pengaruh pembobotan butir RP dan butir RB terhadap kesalahan baku. Penelitian dalam dua tahap, simulasi menggunakan 30 kondisi dengan replikasi 50 dengan variabel panjang tes, jumlah kategori, dan jumlah parameter butir, dan analisis deskriptif, dilanjutkan penerapan penskalaan gabungan butir tipe respons pilihan (rp dan butir respons bebas (rb pada konstruksi tes elektronika yang terdiri 40 butir pilihan ganda dan 4 butir jawaban tersusun, 3 butir memiliki lima kategori jawaban dan 1 butir dengan 4 kategori jawaban, melibatkan 355 siswa. Hasil penelitian menunjukkan: ukuran sampel kurang berpengaruh pada root mean square error atau (RSME> dan korelasi antara 9 dengan 0, namun berpengaruh terhadap akurasi estimasi parameter butir pilihan ganda (/>/y,dan parameter butir respons tersusun (3^- Jumlah parameter butir berpengaruh terhadap parameter kemampuan, tetapi tidak berpengaruh terhadap akurasi dari b^, dan S„,. Estimasi dari parameter tingkat kesulitan butir jawaban tersusun tiga kategori lebih akurat daripada butir jawaban tersusun lima kategori. Estimasi tahan {robust untuk parameter kesulitan butir jawaban tersusun 5 kategori memerlukan sampel minimal 250 responden, sedangkan untuk butir respons tersusun 3 kategori memerlukan sampel minimal 100 responden. Estimasi parameter kemampuan dari skor total (0^^ tidak sama dengan rata-rata jumlah tbeta dari masing-masing subtes (0^ + 0CR. Theta dari tes yang dikalibrasi bersama-sama berbeda dengan theta dari total subtes yang dikalibrasi secara terpisah. Korelasi kemampuan yang mengunakan pembobotan dan kemampuan tanpa pembobotan mempunyai suatu rentang dari 0,988 sampai 0,948. Kata kunci: penyekaiaan, model rash dan partial credit.

  7. DISTRIBUSI TINGKAT KARAT DAN LAJU KOROSI BAJA ST. 37 DALAM LINGKUNGAN AIR LAUT DAN AIR TANAH

    OpenAIRE

    Leonard, Johannes

    2012-01-01

    Untuk mempelajari fenomena pengaruh lingkungan korosif terhadap korosi pada baja karbon st.37, maka pengamatan terhadap masalah tersebut telah dilaksanakan. Tujuan penelitian ini adalah untuk menentukan tingkat karat, tipe dan laju korosi yang terjadi pada plat baja karbon st.37 yang digunakan dalam air laut dan air tanah. Pengujian dilakukan melalui percobaan perendaman pada suhu ruang. Air laut berasal dari perairan sekitar wilayah kota Makassar dan air tanah dari pinggiran kota Sunggum...

  8. Pembuatan Dan Karakterisasi Paving Block Sebagai Beton Konstruksi Dengan Menggunakan Campuran Oil Sludge Dan Semen

    OpenAIRE

    Reni Naibaho

    2009-01-01

    Bahan yang digunakan dalam penelitian ini adalah limbah pertamina (oil sludge) dari PT Pertamina Pangkalan Susu - Kab. Langkat, yang dihasilkan dari proses pengeboran minyak. Limbah ini termasuk limbah padat yang telah mengering dan berbentuk gumpalan (oil sludge). Adapun besaran fisis yang diamati pada sampel paving blok adalah antara lain: porositas, densitas, dan serapan air. Sedangkan besaran mekanika adalah kekerasan, kuat tekan, kuat impak dan kuat patah. Dari hasil penelitian menunjukk...

  9. Pembuatan Dan Karakterisasi Bata Konstruksi Dengan Memanfaatkan Limbah Padat Pulp Dan Semen

    OpenAIRE

    Siti Aisyah Ritonga

    2009-01-01

    Penelitian ini dilakukan dengan tujuan pemanfaatan limbah padat pulp dregs, grits, dan biosludge dalam pembuatan bata. Pada penelitian ini digunakan limbah padat pulp dregs, grits, dan biosludge, dengan variasi komposisi semen 0%, 5%, 10%, 15%, 20%, 25%, dan 30%. Proses pencetakan benda uji dilakukan dengan cara cetak tekan sebesar 5000 kg force. Hasil penelitian menunjukkan bahwa kuat tekan bata dengan campuran limbah padat pulp pada komposisi semen 30% menyamai kuat tekan bata normal. Hasil...

  10. Pencahayaan Buatan pada Pendekatan Teknis dan Estetis untuk Bangunan dan Ruang Dalam

    OpenAIRE

    Budi Setiawan; Grace Hartanti

    2014-01-01

    Cahaya merupakan hal yang penting bagi manusia dan makhluk hidup lainnya. Tanpa cahaya atau penerangan tentu sulit untuk beraktivitas, terutama saat hari menjelang malam. Seiring berkembangnya peradaban dan teknologi, manusia menciptakan pencahayaan buatan. Awalnya, pencahayaan buatan sebagai pengganti sinar alami matahari, lalu cahaya buatan yang didapat dari api, kemudian penelitian dan pengembangan bola lampu oleh Alessandro Volta, Sir Humphry Davy, Warren De La Rue, hingga Tho...

  11. Livres et lecture dans le monde ottoman

    OpenAIRE

    Anastassiadou, Meropi; Arnaud, Jean-Luc; Balta, Evangelia; Bilici, Faruk; Bounfour, Abdallah; Clayer, Nathalie; Denoix, Sylvie; Depaule, Jean-Charles; Dévényid, Kinga; Establet, Colette; Guichard, Pierre; Henry, Jean-Robert; Heyberger, Bernard; Hitzel, Frédéric; Kenderova, Stoyanka

    2004-01-01

    Au cours de ces dernières années, l'histoire du livre et de la lecture s'est affirmée comme l'un des domaines majeurs de l'histoire culturelle. Dans l'Empire ottoman, cette histoire prend une forme particulière car non seulement l'imprimerie en caractères arabes ne fait officiellement son apparition à Istanbul qu'en 1729, mais encore parce que, dans cet empire, cohabitent dans une civilisation commune, des langues et des religions différentes. Les études ici réunies dressent un premier bilan ...

  12. Être dans la musique

    OpenAIRE

    Legrain, Laurent

    2011-01-01

    “Être dans la musique”… cette expression maintes fois entendue dans le cadre d’interviews ou de discussions informelles menées avec des amateurs de jazz montre toute l’importance de ces moments musicaux particuliers dans les trajectoires des amateurs. Mais comment approcher analytiquement cet état fugace et, à la manière des amateurs, le placer au centre de nos préoccupations ? En dénouant le corset kantien qui enserre l’esthétique, de nombreux auteurs ont esquissé les contours d’une notion, ...

  13. DIAGNOSIS DAN PENATALAKSANAAN KATUP URETRA POSTERIOR

    Directory of Open Access Journals (Sweden)

    Putu Primeriana Nugiaswari

    2012-12-01

    Full Text Available Katup uretra posterior merupakan penyebab utama kesakitan, kematian, dan kerusakanginjal berkelanjutan pada anak-anak. Kelainan ini berupa lipatan mukosa abnormalkongenital pada uretra pars prostatika yang menyerupai membran tipis yangmenghambat drainase kandung kemih. Katup uretra posterior mayoritas didiagnosis saatprenatal melalui penggunaan ultrasonografi maternal. Tingkat keparahan dan derajatobstruksi yang disebabkan oleh kelainan ini tergantung pada konfigurasi dari membranobstruktif dalam uretra. Keputusan untuk mengintervensi saat prenatal didasarkan padausia kehamilan, volume cairan amnion, dan fungsi renal pada aspirasi urin fetus. Ablasikatup dengan endoskopi merupakan standar emas penanganan katup uretra posterior.

  14. EFIKASI DAN KEAMANAN DIHIDROARTEMISININ-PIPERAKUIN PADA PENDERITA PLASMODIUM VIVAX DI KALIMANTAN DAN SULAWESI

    Directory of Open Access Journals (Sweden)

    Armedy Ronny Hasugian

    2012-11-01

    Full Text Available Penelitian ini merupakan bagian dari penelitian “Monitoring drug resistance in subject with P.falciparum and  P.vivax malaria in Kalimantan and Sulawesi, Indonesia” yang bertujuan untuk menilai efikasi dan keamanan Dihydroartemisinin – Piperaquine (DHP pada penderita malaria vivaks di Kalimantan dan Sulawesi. Disain penelitian adalah potong lintang dengan prospektif evaluasi terhadap 87 subyek penderita P. vivax. Efikasi dan keamanan DHP dinilai berdasarkan kriteria WHO. Hasil analisis menunjukkan bahwa efikasi DHP secara Intention To Treat (ITT pada Hari 28 (H28 setelah pengobatan DHP adalah 94,3% (95%CI: 87,2 – 97,5 dan H42 adalah 92% (95%CI: 87,2 – 97,5. Efikasi DHP secara Per Protokol (PP pada H28 adalah 100% dan H42 adalah 97,6% (95%CI:91,5 – 99,3. Bebas parasit 100% terjadi pada H2. Bebas gametosit 100% terjadi pada H7. Bebas demam 100% terjadi pada H7. Bebas gejala klinis tidak pernah mencapai 100% pasca pengobatan DHP. Kejadian sampingan yang ditemukan adalah berkeringat, tidak nafsu makan dan diare,  tetapi ringan dan dapat ditolerir.  Oleh karena itu dapat disimpulkan efikasi dan keamanan DHP sesuai dengan kriteria WHO dan dapat direkomendasikan untuk penggunaan secara luas.   Kata Kunci: Malaria, Efikasi, dihidroartemisinin, piperaquine, Kalimantan, Sulawesi 

  15. PENGARUH PENYIMPANAN BEKU SANTAN DAN KELAPA PARUT TERHADAP CITA RASA SANTAN DAN MUTU MINYAK YANG DIHASILKAN

    Directory of Open Access Journals (Sweden)

    Uken S. Soetrisno

    2012-11-01

    Full Text Available Santan dan kelapa parut yang disimpan beku selama 1 sampai dengan 4 minggu telah diuji cita rasa santan dan mutu kimiawi dari minyak yang dihasilkannya. Data yang diperoleh menunjukkan bahwa asam lemak bebas dan bilangan peroksida, yang dipakai sebagai petunjuk kerusakan minyak mengalami kenaikan yang cukup tinggi dan sangat bermakna secara statistik setelah penyimpanan satu minggu, meskipun dengan percepatan yang berbeda. Angka-angka tersebut masih di bawah batas yang ditentukan dalam standar Industri Indonesia. Uji cita rasa menunjukkan bahwa lamanya penyimpanan serta bentuk bahan sangat berpengaruh terhadap tingkat kesukaan panelis. Santan yang berasal dari kelapa parut beku masih disukai sampai dengan penyimpanan dua minggu.

  16. PROFIL TERAPI MEDIK DAN TRADISIONAL PENYALAHGUNA NAPZA DI KOTA BANDUNG, JAKARTA, YOGYAKARTA, SURABAYA DAN DENPASAR

    Directory of Open Access Journals (Sweden)

    S. R. Muktiningsih

    2012-10-01

    Full Text Available Penyalahgunaan napza mempunyai potensi menimbulkan ketergantungan fisik maupun psikis, atau keduanya, dan merupakan masalah dan perlu dicari solusinya bersama. Satu cara pengobatan untuk ketergantungan napza belum tentu sesuai untuk semua orang, disebabkan oleh keanekaragaman napza yang disalahgunakan dan pengobatan tergantung karakteristik pengguna. Beragam terapi dan obat untuk detoksifikasi digunakan oleh panti rehabilitasi, mulai dari cara terapi sederhana, tradisional, murah, sampai yang "canggih"  ("sophisticated'', dapat "langsung sembuh", serta mahal, masing-masing mengklaim obat yang digunakan efektif. Hasil studi eksplorasi yang dilakukan pada rumah sakit/rumah sakit jiwa dan panti rehabilitasi di lima kota besar di Jawa/Bali terhadap terapi putus obat (opiat untuk penyalahguna napza, mengungkapkan bahwa jenis obat untuk terapi secara medik/konvensional sangat beragam yakni metadon, buprenorfin, nalokson, naltrekson, kodein, klonidin, klozapin dan beberapa obat simtomatik lainnya. Sedangkan pada cara terapi tradisonal digunakan obat tradisional/bahan alam (kelapa hijau, lada hitam, kurkuma, pace, pisang batu mengkal, susu, tusuk jarum dan mental-spiritual. Berdasarkan total biaya pengobatan yang diperlukan, terapi putus obat (opiat secara konvensional menggunakan obat simtomatik (klozapin dan substitusi (kodein relatif lebih murah, begitu pula terapi secara tradisional, tidak memerlukan biaya mahal dan relatif dapat terjangkau oleh masyarakat kurang mampu.   Kata kunci: drug therapy, drug and narcotic control, medicine, traditional

  17. The virtual observatory service TheoSSA: Establishing a database of synthetic stellar flux standards. II. NLTE spectral analysis of the OB-type subdwarf Feige 110

    CERN Document Server

    Rauch, T; Kampka, D; Werner, K; Kruk, J W; Moehler, S

    2014-01-01

    In the framework of the Virtual Observatory (VO), the German Astrophysical Virtual Observatory (GAVO) developed the registered service TheoSSA (Theoretical Stellar Spectra Access). It provides easy access to stellar spectral energy distributions (SEDs) and is intended to ingest SEDs calculated by any model-atmosphere code, generally for all effective temperature, surface gravities, and elemental compositions. We will establish a database of SEDs of flux standards that are easily accessible via TheoSSA's web interface. The OB-type subdwarf Feige 110 is a standard star for flux calibration. State-of-the-art non-local thermodynamic equilibrium (NLTE) stellar-atmosphere models that consider opacities of species up to trans-iron elements will be used to provide a reliable synthetic spectrum to compare with observations. In case of Feige 110, we demonstrate that the model reproduces not only its overall continuum shape from the far-ultraviolet (FUV) to the optical wavelength range but also the numerous metal lines ...

  18. An extremely dense group of massive galaxies at the centre of the protocluster at z = 3.09 in the SSA22 field

    CERN Document Server

    Kubo, M; Ichikawa, T; Kajisawa, M; Matsuda, Y; Tanaka, I; Umehata, H

    2015-01-01

    We report the discovery of an extremely dense group of massive galaxies at the centre of the protocluster at $z=3.09$ in the SSA22 field from near-infrared spectroscopy conducted with the Multi-Object InfraRed Camera and Spectrograph (MOIRCS) equipped on the Subaru Telecope. The newly discovered group comprises seven galaxies confirmed at $z_{\\rm spec}\\approx3.09$ within 180 kpc including five massive objects with the stellar masses larger than $10^{10.5}~M_{\\odot}$ and is associated with a bright sub-mm source SSA22-AzTEC14. The dynamical mass of the group estimated from the line-of-sight velocity dispersion of the members is $M_{\\rm dyn}\\sim1.6\\pm0.3\\times10^{13}~M_{\\odot}$. Such a dense group is expected to be very rare at high redshift as we found only a few comparable systems in large-volume cosmological simulations. Such rare groups in the simulations are hosted in collapsed halos with $M_{\\rm vir}=10^{13.4}-10^{14.0}~M_{\\odot}$ and evolve into the brightest cluster galaxies (BCGs) of the most massive c...

  19. Diagnosis dan Penatalaksanaan Abses Septum Nasi

    Directory of Open Access Journals (Sweden)

    Bestari J Budiman

    2013-01-01

    Full Text Available AbstrakAbses septum nasi adalah terkumpulnya pus di antara tulang rawan dengan mukoperikondrium atau tulang septum dengan mukoperiosteum yang melapisinya. Abses septum dapat menyebabkan hidung pelana bahkan komplikasi intrakranial, sehingga diperlukan diagnosis dan tindakan yang tepat dan cepat. Telah dilaporkan satu kasus abses septum pada wanita umur 34 tahun dan telah dilakukan insisi dan eksplorasi abses dalam narkose umum.Kata kunci: Arial 9 Kata Kunci: Abses septum nasi, hematoma septum, hidung pelana.AbstractNasal septal abscess is defined as pus accumulation between cartilage and mucopericondrium or septal bone and mucoperiosteum which is layer it. Septal abscess can cause saddle nose even intracranial complications, requiring additional diagnosis and appropriately and quickly management. Reported one case of septal abscess in woman 34 years old and has been done the abscess incision and exploration in general anaesthesia.Keywords:Nasal septal abscess, haematoma septum, saddle nose.

  20. "Bohr's Atomic Model."

    Science.gov (United States)

    Willden, Jeff

    2001-01-01

    "Bohr's Atomic Model" is a small interactive multimedia program that introduces the viewer to a simplified model of the atom. This interactive simulation lets students build an atom using an atomic construction set. The underlying design methodology for "Bohr's Atomic Model" is model-centered instruction, which means the central model of the…

  1. Mobil SUV Tangguh dan Sporty Terbaik

    OpenAIRE

    rozi,ys

    2016-01-01

    Nissan X-Trail yang  mempunyai perfomance yang sangat baik, contohnya : Ada beberapa Tipe transmisi yang mudah dikendarai dan tidak membuat pengendara cepat lelah saat menyetir. Untuk jok Dapat disesuaikan dengan kondisi jalanan di perkotaan, sekaligus dengan sensasi akselerasi yang halus dan nyaman. Pada bagian Transmisi manual 5-percepatan di Nissan March membantu mendapatkan hasil maksimal dari kekuatan mesin. Baca selengkapnya hanya di: http://rozidotnet.blogspot.com/2016/...

  2. Strategi Pembelajaran Biologi Berbasis Kompetensi dan Konservasi

    Directory of Open Access Journals (Sweden)

    Saiful Ridlo

    2013-09-01

    Full Text Available AbstrakPembelajaran melibatkan interaksi dosen, mahasiswa, dan sumber belajar. Interaksi antara ketiganya membutuhkan strategi pembelajaran. Penelitian ini bertujuan menghasilkan strategi pembelajaran biologi di Jurusan Biologi Unnes yang telah berkomitmen mengaplikasikan kurikulum berbasis kompetensi dan konservasi dengan ciri pendekatan jelajah alam sekitar (JAS. Metodologi penelitian menggunakan pendekatan kualitatif. Informannya dosen dan mahasiswa yang mengajar dan belajar biologi umum, mikrobiologi, dan taksonomi hewan. Data yang diperoleh berupa deskripsi kegiatan belajar mengajar dan lesson study.  Data-data dianalisis kemudian dinarasikan. Hasil penelitian menunjukkan pembelajaran biologi dengan pendekatan berpusat pada siswa yang dikhususkan pada kegiatan penjelajahan alam sekitar dapat dilakukan menggunakan strategi yang berbasis pada cara belajar siswa aktif dan kooperatif. Strategi-strategi tersebut adalah pembelajaran kontekstual, pembelajaran partisipatif, dan pembelajaran inkuiri. AbstractLearning involves the interaction of lecturer, students, and learning resources. The interaction between them requires a learning strategy. This research aims to generate learning strategies of biology in the Department of Biology Unnes which has committed to apply the competence- and conservation-based curriculum of features the environmental exploration (JAS approach. The research methodology uses a qualitative approach. The informants are the faculty members and the students who, respectively, teach and learn biology, microbiology, and animal taxonomy subjects. The data obtained were in the form of description of learning activities and lesson studies. The data were then analyzed narratively. The results showed that the student-centered learning of environmental exploration may be conducted using active- and cooperative-based strategies. Examples of these strategies are contextual learning, participatory learning, and inquiry learning.

  3. Konsep dan Cara membuat mobile robot

    OpenAIRE

    Syam, Rafiuddin

    2012-01-01

    Buku ini disusun untuk memperkaya hasanah buku di Indonesia bidang ilmu robotika. Perkembangan ilmu robotika di Indonesia dalam dekade terakhir ini sangat pesat, walaupun jauh tertinggal dibandingkan ilmu ilmu lain. Sebagai ilmu terapan, robotika, menggabungkan beberepa disiplin ilmu antara mekanika, elektrikal, teknik kendali dan inteligensia buatan serta teknik sensor. Selanjutnya, dalam buku ini dijelaskan konsep dan cara membuat robot, baik berupa mobile robot maupun manipulator. Pem...

  4. BY PRODUCT TERNAK. Teknologi dan Aplikasinya

    OpenAIRE

    Said, Muhammad Irfan

    2014-01-01

    DAFTAR PUSTAKA Adventini, N., Muhayatun, D. D. Lestiani dan W.Y.N. Syahfitri. 2012. Analisis Mikronutrien dalam Daging, Limpa, dan Hati Sapi. Jurnal Medika. 38 (8), 580???586. Angelidaki, I., and B. K. Ahring. 2000. Methods for increasing the biogas potential from the recalcitrant organic matter contained in manure. Water Science Technology. 41 (3), 189-194. Anonim. 1974. Gelita-Instant-Gelatins Type 800 A Type 800 B. Gelatine-Information-Service. Deutsche Gelatine-Febrike...

  5. Desain Dan Pabrikasi Helmet Industri Yang Ergonomik

    OpenAIRE

    Hasrin

    2009-01-01

    Tesis ini melaporkan hasil desain dan pabrikasi model helm industri dari bahan komposit polimer GFRP tipe polyester (resin unsaturated), dengan serat E-Glass jenis Choped Strand Mat. Pada proses pabrikasi helm komposit ini, dengan susunan dua lapisan serat E-Glass jenis CSM, yang dibentuk mengikuti bentuk cetakan helm standard AS/NZS 1801 EN 397 SS 98 dengan metode hand lay up. Sistem pencetakan helmet dilakukan secara terpisah, dan empat sisi dinding helmet dibuat saluran angin. Hasil penguj...

  6. GOOD CORPORATE GOVERNANCE DAN PENERAPANNYA DI INDONESIA

    Directory of Open Access Journals (Sweden)

    Thomas S. Kaihatu

    2006-01-01

    Full Text Available Recent experience indicate that it isn`t sufficient for management just to rely on how efficient is the process of managing. It needs a new instrument, Good Cooperate Governance (GCG, to prove that the management is going well. This concept emphasize on two important things, that is : first, the right of shareholder to be provided of right and just on time information, and second, the obligation of company to disclose accurately, just on time, and transparently all information of company`s performance, shareholders, and stakeholders. Various studies by national and international researchers proved the lack of understanding the importance and strategic implication of applying GCG principles by Indonesian entrepreneur. Besides, organization culture also influencing GCG application in Indonesia. Abstract in Bahasa Indonesia : Perkembangan terbaru membuktikan bahwa manajemen tidak cukup hanya memastikan bahwa proses pengelolaan manajemen berjalan dengan efisien. Diperlukan instrumen baru, Good Corporate Governance (GCG untuk memastikan bahwa manajemen berjalan dengan baik. Ada dua hal yang ditekankan dalam konsep ini, pertama, pentingnya hak pemegang saham untuk memperoleh informasi dengan benar dan tepat pada waktunya dan, kedua, kewajiban perusahaan untuk melakukan pengungkapan (disclosure secara akurat, tepat waktu, dan transparan terhadap semua informasi kinerja perusahaan, kepemilikan, dan stakeholder. Dari berbagai hasil pengkajian yang dilakukan oleh berbagai lembaga riset independen nasional dan internasional, menunjukkan rendahnya pemahaman terhadap arti penting dan strategisnya penerapan prinsip-prinsip GCG oleh pelaku bisnis di Indonesia. Selain itu, budaya organisasi turut mempengaruhi penerapan GCG di Indonesia. Kata kunci: GCG, prinsip-prinsip GCG, budaya organisasi, penerapan di Indonesia.

  7. Pembuatan dan Karakteristik Komposit Polimer Berpenguat Bagasse

    Directory of Open Access Journals (Sweden)

    Eqitha Dea Clareyna

    2013-09-01

    Full Text Available Bagasse memiliki kandungan serat yang cukup besar dan berpotensi digunakan sebagai bahan penguat dalam pembuatan komposit karena sifatnya yang kuat dan ringan. Dalam penelitian tugas akhir ini telah dibuat bahan komposit berpenguat bagasse dengan empat macam ukuran penguat yaitu serat chopped serta partikel berukuran 100 mesh, 140 mesh, dan 200 mesh. Pembuatan komposit menggunakan metode hand lay-up dan fraksi volume penguat divariasi dari 2,5% hingga 15%. Hasil karakterisasi yang telah dilakukan, menunjukkan bahwa kekuatan tarik dan densitas terbaik dimiliki oleh sampel komposit dengan penguat berukuran 200 mesh sebanyak 7,5% volume. Kekuatan tarik sampel tersebut adalah  28,83  MPa dan densitasnya adalah 1,15 gr/cm3. Adapun kekuatan impak terbesar dimiliki oleh sampel komposit dengan 2,5% volume sebesar 0,00271 J/mm2. Dengan demikian sampel komposit yang telah dibuat dapat digunakan sebagai alternatif bahan baku industri menggantikan tiang penyangga (scantlings pada struktur kayu (timber structure sesuai standar AS 1720.1.

  8. PENGGUNAAN TUTOR SEBAYA UNTUK PENINGKATAN AKTIVITAS DAN HASIL BELAJAR

    Directory of Open Access Journals (Sweden)

    Rakimahwati -

    2014-06-01

    Abstrak: Penggunaan Tutor Sebaya untuk Peningkatan Aktivitas dan Hasil Belajar. Penelitian ini bertujuan untuk meningkatkan aktivitas dan hasil belajar mahasiswa dengan menerapkan metode tutor sebaya pada perkuliahan Perencanaan Pembelajaran TK. Metode yang digunakan dalam penelitian adalah penelitian tindakan kelas. Pelaksanaan tindakan dilakukan dua siklus terhadap mahasiswa reguler Pendidikan Guru Pendidikan Anak Usia Dini (PG-PAUD Universitas Negeri Padang. Data diperoleh melalui observasi, angket dan penilaian akhir kegiatan. Data kuantitatif dianalisis dengan rerata dan persentase, dan dikom­parasikan dengan data kualitatif. Hasil penelitian menunjukkan bahwa penggunaan metode tutor sebaya dapat meningkatkan aktivitas dan hasil belajar mahasiswa.

  9. A longitudinal Stern-Gerlach interferometer : the ``beaded'' atom

    Science.gov (United States)

    Miniatura, Ch.; Perales, F.; Vassilev, G.; Reinhardt, J.; Robert, J.; Baudon, J.

    1991-04-01

    The principle on an atomic interferometer based on the longitudinal Stern-Gerlach effect is given. Possible realizations using beams of metastable rare gas atoms or metastable hydrogen atoms are described. Some examples of phase-objects are discussed and some possible applications are suggested. The atoms coming out of the interferometer exhibit uncommon properties, particulary a permanent multiple localisation regarding the external atomic variables (“beaded” atoms). On donne le principe d'un interféromètre atomique dans lequel est utilisé l'effet Stern-Gerlach longitudinal. Des réalisations possibles d'un tel interféromètre fonctionnant avec des atomes métastables de gaz rares ou d'hydrogène sont décrites. Quelques exemples d'objets de phase sont discutés, et quelques applications sont suggérées. A leur sortie de l'interféromètre, les atomes possèdent des propriétés inhabituelles, telles qu'une localisation multiple à l'égard des variables externes (atomes “ en chapelet ”).

  10. Atomic Energy Basics, Understanding the Atom Series.

    Science.gov (United States)

    Atomic Energy Commission, Oak Ridge, TN. Div. of Technical Information.

    This booklet is part of the "Understanding the Atom Series," though it is a later edition and not included in the original set of 51 booklets. A basic survey of the principles of nuclear energy and most important applications are provided. These major topics are examined: matter has molecules and atoms, the atom has electrons, the nucleus,…

  11. Perancangan dan Implementasi Autonomous Landing Menggunakan Behavior-Based dan Fuzzy Controller pada Quadcopter

    OpenAIRE

    Fadjri Andika Permadi; Rusdhianto Effendie Abdul Kadier; Ali Fatoni

    2012-01-01

    Perkembangan teknologi sistem kendali pesawat sayap berputar (copter) semakin pesat salah satunya pada pesawat berbaling-baling empat (quadcopter). Landing merupakan bagian tersulit dalam penerbangan quadcopter. Ukuran quadcopter yang kecil mengakibatkan susahnya pengendalian kestabilan dan kecepatan turun.Cara mengatasi permasalahan ini adalah dengan autonomous landing yang menggunakan algoritma kendali behavior-based (berbasis perilaku). Tugas akhir ini merancang dan mengimplementasikan alg...

  12. Perancangan dan Implementasi Autonomous Landing Menggunakan Behavior-Based dan Fuzzy Controller pada Quadcopter

    Directory of Open Access Journals (Sweden)

    Fadjri Andika Permadi

    2012-09-01

    Full Text Available Perkembangan teknologi sistem kendali pesawat sayap berputar (copter semakin pesat salah satunya pada pesawat berbaling-baling empat (quadcopter. Landing merupakan bagian tersulit dalam penerbangan quadcopter. Ukuran quadcopter yang kecil mengakibatkan susahnya pengendalian kestabilan dan kecepatan turun.Cara mengatasi permasalahan ini adalah dengan autonomous landing yang menggunakan algoritma kendali behavior-based (berbasis perilaku. Tugas akhir ini merancang dan mengimplementasikan algoritma kendali behavior-based (berbasis perilaku pada proses autonomous landing quadcopter dan kontroler PD (Proporsional, Diferensial pada untuk  kestabilan sudut roll dan pitch, sedangkan untuk jarak landing menggunakan kontroler logika fuzzy. Pada Tugas Akhir ini, didapatkan nilai parameter kontroler PD roll dan kontroler PD pitch dari hasil tuning terstruktur pada simulasi Kp=500 dan Kd=30. Sedangkan kendali landing menggunakan kontroler logika fuzzy dengan parameter Ke=4 Kde=175 dan Ku=1 pada simulasi dapat melakukan proses landing selama 8 detik dari ketinggian 3 meter. Respon hasil implementasi pada quadcopter belum sesuai dengan hasil simulasi. Proses landing pada implementasi lebih cepat dengan waktu 3.5 detik dari ketinggian 2 meter, selain itu koreksi sudut roll dan sudut pitch masih terhadapat error +/-3º.

  13. Teach us atom structure

    International Nuclear Information System (INIS)

    This book is written to teach atom structure in very easy way. It is divided into nine chapters, which indicates what is the components of matter? when we divide matter continuously, it becomes atom, what did atom look like? particles comprised of matter is not only atom, discover of particles comprised of atom, symbol of element, various radiation, form alchemy to nuclear transmutation, shape of atom is evolving. It also has various pictures in each chapters to explain easily.

  14. Teach us atom structure

    Energy Technology Data Exchange (ETDEWEB)

    Lim, Suh Yeon

    2006-08-15

    This book is written to teach atom structure in very easy way. It is divided into nine chapters, which indicates what is the components of matter? when we divide matter continuously, it becomes atom, what did atom look like? particles comprised of matter is not only atom, discover of particles comprised of atom, symbol of element, various radiation, form alchemy to nuclear transmutation, shape of atom is evolving. It also has various pictures in each chapters to explain easily.

  15. Analisis Kesuksesan Sistem Informasi Manajemen Sumber Daya dan Perangkat Pos dan Informatika (SIMS

    Directory of Open Access Journals (Sweden)

    Awangga Febian Surya Admaja

    2014-06-01

    Full Text Available Dalam perkembangan suatu sistem informasi yang digunakan oleh sebuah institusi, perlu dilihat bagaimana kesuksesan dan dampak positif yang diberikan sistem informasi tersebut terhadap manfaat bersih yang diterima oleh instansi terkait dengan penggunaan dan kepuasan pengguna sistem informasi tersebut. Sistem informasi yang digunakan oleh Ditjen SDPPI saat ini telah berkembang menjadi sistem informasi manajemen sumber daya dan perangkat pos dan informatika (SIMS dan perlu dilihat bagaimana kesuksesan sistem informasi tersebut dalam memenuhi kebutuhan manajemen Ditjen SDPPI. Dalam penelitian ini digunakan persamaan struktural berbasis partial least square (PLS dengan mengacu kepada model kesuksesan sistem informasi oleh DeLone & McLean. Hasil perhitungan model tersebut menunjukkan bahwa model kesuksesan DeLone & Mclean tidak membuktikan keseluruhan hipotesis dari penelitian dimana penggunaan tidak berpengaruh signifikan terhadap manfaat bersih yang didapatkan oleh institusi.

  16. Atomic phase diagram

    Institute of Scientific and Technical Information of China (English)

    LI Shichun

    2004-01-01

    Based on the Thomas-Fermi-Dirac-Cheng model, atomic phase diagram or electron density versus atomic radius diagram describing the interaction properties of atoms of different kinds in equilibrium state is developed. Atomic phase diagram is established based on the two-atoms model. Besides atomic radius, electron density and continuity condition for electron density on interfaces between atoms, the lever law of atomic phase diagram involving other physical parameters is taken into account, such as the binding energy, for the sake of simplicity.

  17. Atomizer design for viscous-melt atomization

    Energy Technology Data Exchange (ETDEWEB)

    Czisch, C. [Chemical Engineering Department, University Bremen, Badgasteiner Str. 3, 28359 Bremen (Germany); Fritsching, U. [Chemical Engineering Department, University Bremen, Badgasteiner Str. 3, 28359 Bremen (Germany)], E-mail: ufri@iwt.uni-bremen.de

    2008-03-25

    The development of a gas atomization unit is introduced, which utilizes characteristic flow effects for efficient fragmentation of viscous liquids and melts. The proposed device combines a classical rotary atomizer with an external mixing gas atomizer. Here, the liquid stream is first transformed into a thin liquid sheet before disintegration. Thereby the specific surface energy is increased without breakup. The movement of the free flowing liquid film is controlled by the local gas flow field in order to transport the film into the most effective atomization region. The fragmentation process itself is caused by a perpendicular impinging gas stream. Numerical flow simulations are used for the development of the hybrid atomizer construction. Experiments using viscous model liquids show that for constant air-to-liquid mass-flow ratio the particle size is reduced using the hybrid atomizer compared with a conventional gas atomizer. Results of model experiments as well as of experiments with a viscous mineral melt are discussed.

  18. Atomizer design for viscous-melt atomization

    International Nuclear Information System (INIS)

    The development of a gas atomization unit is introduced, which utilizes characteristic flow effects for efficient fragmentation of viscous liquids and melts. The proposed device combines a classical rotary atomizer with an external mixing gas atomizer. Here, the liquid stream is first transformed into a thin liquid sheet before disintegration. Thereby the specific surface energy is increased without breakup. The movement of the free flowing liquid film is controlled by the local gas flow field in order to transport the film into the most effective atomization region. The fragmentation process itself is caused by a perpendicular impinging gas stream. Numerical flow simulations are used for the development of the hybrid atomizer construction. Experiments using viscous model liquids show that for constant air-to-liquid mass-flow ratio the particle size is reduced using the hybrid atomizer compared with a conventional gas atomizer. Results of model experiments as well as of experiments with a viscous mineral melt are discussed

  19. Cold Matter Assembled Atom-by-Atom

    CERN Document Server

    Endres, Manuel; Keesling, Alexander; Levine, Harry; Anschuetz, Eric R; Krajenbrink, Alexandre; Senko, Crystal; Vuletic, Vladan; Greiner, Markus; Lukin, Mikhail D

    2016-01-01

    The realization of large-scale fully controllable quantum systems is an exciting frontier in modern physical science. We use atom-by-atom assembly to implement a novel platform for the deterministic preparation of regular arrays of individually controlled cold atoms. In our approach, a measurement and feedback procedure eliminates the entropy associated with probabilistic trap occupation and results in defect-free arrays of over 50 atoms in less than 400 ms. The technique is based on fast, real-time control of 100 optical tweezers, which we use to arrange atoms in desired geometric patterns and to maintain these configurations by replacing lost atoms with surplus atoms from a reservoir. This bottom-up approach enables controlled engineering of scalable many-body systems for quantum information processing, quantum simulations, and precision measurements.

  20. KEPEMIMPINAN, SISTEM DAN STRUKTUR ORGANISASI, LINGKUNGAN FISIK, DAN KEEFEKTIFAN ORGANISASI SEKOLAH

    Directory of Open Access Journals (Sweden)

    Connie Chairunnisa

    2013-05-01

    Full Text Available Abstract: The Effects of Leadership, System and Structure, and Physical Environment on the Ef­fectiveness of School Organization. The study aims at obtaining information of the effects of leadership, system and structure, and physical environment on the effectiveness of organization. This causal study was conducted in one hundred schools in Jakarta. Survey method with causal approach and  path analysis was employed. The population consisted of288 teachers in junior high schools in DKI Province of Jakarta. The sample of 100 teachers was selected by applying simple random sampling technique. The results show di­rect effects of (1 system and structure on physical environment,  (2  leadership  on the effectiveness, (3 system and structure on physical environment as well as the effectiveness of organization, (4 physical en­vironment on the effectiveness of organization. In addition, system and structure show indirect effect on the effectiveness of organization through the physical environment. The research concludes that any change or variation in organizational effectiveness can be influenced by leadership, system and structure, and physical environment. Abstrak: Kepemimpinan, Sistem dan Struktur Organisasi, Lingkungan Fisik, dan Keefektifan Orga­nisasi. Penelitian ini bertujuan untuk mendeskripsikan pengaruh kepemimpinan, sistem dan struktur organi­sasi, dan lingkungan fisik terhadap keefektifan organisasi. Penelitian diselenggarakan di seratus sekolah di Jakarta, dengan menggunakan metode survei melalui pendekatan kausal dan analisis jalur. Sampel sebanyak 100 guru SMP Negeri Provinsi DKI Jakarta diambil dengan teknik penyampelan acak sederhana. Hasil penelitian menunjukkan bahwa terdapat pengaruh langsung dari (1 sistem dan struktur organisasi terhadap lingkungan fisik; (2 kepemimpinan kepala sekolah terhadap keefektifan organisasi; (3 sistem dan struktur terhadap lingkungan fisik juga terhadap keefektifan organisasi; (4 lingkungan fisik

  1. Constraints on deformation of Hekla volcano, Iceland, 2011-2014, from time-series interferometric analysis of COSMO-SkyMed SAR data and Singular Spectrum Analysis (SSA)

    Science.gov (United States)

    Dumont, Stéphanie; Sigmundsson, Freysteinn; Parks, Michelle; Ófeigsson, Benedikt; Bagnardi, Marco; Hooper, Andy; Einarsson, Páll; Wittmann, Werner

    2015-04-01

    Hekla volcano is one of the most active volcanoes in Iceland with 18 summit eruptions during the last 1100 years. Since 1970, the volcano has erupted approximatively every 10 years: in 1980-1981, 1991 and 2000. A special feature of Hekla volcano is its aseismic behavior except within 2 hours before these eruptions. However, in 2013 and 2014, some seismic swarms were detected within a 5km radius centered on the volcano, which is unusual for any time period between eruptions. No change in the ground deformation (continuous borehole strainmeter and ground-based GPS), was observed during these events. This year, will be the fifteenth year without an eruption at Hekla, the extended period (since the last eruption) raises the following question: Has the magma plumbing system or the rate of melt supply changed since the last eruption? What is the state of the volcano? What does it imply for its eruptive cycle? To address these questions, we study ground deformation around Hekla volcano using time-series analysis. We analyzed COSMO-SkyMed SAR data acquired between 2011 and 2014 using the Persistent Scatterer Interferometric Synthetic Aperture Radar (PS-InSAR) approach for both ascending and descending configurations. As highlighted by previous studies of ground deformation around Hekla, the small deformation rate distributed over a large area increases the importance of the noise reduction process. Once the signal to noise ratio is improved, both time-series display a dominant subsidence signal. The subsiding areas correlate with lava flows extruded during the 2000 eruption. A small inflation signal is more difficult to substantiate from the SAR data alone. For this reason further investigation of source characteristics using a Singular Spectrum Analysis (SSA) is required. SSA is an empirical based decomposition of the signal. This decomposition is applied on a trajectory matrix, called a Hankel matrix (similar to a cross-lag correlation matrix). This method enables the

  2. The virtual observatory service TheoSSA: Establishing a database of synthetic stellar flux standards . II. NLTE spectral analysis of the OB-type subdwarf Feige 110

    Science.gov (United States)

    Rauch, T.; Rudkowski, A.; Kampka, D.; Werner, K.; Kruk, J. W.; Moehler, S.

    2014-06-01

    Context. In the framework of the Virtual Observatory (VO), the German Astrophysical VO (GAVO) developed the registered service TheoSSA (Theoretical Stellar Spectra Access). It provides easy access to stellar spectral energy distributions (SEDs) and is intended to ingest SEDs calculated by any model-atmosphere code, generally for all effective temperatures, surface gravities, and elemental compositions. We will establish a database of SEDs of flux standards that are easily accessible via TheoSSA's web interface. Aims: The OB-type subdwarf Feige 110 is a standard star for flux calibration. State-of-the-art non-local thermodynamic equilibrium stellar-atmosphere models that consider opacities of species up to trans-iron elements will be used to provide a reliable synthetic spectrum to compare with observations. Methods: In case of Feige 110, we demonstrate that the model reproduces not only its overall continuum shape from the far-ultraviolet (FUV) to the optical wavelength range but also the numerous metal lines exhibited in its FUV spectrum. Results: We present a state-of-the-art spectral analysis of Feige 110. We determined , log g = 6.00 ± 0.20, and the abundances of He, N, P, S, Ti, V, Cr, Mn, Fe, Co, Ni, Zn, and Ge. Ti, V, Mn, Co, Zn, and Ge were identified for the first time in this star. Upper abundance limits were derived for C, O, Si, Ca, and Sc. Conclusions: The TheoSSA database of theoretical SEDs of stellar flux standards guarantees that the flux calibration of astronomical data and cross-calibration between different instruments can be based on models and SEDs calculated with state-of-the-art model-atmosphere codes. Based on observations with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS5-26666. Based on observations made with the NASA-CNES-CSA Far Ultraviolet Spectroscopic Explorer. Table 2, Figs. 3 and

  3. Perbandingan Akurasi Pengukuran Suhu dan Kelembaban Antara Sensor DHT11 dan DHT22 Studi Komparatif pada Platform ATMEL AVR dan Arduino

    Directory of Open Access Journals (Sweden)

    Arief Hendra Saptadi

    2015-01-01

    Full Text Available Suhu dan kelembaban merupakan dua objek pengukuran yang acapkali terdapat di dalam sistem akuisisi data. Terdapat banyak piranti sensor yang berfungsi untuk mengukur dua objek tersebut dan akurasi merupakan salah satu parameter yang dapat digunakan untuk memilihnya. DHT11 dan DHT22 adalah sensor seri DHT dari Aosong Electronics yang dapat melakukan pengukuran suhu dan kelembaban secara serempak dengan keluaran digital. Informasi tentang akurasi terdapat di dalam lembar data keduanya. Kendati pun demikian informasi tersebut tidak menggambarkan kondisi sesungguhnya saat dioperasikan pada lokasi maupun platform tertentu. Tujuan dari penelitian ini adalah untuk membandingkan akurasi dari DHT11 dan DHT22 dalam pengukuran suhu dan kelembaban saat dioperasikan di dalam maupun di luar ruangan, menggunakan platform ATMEL AVR dan Arduino. Berdasarkan pengujian yang telah dilakukan, DHT22 memiliki akurasi yang lebih baik daripada DHT11 dengan galat relatif pengukuran suhu 4% dan kelembaban 18%. DHT11 sebaliknya memiliki rentang galat yang lebih lebar sebesar 1 – 7% dan 11 – 35%, masing-masing untuk pengukuran suhu dan kelembaban. Perbedaan lokasi dan platform tidak memberikan pengaruh pada hasil pengukuran. Galat pengukuran kelembaban yang masih di atas 10% menunjukkan perlunya kalibrasi ulang. Di masa mendatang, selain akurasi, kepresisian juga perlu diuji menggunakan penghitungan simpangan baku pada hasil-hasil pengukuran.

  4. Pola Manajemen Keuangan Berbasis Sekolah dan Hubungan dengan Kinerja Sekolah (studi kasus di SMP negeri 1, 5, dan 8 yogyakarta

    Directory of Open Access Journals (Sweden)

    Muhamad Jaeni

    2005-06-01

    Full Text Available Penelitian ini bertujuan mengungkapkan perencanaan, prosedur pengesahan, pelaksanaan, mekanisme dan bentuk laporan, serta evaluasi anggaran berbasis sekolah, pengaruh pola manajemen keuangan terhadap kinerja sekolahj dan upaya sekolah menumbuhkan kesadaran masyarakat dalam membantu dan mengawasi penyelenggaraan pendidikan di sekolah. Penelitian ini menggunakan pendekatan deskriptif kualitatif. Data dikumpulkan melalui wawancara, observasi, dan analisis dokumen sekolah. Informan adalah kepala sekolah, wakil kepala sekolah, bendahara, guru, staf administrasi, anggota OSIS, komite sekolah, dewan pendidikan, dinas pendidikan, Badan Pemeriksa Keuangan Daerah (BPKD, dan Lembaga Pengawasan Internal (LPI. Hasil penelitian menunjukkan bahwa: Pertama, RAPBS selalu mengalami kenaikan sekitar 20% tiap tahun. Dalam konteks MBS, pendekatan perencanaan keuangan yang dipakai tidak lagi menggunakan line item budget, tetapi didasarkan kepada kebutuhan program dan kinerja sekolah. Dalam rapat RAPBS, seringkali kepala sekolah dan bendahara hanya membahas dana dari pemerintah dan orang tua. Kedua, laporan, pengesahan, dan evaluasi keuangan sekolah disampaikan dan dilakukan oleh Dinas Pendidikan dan Tim Monitoring Block Grant, yang terdiri dari dinas P&P, Dewan Pendidikan, Bappeda, BPKD, dan LPI. Ketiga, Sekitar 85% anggaran sekolah dipergunakan untuk gaji dan kesejahteraan, sementara sisanya untuk KBM menggunakan dana block grant dari pemerintah. Kinerja evaluator belum maksimal. Keempat, upaya kepala sekolah serta stakeholders untuk menumbuhkan kesadaran masyarakat dalam membantu penyelenggaraan pendidikan di sekolah. Kata kunci: manajemen keuangan berbasis sekolab, kinerja sekolab

  5. PENINGKATAN MINAT DAN KEPUTUSAN BERPARTISIPASI AKSEPTOR KB

    Directory of Open Access Journals (Sweden)

    Ken Sudarti

    2011-09-01

    Full Text Available Tujuan dari studi ini adalah untuk menemukan dampak dari kualitas layanan dan konseling yang disediakan oleh PLKB dan persepsi pengguna kontrasepsi pada budaya lingkungan yang berkontribusi terhadap ketertarikan dan keputusan para pengguna alat kotrasepsi. Populasi penelitian ini adalah 98 wanita yang melakukan program keluarga berencana dalam jangka waktu lama dengan menggunakan sample convenience. Penelitian ini menunjukkan mayoritas pengguna kontrasepsi adalah usia rawan untuk melahirkan, memiliki lebih dari dua anak, dan relatif memiliki latar belakang pendidikan rendah. Kualitas layanan program konseling dan budaya lingkungan dalam program keluarga berencana mempunyai dampak positif terhadap ketertarikan dan keputusan untuk berpartisipasi terhadap program keluarga berencana. Kualitas layanan ditemukan sebagai kontribusi terbesar terhadap peningkatan ketertarikan dan partisipasi dalam program keluarga berencana.The aim of this study was to find out the effect of the service quality and counceling provided by the family planning field workers (PLKB and the perception of the contraception users on the environmental culture that contribute to the interest and decision of the contraception users.The population of this study was the contraception users in Demak District. The traditional statistical model of yamae was applied to recruit the 98 women who were long-term users of birth control within the government-sponsored family planning program using the convenience sampling method.The study showed that the majority of the contraception users were in the age at risk of giving birth , with more than two children and relatively had low education background. The service quality, councelling program and environmental culture had a possitive effect on the interest and the decision of participating in the family planning program . Service quality was found to give the biggest contribution for the improved interest and partisipation in the family

  6. POTENSI DAN KARAKTERISTIK PRODUKSI Lemna minor PADA BERBAGAI MEDIA TANAM

    Directory of Open Access Journals (Sweden)

    Iwan Prihantoro

    2015-06-01

    Full Text Available Lemna minor merupakan jenis tanaman yang hidup dominan pada perairan dengan kualitas nutrisi tinggi dan potensial sebagai sumber hijauan pakan bagi ternak. Penelitian ini bertujuan untuk mengukur potensi Lemna minor dan karakteristiknya pada berbagai media tanam untuk mendapatkan teknik produksi yang optimal. Penelitian dilakukan pada bak plastik dengan ukuran 36.5×27×10 cm3 selama dua minggu. Rancangan yang digunakan adalah Acak Lengkap (RAL dengan lima perlakuan media dan lima ulangan. Jenis media yang digunakan adalah kontrol, hoagland, hyponex, kompos dan NPK. Parameter yang diukur meliputi serapan nitrogen, pH media, cover area, penyusutan media, dan produksi biomassa. Hasil penelitian menunjukkan bahwa lemna minor efektif dalam memanfaatkan nitrogen dengan nilai serapan > 98 %, media kompos memberikan status pH media yang stabil/netral dan pertambahan luas cover area (LCA tercepat dan tingkat produksi biomassa Lemna minor terbaik pada media kompos dan Hoagland.

  7. HUBUNGAN KONDISI PERUMAHAN DENGAN PENULARAN PENYAKIT ISPA DAN TB PARU

    Directory of Open Access Journals (Sweden)

    Sri Soewasti Soesanto

    2012-10-01

    Full Text Available Suatu rumah baru dapat dikatakan memenuhi syarat kesehatan apabila memenuhi empat hal pokok berikut ini:Memenuhi kebutuhan fisiologis (meliputi pencahayaan, perhawaan dan ruang gerak yang cukup, terhindar dari kebisingan yang mengganggu tidur dan sebagainya;Memenuhi kebutuhan psikologis (seperti privacy yang cukup, komunikasi yang sehat antar anggota keluarga/penghuni rumah dan sebagainya;Memenuhi persyaratan pencegahan penularan penyakit antar anggota keluarga/penghuni rumah (meliputi penyediaan air minum, pengelolaan tinja dan limbah rumah tangga, bebas vektor penyakit dan tikus, kepadatan hunian yang tidak berlebihan, cukup sinar matahari pagi, terlindungnya makanan dan minuman dari pencemaran, di samping pencahayaan dan perhawaan yang cukup seperti tersebut dalam butir 1;Memenuhi persyaratan pencegahan terjadinya kecelakaan baik yang timbul karena keadaan luar maupun dalam rumah (seperti persyaratan garis sempadan jalan, konstruksi yang tidak raudah roboh, yang tidak mudah terbakar, yang tidak cenderung membuat penghuninya jatuh, tergelincir dan sebagainya. 

  8. Pengaruh Laba Akuntansi, Arus Kas dan ROA terhadap Keputusan Investor

    OpenAIRE

    Syarif, Azizah

    2012-01-01

    AZIZAH SYARIF, A311 08 309. Pengaruh Laba Akuntansi, Arus Kas dan ROA terhadap Keputusan Investor, dibimbing oleh Prof. Dr. H. Gagaring Pagalung, SE., MS., Ak. (Pembimbing I) dan Drs. Syahrir, M.Si., Ak. (Pembimbing II). Kata Kunci: Laba Akuntansi, Arus Kas, ROA, dan Keputusan Investor. Penelitian ini bertujuan untuk menguji dan memahami bukti empirik pengaruh informasi laba akuntansi, arus kas dari aktivitas operasi, arus kas dari ...

  9. PROFIL KEADAAN GIZI USILA DI DKI JAKARTA DAN YOGYAKARTA

    OpenAIRE

    Heryudarini Harahap; Anies Irawati; Dyah Santi Puspitasari; Sihadi Sihadi; Husaini, M.A.

    2012-01-01

    Telah dilakukan penelitian tentang profil keadaan gizi usila di DKI Jakarta dan DIY. DKI Jakarta menggambarkan daerah perkotaan dengan etnik yang beragam; DIY menggambarkan daerah pedesaan dengan etnik Jawa yang kebudayaannya masih kuat dalam kehidupan sehari-hari. Penelitian dilakukan pada 90 orang usila di DKI Jakarta dan 180 usila di DIY dengan tingkat sosial ekonomi rendah. Hasil penelitian menunjukkan 82.8% dan 58.3% usila masing-masing untuk DKI Jakarta dan DIY adalah perempuan. Usila p...

  10. KERJASAMA INDIA DAN PAKISTAN DALAM PENGELOLAAN SUNGAI INDUS

    OpenAIRE

    ANUGRAH, RARA

    2015-01-01

    Rara Anugrah E131 11 261, Kerjasama India dan Pakistan Dalam Pengelolaan Sungai Indus, dibawah bimbingan Bapak Muh.Nasir Badu, Ph.D sebagai pembimbing I dan Ibu Nur Isdah, S.IP, MA sebagai pembimbing II, Jurusan Ilmu Hubungan Internasional, Fakultas Ilmu Sosial dan Ilmu Politik, Universitas Hasanuddin. Penelitian ini bertujuan untuk mengetahui kerjasama India dan Pakistan dalam mengelola Sungai Indus berdasarkan pada per...

  11. Motivasi dan Kinerja Karyawan di Hotel Madani Medan

    OpenAIRE

    Ramadan, Chaidir

    2016-01-01

    Menurut Kusmayadi (2004: 102) Kinerja merupakan suatu hasil kerja yang dicapai seseorang dalam melaksanakan tugas-tugas yang dibebankan kepadanya yang didasarkan atas kecakapan, pengalaman dan kesungguhan serta waktu. Kinerja karyawan ini adalah “Gabungan dari tiga faktor penting yaitu kemampuan dan minat seseorang pekerja, kemampuan dan penerimaan atas penjelasan delegasi tugas dan peran serta tingkat motivasi seorang pekerja”. Semakin tinggi ketiga faktor di atas, maka semakin besarlah kine...

  12. MODEL TES DAN ANALISIS PRESTASI BELAJAR MATEMATIK SISWA SEKOLAH DASAR

    OpenAIRE

    Zamsir Zamsir

    2013-01-01

    Penelitian ini bertujuan untuk menemukan model tes dan analisis prestasi belajar siswa yang dapat dipakai untuk melakukan identifikasi level kemampuan dan menyusun profil pencapaian kompetensi siswa, khususnya di sekolah dasar. Penelitian ini merupakan penelitian pengembangan model yang dikembangkan menyangkut dua hal, yaitu: (1) prosedur dan langkah-langkah penyusunan tes serta teknik identifikasi level kemampuan siswa, dan (2) pelaporan hasil tes. Identifikasi dilakukan dengan cara menempat...

  13. Insight, obsession et verification dans le trouble obsessionnel-compulsif

    OpenAIRE

    Jaafari, N.; Daniel, M.-L.; Lacoste, J.; Bacconnier, M.; Belin, D; Rotge, J.Y.

    2011-01-01

    Resume Introduction ? L?insight a une place centrale dans le trouble obsessionnel compulsif (TOC), il conditionne la prise en charge diagnostique et therapeutique du patient. Cependant, le role de l?insight dans l?emergence des symptomes obsessionnels compulsifs demeure controverse. Dans le but de clarifier le role de l?insight dans le TOC, nous avons evalue la relation entre le degre d?insight et certaines alterations cognitives qui font le lit de l?expression symptomatique. Pour ...

  14. PENGOLAHAN LINDI DENGAN OZON DAN PROSES OKSIDASI LANJUT BERBASIS OZON

    OpenAIRE

    Mohamad Rangga Sururi; Siti Ainun Saleh; Amalia Krisna

    2014-01-01

    Limbah industri tekstil di area pinggir kota Surabaya mempunyai karakteristik perbandingan COD dan BOD = 5.57. Limbah jenis ini sulit untuk dibiodegradasi. Studi ini mempelajari tekonologi elektrokoagulasi untuk mengolah limbah tekstil dengan menurunkan intensitas warna, Total Suspended Solid (TSS) dan Chemical Oxygen Demand (COD). Percobaan batch pada suhu kamar dilakukan untuk mempelajari pengaruh pH, jarak elektroda terhadap penurunan warna,TSS dan COD dan membandingkan biaya operasinya ji...

  15. Tradisi keilmuan dan pendidikan dalam tamadun melayu di nusantara

    OpenAIRE

    Mohd. Koharuddin b. Mohd. Balwi

    2004-01-01

    Kertas ini mengyelongkar tradisi keilmuan dan keintelektualan dalam tamadun Melayu di Nusantara. Masyarakat Melayu yang tersebar luar di alam Melayu atau Nusantara ini telah memiliki tradisi keilmuan dan pendidikan yang menjadi teras kepada kemunculan tamaduan yang tinggi dan cemerlang. Tradisi keilmuan ini kemudiannya menjadi marak melalui kedatangan Islam di Nusantara apabila ia merevolosikan tradisi ini kerana Islam memang amat manganjurkan kepada keilmuan dan keintelektualan. gelombang in...

  16. ssa Kadri, Instituteurs et enseignants en Algérie 1945-1975. Histoire et mémoires

    OpenAIRE

    Boyer, Gilles

    2015-01-01

    Instituteurs et enseignants en Algérie 1945-1975. Histoire et mémoires est un ouvrage qui, sous la direction d’Aïssa Kadri (professeur émérite de sociologie à l’université Paris 8), aborde une question essentielle de l’histoire du fait colonial, celle de l’enseignement. La première partie du livre retrace l’histoire du système de l’enseignement en Algérie sous différents aspects depuis les conditions d’imposition du système scolaire français à l’Algérie jusqu’à l’Algérie indépendante. La temp...

  17. Influence of processing on the ethylene-vinyl alcohol (EVOH properties: Application of the successive self-nucleation and annealing (SSA technique

    Directory of Open Access Journals (Sweden)

    2010-03-01

    Full Text Available Films of EVOH copolymers, processed three times by twin-screw extrusion were prepared using a cast-film line. The variation on the melt flow rate (MFR and rheological behaviour of the films were determined, as well as the thermal properties assessed by differential scanning calorimetry (DSC and dynamic-mechanical thermal analysis (DMTA. As the results showed that the reprocessing induced an increase in the viscosity and orientation of the films, it was suggested that structural modifications from chain-extension or cross-linking reactions promoted by hydroxyl and residual acetoxyl groups, could be occurring. The successive self-nucleation and annealing (SSA technique was applied, evidencing the structural modifications on the EVOH copolymer.

  18. Intrication de deux atomes en utilisant le blocage de Rydberg

    Science.gov (United States)

    Gaëtan, A.

    2010-12-01

    Considérons un système quantique constitué de deux sous-systèmes : on dit qu'il est dans un état intriqué s'il existe des corrélations quantiques entre les états de ces derniers. La compréhension et la mise en œuvre d'états intriqués ont de nombreuses applications (métrologie quantique, étude des systèmes fortement corrélés, traitement quantique de l'information, etc.) et constituent le contexte général de ce travail de thèse. Plus en détail, nous démontrons la réalisation d'un état intriqué de deux atomes neutres piégés indépendamment. Pour cela, nous exploitons le phénomène de blocage de Rydberg : lorsqu'on essaie d'exciter simultanément deux atomes séparés de quelques micromètres vers un état de Rydberg donné, la forte interaction entre atomes de Rydberg peut empêcher cette excitation simultanée. Dans ce cas, seul un des deux atomes est excité et l'on génère ainsi des corrélations quantiques entre les états des deux atomes, c'est-à-dire de l'intrication. Dans notre expérience, deux atomes de 87Rb dans l'état fondamental 5S1/2 sont piégés chacun dans une pince optique microscopique, à une distance relative de 4 micromètres. En réalisant des transitions entre l'état 5S1/2 et l'état de Rydberg 58D3/2 par des transitions à deux photons, nous obtenons un état intriqué des deux atomes dans les sous-niveaux |5S1/2, f = 1, mf = 1> et |5S1/2, f = 2, mf = 2>. Afin de quantifier l'intrication, nous mesurons la fidélité par rapport à l'état-cible en réalisant des transitions Raman entre ces deux sous-niveaux. La fidélité des paires d'atomes présentes à la fin de l'expérience est supérieure à la valeur seuil de 0,5, ce qui prouve la création d'un état intriqué.

  19. PENGARUH KEPUASAN KERJA DAN KOMITMEN ORGANISASI TERHADAP ORGANIZATIONAL CITIZENSHIP BEHAVIOR

    OpenAIRE

    Arum Darmwati; Lina Nur Hayati; Dyna Herlina S.

    2013-01-01

    Abstrak: Pengaruh Kepuasan Kerja dan Komitmen Organisasi Terhadap Organizational Citizenship Behavior. Penelitian ini bertujuan untuk mengetahui pengaruh kepuasan kerja dan komitmen organisasi terhadap organizational citizenship behavior. Penelitian ini merupakan penelitian korelasional dengan mengambil sampel karyawan bagian Tata Usaha FISE UNY. Metode pengumpulan datanya menggunakan metode survey dan analisis datanya menggunakan analisis regresi berganda. Penelitian ini menemukan bahwa vari...

  20. HUBUNGAN ANTARA JUDGMENT AUDIT DENGAN RESIKO DAN MATERIALITAS

    OpenAIRE

    Eko Madyo Sutanto

    2014-01-01

    Laporan audit auditor harus mempertimbangkan masalah materialitas, risiko dan penilaian. Pertimbangan Materialitas termasuk kualitatif dan kuantitatif pertimbangan. Pertimbangan kuantitatif berhubungan dengan kesalahan yang menjadi penentu dalam laporan keuangan. Sementara faktor kualitatif berhubungan dengan penyebab kesalahan tersebut. Untuk menghindari atau meminimalkan risiko audit, menurut Standar Audit seksi 312 menekankan “Risiko audit dan Materialitas dalam Pelaksanaan audit”, maka au...

  1. Kapasitas Jerap Niosom Terhadap Ketoprofen dan Perdiksi Penggunaan Transdermal

    OpenAIRE

    Rahman, Latifah; Ismail, Isriani; Wahyudin, Elly

    2013-01-01

    Niosom adalah system vesikel yang dapat digunakan sebagai pembawa obat lipofilik, hidrofilik dan ampifilik. Ketoprofen adalah salah satu golongan AINS yang sangat sukar larut dalam air dan dapat menyebabkan iritasi lambung pada penggunaan oral. System penghantaran obat secara transdermal sangat penting dikembangkan untuk ketoprofen. Penelitian ini bertujuan untuk memformulasi niosom yang dapat menjerap ketoprofen secara optimal dan dapat menghantarkan ketoprofen melalui rute pemberian transde...

  2. Referendum Inggris di Kepulaun Falkland / Malvinas dan Dampaknya Terhadap Argentina

    OpenAIRE

    Trisno Panggalo, Efrianto

    2014-01-01

    Penelitian ini bertujuan untuk mengetahui dan menjelaskan bagaimana kepentingan nasional Inggris dalam referendum di kepulauan Falkland/Malvinas. Dan mengetahui dan menjelaskan bagaimana dampak referendum kepulauan Falkland/Malvinas tersebut terhadap klaim kedaulatan Argentina pada kepulauan Falkland/Malvinas Tipe penelitian yang penulis gunakan untuk mencapai tujuan penelitian adalah tipe penelitian deskriptif-analitik. Teknik pengumpulan data yang penulis gunakan adalah studi pustaka. ...

  3. Dans le grand collisionneur du CERN

    CERN Document Server

    Campanelli, Mario

    2014-01-01

    Ce livre fait pénétrer le lecteur non initié dans l’instrument scientifique le plus grand du monde. D’ailleurs, le web fut précisément inventé à Genève en vue d’une collaboration aussi gigantesque. Résultat de vingt ans de recherche, le LHC, Grand collisionneur de hadrons, est l’anneau de 26,7 km creusé sous la frontière francosuisse, où sont accélérés, en sens opposés, des paquets de particules jusqu’à des vitesses et des énergies extrêmes. Ainsi la physique s’est-elle engagée dans une étape nouvelle de nos connaissances. Après les grandes découvertes de l’univers et de la réalité microscopique du siècle dernier, le collisionneur nous fait progresser aujourd’hui dans un «nuage de probabilités» aux frontières de l’antimatière. Dans une bousculade de particules, voici le champ convoité du boson de Higgs. Mario Campanelli, professeur associé à l’Université de Londres et collaborateur au projet ATLAS du LHC, propose, dans cet ouvrage, de s’introduire pas �...

  4. ANALISIS PERBANDINGAN SPAP, IAS DAN SPKN

    Directory of Open Access Journals (Sweden)

    Maylia Pramono Sari

    2012-03-01

    Full Text Available Dalam mewujudkan Good Goveronance  akan dilakukan analisis perbandingan mengenai standar pemeriksaan nasional yaitu SPAP, ISA, dan SPKN untuk menemukan standar yang lebih tepat dan lebih lengkap untuk pemeriksaan sektor publik. Persamaan SPKN dan ISS  adalah tanggungjawab manajemen dan tanggungjawab auditor sedangkan perbedaannya adalah badan yang menerbitkannya. Perbedaan yang mendasar terletak pada karakter pemeriksaan BPK. Karakter tersebut adalah keharusan pemeriksa BPK untuk merancang prosedur pemeriksaan terhadap kepatuhan yang terkait dengan pemeriksaan yang dilakukan dan waspada atas penyimpangan lainnya. Abstract To realize Good Governance, it needs a comparative analysis for finding out the national standardization of SPAP, ISA, and SPKN . It is used for auditing public sector. SPKN and ISA have similarities and difference. Both SPKN and ISA have the same responsibility of management and audit. SPKN and ISA  have different characteristics in auditing. The compliance of audit procedure is obligatory for  BPK. Moreover, it becomes the strength of BPK RI and the one that make BPK and KAP different.Keywords: SPAP; ISA; SPKN

  5. LEMAK TUBUH DAN KESEGARAN JASMANI PEKERJA INDONESIA

    Directory of Open Access Journals (Sweden)

    Y. Krisdinamurtirin

    2012-11-01

    Full Text Available Penelitian mengenai Lemak Tubuh dan Kesegaran Jasmani telah dilakukan terhadap 62 orang karyawan gemuk, 73 orang karyawan sedang dan 86 orang karyawan kurus. Mereka terdiri atas kelompok Gemuk Aktif (GPA: 33 orang; Gemuk Sendentary (GPSD: 29 orang; Sedang Aktif (SPA: 33 orang; Sedang Sendentary (SPSD: 40 orang; Kurus Aktif (KPA: 35 orang; Kurus Sendentary (KPSD: 51 orang. Umur mereka adalah antara 20 tahun dan 40 tahun. Uji Kesegaran jasmani menggunakan cara Harvard Step Test (HST menunjukkan bahwa skor list kelompok Gemuk cenderung kurang bila dibandingkan dengan kelompok Sedang maupun Kurus. Uji kemaknaan perbedaan secara statistik menggunakan Student test, ternyata perbedaan terdapat pada tingkat Kegemukan, sedangkan pada tingkat jenis kegiatan (aktif/sendentary tidak menunjukkan perbedaan skor. Demikian pula clengan menggunakan Analisis Variance, menunjukkan bahwu ada kailan antaru Kegemuknn dengan skor HST (P:0,002, sedangkan antara jenis kegiatan dengan skor HST tidak ada kaitan (P:0,9049. Garis regresi memberikan gambaran bahwa makin tinggi presentase lemak tubuh, tingkat kesegaran jasmani yang dinyatakan dalam skor HST makin menurun. Garis regresi antara% 88/TB dengan kesegaran jasmani, memberikan gambaran pula ada kecenderungan bahwa pada % 88/TB 100%, kesegaran jasmani menurun. Sedangkan regresi antara kesegaran jasmani dengan tinggi duduk tidak menunjukkan kaitan yang jelas. Tetapi antara urnur dan kesegaran jasmani, menunjukkan ada kecenderungan makin tinggi urnur, kesegaran jasmani menurun. Kesimpulan dari penelitlan inl ialah bahwa ada kaitan antara kesegaran jasmani yang dinyatakan dalam skor Uji HST dengan (a kegemukan dan (b umur.

  6. Highlights from 4STAR Sky-Scanning Retrievals of Aerosol Intensive Optical Properties from Multiple Field Campaigns with Detailed Comparisons of SSA Reported During SEAC4RS

    Science.gov (United States)

    Flynn, C. J.; Dahlgren, R. P.; Dunagan, S. E.; Johnson, R. R.; Kacenelenbogen, M. S.; LeBlanc, S. E.; Livingston, J. M.; Redemann, J.; Schmid, B.; Segal-Rosenhaimer, M.; Shinozuka, Y.; Zhang, Q.; Schmidt, S.; Holben, B. N.; Sinyuk, A.; Hair, J. W.; Anderson, B. E.; Ziemba, L. D.

    2015-12-01

    The 4STAR (Spectrometer for Sky-Scanning, Sun-Tracking Atmospheric Research) instrument combines airborne sun tracking capabilities of the Ames Airborne Tracking Sun Photometer (AATS-14) with AERONET-like sky-scanning capability and adds state-of-the-art fiber-coupled grating spectrometry to yield hyperspectral measurements of direct solar irradiance and angularly resolved sky radiance. The combination of sun-tracking and sky-scanning capability enables retrievals of wavelength-dependent aerosol optical depth (AOD), mode-resolved aerosol size distribution (SD), asphericity, and complex refractive index, and thus also the scattering phase function, asymmetry parameter, single-scattering albedo (SSA), and absorption aerosol optical thickness (AAOT). From 2012 to 2014 4STAR participated in four major field campaigns: the U.S. Dept. of Energy's TCAP I & II campaigns, and NASA's SEAC4RS and ARISE campaigns. Establishing a strong performance record, 4STAR operated successfully on all flights conducted during each of these campaigns. Sky radiance spectra from scans in either constant azimuth (principal plane) or constant zenith angle (almucantar) were interspersed with direct beam measurements during level legs. During SEAC4RS and ARISE, 4STAR airborne measurements were augmented with flight-level albedo from the collocated Shortwave Spectral Flux Radiometer (SSFR) providing improved specification of below-aircraft radiative conditions for the retrieval. Calibrated radiances and retrieved products will be presented with particular emphasis on detailed comparisons of ambient SSA retrievals and measurements during SEAC4RS from 4STAR, AERONET, HSRL2, and from in situ measurements.

  7. PERKEMBANGAN DAN DIVERSIFIKASI EKSPOR INDONESIA

    Directory of Open Access Journals (Sweden)

    Hermanto Siregar

    2011-08-01

    Full Text Available Normal 0 false false false MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Times New Roman"; mso-ansi-language:#0400; mso-fareast-language:#0400; mso-bidi-language:#0400;} To some extent there was a change of Indonesia’s export in term of product diversification and countries of destination. From the market side , however, there was no change at the  composition of nine biggest export destination in the period of 2002-2004. This shows that there was sluggishness in making adjustment and overcoming constraints in trade. Indonesia needs to diversify the market dan the export products further. Foreign direct investment factor per se can not push the diversification. This factor need to be accompanied by economic stability, as well as taking care of the various internal and external constraints. 

  8. Dans le tourbillon des particules

    CERN Document Server

    Zito, Marco

    2015-01-01

    Accélérateurs géants, détecteurs complexes, particules énigmatiques... La physique subatomique peut sembler bien intimidante pour le novice. Et pourtant, qui n a jamais entendu parler du boson de Higgs et du CERN, le laboratoire européen où il a été découvert en 2012 ? Nul besoin d être un spécialiste pour comprendre de quoi il s agit. Aujourd hui, une théorie extraordinairement élégante, le Modèle Standard, décrit tous les résultats des expériences dans le domaine. Trente-sept particules élémentaires et quatre forces fondamentales : c est tout ce dont nous avons besoin pour expliquer la matière et l Univers ! Ce livre, destiné à un large public, raconte sans équations le long parcours qui a abouti au Modèle Standard. Ce parcours, parfois sinueux, a été entamé lorsque les Grecs anciens, et peut-être d autres avant eux, ont imaginé que la matière est composée de petites « billes ». Il faudra attendre plusieurs siècles pour qu on réalise que la matière, à l échelle micros...

  9. dan valgte de

    DEFF Research Database (Denmark)

    2015-01-01

    Samtale med historikeren Joachim Lund om Erling Foss og Gunnar Larsen. Danmarks største industriforetagende, F L Smidth var deres fælles udgangspunkt. Under besættelsen valgte Erling Foss modstanden og blev medlem af Danmarks Frihedsråd. Gunnar Larsen blev optaget i Staunings Samlingsregering som...... en af de 3 upolitiske ministre. Han blev fængslet og dømt efter befrielsen. Joachim Lund fortæller om deres valg. Billedudsnittet er fra Georg Jacobsens maleri Danmarks Frihedsråd på Frederiksborg Slot. Erling Foss med hænderne i lommen.Bag Foss ses kommunisten Alfred Jensen,der under retsopgøret...... krævede en hård behandling af Gunnar Lasen. Tegningen er af Herluf Bidstrup og viser de 3 upolitiske ministre: Scavenius, Gunnar Larsen og Thune Jacobsen. Tegningen er gengivet fra Carl Madsens bog “Vi skrev loven” fra 1968. Om Gunnar Larsen dagbøger se under samtalen “Samarbejdets mand” Antologien “Sådan...

  10. Implementasi dan Evaluasi Kinerja Modulasi dan Demodulasi GMSK dengan menggunakan WARP

    Directory of Open Access Journals (Sweden)

    Dwi Putri Kusumadewi

    2015-03-01

    Full Text Available Modulasi GMSK ( Gaussian Minimum Shift Keying adalah teknik modulasi yang mengurangi spectrum sidelobe pada modulasi Minimum Shift Keying (MSK dengan cara melewatkan sinyal NRZ ke filter LPF Gaussian. Pada Tugas Akhir ini dilakukan proses perancangan dan implementasi modulasi dan demodulasi GMSK pada platform WARP. Proses perancangan modulasi GMSK dilakukan melalui pemrograman pada software MATLAB 2012. Sistem diimplementasi pada modul WARPLab7. Jumlah bit yang dibangkitkan adalah 106800 bit. Sebelum sistem diimplementasikan pada modul WARP, sinyal hasil ditambahkan dengan bit pilot dan preamble yang nantinya berguna untuk mendeteksi data informasi di penerima. Setelah penambahan pilot dan preamble, data di upsample terlebih dahulu kemudian dilakukan proses upconvert agar dapat dikirimkan melalui WARP. Pengujian implementasi sistem dilakukan dengan cara pengukuran nilai BER (Bit Error Rate secara real pada beberapa kondisi, diantaranya perbedaan nilai BT, perbedaan jarak antara node pengirim dan node penerima dan kondisi LOS (Line of Sight dan NLOS (No Line of Sight.  Berdasarkan hasil pengujian didapatkan pada lingkungan indoor nilai BER terkecil diperoleh pada jarak 4 meter kondisi LOS dengan TxRF sebesar -22.97 dBm dengan BER 6x10-6, sedangkan untuk lingkungan outdoor nilai BER terkecil diperoleh pada jarak 6 meter kondisi LOS dengan TxRF sebesar -22.97 dBm dengan BER 6.9x10-5

  11. EFEKTIVITAS MODEL BLENDED LEARNING TERHADAP MOTIVASI DAN TINGKAT PEMAHAMAN MAHASISWA MATA KULIAH ALGORITMA DAN PEMROGRAMAN

    Directory of Open Access Journals (Sweden)

    Sarah Bibi

    2015-02-01

    Full Text Available Penelitian ini bertujuan untuk (1 mengetahui perbedaan motivasi dan tingkat pemahaman mahasiswa antara pembelajaran model blended learning dengan pembelajaran konvensional, dan (2 mengetahui peningkatan motivasi dan tingkat pemahaman mahasiswa akibat penerapan pembelajaran model blended learning. Jenis penelitian ini adalah quasi experimental. Populasi penelitian adalah mahasiswa semester 2 tahun ajaran 2013/2014 Program Studi Pendidikan Teknologi Informasi dan Komputer STKIP PGRI Pontianak yang berjumlah sebanyak 270 mahasiswa. Penentuan sampel menggunakan teknik purposive sampling berjumlah 156 mahasiswa. Pengumpulan data menggunakan tes soal berbentuk pilihan ganda dan angket, teknik analisis data yang digunakan adalah statistik parametrik uji-t dengan taraf signifikansi 0,05. Hasil penelitian ini menunjukkan bahwa (1 terdapat perbedaan motivasi belajar mahasiswa antara pembelajaran model blended learning dengan pembelajaran konvensional sebesar 5,782 dan terdapat perbedaan tingkat pemahaman sebesar 9,935 serta (2 ada peningkatan motivasi belajar mahasiswa akibat penerapan pembelajaran model blended learning rata-rata peningkatan 11,705 dan ada peningkatan pemahaman mahasiswa rata-rata peningkatan 30,288.

  12. Pengaruh Variasi Kadar Zn Dan Temperatur Hydrotermal Terhadap Struktur Dan Nilai Konduktivitas Elektrik Material Graphene

    Directory of Open Access Journals (Sweden)

    Lita Nur Azizah

    2014-09-01

    Full Text Available Graphene adalah bentuk 2D dari karbon dengan sifat-sifat unggul yang menarik untuk dikembangkan. Permasalahan yang kemudian muncul adalah proses sintesis massal yang masih menjadi kendala. Penelitian ini bertujuan untuk mensintesis material graphene secara kimiawi dengan menggunakan reduktor zinc dan metode hydrothermal dan menganalisa pengaruh varaiasi penambahan massa sebesar 0,8 gram, 1,6 gram, dan 2,4 gram zinc serta variasi temperatur hydrthermal 160ᵒC, 180ᵒC, 200ᵒC. Proses karakterisasi material graphene dilakukan dengan pengujian Scanning Electron Microscope (SEM, X-Ray Diffraction (XRD, Fourier Transform Infrared spectroscopy, Uji Iodine number, dan Four Point Probe digunakan untuk mengetahui nilai konduktivitas elektrik material. Morfologi dari graphene yang dihasilkan berbentuk lembaran-lembaran transparan dan disertai dengan kerutan pada permukaannya. Nilai konduktivitas elektrik terbesar dihasilkan dari variasi panambahan serbuk zinc sebesar 0,8 gram dan temperatur hydrothermal sebesar 200ᵒC dengan nilai sebesar 0,10281 S/cm dan bilangan iodine 11384,64.

  13. Transfert de rayonnement hors ETL pour l'étude des photosphères et des chromosphères stellaires : applications aux atomes du magnésium, du calcium et du fer dans les étoiles tardives.

    OpenAIRE

    Merle, Thibault

    2012-01-01

    The stellar abundance analysis frequently relies on the local thermodynamic equilibrium (LTE) assumption for spectral line formation. This assumption is not always appropriate, in particular, for metal-poor and/or evolved stars. To better understand these stars and contrain their impacts in the chemical enrichment of the Galaxy, it is necessary to use a non-LTE (NLTE) description more realistic but also more complex to built up. My thesis work consisted in constructing model atoms from the mo...

  14. Calcul de haute précision d'énergies de transitions dans les atomes exotiques et les lithiumoïdes : corrections relativistes, corrections radiatives, structure hyperfine et interaction avec le cortège électronique résiduel

    OpenAIRE

    Boucard, Stéphane

    1998-01-01

    In this work we present the calculations of transition energies inlithiumlike and in exotics atoms : 1) With the use of new ions beamsource, it is now possible to produce highly charged ions. We thushave studied li-like ions hyperfine structure to obtain information onrelativistic many-body corrections and the magnetic sector of strongfield QED. In heavy ions these are of the order of a few percent ofthe total transition energy. We also evaluated the Bohr-Weisskopfcorrection, which depends on...

  15. STUDI KANDUNGAN DAN DISTRIBUSI SPASIAL LOGAM BERAT TIMBAL (Pb) PADA SEDIMEN DAN KERANG (Anadara Sp) DI WILAYAH PESISIR KOTA MAKASSAR

    OpenAIRE

    Payung, Febrianti Lolo; Ruslan; Birawida, Agus Bintara

    2013-01-01

    Wilayah pesisir Kota Makassar cukup pesat dengan aktifitas industri dan Kegiatan rumah tangga, serta adanya kegiatan di hulu sungai yang dapat memberikan sumbangsi terbesar bagi pencemaran laut yang berbahaya baik terhadap kehidupan kerang (Anadara sp) dan kesehatan manusia.Penelitian ini bertujuan mengetahui kandungan dan distribusi spasial logam berat timbal (Pb) pada sedimen dan kerang di wilayah pesisir Kota Makassar.Jenis penelitian ini adalah penelitian observasional dengan desain deskr...

  16. Stres dan Koping Mahasiswa Kepribadian Tipe A dan Tipe B dalam Menyusun Skripsi di Fakultas Keperawatan Universitas Sumatera Utara

    OpenAIRE

    Hasibuan, Masnun Dewani

    2012-01-01

    Stres merupakan gangguan pada tubuh dan pikiran yang disebabkan oleh perubahan dan tuntutan kehidupan. Stres bisa terjadi pada siapa saja mulai dari anak-anak, remaja, dewasa dan lansia. Sumber- sumber stres salah satunya adalah tipe kepribadian. Sedangkan koping merupakan cara yang dilakukan individu dalam menyelesaikan masalah, menyesuaikan diri dengan perubahan atau respons terhadap situasi yang mengancam. Penelitian ini bertujuan untuk mengetahui perbedaan stres dan koping mahasiswa kepri...

  17. KESESUAIAN BERAT BADAN DAN TINGGI BADAN TERHADAP ESTIMASI BERAT BADAN DAN TINGGI BADAN PADA USIA DEWASA ETNIS BUGIS KABUPATEN WAJO

    OpenAIRE

    Marhayati; Citrakesumasari; Salam, Abdul

    2015-01-01

    Penilaian status gizi pasien rawat inap di rumah sakit saat ini masih sulit dilakukan karena kondisi pasien yang harus berbaring ditempat tidur. Pengukuran antropometri menjadi bagian dari penilaian status gizi sebagai dasar perhitungan kebutuhan gizi pasien dan untuk menentukan risiko timbulnya masalah gizi. Tujuan penelitian untuk mengetahui kesesuaian antara berat badan dan tinggi badan dengan estimasi berat badan dan tinggi badan berdasarkan LiLA, TILUT dan RL usia dewasa Bugis. Jenis pen...

  18. KESESUAIAN BERAT BADAN DAN TINGGI BADAN TERHADAP ESTIMASI BERAT BADAN DAN TINGGI BADAN PADA USIA DEWASA ETNIS MAKASSAR KABUPATEN JENEPONTO

    OpenAIRE

    Hamid, Nursiami; Jafar, Nurhaedar; Citrakesumasari

    2015-01-01

    Data berat badan dan tinggi badan sangat diperlukan dalam penilaian status gizi, penentuan kebutuhan zat gizi pasien dan pemberian terapi seperti obat atau obat terapi lainnya. Penelitian ini bertujuan untuk mengetahui kesesuaian (kofesien korelasi) antara BB dengan estimasi BB berdasarkan LiLA dan TBA dengan estimasi TB berdasarkan TILUT dan RL pada usia dewasa etnis Makassar. Jenis penelitian ini adalah penelitian deskriptif numeric dengan desain penelitian cross sectional.Teknik sampling m...

  19. Stable atomic hydrogen: Polarized atomic beam source

    International Nuclear Information System (INIS)

    We have carried out experiments with stable atomic hydrogen with a view to possible applications in polarized targets or polarized atomic beam sources. Recent results from the stabilization apparatus are described. The first stable atomic hydrogen beam source based on the microwave extraction method (which is being tested ) is presented. The effect of the stabilized hydrogen gas density on the properties of the source is discussed. (orig.)

  20. PENGARUH PEMBERDAYAAN KERJA DAN PSIKOLOGIS TERHADAP KEPERCAYAAN ORGANISASIONAL DAN KEPUASAN KERJA DOSEN TETAP PERGURUAN TINGGI SWASTA

    Directory of Open Access Journals (Sweden)

    Debora Debora

    2006-01-01

    Full Text Available This research is based on an insifht which is developed from Kanter's structural theory of power in organizations, thich purports to examine the impact of job and psychological emprowerment on organizational trust and job satisfaction. This research employs a cross sectional design, using a sample from 5 private universities in Kalimantan. The respondents are 186 full-time lecturers in these universities. The result of this research proves that job empowerment has a significant and positive impact on psychological empowerment, organizational trust and job satisfaction. Psychological empowerment in turn has significant and positive impact on organizational trust and job satisfaction. Organizational trust has significant and positive impact on job satisfaction. It is also found that job empowerment exerts its positive and significant impact on job satisfaction through the modiation of psychological empowerment and organizational trust. Abstract in Bahasa Indonesia : Penelitian ini merupakan pengembangan teori Kanter tentang structural theory of power in organizations, yang bertujuan menguji pengaruh pemberdayaan kerja, pemberdayaan psikologis dan kepercayaan organisasional terhadap kepuasan kerja. Penelitian ini menggunakan pendekatan cross sectional study pada 5 perguruan tinggi swasta berbentuk universitas di Kalimantan. Responden adalah dosen tetap PTS dengan jumlah 186 orang. Hasil penelitian menunjukkan bahwa pemberdayaan kerja berpengaruh signifikan dan positif terhadap pemberdayaan psikologis, kepercayaan organisasional dan kepuasan kerja. Pemberdayaan psikologis berpengaruh signifikan dan positif terhadap kepercayaan organisasional dan kepuasan kerja. Kepercayaan organisasional berpengaruh signifikan dan positif terhadap kepuasan kerja. Demikian juga pemberdayaan kerja berpengaruh signifikan dan positif terhadap kepuasan kerja dengan dimediasi oleh pemberdayaan psikologis dan kepercayaan organisasional. Kata kunci: pemberdayaan kerja

  1. Neutral atom traps.

    Energy Technology Data Exchange (ETDEWEB)

    Pack, Michael Vern

    2008-12-01

    This report describes progress in designing a neutral atom trap capable of trapping sub millikelvin atom in a magnetic trap and shuttling the atoms across the atom chip from a collection area to an optical cavity. The numerical simulation and atom chip design are discussed. Also, discussed are preliminary calculations of quantum noise sources in Kerr nonlinear optics measurements based on electromagnetically induced transparency. These types of measurements may be important for quantum nondemolition measurements at the few photon limit.

  2. MULTIPHOTON IONIZATION OF ATOMS

    OpenAIRE

    Mainfray, G.

    1985-01-01

    Multiphoton ionization of one-electron atoms, such as atomic hydrogen and alkaline atoms, is well understood and correctly described by rigorous theoretical models. The present paper will be devoted to collisionless multiphoton ionization of many-electron atoms as rare gases. It induces removal of several electrons and the production of multiply charged ions. Up to Xe5+ ions are produced in Xe atoms. Doubly charged ions can be produced, either by simultaneous excitation of two electrons, or b...

  3. Angular correlation measurements in a thermal beam of H^* (2s) atoms using a Stern-Gerlach atomic axicon

    Science.gov (United States)

    Robert, J.; Miniatura, Ch.; Chormaic, S. Nic; Lawson-Daku, J.; Gorceix, O.; Perales, F.; Baudon, J.

    1994-11-01

    The effect of transverse magnetic gradients in Stern-Gerlach atom interferometry is to make interfere plane waves the momenta of which differ in their directions. As a result the contrast of the interference pattern produced by the longitudinal gradient is attenuated by an angular auto-correlation function in the momentum space. This effect is studied experimentally on a thermal beam of metastable H^* (2s) atoms, with a radial transverse gradient (atomic “axicon”). L'effet de gradients magnétiques transverses en interférométrie atomique de type Stern-Gerlach est de faire interférer des ondes planes ayant initialement des vecteurs d'onde différant par leurs directions. Il en résulte que, dans le signal d'interférences induit par le gradient longitudinal, le contraste est atténué par une fonction d'autocorrélation angulaire. Cet effet est étudié expérimentalement sur un jet thermique d'atomes métastables H^* (2s), dans le cas d'un gradient transverse radial (“axicon” atomique).

  4. Customer Services Dan Kepuasan Nasabah (Study Korelasional Antara Aktivitas Customer Service Dan Kepuasaan Nasabah di Bank Syariah Bank Mandiri Medan)

    OpenAIRE

    Wulandari, Ratih

    2010-01-01

    Penelitian ini berjudul COSTUMER SERVICE DAN KEPUASAN NASABAH sebuah studi korelasional tentang hubungan antara aktivitas customer service dan kepuasan nasabah di PT. Bank Syariah Mandiri. Masalah dalam penelitian ini adalah Sejauhmanakah pengaruh Customer Service PT. Bank Syariah Mandiri dapat memberi kepuasan kepada nasabah ?”. Tujuan penelitian adalah untuk mengetahui bagaimana kepuasan yang dirasakan nasabah Bank Syariah Mandiri Medan dan untuk mengetahui sejauhmana peng...

  5. Korelasi Kondisi Daun Terhadap Kadar Pb, dan Klorofil Daun Hibiscus tiliaceus dan Swietenia macrophylla King di Kampus Universitas Hasanuddin Makassar

    OpenAIRE

    Sri Suhadiyah; Roland A. Barkey; Elis Tambaru

    2015-01-01

    Meningkatnya aktivitas yang bersifat komersial diperkotaan berpotensi meningkatkan konsentrasi polutan di udara akibat padatnya lalu lintas kendaraan bermotor dan kegiatan industri. Penelitian analisis kadar klorofil, Konsentrasi Pb, jumlah stomata, jumlah trikomata dan luas daun waru (Hibiscus tiliaceus L.) dan mahoni (Swietenia macrophylla King.) di Kampus Universitas Hasanuddin Makassar telah dilakukan pada bulan juli-agustus 2014. Penelitian ini bertujuan untuk mengetahui pengaruh tanam...

  6. Pengaruh pupuk kandang dan NPK terhadap populasi bakteri Azotobacter dan Azospirillum dalam tanah pada budidaya cabai (Capsicum annum)

    OpenAIRE

    MUJIYATI; SUPRIYADI

    2009-01-01

    Mujiyati, Supriyadi. 2009. Pengaruh pupuk kandang dan NPK terhadap populasibakteri Azotobacter dan Azospirillum dalam tanah pada budidaya cabai (Capsicumannum). Bioteknologi 6: 63-69. Tujuan penelitian ini adalah mengetahui peningkatan populasi bakteri Azotobacter dan Azospirillum akibat pemberian pupuk kandang. Percobaan menggunakan rancangan acak kelompok dengan perlakuan: (i) tanpa pupuk sebagai kontrol, (ii) dengan pupuk kandang, (iii) dengan pupuk NPK. Data dikumpulkan se...

  7. Cross section measurements of the processes occurring in the fragmentation of H{sub n}{sup +} (3 {<=} n {<=} 35) hydrogen clusters induced by high speed (60 keV/u) collisions on helium atoms; Mesure des sections efficaces des differents processus intervenant dans la fragmentation d`agregats d`hydrogene H{sub n}{sup +} (3 {<=} n {<=} 35) induite par collision a haute vitesse (60 keV/u) sur un atome d`helium

    Energy Technology Data Exchange (ETDEWEB)

    Louc, Sandrine [Inst. de Physique Nucleaire, Lyon-1 Univ., 69 - Villeurbanne (France)

    1997-09-15

    Different processes involved in the fragmentation of ionised hydrogen clusters H{sub 3} + (H{sub 2}){sub (n-3)/2} (n = 5-35) have been studied in the same experiment: the fragmentation of the cluster is induced by the collision with an helium atom at high velocity ({approx_equal} c/100). The collision is realised in reversed kinematic - clusters are accelerated - which allows the detection of neutral and charged fragments. The different channels of fragmentation are identified by using coincidence techniques. For all the cluster sizes studied the capture cross sections of one electron of the target by the cluster is equal to the capture cross section of the H{sub 3}{sup +} ion. In the same way, the dissociation cross section of the H{sub 3}{sup +} core of the cluster does not depend on cluster size. These fragmentation processes are due to the interaction of H{sub 3}{sup +} core of the cluster and the helium atom without ionization of another component of the cluster. On the contrary, the cross sections of loss of one, two and three molecules by the cluster and the dissociation cross section of the cluster in all its molecular components depends strongly on the cluster size. This dependence is different from the one measured for the metastable decay of the cluster. Thus, the process of loss of molecules induced by a collision should correspond to a different dissociation mechanism. In regard of the singularities observed for the size dependence, the H{sub 9}{sup +}, H{sub 15}{sup +}, H{sub 19}{sup +} and H{sub 29}{sup +} clusters could be the `core` of the biggest clusters. These observation are in agreement with the size effects of smaller magnitude observed for the dissociation cross section (all the processes). The values of the cross section for the process of at least one ionization of the cluster indicate that about 80% of the fragmentation events result from this process. (author) 114 refs., 74 figs., 9 tabs.

  8. Perolehan Kembali Nikel Dari Katalis Nikel Terpakai (Spent Catalyst) Pasca Proses Hidrogenasi Minyak Sawit Dengan Proses Pelindian (Leaching) Asam Sulfat

    OpenAIRE

    Hasrul Abdi Hasibuan

    2010-01-01

    Telah dilakukan penelitian tentang perolehan kembali nikel dari katalis nikel terpakai (spent catalyst) pasca proses hidrogenasi minyak sawit dengan proses pelindian (leaching) asam sulfat. Penelitian ini dilakukan dengan cara ekstraksi residu minyak, rekoveri nikel dari katalis nikel terpakai serta penentuan energi aktivasi proses pelindian. Minyak diekstraksi menggunakan alat soklet dan kadar Ni ditentukan menggunakan Spektrofotometer Serapan Atom (SSA). Hasilnya menunjukkan bahwa katal...

  9. ISOLASI DAN PENAPISAN BAKTERI ASAM LAKTAT DARI SALURAN PENCERNAAN IKAN SEBAGAI PROBIOTIK UNTUK PENGENDALIAN PENYAKIT STREPTOCOCCOSIS DAN LACTOCOCCOSIS PADA IKAN NILA (OREOCHROMIS NILOTICUS)

    OpenAIRE

    Hasni Azis; Hilal Anshary; Sriwulan; Gunarto Latama

    2012-01-01

    Isolasi dan identifikasi bakteri asam laktat yang memiliki potensi antibakteri terhadap bakteri penyebab penyakit streptococcosis/Lactococcosis dari usus ikan Lele Clarias gariepinus dan ikan gabus Ophiocephalus striatus telah dilakukan untuk mengatasi penyakit tersebut pada ikan nila Oreochromis niloticus. Sebanyak masing-masing 20 ekor ikan lele dan ikan gabus dibedah secara aseptic dengan mengambil bagian usus dan lambungnya dan selanjutnya usus dibedah secara aseptic dan selanjutnya melet...

  10. ISOLASI DAN PENAPISAN BAKTERI ASAM LAKTAT DARI SALURAN PENCERNAAN IKAN SEBAGAI PROBIOTIK UNTUK PENGENDALIAN PENYAKIT STREPTOCOCCOSIS DAN LACTOCOCCOSIS PADA IKAN NILA (OREOCHROMIS NILOTICUS)

    OpenAIRE

    Hasni Azis; Hilal Anshary; Gunarto Latama

    2013-01-01

    Isolasi dan identifikasi bakteri asam laktat yang memiliki potensi antibakteri terhadap bakteri penyebab penyakit streptococcosis/Lactococcosis dari usus ikan Lele Clarias gariepinus dan ikan gabus Ophiocephalus striatus telah dilakukan untuk mengatasi penyakit tersebut pada ikan nila Oreochromis niloticus. Sebanyak masing-masing 20 ekor ikan lele dan ikan gabus dibedah secara aseptic dengan mengambil bagian usus dan lambungnya dan selanjutnya usus dibedah secara aseptic dan selanjutnya melet...

  11. PENGEMBANGAN MODEL TRACKING DAN TRACING DALAM DISTRIBUSI KOMODITI PERTANIAN

    Directory of Open Access Journals (Sweden)

    Yandra Rahadian Perdana

    2011-06-01

    Full Text Available Kegagalan distribusi komoditi pertanian dapat berdampak pada penurunan dan kehilangan nilai baik secara kualitas dan kuantitas karena suatu perubahan dimensi waktu-jarak atau suhu serta sarana pengangkutan dalam setiap mata rantai aktivitas distribusi. Model tracking dan tracing system dapat menjadi strategi untuk menjamin keberhasilan distribusi komoditi pertanian secara tepat baik kuantitas maupun kualitas. Model tracking dan tracing komoditi pertanian adalah sebuah sistem proaktif yang real time yang dilengkapi dengan komponen pendukung proses distribusi dengan data yang akurat, terpercaya, berguna, dan cepat dengan memberikan informasi posisi barang atau sarana moda transportasinya.

  12. Aspek Legal dan Komitmen Etikal dalam Mu’amalah Maliyah

    Directory of Open Access Journals (Sweden)

    Lalu Fahmi Zainul Arifin

    2015-11-01

    Full Text Available Legalitas dalam mu’amalah maliyah bukanlah sekedar formalitas yang apriori ataupun pesimistik terhadap relativisme moral, karena aspek etikal yang diartikulasikan dalam berbagai prinsip mu’amalah adalah salah satu konsideran yang mendasar dan pokok dalam proses memahami dan inheren dengan “halal haram”, sehingga terkadang sukar untuk menarik garis tegas antara normativitas dan positivitas. Artikel ini menjelaskan bagaimana prinsip-prinsip moral keislaman sebagai aspek pokok dan karakteristik mendasr mu’amalah maliyah, sehingga komitmen moral di dalam mu’amalah maliyah dapat diukur melalui sistem pengawasan internal, yaitu tanggungjawab personal hamba kepada Tuhan dan pengawasan eksternal melalui otoritas pemerintah atau lembaga berwenang.

  13. Quel 'partage' dans un voyage en covoiturage ?

    OpenAIRE

    Mani, Zied

    2016-01-01

    Notre recherche s'intéresse au principe de partage dans la consommation collaborative à travers l'exemple du covoiturage. Une étude qualitative basée sur une triangulation des méthodes de collecte nous a permis d'identifier trois dimensions de partage: le partage économique, le partage social et le partage d'espace privé. Ainsi, le partage dans le covoiturage apparaît comme un concept ambivalent. Il est à l’origine d’une pratique qui bénéficie économiquement à tous les participants. Cependant...

  14. Intrication et Imperfections dans le Calcul Quantique

    OpenAIRE

    Pomeransky, Andrei

    2004-01-01

    L'information quantique est un nouveau domaine de la physique, qui consiste à employer les systèmes quantiques dans le calcul et la transmission de l'information. Cette thèse est consacrée à l'étude de certains aspects théoriques de l'information quantique. Les ordinateurs quantiques utilisent les lois de la mécanique quantique pour exécuter des calculs d'une manière bien plus efficace que les ordinateurs existants. Les ordinateurs quantiques envisageables dans la pratique seraient influencés...

  15. RITUXIMAB DANS LA POLYARTHRITE RHUMATOÏDE

    OpenAIRE

    ABABOU, Hadjer; DAFFI, SOUMIA

    2012-01-01

    La polyarthrite rhumatoïde est un rhumatisme inflammatoire chronique. Les biothérapies mises au point ont révolutionné la prise en charge du patient, parmi ceux-ci, on peut citer le Rituximab: est un anticorps monoclonal inhibant spécifiquement le récepteur CD20 des lymphocytes B. Notre travail a pour buts d'évaluer l'efficacité de Rituximab dans le traitement de polyarthrite rhumatoïde chez les patients suivis dans le service de rééducation CHU Tlemcen. Il s'agit d'une étud...

  16. Le corps dans l'Antiquité

    Directory of Open Access Journals (Sweden)

    Sophie Lalanne

    2008-06-01

    Full Text Available Ouvrages générauxLaqueur Thomas, La fabrique du sexe. Essai sur le corps et le genre en Occident, trad. fr., Paris, Gallimard, 1992.Feher Michel, Naddaff Ramona, Tazi Nadia, Fragments for a History of the Human Body, 3 volumes, New York, Zone Books, 1989.Le Corps dans l’AntiquitéBodiou Lydie, Frère Dominique, Mehl Véronique dir., L’expression des corps. Gestes, attitudes, regards dans l’iconographie antique, Rennes, Presses Universitaires de Rennes, 2006.Bonnard Jean-Baptiste, Le complexe de ...

  17. Procrastination et projection mentale dans le futur

    OpenAIRE

    Zuber, Sascha

    2014-01-01

    La procrastination ou la tendance à remettre les choses au lendemain est un phénomène complexe car plusieurs facteurs y sont associés. Le but ici est d’examiner le lien entre la procrastination et la projection mentale dans le futur. Mais également d'explorer différents facteurs qui pourraient moduler ce lien tels que la perspective temporelle, le niveau d’identification de l’action et la régulation émotionnelle. Nous avons donc administré une tâche de projection mentale dans le futur, ainsi ...

  18. Dan jiang kou hydropower station turbine refurbishment

    International Nuclear Information System (INIS)

    Dan jiangkou hydropower station refurbished project, isan important project of Chinese refurbishment market. Tianjin Alstom Hydro Co., ltd won this contract by right of good performance and design technology,Its design took into account all the constraints linked to the existing frame. It results in a specific and highly advanced shape.The objective of this paper is to introduce the successful turbine hydraulic design, model test and mechanical design of Dan jiangkou project; and also analyze the cavitation phenomena occurred on runner band surface of Unit 4 after putting into commercial operation. These technology and feedback shall be a good reference and experience for other similar projects

  19. Atomic and molecular manipulation

    CERN Document Server

    Mayne, Andrew J

    2011-01-01

    Work with individual atoms and molecules aims to demonstrate that miniaturized electronic, optical, magnetic, and mechanical devices can operate ultimately even at the level of a single atom or molecule. As such, atomic and molecular manipulation has played an emblematic role in the development of the field of nanoscience. New methods based on the use of the scanning tunnelling microscope (STM) have been developed to characterize and manipulate all the degrees of freedom of individual atoms and molecules with an unprecedented precision. In the meantime, new concepts have emerged to design molecules and substrates having specific optical, mechanical and electronic functions, thus opening the way to the fabrication of real nano-machines. Manipulation of individual atoms and molecules has also opened up completely new areas of research and knowledge, raising fundamental questions of "Optics at the atomic scale", "Mechanics at the atomic scale", Electronics at the atomic scale", "Quantum physics at the atomic sca...

  20. Advances in atomic spectroscopy

    CERN Document Server

    Sneddon, J

    2000-01-01

    This fifth volume of the successful series Advances in Atomic Spectroscopy continues to discuss and investigate the area of atomic spectroscopy.It begins with a description of the use of various atomic spectroscopic methods and applications of speciation studies in atomic spectroscopy. The emphasis is on combining atomic spectroscopy with gas and liquid chromatography. In chapter two the authors describe new developments in tunable lasers and the impact they will have on atomic spectroscopy. The traditional methods of detection, such as photography and the photomultiplier, and how they are being replaced by new detectors is discussed in chapter three. The very active area of glow discharge atomic spectrometry is presented in chapter four where, after a brief introduction and historical review, the use of glow discharge lamps for atomic spectroscopy and mass spectrometry are discussed. Included in this discussion is geometry and radiofrequency power. The future of this source in atomic spectroscopy is also dis...

  1. Les AOC dans la mondialisation

    Directory of Open Access Journals (Sweden)

    Jean-Claude Hinnewinkel

    2004-12-01

    Full Text Available Fruit du conflit plusieurs fois séculaire entre les producteurs et le négoce, le terroir vitivinicole est né de phénomènes de « distinction » qui en Bordelais donnent les « crus ». Ces terroirs de production identifiés, il fallut les faire durer, face à conjoncture, face au négoce. Les réussites les plus nettes sont le résultat d’un projet collectif dont l’AOC à la française est l’une des plus spectaculaires. Renforcer le terroir, compris comme un espace de production géré par les producteurs, devient alors une des conditions essentielles de la durabilité du système. L’avenir des AOC réside sans doute dans une meilleure gestion du conflit négoce/production par l’interprofession mais aussi (surtout ! dans un renforcement de la gestion de la production au sein de l’aire de production qu’est le terroir. L’avenir du terroir relève de la gouvernance de cette aire de production avec trois partenaires : la puissance publique (INAO, l’interprofession et le syndicat des producteurs. Se pose dès lors la question du partage des compétences et la durabilité des AOC paraît liée en grande partie à une définition claire du rôle et donc du statut des syndicats de producteurs, à une véritable gouvernance locale, seule capable de donner du sens à l’ancrage géographique des vins dits de « terroir ». Mais alors ne faut-il pas impliquer un troisième partenaire, la société locale toute entière à travers ses représentations démocratique et associative ?Resulting from century-long conflicts between producers and merchants, vineyards have developped out of "distinction" phenomenons which in the Bordeaux region gave birth to "crus" (vintages. Such identified terroirs had to be defended: the French collective AOC (Denomination of Origin project is one of the most spectacular success. The terroir, as production territory organized by producers, is one of the essential conditions for sustainability

  2. Frequency shift due to blackbody radiation in a cesium atomic fountain and improvement of the clock performances; Deplacement de frequence du au rayonnement du corps noir dans une fontaine atomique a cesium et amelioration des performances de l'horloge

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, S

    2004-07-01

    FO1 was the first caesium fountain primary frequency standard in the world. The most recent evaluation in 2002 before improvement reached an accuracy of 1*10{sup -15} when operated with optical molasses. Working as an extremely precise and stable instrument, FO1 has contributed to fundamental physics and technical measurements: - Frequency comparison between Cs and Rb fountains over an interval of 5 years sets an upper limit for a possible variation of the fine structure constant as |alpha/alpha| < 2*10{sup -15}/y. The resolution is about 5 times better than the previous test in our laboratory. The projected accuracy of the space clock PHARAO is 1*10{sup -16}. We confirmed its Ramsey cavity performance by testing the phase difference between the two interaction zones in FO1. The measured temperature T dependent frequency shift of the Cs clock induced by the blackbody radiation field is given as nu(T)=154(6)*10{sup -6}*(T/300){sup 4}[1+{epsilon}(T/300){sup 2}] Hz with the theoretical value {epsilon} = 0,014. The obtained accuracy represents a 3 times improvement over the previous measurement by the PTB group. Some improvements have been carried out on FO1. The new FO1 version works directly with optical molasses loaded by a laser slowed atomic beam. The application of the adiabatic passage method to perform the state selection allows us to determine the atom number dependent frequency shifts due to the cold collision and cavity pulling effects at a level of of 10{sup -16}. Recently, the obtained frequency stability is 2,8*10{sup -14}*{tau}{sup -1/2} for about 4*10{sup 6} detected atoms. The accuracy is currently under evaluation, the expected value is a few times 10{sup -16}. (author)

  3. PENYAKIT MENULAR SEKSUAL AKIBAT JAMUR, PROTOZOA, DAN PARASIT

    Directory of Open Access Journals (Sweden)

    Max Joseph Herman

    2012-09-01

    Full Text Available Berbagai penyakit akibat hubungan seksual (PHS selain yang disebabkan oleh bakteri, klamidia, virus, dan mikroplasma, juga mungkin disebabkan oleh jamur, protozoa dan parasit, antara lain kandidiasis, trikomoniasis, giardiasis, amebiasis, kudis, dan kutu pubis. Diagnosis PHS yang tepat dan pasti sangat penting karena mcmiliki konotasi sosial dan biasanya diperoleh melalui pemeriksaan mikroskopik, pembenihan bakteriologis atau virologis. Sedangkan penatalaksanaan PHS bergantung pada infeksi masing-masing individu, tetapi secara umum apabila PHS sendiri tidak/kurang serius seperti trikomoniasis atau ektoparasit maka tidak perlu pengamatan pasangan seksual meskipun harus diobati juga karena hampir pasti ia juga terinfeksi. Sebagian besar PHS lain demikian berat (dalam kasus gonore resistensi terhadap antibiotika merupakan masalah sehingga semua kontak seksual harus ditelusuri dan diobati, khususnya pada gonore, sifilis dan AIDS.

  4. MENDORONG PASAR MODAL EFISIEN DAN BERDAYA SAING GLOBAL

    Directory of Open Access Journals (Sweden)

    Satia Nur Maharani

    2006-01-01

    Full Text Available Globalisasi semakin memperpendek jarak dan waktu. Kemampuannya mampu  merubah wajah planet bumi menjadi” just a small village “ melalui peningkatan ilmu pengetahuan dan teknologi. Perubahan tersebut bertransformasi pula pada  sistem ekonomi. Modal berdiri sendiri tanpa identitas dan siapa saja berhak untuk berinvestasi tanpa batas melalui sebuah mekanisme antar negara dan benua. Salah satu lintasan modal untuk meraih keuntungan adalah melalui mekanisme pasar modal. Pasar modal manakah yang diminati oleh arus modal masuk adalah pasar modal yang mampu memberikan jamuan terbaik berupa keuntungan yang tinggi dengan resiko yang optimal. Maka untuk mencapai pelayan yang maksimal bagi masyarakat pemodal , pasar modal harus efisien dan berdaya saing global. Maka keterbukaan informasi, peningkatan teknologi, efisiensi biaya penegakan hukum, partisipasi masyarakat dan pemerintah, inovasi produk mutlak untuk dievaluasi dan ditingkatkan

  5. Modernitas dan Tragedi: Kritik dalam Sosiologi Humanistis Zygmunt Bauman

    Directory of Open Access Journals (Sweden)

    Robertus Robet

    2016-06-01

    Full Text Available Bauman berpandangan bahwa modernitas memiliki dua gejala pokok yakni modernitas padat dan modernitas cair. Dalam modernitas padat masyarakat tumbuh dalam bimbingan ide dan tatanan, sementara dalam modernitas cair masyarakat dan manusia secara paradoksal didikte oleh ilusi mengenai kecepatan dan perubahan yang terus menerus hingga akhirnya kehilangan pendasaran. Dalam membentuk tatanan, modernitas mensyaratkan praktik kategorisasi dan pengadministrasian. Dengan itu modernitas memastikan siapa yang bagian tatanan dan siapa yang bukan bavian dari tatanan. Kategorisasi berimplikasi pada ambivalansi yakni munculnya aktor yang tak terdefinisikan sebagai bagian atau bukan bagian dari kategorisasi dan administrasi itu. Dalam sejarah, mereka yang didefinisikan sebagai bukan bagian adalah mereka yang rentan untuk diekslusikan. Ambivalensi modernitas inilah yang kemudian berujung pada holocaust. Berdasar pengalaman itu, Bauman kemudian mengajak kita untuk bukan hanya memahami sosiologi sebagai ilmu yang memiliki komitmen terhadap kebenaran , tetapi juga ilmu yang menghargai kekayaan dalam pengalaman manusia yang beragam.

  6. CARA MENGHILANGKAN RASA DAN BAU PADA PENGOLAHAN AIR MINUM

    Directory of Open Access Journals (Sweden)

    Sri Soewasti Soesanto

    2012-12-01

    Full Text Available Salah satu syarat kualitas air minum adalah tidak berwarna, tidak ada rasa, dan tidak berbau. Kebanyakan konsumen air minum menilai baik tidaknya kualitas air minum hanya secara visual, keruh atau jernih, berwarna atau tidak dan dengan indera pengecap apakah ada rasa atau tidak serta dengan indera pencium; berbau atau tidak. Tulisan ini hanya akan membahas dua aspek yaitu rasa dan bau yang sering dikeluhkan oleh konsumen.Sumber kontaminasi yang menimbulkan rasa dan bau dalam air dapat bersifat alami maupun anthropogenik.Untuk menghilangkan rasa dan bau karena sebab alami ada beberapa pilihan cara pengolahan yaitu sedimentasi konvensional secara gaya berat (Conventional Gravity Sedimentatin = CGS dan pengembangan udara terlarut (Dissolved Air Flotation = DAF, ozonisasi dan filtrasi dengan karbon aktif granular (Granular Activated Carbon = GAC. 

  7. EFEKTIVITAS DAN EFEK TOKSIK EKSTRAK STEROID TERIPANG DAN 17α METILTESTOSTERON PADA MANIPULASI KELAMIN UDANG GALAH

    Directory of Open Access Journals (Sweden)

    Apri Arisandi

    2012-10-01

    Full Text Available Testosteron selain dapat dimanfaatkan sebagai obat, juga dimanfaatkan untuk sex reversal pada udang galah (Macrobrachium rosenbergii de Man.  Hormon yang umum dipakai untuk sex reversal jantan adalah 17α metiltestosteron, merupakan hormon sintetis.  Bioassay pada ayam, diketahui bahwa hormon sintetis memberikan efek samping toksik pada hati, limpa dan bursa fabricius.  Agar tidak memberikan efek toksik, salah satu cara dengan menggunakan sumber hormon testosteron alami dari teripang.  Pemberian hormon menggunakan metode dipping, lima perlakuan dan tiga ulangan.  Dosis ekstrak steroid teripang 1, 2 dan 3mg/l, serta 17α metiltestosteron 2mg/l dapat menghasilkan populasi jantan lebih tinggi dari kontrol negatif (tanpa hormon, yaitu 44,15%, 49,65%, 49,72% dan 50,45%.   Kata kunci: ekstrak steroid teripang, 17α metiltestosteron, udang galah

  8. THE ORNL ATOM PROBE

    OpenAIRE

    Miller, M

    1986-01-01

    The ORNL Atom Probe is a microanalytical tool for studies in materials science. The instrument is a combination of a customized version of the vacuum system of the VG FIM-100 atom probe, an ORNL-designed microcomputer-controlled digital timing system, and a double curved CEMA Imaging Atom Probe detector. The atom probe combines four instruments into one - namely a field ion microscope, an energy compensated time-of-flight mass spectrometer, an imaging atom probe, and a pulsed laser atom probe.

  9. Innovation and optimization of a method of pump-probe polarimetry with pulsed laser beams in view of a precise measurement of parity violation in atomic cesium; Innovation et optimisation d'une methode de polarimetrie pompe-sonde avec des faisceaux laser impulsionnels en vue d'une mesure precise de violation de la parite dans l'atome de cesium

    Energy Technology Data Exchange (ETDEWEB)

    Chauvat, D

    1997-10-15

    While Parity Violation (PV) experiments on highly forbidden transitions have been using detection of fluorescence signals; our experiment uses a pump-probe scheme to detect the PV signal directly on a transmitted probe beam. A pulsed laser beam of linear polarisation {epsilon}{sub 1} excites the atoms on the 6S-7S cesium transition in a colinear electric field E || k(ex). The probe beam (k(pr) || k(ex)) of linear polarisation {epsilon}{sub 2} tuned to the transition 7S-6P(3/2) is amplified. The small asymmetry ({approx} 10{sup -6}) in the gain that depends on the handedness of the tri-hedron (E, {epsilon}{sub 1}, {epsilon}{sub 2}) is the manifestation of the PV effect. This is measured as an E-odd apparent rotation of the plane of polarization of the probe beam; using balanced mode polarimetry. New criteria of selection have been devised, that allow us to distinguish the true PV-signal against fake rotations due to electromagnetic interferences, geometrical effects, polarization imperfections, or stray transverse electric and magnetic fields. These selection criteria exploit the symmetry of the PV-rotation - linear dichroism - and the revolution symmetry of the experiment. Using these criteria it is not only possible to reject fake signals, but also to elucidate the underlying physical mechanisms and to measure the relevant defects of the apparatus. The present signal-to-noise ratio allows embarking in PV measurements to reach the 10% statistical accuracy. A 1% measurement still requires improvements. Two methods have been demonstrated. The first one exploits the amplification of the asymmetry at high gain - one major advantage provided by our detection method based on stimulated emission. The second method uses both a much higher incident intensity and a special dichroic component which magnifies tiny polarization rotations. (author)

  10. Semiotika Kemasan Produk Susu Rasa Coklat Dan Stroberi pada Merek Indomilk Kids Dan Boneeto

    OpenAIRE

    Mukaromah Mukaromah

    2016-01-01

    Abstrak Kemasan adalah salah satu penentu keberhasilan dalam penjualan produk terkait dengan informasi pesan yang ingin disampaikan,untuk itu visualisasi dibuat semenarik mungkin agar dapat menyasar segmen yang ingin diraih. Demikian halnya dengan susu kemasan kotak untuk anak-anak yang terpapar di meja elalase di pusat- pusat perbelanjaan. Dalam penelitian ini penulis melihat bagaimana susu kemasan kotak merek Indomilk Kids dan Boneeto rasa coklat dan rasa stroberi yang dikonstruksikan sed...

  11. Diagnosis dan Penatalaksanaan Tragus Asesorius dan Stenosis Liang Telinga pada Hemifasial Mikrosomia

    Directory of Open Access Journals (Sweden)

    Al Hafiz .

    2016-01-01

    Full Text Available Abstrak           Hemifasial mikrosomia (HFM adalah diagnosis paling sering pada lesi wajah asimmetris dan merupakan kelainan kongenital wajah terbanyak kedua. HFM merupakan malformasi kongenital dimana terdapat defisiensi jaringan lunak dan tulang pada satu sisi wajah dan gangguan perkembangan telinga, terutama telinga luar. Diagnosis ditegakkan berdasarkan pada anamnesis, pemeriksaan fisik, dan pemeriksaan radiologis. HFM memiliki manifestasi klinis yang beragam, dan dipertimbangkan mendapatkan penatalaksanaan komprehensif yang melibatkan rekontruksi medik luas.               .           Sebuah kasus hemifasial mikrosomia dengan tragus asesorius dan stenosis liang telinga kanan dilaporkan pada perempuan berusia 13 tahun dan telah dilakukan rekonstruksi tragus dan kanaloplasti. Kata kunci: hemifasial mikrosomia, lesi wajah asimmetris, rekontruksi tragus, kanaloplasti. AbstractHemifacial microsomia (HFM is the most frequent diagnosis in asymmetry facial lesions and the top second facial congenital lesion. HFM is a congenital malformation in which there is a deficiency of soft tissue and bone on one side of the face and malformation of the ear, especially outer ear. The diagnosis is based on history, physical examination, and radiological finding. HFM had various clinical manifestation and considered to comprehensive management involving extensive medical reconstruction. A hemifacial microsomia case with right tragal assesoria and ear canal stenosis has been reported in girl aged 13 years old and have performed tragus reconstruction and canaloplasty. Keywords:  hemifacial microsomia, asymmetrical facial lession, tragus reconstruction, canaloplasty

  12. Perancangan dan Pembuatan Commerce Qz_Collection Online System Berbasis Web Menggunakan PHP dan Mysql

    OpenAIRE

    Puspita, Putri Indah

    2015-01-01

    Kajian ini bertujuan membangun suatu website E-Commerce pada toko baju Qz_Collection. Website ini di kembangkan dengan menggunakan perangkat lunak Adobe Dreamweaver, Apache, PHP dan MySQL. Website ini berfungsi untuk memberikan informasi tentang toko baju Qz_Collection yang juga meliputi sistem penjualan online.Tujuan perancangan situs e-commerce ini adalah untuk mempermudah masyarakat dalam memperoleh informasi mengenai toko baju Qz_Collection secara online dan update mengenai deskripsi baju...

  13. Teknologi Pengolahan dan Pemanfaatan Bambu oleh Masyarakat Kota Binjai dan Kabupaten Langkat

    OpenAIRE

    Manalu, Eka A.

    2011-01-01

    Bambu tergolong dalam hasil hutan non kayu, yang oleh masyarakat dikenal sebagai tanaman serbaguna. Dikatakan demikian karena tanaman ini dapat digunakan untuk berbagai keperluan, salah satu manfaatnya adalah sebagai alternatif pengganti kayu. Bambu mudah diperoleh dengan harga yang relatif murah dan umur produksinya relatif cepat. Bambu merupakan tanaman berumpun dan dimasukkan dalam famili Gramineae. Bambu merupakan sumberdaya alam yang dapat diperbaharui serta memiliki keunggulan dari s...

  14. Afiks/Ahruf Ziy?dah Dalam Bahasa Arab Dan Pengaruhnya Terhadap Perubahan Makna : Analisis Morfologi

    OpenAIRE

    Kamalia

    2009-01-01

    Proses afiksasi dalam bahasa Arab dibentuk dari bentuk dasar verba/fi’l dengan penambahan prefiks/awalan (as-s?biq), infiks/sisipan (az-ziy?dah),dan konfiks/ awalan dan akhiran (as-s?biq wa al-l?hiq). Prefiks dan infiks yang digunakan untuk membentuk nomina/ism dari bentuk dasar verba/ fi’l terdiri dari prefiks mim dan infiks alif, serta konfiks mim dan ta’, konfiks mim dan waw dan konfiks mim dan alif. Penambahan afiks dari bentuk dasar adjektiva terdiri dari prefiks hamzah dan infiks a...

  15. SEBARAN KANDUNGAN LOGAM BERAT Cd PADA SEDIMEN DI MUARA SUNGAI WAY KUALA BANDAR LAMPUNG

    OpenAIRE

    Diky Hidayat; Ni Putu Inda Novita

    2012-01-01

    Penelitian penentuan penyebaran konsentrasi logam berat Cd pada sedimen di muara sungai Way Kuala telah dilakukan. Tujuan penelitian ini adalah untuk melihat penyebaran konsentrasi logam berat pada sedimen di muara tersebut. Konsentrasi Cd ditentukan dengan menggunakan spektrofotometer serapan atom (SSA), dengan menggunakan empat validasi metode yaitu batas deteksi, presisi, akurasi, dan linieritas. Hasil menunjukkan bahwa konsentrasi logam berat Cd dalam sampel sedimen di hulu, badan, dan hi...

  16. Using gamma ray 60Co for improvement rive variety (KhangDan-18)

    International Nuclear Information System (INIS)

    Mutation breeding has been applied successfully for crop breeding. By 2005, there were 2451 varieties were released through mutagenesis in the world, in which rice varieties were more than 1750 varieties (IAEA, 2007). According to scientists mutagensis treatment seem to be more efficiency than other traditional methods because of this method causes changing only one or two characters but the remain are intact. Under supporting from IAEA/VIE/5/014 and Vietnam Atomic Energy Commission, we carried out scientific topic Improvement of KhangDan-18 by induce mutagenesis treatment on dry seed. The main objective of project is through mutagenesis treatment to maintain promising characters and repair some disadvantage characters of the origin Khang dan 18 variety. Mutant variety DT38 have been released, which is prominent to the origin such as: higher yield, non lodging, good resistance to some pests and diseases. This variety have been planting in different provinces. The average yielding of DT38 is higher than that of the origin KhangDan-18 10%, in some locations is 15%. (author)

  17. ASUPAN ZAT GIZI DAN STATUS GIZI PADA REMAJA PUTRI YANG SUDAH DAN BELUM MENSTRUASI

    Directory of Open Access Journals (Sweden)

    Dyan Fajar Christianti

    2013-11-01

    Full Text Available ABSTRACTThe objective of this study was to analyze nutrient intake and nutritional status of menstruating and non-menstruating girls. This survey was conducted from April to September 2012 in elementary schools and junior high schools in Bogor. Total subjects consisted of 35 menstruating and 35 non-menstruating girls who were chosen through screening. The results showed that the percentage of menstruating girls in urban (28.0% were more than in rural (25.1%. About 57.1% of subjects had menarche at 10 years old. The average of nutrient intake on menstruating and non-menstruating girls were under DRI (Keywords: BMI/age, girls, menstruation, nutrient intake, percent body fatABSTRAKTujuan penelitian ini adalah untuk menganalisis asupan zat gizi dan status gizi pada remaja putri yang sudah dan belum menstruasi. Survei ini dilaksanakan pada April—September 2012 di Sekolah Dasar (SD dan Sekolah Menengah Pertama (SMP di Bogor. Jumlah subjek terdiri dari 35 orang yang sudah menstruasi dan 35 orang yang belum menstruasi dan dipilih melalui screening. Hasil penelitian menunjukkan bahwa persentase terjadinya menstruasi pada siswi di sekolah kota lebih besar (28.0% dibandingkan dengan di kabupaten (25.1%. Sebanyak 57.1% subjek mengalami menarche pada usia 10 tahun. Rata-rata asupan zat gizi subjek yang sudah dan belum menstruasi masih berada di bawah AKG (Kata kunci: asupan zat gizi, IMT/U, menstruasi, persen lemak tubuh, remaja putri*

  18. Pemahaman dan Keterampilan Siswa dalam Pengelolaan Sampah Rumah Tangga dan Penerapan E-Media

    Directory of Open Access Journals (Sweden)

    Mimien Henie Irawati Al Muhdhar

    2013-01-01

    Full Text Available Abstract: Students' Understanding and Skills in Managing Household Waste and the Implementation of E-Media. This classroom action research aims at examining how the implementation of e-media can improve the understanding and the skills of students of various levels of education in Malang in managing household waste. Through the stages of planning, implementing, observing, and reflecting, the study reveals that the implementation of e-media can improve the  understanding and skills of students of elementary schools, junior high schools, and senior high schools.   Abstrak: Pemahaman dan Keterampilan Siswa dalam Pengelolaan Sampah Rumah Tangga dan Penerapan E-Media. Penelitian ini telah dilakukan pada tahun 2010 di kota Malang. Tujuan penelitian tindakan ini adalah untuk mengetahui meningkatkan pemahaman dan keterampilan siswa dalam pengelo­laan sampah rumah tangga. Tahap-tahap penelitian meliputi perencanaan, pelaksanaan tindakan, observasi, dan refleksi. Hasil penelitian menunjukkan bahwa penerapan E-Media VCD 6M telah meningkatkan pemahaman dan keterampilan dalam pengelolaan sampah rumah tangga oleh siswa SD/MI, SMP/MTs, dan SMA/MA di kota Malang.

  19. Peranan Departemen Sumber Daya Manusia Dalam Meningkatkan Efesiensi Dan Kinerja Karyawan Di Hotel JW Marriott Medan

    OpenAIRE

    Kemal, M. Arya

    2013-01-01

    Kemajuan ilmu pengetahuan dan tekhnologi di negara maju maupun negara berkembang sangat ditentukan oleh peranan dan perkembangan Departemen Sumberdaya Manusia. Fungsi utama Departemen Sumberdaya Manusia adalah melatih dan menyediakan karyawan yang kompeten dan professional yang berorientasi kepada kepuasan pelanggan atau tamu. Kompetensi adalah sebuah persaingan terhadap apa yang seseorang harus lakukan ditempat dimana ia bekerja untuk menunjukkan pengetahuan, kualitas, dan keterampilan yang ...

  20. KEEFEKTIFAN TEAM TEACHING PENDIDIK PROGRAM PENDIDIKAN DAN PENGEMBANGAN ANAK USIA DINI (PPAUD) DI KABUPATEN KULON PROGO

    OpenAIRE

    Benny Erifiani; Puji Yanti Fauziah

    2014-01-01

    Penelitian ini bertujuan untuk mengetahui keefektifan: (1) Pemahaman, perencanaan, pelaksanaan, dan evaluasi pendidik program PPAUD tentang team teaching (2) hasil team teaching, dan (3) faktor pendukung dan penghambat keefektifan team teaching. Penelitian ini merupakan penelitian evaluasi dengan logic models menggunakan pendekatan kualitatif dan kuantitatif. Subjek penelitian 65 orang pendidik. Instrumen pengumpulan data yang digunakan adalah kuesioner, lembar observasi, dan pedoman wawancar...

  1. Karakterisasi Simplisia Daun Dan Biji Kelor (Moringa Oleifera Lam.) Serta Analisis Magnesium Dan Besi Secara Spektrofotometri Serapan Atom

    OpenAIRE

    Ramahdani

    2016-01-01

    Moringa leaves was used as vegetable by most of the villagers and also used as a medicinal plant efficacious. Nowaday people are starting to utilize parts of the moringa plant in the form of fresh are then processed into simplicia of moringa leaves, tea of moringa and simplicia of moringa seeds. Monograph of characterization simplicia of moringa leaves and seeds have not been listed in the Indonesian Herbal Pharmacapoeia. Minerals are nutrients needed to maintain health. This study aims to in...

  2. Karakterisasi Simplisia dan Analisis Kalium, Kalsium, Natrium dan Magnesium pada Serbuk Daun Kelor (Moringa oleifera Lam.) secara Spektrofotometri Serapan Atom

    OpenAIRE

    Pratiwi, Eka Yulia

    2016-01-01

    Moringa (Moringa oleifera Lam.) is a plant which is classified to the family of Moringaceae and it can grow quickly. Moringa leave is useful. It has very good nutrients contents, and it also has a sufficient amount of minerals and vitamins. Moringa leaves can be consumed by being cooked, eaten raw, or dried up into moringa leaves powder. Moringa leaves powder has higher amount of nutrients content than fresh moringa leaves. Characterization of the Moringa leaves is not liste...

  3. Analisis Kandungan Kalsium, Kalium, dan Magnesium pada Daun Kelor (Moringa oleifera Lam.) Segar dan Direbus Secara Spektrofotometri Serapan Atom

    OpenAIRE

    Wahyuni, Sri

    2015-01-01

    Moringa oleifera Lam that we know as Moringa is the best-known species of the thirteen species of the genus Moringacae. Minerals contained in Moringa are calcium, copper, iron, manganese, magnesium, phosphorus, potassium, sodium, sulphur, and zinc. Moringa leaves as a source of vitamins and minerals can be consumed in a way cooked, or eaten raw or dried into powder. One of the cooking method is boiling in the water. Vitamins and minerals are easily soluble in water is a nutrient that is quick...

  4. Pengaruh Penambahan Ni, Cu, dan Al dan Waktu Milling pada Mechanical Alloying Terhadap Sifat Absorpsi dan Desorpsi Mg sebagai Material Penyimpan Hidrogen

    Directory of Open Access Journals (Sweden)

    Febrian Budi Pratama

    2012-09-01

    Full Text Available Mg merupakan salah satu material yang digunakan sebagai material penyimpan hidrogen dengan membentuk MgH2. Sifat absorpsi dan desorpsi hidrogen dari suatu metal hidrida salah satunya tergantung  pada bahan, unsur penambah, dan metode pembuatannya. Pada penelitian kali ini Mg sebagai material penyimpan hidrogen dihasilkan melalui metode mechanical alloying dengan unsur penambah Ni, Cu, dan Al dan variasi waktu milling 10, 20, 30 jam. Selanjutnya sampel dilakukan pengujian SEM, XRD, DSC, dan Uji hidrogenisasi. Dari data uji diperoleh bahwa meningkatnya waktu milling menurunkan ukuran partikel sehingga meningkatkan wt% hidrogen terabsorb dan menurunkan temperatur onset desorpsi. Namun efek aglomerasi dan coldwelding yang berlebih pada proses mechanical alloying mengakibatkan ukuran partikel menjadi lebih besar. Unsur pemadu Al dan Cu berfungsi sebagai katalis, sedangkan Ni berfungsi sebagai pemadu yang ikut bereaksi dengan hidrogen. Mg10wt%Al dengan waktu milling 20 jam mempunyai nilai weight percent terbaik H2 yaitu 0.38% dalam temperatur hidrogenisasi 2500C, tekanan 3 atm, dan waktu tahan 1 jam. Sedangkan Mg10wt%Al dengan waktu milling 30 jam memiliki temperatur onset paling rendah yaitu 341.490C Kata Kunci— Absorpsi, Desorpsi, Material Penyimpan Hidrogen, Mechanical Alloying, Mg

  5. Sosiologi Desa: Revolusi Senyap dan Tarian Kompleksitas

    OpenAIRE

    Salman, Darmawan

    2012-01-01

    Revolusi sebagai perubahan sosial tidaklah selalu melibatkan konflik kelas, apalagi yang berdarah-darah, seperti ketika perubahan itu meniscayakan sebuah rezim ditumbangkan, ataupun ketika pemodal borjuis disingkirkan. Revolusi sebagai perubahan sosial dapat berlangsung senyap dan bukan selalu karena konflik kelas ataupun gerakan sosial Buku ini membahas jagad desa Indonesia berikut dinamikanya. Desa menjadi entitas yang eksis dalam paradoks independensi. Karena terkait kenyataan akademik ...

  6. Fungsi Metabolisme Dan Sintesis Pada Jaringan Kambium

    OpenAIRE

    Utomo, Budi

    2008-01-01

    Hutan merupakan areal penghasil energi yang paling produktif di dunia. Hutan mampu menghasilkan dan mengumpulkan energi setiap tahunnya (Lehninger, 1965; Whittaker, 1975). Proses pembentukan energi diawali dengan pengubahan energi dari cahaya matahari menjadi energi kimia dalam bentuk ikatan kimia yang stabil melalui proses fotosintesis. Banyak orang menganggap agregat berguna tersebut sebagai ikatan kimia kayu yang stabil.

  7. TRADISIONALITAS DAN MODERNITAS TIPOLOGI ARSITEKTUR MASJID

    Directory of Open Access Journals (Sweden)

    M. Syaom Barliana Iskandar

    2004-01-01

    Full Text Available This research want to present what the religious doctrine of the mosque community included the way and mind orientation could be supposed influence in the architecture typhology of mosque. Qualitative descriptive research method is used based on syncronic and diacronic approach with three steps: generic typhology, genetic morphology, and holistic comparison. The result of research shown that Nahdlatul Ulama mosques typhology is reflecting the traditionality of architecture, and vise verse Muhammadiyah mosques typhology is reflecting the modernity of architecture. Finally the study concludes that the specific differences of the mosque architecture typhology due to the religious doctrine differences. Abstract in Bahasa Indonesia : Penelitian ini bermaksud mendeskripsikan apakah faham keagamaan masyarakat pendukung masjid yang didalamnya menyangkut pula cara dan orientasi berfikir, turut mempengaruhi bentukan tipologi arsitektur masjid. Metode penelitian deskriptif kualitatif digunakan dengan pendekatan penelitian sinkronik-diakronik; dalam tiga langkah generik tipologi, generik morfologi, dan holistik komparasi. Hasil penelitian pada kasus masjid yang diteliti dan tidak dapat digeneralisasi pada kasus lain, menunjukkan bahwa tipologi masjid Nahdlatul Ulama mencerminkan tradisionalitas arsitektur masjid, dan sebaliknya tipologi masjid Muhammadiyah menampilkan modernitas arsitektur masjid. Artinya terdapat perbedaan yang khas dari tipologi arsitektur masjid, yang disebabkan oleh perbedaan dalam doktrin keagamaan. Kata kunci: faham/doktrin keagamaan, tradisionalitas, modernitas tipologi arsitektur masjid.

  8. Des Taiwanais dans Ie sud du Fujian

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Se trouvant dans le sud-est de la Chine au bord dela mer, la province du Fujian s’appelle aussi toutsimplement "Min". Les anc(?)tres d’une grande partie de lapopulation de Taiwan sont venus du Fujian (Min). Les deux

  9. Interaction de l'atome d'hydrogene avec un champ laser intense et bref a derive de frequence

    Science.gov (United States)

    Ba, Harouna Sileye

    Nous presentons dans ce document une etude theorique de l'interaction entre l'atome d'hydrogene et un champ laser intense et bref a derive de frequence. Dans un premier temps, nous etablissons une methode basee sur les fonctions B-splines qui permet de decrire avec precision l'ensemble de la structure energetique du systeme atomique. Dans le second temps, nous developpons une approche non perturbative de type spectrale, basee sur la resolution exacte de l'equation de Schrodinger dependante du temps, pour decrire l'atome d'hydrogene en interaction avec un champ laser. Nous proposons particulierement une representation realiste d'une impulsion laser a derive de frequence. Finalement, nous etudions le processus d'ionisation au dessus du seuil de l'atome d'hydrogene soumis a une impulsion a derive de frequence. Nos resultats montrent que la derive de frequence laser permet de controler et d'optimiser le transfert de population de l'etat fondamental vers les etats electroniques intermediaires impliques dans le processus d'ionisation. Mots-cles : Atome d'hydrogene Fonctions B-splines Methode non perturbative spectrale Impulsion laser intense et breve Parametre de derive de frequence laser lonisation multiphotonique

  10. Atomic and molecular structure

    International Nuclear Information System (INIS)

    This book is a textbook for an introductory course of atomic physics for students of chemistry. After an introduction to the mathematical and physical foundations the quantum mechanical theory of atoms is described starting from simple examples of quantum mechanics. Then the atomic structure and the chemical bending are extensively discussed. This book is also suited for physicists who are especially interested in the atomic structure and the theory of chemical reactions. (HSI)

  11. Atomic Scale Plasmonic Switch

    OpenAIRE

    Emboras, A.; Niegemann, J.; Ma, P; Haffner, C; Pedersen, A.; Luisier, M.; Hafner, C; Schimmel, T.; Leuthold, J.

    2016-01-01

    The atom sets an ultimate scaling limit to Moore’s law in the electronics industry. While electronics research already explores atomic scales devices, photonics research still deals with devices at the micrometer scale. Here we demonstrate that photonic scaling, similar to electronics, is only limited by the atom. More precisely, we introduce an electrically controlled plasmonic switch operating at the atomic scale. The switch allows for fast and reproducible switching by means of the relocat...

  12. Atomizing nozzle and process

    Science.gov (United States)

    Anderson, Iver E.; Figliola, Richard S.; Molnar, Holly M.

    1992-06-30

    High pressure atomizing nozzle includes a high pressure gas manifold having a divergent expansion chamber between a gas inlet and arcuate manifold segment to minimize standing shock wave patterns in the manifold and thereby improve filling of the manifold with high pressure gas for improved melt atomization. The atomizing nozzle is especially useful in atomizing rare earth-transition metal alloys to form fine powder particles wherein a majority of the powder particles exhibit particle sizes having near-optimum magnetic properties.

  13. Antiprotonic Helium Atoms

    OpenAIRE

    Kartavtsev, O. I.

    1995-01-01

    Metastable antiprotonic helium atoms $^{3,4}\\! H\\! e\\bar pe$ have been discovered recently in experiments of the delayed annihilation of antiprotons in helium media. These exotic atoms survive for an enormous time (about tens of microseconds) and carry the extremely large total angular momentum $L\\sim 30-40$. The theoretical treatment of the intrinsic properties of antiprotonic helium atoms, their formation and collisions with atoms and molecules is discussed.

  14. Atoms Talking to SQUIDs

    OpenAIRE

    2011-01-01

    We present a scheme to couple trapped $^{87}$Rb atoms to a superconducting flux qubit through a magnetic dipole transition. We plan to trap atoms on the evanescent wave outside an ultrathin fiber to bring the atoms to less than 10 $\\mu$m above the surface of the superconductor. This hybrid setup lends itself to probing sources of decoherence in superconducting qubits. Our current plan has the intermediate goal of coupling the atoms to a superconducting LC resonator.

  15. PENGARUH KETEBALAN IRISAN DAN LAMA PEREBUSAN (BLANCHING TERHADAP GAMBARAN MAKROSKOPIS DAN KADAR MINYAK ATSIRI SIMPLISIA DRINGO (Acorus calamus L.

    Directory of Open Access Journals (Sweden)

    Heru Sudrajad

    2012-10-01

    Full Text Available Beberapa simplisia perlu mengalami proses seperti perajangan dan blanching. Perajangan dilakukan untuk mempermudah proses pengeringan, pengepakan dan penggilingan. Semakin tipis bahan yang dikeringkan, semakin cepat penguapan air yang dikandung, sehingga mempercepat waktu pengeringan. Namun irisan yang terlalu tipis menyebabkan zat yang mudah menguap seperti minyak atsiri akan berkurang kadarnya, sehingga mempengaruhi komposisi, bau dan rasa terutama pada simplisia seperti temu lawak, temu giring, jahe, kencur dan bahan sejenis lainnya. Perebusan (blanching adalah suatu proses pemanasan yang diberikan kepada bahan mentah selama beberapa menit  pada  suhu  air  mendidih yang bertujuan untuk memperbaiki kualitas produk yang diolah. Rimpang tanaman ini secara empiris digunakan sebagai insektisida, demam nifas, karminatif. disentri dan limpa bengkak. Penelitian ini bertujuan untuk melihat pengaruh ketebalan irisan dan lama perebusan (blanching terhadap gambaran makroskopis dan kadar minyak atsiri simplisia dringo (Acorus calamus L. Sebagai model digunakan Acorus calamus L. Penelitian disusun dalam rancangan acak lengkap menggunakan 2 faktor perlakuan, yaitu faktor pertama ketebalan irisan (K. yaitu K1 =2 mm, K2 =4 mm. K3 = 6 mm dan lama blanching (B yaitu BO = tanpa blanching, B 1 = 5 menit dan B2 = 10 menit. Pengamatan dilakukan terhadap kualitas (warna, bentuk permukaan dan tekstur simplisia dan kadar minyak atsiri rimpang dringo. Simplisia dengan ketebalan irisan 2 mm tanpa perlakuan blanching menghasilkan minyak atsiri lebih tinggi (4,5% dengan kualitas simplisia yang lebih baik (warna putih kekuningan, permukaan rata dan tekstur liat, mudah dipatahkan sedangkan yang hasil terendah diperoleh pada perlakuan ketebalan irisan 2 mm dengan perlakuan lama blanching 10 menit yaitu  warna simplisia coklat, keadaan fisik irisan bergelombang, permukaan keras, sukar dipatahkan dengan kadar minyak atsiri (2%. Hasil percobaan menunjukkan bahwa tebal

  16. Atomic Spectra Database (ASD)

    Science.gov (United States)

    SRD 78 NIST Atomic Spectra Database (ASD) (Web, free access)   This database provides access and search capability for NIST critically evaluated data on atomic energy levels, wavelengths, and transition probabilities that are reasonably up-to-date. The NIST Atomic Spectroscopy Data Center has carried out these critical compilations.

  17. Atomic Energy Control Act

    International Nuclear Information System (INIS)

    This act provides for the establishment of the Atomic Energy Control Board. The board is responsible for the control and supervision of the development, application and use of atomic energy. The board is also considered necessary to enable Canada to participate effectively in measures of international control of atomic energy

  18. Cooperation between the international atomic energy agency and the european union in the field of nuclear safety; La cooperation entre l'Agence internationale pour l'energie atomique et l'Union europeenne dans le domaine de la surete nucleaire

    Energy Technology Data Exchange (ETDEWEB)

    Jamet, Ph. [surete des installations nucleaires - Agence internationale pour l' energie atomique (AIEA), 75 - Paris (France)

    2010-11-15

    The establishment of safety standards is one of the tasks conferred upon the International Atomic Energy Agency (IAEA) by its statute. These standards are intended to protect the health of persons and reduce as far as possible the hazards related to the harmful effects of ionising radiation on persons and property. The IAEA must apply these standards to its own activities. States must apply them to the operations that they carry out with IAEA assistance. The IAEA provides support for the use or application of its standards to states that request it. This support may take the form of training programmes or expert task forces. The nuclear safety activities of the IAEA, based essentially on its safety standards and on the support provided to its member states, give rise to very substantial cooperation programmes with the European Union. (author)

  19. Diagnosis dan Penatalaksanaan Tumor Ganas Laring

    Directory of Open Access Journals (Sweden)

    Dolly Irfandy

    2015-05-01

    Full Text Available Abstrak Laring berperan dalam koordinasi fungsi saluran aerodigestif atas seperti bernafas, berbicara dan menelan.Laring terbagi tiga yaitu supraglotis, glotis dan subglotis. Laring merupakan daerah tersering kedua untuk kasuskarsinoma sel skuamosa kepala-leher, biasanya berhubungan dengan tembakau dan alkohol. Lebih dari 95% kasustumor ganas laring adalah karsinoma sel skuamosa. Pasien tumor ganas laring datang dengan berbagai keluhanseperti disfonia, obstruksi jalan napas, disfagia, odinofagi dan hemoptisis. Diagnosis tumor ganas laring ditegakkanberdasarkan anamnesis, pemeriksaan klinis menggunakan endoskopi kaku, serat optik dan biopsi. Penatalaksanaantumor ganas laring tergantung stadium dengan modalitas berupa operasi, kemoterapi, radiasi atau terapi kombinasi.Dilaporkan kasus laki-laki 53 tahun dengan karsinoma glotis stadium III (T3N0M0 squamous cell ca keratinized welldifferentiated. Penatalaksanaan pada pasien ini dengan melakukan laringektomi total.Kata kunci: Tumor ganas laring, karsinoma, laringektomi, tembakau Abstract Larynx plays a certain role in coordinating functions of the upper aerodigestive tract, such as respiration,speech, and swallowing. The larynx is divided into three region; supraglottic, glottic, and subglottic. Larynx is thesecond most common site for squamous cell carcinoma in the head and neck and usually related to tobacco andalcohol exposure. Primary malignant tumors of the larynx are squamous cell carcinomas can found more than 95% ofcases. Patients with laryngeal tumors usually present with complaints of hoarseness, respiratory obstruction,dysphagia, odynophagia and hemoptysis. Diagnosis of laryngeal cancer is made by medical history, clinicalexamination using a rigid or fiberoptic endoscope and biopsy. Management of laryngeal tumour depends on stadiumwith various modality included surgery, chemotheraphy, radiotheraphy or combined therapy. Reported case of 53years old male with Glottic carcinoma of the larynx

  20. Musik Internal dan Eksternal dalam Kesenian Randai

    Directory of Open Access Journals (Sweden)

    Sri Rustiyanti

    2015-03-01

    Full Text Available Kehidupan musik pada masyarakat Minangkabau tidak terlepas adanya peranan serta fungsi yang melekat pada kesenian Randai. Melalui pendekatan etnomusikologi, tulisan ini menelaah peranan musik internal dan eksternal dalam kesenian Randai. Kesenian ini menggunakan medium seni ganda atau kolektif karena didukung oleh beberapa cabang seni antara lain tari, musik, teater, sastra, dan rupa. Hasil penelitian menunjukkan bahwa musik iringan dalam Randai terbagi menjadi dua, yaitu musik internal dan musik eksternal. Musik internal adalah musik atau bunyi-bunyian yang berasal dari anggota tubuh manusia (penari, misalnya tepukan tangan, petik jari, tepuk dada, siulan, hentakan kaki ke tanah dan sebagainya, sedangkan musik eksternal adalah bunyi-bunyian atau suara yang berasal dari alat musik atau instrumen seperti talempong, gandang, saluang, dan rabab. The Role of Internal and External Music in the Arts of Randai. The musical life in Minangkabau society is inseparable from its roles and functions which attach to the arts of Randai. Through the ethnomusicology approach, this paper examines the role of internal and external music in the art of Randai. Considering its sustainability and amendment, the musicality is the identity of Minangkabau society so that the sustainability of the music can be run in accordance with the dynamics of society today. Among the types of arts in Minangkabau, Randai is an art form that uses multiple or collective art medium for it is supported by several branches of the arts, including dance, music, theater arts, literary arts, and fine arts. The results of this study is more focused on the art of music. Musical accompaniment in Randai is divided into two, namely internal and external music. The internal music is the music or the sounds that come from the human body (a dancer, for example, clapping, finger picking, patting the chest, whistling, stomping on the ground, and so on, while the external music is the sounds emanating