WorldWideScience

Sample records for astatine 220

  1. Radiochemistry of astatine

    Energy Technology Data Exchange (ETDEWEB)

    Ruth, T J; Dombsky, M; D' Auria, J M; Ward, T E

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs. (DLC)

  2. Discovery of the astatine, radon, francium, and radium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-09-15

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  3. Discovery of the astatine, radon, francium, and radium isotopes

    CERN Document Server

    Fry, C

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Discovery of the astatine, radon, francium, and radium isotopes

    Science.gov (United States)

    Fry, C.; Thoennessen, M.

    2013-09-01

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  5. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Energy Technology Data Exchange (ETDEWEB)

    Uusitalo, J.; Jakobsson, U. [Department of Physics, University of Jyvaeskylae (Finland); Collaboration: RITU-Gamma Gollaboration

    2011-11-30

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  6. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Science.gov (United States)

    Uusitalo, J.; Jakobsson, U.

    2011-11-01

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  7. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  8. Measurement of the first ionization potential of astatine by laser ionization spectroscopy.

    Science.gov (United States)

    Rothe, S; Andreyev, A N; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yuri; Köster, U; Lane, J F W; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt, K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine.

  9. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Jakobsson, U., E-mail: ulrjak@kth.se; Cederwall, B. [KTH, The Division of Nuclear Physics, AlbaNova University Center, SE-10691 Stockholm (Sweden); Uusitalo, J.; Auranen, K.; Badran, H.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; Herzáň, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J. [University of Jyvaskyla, Department of Physics, P.O. Box 35, FI-40014 University of Jyvaskyla (Finland); and others

    2015-10-15

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2{sup +} state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2{sup +} state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2{sup +} state and the spherical 9/2{sup −} ground state in {sup 203}Fr and {sup 205}Fr.

  10. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Science.gov (United States)

    Jakobsson, U.; Uusitalo, J.; Auranen, K.; Badran, H.; Cederwall, B.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; HerzáÅ, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J.; Scholey, C.; Sorri, J.; Stolze, S.

    2015-10-01

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2+ state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2+ state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2+ state and the spherical 9/2- ground state in 203Fr and 205Fr.

  11. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...

  12. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    NARCIS (Netherlands)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Koester, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjoedin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical

  13. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  14. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even sing...... of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies....

  15. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  16. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  17. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  18. Adsorption of the astatine species on a gold surface: A relativistic density functional theory study

    Science.gov (United States)

    Demidov, Yuriy; Zaitsevskii, Andréi

    2018-01-01

    We report first-principle based studies of the adsorption interaction of astatine species on a gold surface. These studies are aimed primarily at the support and interpretation of gas chromatographic experiments with superheavy elements, tennessine (Ts, Z = 117), a heavier homologue of At, and possibly its pseudo-homologue nihonium (Nh, Z = 113). We use gold clusters with up to 69 atoms to simulate the adsorption sites and estimate the desorption energies of At & AtOH from a stable gold (1 1 1) surface. To describe the electronic structure of At -Aun and AtOH -Aun complexes, we combine accurate shape-consistent relativistic pseudopotentials and non-collinear two-component relativistic density functional theory. The predicted desorption energies of At and AtOH on gold are 130 ± 10 kJ/mol and 90 ± 10 kJ/mol, respectively. These results confirm the validity of the estimates derived from chromatographic data (147 ± 15 kJ/mol for At, and 100-10+20 kJ/mol for AtOH).

  19. DEC VT220

    CERN Multimedia

    1983-01-01

    The DEC (Digital Equipment Corporation) VT220 is a text terminal which uses an redesigned keyboard(LK201). The VT220 improved on the earlier VT100 series of terminals with much smaller physical packaging and and a much faster microprocessor.

  20. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  1. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  2. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  3. 30 CFR 220.012 - Overhead allowance.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Overhead allowance. 220.012 Section 220.012... § 220.012 Overhead allowance. (a) During the capital recovery period the overhead allowance shall be... overhead allowance shall be debited to the NPSL capital account in accordance with § 220.021(b)(2). (b) For...

  4. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  5. 49 CFR 179.220-10 - Welding.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Welding. 179.220-10 Section 179.220-10... Specifications for Non-Pressure Tank Car Tanks (Classes DOT-111AW and 115AW) § 179.220-10 Welding. (a) All joints... of this subchapter). Welding procedures, welders, and fabricators shall be approved. (b) Radioscopy...

  6. 10 CFR 603.220 - Government participation.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Government participation. 603.220 Section 603.220 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS TECHNOLOGY INVESTMENT AGREEMENTS Appropriate Use of Technology Investment Agreements § 603.220 Government participation. A TIA is used to carry out cooperative...

  7. 21 CFR 189.220 - Flectol H.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Flectol H. 189.220 Section 189.220 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Addition to Human Food Through Food-Contact Surfaces § 189.220 Flectol H. (a) Flectol H is the chemical 1,2...

  8. 20 CFR 220.133 - Skill requirements.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Skill requirements. 220.133 Section 220.133... DISABILITY Vocational Considerations § 220.133 Skill requirements. (a) General. To evaluate skills and to... claimant does not gain work skills by doing unskilled jobs. For example, jobs are considered unskilled if...

  9. 20 CFR 220.12 - Evidence considered.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence considered. 220.12 Section 220.12... § 220.12 Evidence considered. The regulations explaining the employee's responsibility to provide evidence of disability, the kind of evidence, what medical evidence consists of, and the consequences of...

  10. 20 CFR 220.104 - Multiple impairments.

    Science.gov (United States)

    2010-04-01

    ... DISABILITY Evaluation of Disability § 220.104 Multiple impairments. To determine whether the claimant's physical or mental impairment or impairments are of a sufficient medical severity that such impairment or... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Multiple impairments. 220.104 Section 220.104...

  11. 46 CFR 184.220 - Cooking equipment.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Cooking equipment. 184.220 Section 184.220 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS (UNDER 100 GROSS TONS) VESSEL CONTROL AND MISCELLANEOUS SYSTEMS AND EQUIPMENT Cooking and Heating § 184.220 Cooking equipment...

  12. 12 CFR 220.4 - Margin account.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Margin account. 220.4 Section 220.4 Banks and... BROKERS AND DEALERS (REGULATION T) § 220.4 Margin account. (a) Margin transactions. (1) All transactions not specifically authorized for inclusion in another account shall be recorded in the margin account...

  13. 7 CFR 58.220 - Drying systems.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Drying systems. 58.220 Section 58.220 Agriculture....220 Drying systems. (a) Spray dryers. Spray dryers shall be of a continuous discharge type and all... filter system shall comply with the applicable requirements of the 3-A Accepted Practices for Milk and...

  14. 49 CFR 220.7 - Penalty.

    Science.gov (United States)

    2010-10-01

    ..., or has caused death or injury, a penalty not to exceed $100,000 per violation may be assessed; and... 49 Transportation 4 2010-10-01 2010-10-01 false Penalty. 220.7 Section 220.7 Transportation Other... TRANSPORTATION RAILROAD COMMUNICATIONS General § 220.7 Penalty. Any person (including but not limited to a...

  15. 46 CFR 129.220 - Basic safety.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Basic safety. 129.220 Section 129.220 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OFFSHORE SUPPLY VESSELS ELECTRICAL INSTALLATIONS General Requirements § 129.220 Basic safety. (a) Electrical equipment and installations must be suitable...

  16. 7 CFR 220.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 220.3 Section 220.3 Agriculture... CHILD NUTRITION PROGRAMS SCHOOL BREAKFAST PROGRAM § 220.3 Administration. (a) Within the Department, FNS shall act on behalf of the Department in the administration of the Program covered by this part. Within...

  17. 12 CFR 220.8 - Cash account.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Cash account. 220.8 Section 220.8 Banks and... BROKERS AND DEALERS (REGULATION T) § 220.8 Cash account. (a) Permissible transactions. In a cash account... sufficient funds in the account; or (ii) The creditor accepts in good faith the customer's agreement that the...

  18. 49 CFR 571.220 - Standard No. 220; School bus rollover protection.

    Science.gov (United States)

    2010-10-01

    ... result from failure of the school bus body structure to withstand forces encountered in rollover crashes... 49 Transportation 6 2010-10-01 2010-10-01 false Standard No. 220; School bus rollover protection... STANDARDS Federal Motor Vehicle Safety Standards § 571.220 Standard No. 220; School bus rollover protection...

  19. 49 CFR 179.220-7 - Materials.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Materials. 179.220-7 Section 179.220-7 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION HAZARDOUS MATERIALS REGULATIONS SPECIFICATIONS FOR TANK CARS...

  20. 24 CFR 220.253 - Substitute mortgagors.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Substitute mortgagors. 220.253... Contract Rights and Obligations-Homes § 220.253 Substitute mortgagors. (a) Selling mortgagor. The mortgagee... the Commissioner's approval of a substitute mortgagor, as provided by this section. (b) Purchasing...

  1. 24 CFR 3.220 - Admissions.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Admissions. 3.220 Section 3.220 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE...

  2. 40 CFR 86.220-94 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false 86.220-94 Section 86.220-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty Passenger...

  3. 36 CFR 220.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Definitions. 220.3 Section... ENVIRONMENTAL POLICY ACT (NEPA) COMPLIANCE § 220.3 Definitions. The following definitions supplement, by adding... the least harm to the biological and physical environment; it also is the alternative which best...

  4. 36 CFR 220.6 - Categorical exclusions.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Categorical exclusions. 220.6 Section 220.6 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE NATIONAL... portion of a stand damaged by a wind or ice event and construction of a short temporary road to access the...

  5. 49 CFR 220.27 - Identification.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Identification. 220.27 Section 220.27... Identification. (a) Except as provided in paragraph (c) of this section, the identification of each wayside, base... identification of each mobile station shall consist of the following elements, stated in the order listed: (1...

  6. An automated flow system incorporating in-line acid dissolution of bismuth metal from a cyclotron irradiated target assembly for use in the isolation of astatine-211

    Energy Technology Data Exchange (ETDEWEB)

    O’Hara, Matthew J.; Krzysko, Anthony J.; Niver, Cynthia M.; Morrison, Samuel S.; Owsley, Stanley L.; Hamlin, Donald K.; Dorman, Eric F.; Scott Wilbur, D.

    2017-04-01

    Astatine-211 (211At) is a promising cyclotron-produced radionuclide being investigated for use in targeted alpha therapy of blood borne and metastatic cancers, as well as treatment of tumor remnants after surgical resections. The isolation of trace quantities of 211At, produced within several grams of a Bi metal cyclotron target, involves a complex, multi-step procedure: (1) Bi metal dissolution in strong HNO3, (2) distillation of the HNO3 to yield Bi salts containing 211At, (3) dissolution of the salts in strong HCl, (4) solvent extraction of 211At from bismuth salts with diisopropyl ether (DIPE), and (5) back-extraction of 211At from DIPE into NaOH, leading to a purified 211At product. Step (1) has been addressed first to begin the process of automating the onerous 211At isolation process. A computer-controlled Bi target dissolution system has been designed. The system performs in-line dissolution of Bi metal from the target assembly using an enclosed target dissolution block, routing the resulting solubilized 211At/Bi mixture to the subsequent process step. The primary parameters involved in Bi metal solubilization (HNO3 concentration and influent flow rate) were optimized prior to evaluation of the system performance on replicate cyclotron irradiated targets. The results indicate that the system performs reproducibly, having nearly quantitative release of 211At from irradiated targets, with cumulative 211At recoveries that follow a sigmoidal function. The predictable nature of the 211At release profile allows the user to tune the system to meet target processing requirements.

  7. Reagents for astatination of biomolecules. 2. Conjugation of anionic boron cage pendant groups to a protein provides a method for direct labeling that is stable to in vivo deastatination.

    Science.gov (United States)

    Wilbur, D Scott; Chyan, Ming-Kuan; Hamlin, Donald K; Vessella, Robert L; Wedge, Timothy J; Hawthorne, M Frederick

    2007-01-01

    Cancer-targeting biomolecules labeled with 211At must be stable to in vivo deastatination, as control of the 211At distribution is critical due to the highly toxic nature of alpha-particle emission. Unfortunately, no astatinated aryl conjugates have shown in vivo stability toward deastatination when (relatively) rapidly metabolized proteins, such as monoclonal antibody Fab' fragments, are labeled. As a means of increasing the in vivo stability of 211At-labeled proteins, we have been investigating antibody conjugates of boron cage moieties. In this investigation, protein-reactive derivatives containing a nido-carborane (2), a bis-nido-carborane derivative (Venus Flytrap Complex, 3), and four 2-nonahydro-closo-decaborate(2-) derivatives (4-7) were prepared and conjugated with an antibody Fab' fragment such that subsequent astatination and in vivo tissue distributions could be obtained. To aid in determination of stability toward in vivo deastatination, the Fab'-borane conjugates were also labeled with 125I, and that material was coinjected with the 211At-labeled Fab'. For comparison, direct labeling of the Fab' with 125I and 211At was conducted. Direct labeling with Na[125I]I and Chloramine-T gave an 89% radiochemical yield. However, direct labeling of the Fab' with Na[211At]At and Chloramine-T resulted in a yield of Studies to optimize the closo-decaborate(2-) conjugates for protein labeling are underway.

  8. 32 CFR 220.3 - Exclusions impermissible.

    Science.gov (United States)

    2010-07-01

    ... United States. (b) General rules. Based on the statutory requirement, the following are general rules for...) MISCELLANEOUS COLLECTION FROM THIRD PARTY PAYERS OF REASONABLE CHARGES FOR HEALTHCARE SERVICES § 220.3...

  9. 32 CFR 220.5 - Records available.

    Science.gov (United States)

    2010-07-01

    ... to representatives of any third party payer from which the United States seeks payment under 10 U.S.C... COLLECTION FROM THIRD PARTY PAYERS OF REASONABLE CHARGES FOR HEALTHCARE SERVICES § 220.5 Records available...

  10. 12 CFR 303.220 - Scope.

    Science.gov (United States)

    2010-01-01

    ... of the FDI Act (Consent to Service of Persons Convicted of Certain Criminal Offenses) § 303.220 Scope. This subpart covers applications under section 19 of the FDI Act (12 U.S.C. 1829). Pursuant to section...

  11. 7 CFR 220.17 - Prohibitions.

    Science.gov (United States)

    2010-01-01

    ... for participation in the Program. (b) The value of assistance to children under the Act shall not be... CHILD NUTRITION PROGRAMS SCHOOL BREAKFAST PROGRAM § 220.17 Prohibitions. (a) In carrying out the... State and local sources for the maintenance of food programs for children shall not be diminished as a...

  12. 20 CFR 220.46 - Medical evidence.

    Science.gov (United States)

    2010-04-01

    ... DISABILITY Evidence of Disability § 220.46 Medical evidence. (a) Acceptable sources. The Board needs reports... optometrists for the measurement of visual acuity and visual fields (a report from a physician may be needed to...'s findings on the factors under paragraph (b)(1) through (5) of this section (except in disability...

  13. 6 CFR 27.220 - Tiering.

    Science.gov (United States)

    2010-01-01

    ... DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY CHEMICAL FACILITY ANTI-TERRORISM STANDARDS Chemical Facility Security Program § 27.220 Tiering. (a) Preliminary Determination of Risk-Based Tiering. Based on... Risk-Based Tiering. Following review of a covered facility's Security Vulnerability Assessment, the...

  14. 46 CFR 132.220 - Installation.

    Science.gov (United States)

    2010-10-01

    ... Portable and Semiportable Fire Extinguishers § 132.220 Installation. (a) Each portable fire extinguisher approved under subpart 162.028 of this chapter and each semiportable fire extinguisher approved under... placement of each extinguisher must satisfy the cognizant OCMI, who may also deem added extinguishers...

  15. 32 CFR 220.14 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... COLLECTION FROM THIRD PARTY PAYERS OF REASONABLE CHARGES FOR HEALTHCARE SERVICES § 220.14 Definitions....2). Covered beneficiaries. Covered beneficiaries are all healthcare beneficiaries under chapter 55... program. Facilities of the Uniformed Services also include several former Public Health Services...

  16. 7 CFR 220.13 - Special responsibilities of State agencies.

    Science.gov (United States)

    2010-01-01

    ... Agency's Letter of Credit. (e) State agencies shall provide School Food Authorities with monthly... the nutrient and calorie levels in § 220.8(b) or (c) or those developed under § 220.8(e)(1) or (h...

  17. 42 CFR 2.20 - Relationship to State laws.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Relationship to State laws. 2.20 Section 2.20 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL PROVISIONS CONFIDENTIALITY OF ALCOHOL AND DRUG ABUSE PATIENT RECORDS General Provisions § 2.20 Relationship to State laws...

  18. 2 CFR 220.40 - Relationship to previous issuance.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Relationship to previous issuance. 220.40 Section 220.40 Grants and Agreements OFFICE OF MANAGEMENT AND BUDGET CIRCULARS AND GUIDANCE Reserved COST PRINCIPLES FOR EDUCATIONAL INSTITUTIONS (OMB CIRCULAR A-21) § 220.40 Relationship to previous issuance. (a...

  19. 43 CFR 17.220 - Preschool, elementary, and secondary education.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Preschool, elementary, and secondary education. 17.220 Section 17.220 Public Lands: Interior Office of the Secretary of the Interior... Handicap § 17.220 Preschool, elementary, and secondary education. This section applies to preschool...

  20. 20 CFR 220.170 - The trial work period.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false The trial work period. 220.170 Section 220... DETERMINING DISABILITY Trial Work Period and Reentitlement Period for Annuitants Disabled for Any Regular Employment § 220.170 The trial work period. (a) Definition of the trial work period. The trial work period is...

  1. 21 CFR 573.220 - Feed-grade biuret.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Feed-grade biuret. 573.220 Section 573.220 Food... Additive Listing § 573.220 Feed-grade biuret. The food additive feed grade biuret may be safely used in... resulting from the controlled pyrolysis of urea conforming to the following specifications: Percent Biuret...

  2. 20 CFR 220.101 - Evaluation of mental impairments.

    Science.gov (United States)

    2010-04-01

    ... ACT DETERMINING DISABILITY Evaluation of Disability § 220.101 Evaluation of mental impairments. (a) General. The steps outlined in § 220.100 apply to the evaluation of physical and mental impairments. In... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evaluation of mental impairments. 220.101...

  3. 20 CFR 220.60 - Diagnostic surgical procedures.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Diagnostic surgical procedures. 220.60 Section 220.60 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT DETERMINING DISABILITY Consultative Examinations § 220.60 Diagnostic surgical procedures. The Board will not...

  4. 37 CFR 2.20 - Declarations in lieu of oaths.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Declarations in lieu of oaths. 2.20 Section 2.20 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES Declarations § 2.20 Declarations in lieu of oaths...

  5. 7 CFR 65.220 - Processed food item.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Processed food item. 65.220 Section 65.220 Agriculture..., PEANUTS, AND GINSENG General Provisions Definitions § 65.220 Processed food item. Processed food item... other covered commodity or other substantive food component (e.g., chocolate, breading, tomato sauce...

  6. 49 CFR 220.35 - Ending a radio transmission.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Ending a radio transmission. 220.35 Section 220.35..., DEPARTMENT OF TRANSPORTATION RAILROAD COMMUNICATIONS Radio and Wireless Communication Procedures § 220.35 Ending a radio transmission. (a) Except for transmissions relating to yard switching operations, at the...

  7. 49 CFR 220.33 - Receiving a radio transmission.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Receiving a radio transmission. 220.33 Section 220... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD COMMUNICATIONS Radio and Wireless Communication Procedures § 220.33 Receiving a radio transmission. (a) Upon receiving a radio call, an employee shall promptly...

  8. 49 CFR 220.47 - Emergency radio transmissions.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Emergency radio transmissions. 220.47 Section 220... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD COMMUNICATIONS Radio and Wireless Communication Procedures § 220.47 Emergency radio transmissions. An initial emergency radio transmission shall be preceded by the...

  9. 12 CFR 220.6 - Good faith account.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Good faith account. 220.6 Section 220.6 Banks... BY BROKERS AND DEALERS (REGULATION T) § 220.6 Good faith account. In a good faith account, a creditor...) Securities entitled to good faith margin—(1) Permissible transactions. A creditor may effect and finance...

  10. 12 CFR 220.7 - Broker-dealer credit account.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Broker-dealer credit account. 220.7 Section 220... SYSTEM CREDIT BY BROKERS AND DEALERS (REGULATION T) § 220.7 Broker-dealer credit account. (a) Requirements. In a broker-dealer credit account, a creditor may effect or finance transactions in accordance...

  11. 20 CFR 220.36 - Period of disability.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Period of disability. 220.36 Section 220.36... DISABILITY Disability Determinations Governed by the Regulations of the Social Security Administration § 220.36 Period of disability. (a) General. In order to receive an annuity based upon a disability, an...

  12. 30 CFR 220.010 - NPSL capital account.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false NPSL capital account. 220.010 Section 220.010... § 220.010 NPSL capital account. (a) For each NPSL tract, an NPSL capital account shall be established and maintained by the lessee for NPSL operations. The NPSL capital account shall include debit entries...

  13. CompTIA A+ complete study guide exams 220-801 and 220-802

    CERN Document Server

    Docter, Quentin; Skandier, Toby

    2012-01-01

    CompTIA Authorized, fully updated Study Guide for the leading IT certification: CompTIA A+ CompTIA A+ is the de facto certification for IT technicians. Some vendors even require employees to achieve certification as part of their job training. This book prepares you for both required exams: 220-801 and 220-802. Totally updated to cover the 2012 exams, this popular prep guide covers all the exam objectives. Readers will also have access to additional study tools, including the Sybex Test Engine with bonus practice exams, electronic flashcards, and a glossary of important terms in searchable PD

  14. 220-kV combined optical transformer

    Science.gov (United States)

    Cui, Ying; Ye, Miaoyuan; Zhu, Yong; Xu, Yan; Luo, Sunan

    2000-10-01

    The magneto-optic current and electro-optic voltage sensing technologies were combined into a single phase unit which provides a new solution for combined current and voltage sensing and relaying applications. It senses voltage and current by making utilities of Pockels electro-optic effect of a BGO(Bi4Ge3O12) crystal and Faraday magneto-optic effect of a close-loop flint. The 220 kV high voltage is directly applied on the BGO crystal without capacitive dividers. This design permits true optical voltage measurement to be performed for the highest possible accuracy and stability. In the current sensor, a light beam circles around the current carrying conductor. The effect of the location movement of the conductor and external magnetic field are reduced. It has superior advantages of compact size, light- weight and better performance compared with conventional current and voltage transformers. Composite bushing consisting of a fiberglass tube support and silicone rubber that is filled with SF6 gas is employed for HV insulation. Connections between the Combined Optical Transformers in the substation and the metering and protecting unit in the control house are via optical fiber cable. The fundamental principal, system design and test result of this new 220 kV Combined Optical Transformer will be introduced in this paper.

  15. 10 CFR 600.220 - Standards for financial management systems.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Standards for financial management systems. 600.220... Post-Award Requirements § 600.220 Standards for financial management systems. (a) A State must expend... prohibitions of applicable statutes. (b) The financial management systems of other grantees and subgrantees...

  16. 34 CFR 300.220 - Exception for prior local plans.

    Science.gov (United States)

    2010-07-01

    ... CHILDREN WITH DISABILITIES Local Educational Agency Eligibility § 300.220 Exception for prior local plans... 34 Education 2 2010-07-01 2010-07-01 false Exception for prior local plans. 300.220 Section 300... effective date of the Individuals with Disabilities Education Improvement Act of 2004, the applicable...

  17. 7 CFR 1430.220 - Misrepresentation and scheme or device.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Misrepresentation and scheme or device. 1430.220... Contract Program § 1430.220 Misrepresentation and scheme or device. (a) A dairy operation shall be ineligible for the MILC program if FSA determines that it knowingly: (1) Adopted a scheme or device that...

  18. 24 CFR 220.802 - Final insurance endorsement.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Final insurance endorsement. 220.802 Section 220.802 Housing and Urban Development Regulations Relating to Housing and Urban... insurance endorsement. When all advances of loan proceeds have been made, and all the terms and conditions...

  19. 24 CFR 220.803 - Effect of insurance endorsement.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Effect of insurance endorsement. 220.803 Section 220.803 Housing and Urban Development Regulations Relating to Housing and Urban... insurance endorsement. From the date of initial endorsement, the Commissioner and the lender shall be bound...

  20. 24 CFR 220.801 - Initial insurance endorsement.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Initial insurance endorsement. 220.801 Section 220.801 Housing and Urban Development Regulations Relating to Housing and Urban... insurance endorsement. The Commissioner shall indicate his insurance of the loan by endorsing the original...

  1. 20 CFR 220.179 - Exceptions to medical improvement.

    Science.gov (United States)

    2010-04-01

    ... disability decision was in error. The Board will apply the exception to medical improvement based on error if... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Exceptions to medical improvement. 220.179... Medical Improvement § 220.179 Exceptions to medical improvement. (a) First group of exceptions to medical...

  2. 20 CFR 220.129 - Education as a vocational factor.

    Science.gov (United States)

    2010-04-01

    ... English. Since the ability to speak, read, and understand English is generally learned or increased at... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Education as a vocational factor. 220.129... ACT DETERMINING DISABILITY Vocational Considerations § 220.129 Education as a vocational factor. (a...

  3. 32 CFR 220.9 - Rights and obligations of beneficiaries.

    Science.gov (United States)

    2010-07-01

    ... from facilities of the Uniformed Services. (d) Mandatory disclosure of Social Security account numbers... 32 National Defense 2 2010-07-01 2010-07-01 false Rights and obligations of beneficiaries. 220.9 Section 220.9 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE...

  4. 42 CFR 403.220 - Supplemental Health Insurance Panel.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Supplemental Health Insurance Panel. 403.220... Programs § 403.220 Supplemental Health Insurance Panel. (a) Membership. The Supplemental Health Insurance... determines whether or not a State regulatory program for Medicare supplemental health insurance policies...

  5. 12 CFR 220.12 - Supplement: margin requirements.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Supplement: margin requirements. 220.12 Section... SYSTEM CREDIT BY BROKERS AND DEALERS (REGULATION T) § 220.12 Supplement: margin requirements. The required margin for each security position held in a margin account shall be as follows: (a) Margin equity...

  6. 24 CFR 92.220 - Form of matching contribution.

    Science.gov (United States)

    2010-04-01

    ... HOME assistance or contracts, or investors who own, are working on, or are proposing to apply for....220 Section 92.220 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development HOME INVESTMENT PARTNERSHIPS PROGRAM Program Requirements Matching Contribution...

  7. 49 CFR 220.61 - Radio transmission of mandatory directives.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Radio transmission of mandatory directives. 220.61... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD COMMUNICATIONS Radio and Wireless Communication Procedures § 220.61 Radio transmission of mandatory directives. (a) Each mandatory directive may be transmitted by...

  8. 49 CFR 220.31 - Initiating a radio transmission.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Initiating a radio transmission. 220.31 Section... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD COMMUNICATIONS Radio and Wireless Communication Procedures § 220.31 Initiating a radio transmission. Before transmitting by radio, an employee shall: (a) Listen to...

  9. 20 CFR 663.220 - Who may receive intensive services?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Who may receive intensive services? 663.220 Section 663.220 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR ADULT AND...-Stop operator to be in need of intensive services to obtain or retain employment that leads to self...

  10. 20 CFR 220.45 - Providing evidence of disability.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Providing evidence of disability. 220.45... DETERMINING DISABILITY Evidence of Disability § 220.45 Providing evidence of disability. (a) General. The claimant for a disability annuity is responsible for providing evidence of the claimed disability and the...

  11. 42 CFR 93.220 - Public Health Service or PHS.

    Science.gov (United States)

    2010-10-01

    ... HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON... Health, and the Substance Abuse and Mental Health Services Administration, and the offices of the... 42 Public Health 1 2010-10-01 2010-10-01 false Public Health Service or PHS. 93.220 Section 93.220...

  12. 49 CFR 220.303 - General use of electronic devices.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD COMMUNICATIONS Electronic Devices § 220.303 General use of electronic devices. A railroad operating employee shall not use an electronic device if that use would... 49 Transportation 4 2010-10-01 2010-10-01 false General use of electronic devices. 220.303 Section...

  13. 49 CFR 220.305 - Use of personal electronic devices.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD COMMUNICATIONS Electronic Devices § 220.305 Use of personal electronic devices. A railroad operating employee must have each personal electronic device turned off with... 49 Transportation 4 2010-10-01 2010-10-01 false Use of personal electronic devices. 220.305...

  14. Dicty_cDB: VSC220 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSC220 (Link to dictyBase) - - - Contig-U15185-1 VSC220Z (Link to Original site)...- - VSC220Z 338 - - - - Show VSC220 Library VS (Link to library) Clone ID VSC220 (Link to dictyBase)...AL114982 |AL114982.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 70 2e-08...AL116011 |AL116011.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 70 2e-08...AL116009 |AL116009.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 70 2e-08

  15. 32 CFR 220.6 - Certain payers excluded.

    Science.gov (United States)

    2010-07-01

    ... Uniformed Services or other authorized representative for the United States makes a determination, based on...) MISCELLANEOUS COLLECTION FROM THIRD PARTY PAYERS OF REASONABLE CHARGES FOR HEALTHCARE SERVICES § 220.6 Certain...

  16. 46 CFR 174.220 - Hatches and coamings.

    Science.gov (United States)

    2010-10-01

    ... PERTAINING TO SPECIFIC VESSEL TYPES Special Rules Pertaining to Offshore Supply Vessels § 174.220 Hatches and... securing-devices; and (2) Be attached to the hatch frame or coaming by hinges, captive chains, or other...

  17. 1997 County Pesticide Use Estimates for 220 Compounds

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This dataset includes information for 220 pesticides on the average amount (pounds) applied to 87 agricultural crops and the acres of crops treated for counties...

  18. 2 CFR 801.220 - What contracts and subcontracts, in addition to those listed in 2 CFR 180.220, are covered...

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false What contracts and subcontracts, in addition to those listed in 2 CFR 180.220, are covered transactions? 801.220 Section 801.220 Grants and Agreements Federal Agency Regulations for Grants and Agreements DEPARTMENT OF VETERANS AFFAIRS NONPROCUREMENT...

  19. 49 CFR Appendix A to Part 220 - Recommended Phonetic Alphabet

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Recommended Phonetic Alphabet A Appendix A to Part 220 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD...—Recommended Phonetic Alphabet A—ALFA B—BRAVO C—CHARLIE D—DELTA E—ECHO F—FOXTROT G—GOLF H—HOTEL I—INDIA J...

  20. 49 CFR 179.220-11 - Postweld heat treatment.

    Science.gov (United States)

    2010-10-01

    ... treated before welding to shell if postweld heat treatment is not practicable due to assembly procedures... SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION HAZARDOUS MATERIALS REGULATIONS SPECIFICATIONS FOR TANK CARS Specifications for Non-Pressure Tank Car Tanks (Classes DOT-111AW and 115AW) § 179.220-11...

  1. 50 CFR 300.220 - Confidentiality of information.

    Science.gov (United States)

    2010-10-01

    ... Section 300.220 Wildlife and Fisheries INTERNATIONAL FISHING AND RELATED ACTIVITIES INTERNATIONAL... having access to confidential information may be subject to criminal and civil penalties for unauthorized... section is intended to confer any right, claim, or entitlement to obtain access to confidential...

  2. 41 CFR 101-29.220 - Market research and analysis.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Market research and... PRODUCT DESCRIPTIONS 29.2-Definitions § 101-29.220 Market research and analysis. Market research and... to determine whether they meet user needs and to identify the market practices of firms engaged in...

  3. 32 CFR 220.1 - Purpose and applicability.

    Science.gov (United States)

    2010-07-01

    ... general, 10 U.S.C. 1095 establishes the statutory obligation of third party payers to reimburse the United States the reasonable charges of healthcare services provided by facilities of the Uniformed Services to...) MISCELLANEOUS COLLECTION FROM THIRD PARTY PAYERS OF REASONABLE CHARGES FOR HEALTHCARE SERVICES § 220.1 Purpose...

  4. P CYGNI PROFILES OF MOLECULAR LINES TOWARD ARP 220 NUCLEI

    NARCIS (Netherlands)

    Sakamoto, Kazushi; Aalto, Susanne; Wilner, David J.; Black, John H.; Conway, John E.; Costagliola, Francesco; Peck, Alison B.; Spaans, Marco; Wang, Junzhi; Wiedner, Martina C.

    2009-01-01

    We report similar to 100 pc (0 ''.3) resolution observations of (sub) millimeter HCO(+) and CO lines in the ultraluminous infrared galaxy Arp 220. The lines peak at two merger nuclei, with HCO(+) being more spatially concentrated than CO. Asymmetric line profiles with blueshifted absorption and

  5. 21 CFR 1271.220 - Processing and process controls.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Processing and process controls. 1271.220 Section... process controls. (a) General. If you are an establishment that processes HCT/Ps, you must process each... mixed in a single receptacle) during manufacturing. (c) In-process control and testing. You must ensure...

  6. 49 CFR 220.11 - Requirements for roadway workers.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Requirements for roadway workers. 220.11 Section... workers. (a) On and after July 1, 1999, the following requirements apply to a railroad that has 400,000 or... to provide on-track safety for a roadway work group or groups, and each lone worker, shall be...

  7. 20 CFR 404.220 - Average-monthly-wage method.

    Science.gov (United States)

    2010-04-01

    ... 404.220 Employees' Benefits SOCIAL SECURITY ADMINISTRATION FEDERAL OLD-AGE, SURVIVORS AND DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts Average-Monthly-Wage Method of Computing Primary... before 1979, reach age 62, become disabled or die to be eligible for us to compute your primary insurance...

  8. 46 CFR 127.220 - General fire protection.

    Science.gov (United States)

    2010-10-01

    ... Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OFFSHORE SUPPLY VESSELS CONSTRUCTION AND ARRANGEMENTS Particular Construction and Arrangements § 127.220 General fire protection. (a) Each vessel must... components of that source, adjoins a space containing either the ship's service generators or machinery...

  9. 20 CFR 725.220 - Determination of relationship; child.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Determination of relationship; child. 725.220... Determination of relationship; child. For purposes of determining whether an individual may qualify for benefits as the child of a deceased miner, the provisions of § 725.208 shall be applicable. As used in this...

  10. 20 CFR 220.113 - Symptoms, signs, and laboratory findings.

    Science.gov (United States)

    2010-04-01

    ....113 Section 220.113 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD... (symptoms). Signs must be shown by medically acceptable clinical diagnostic techniques. Psychiatric signs... psychological phenomena which can be shown by the use of medically acceptable laboratory diagnostic techniques...

  11. 49 CFR 179.220-18 - Bottom outlets.

    Science.gov (United States)

    2010-10-01

    ... Specifications for Non-Pressure Tank Car Tanks (Classes DOT-111AW and 115AW) § 179.220-18 Bottom outlets. (a) The... or stem projection below the “V” groove or its equivalent. The valve and seat must be readily...

  12. 24 CFR 220.830 - Debenture interest rate.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Debenture interest rate. 220.830... rate. Debentures shall bear interest from the date of issue, payable semiannually on the first day of... rates of interest will be published twice each year as a notice in the Federal Register. ...

  13. 7 CFR 220.7 - Requirements for participation.

    Science.gov (United States)

    2010-01-01

    ... may be used to support a nonprofit nutrition program for the elderly, including a program funded under... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SCHOOL BREAKFAST PROGRAM § 220.7 Requirements for participation. Link to...

  14. 33 CFR 209.220 - Flood control regulations.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Flood control regulations. 209..., DEPARTMENT OF DEFENSE ADMINISTRATIVE PROCEDURE § 209.220 Flood control regulations. (a) Local protection.... Regulations prescribed by the Secretary of the Army for the maintenance and operation of local flood...

  15. 24 CFR 1006.220 - Crime prevention and safety activities.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Crime prevention and safety... URBAN DEVELOPMENT NATIVE HAWAIIAN HOUSING BLOCK GRANT PROGRAM Eligible Activities § 1006.220 Crime... enforcement measures and activities appropriate to protect residents of affordable housing from crime...

  16. 27 CFR 28.220 - Notice of return.

    Science.gov (United States)

    2010-04-01

    ... identification of the containers; (e) Total wine gallons for each tax class of wine; and (f) Reason for the... OF THE TREASURY LIQUORS EXPORTATION OF ALCOHOL Exportation of Wine With Benefit of Drawback § 28.220 Notice of return. If an exporter desires to return wine to a bonded wine cellar or wholesale liquor...

  17. 36 CFR 220.7 - Environmental assessment and decision notice.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Environmental assessment and... AGRICULTURE NATIONAL ENVIRONMENTAL POLICY ACT (NEPA) COMPLIANCE § 220.7 Environmental assessment and decision notice. (a) Environmental assessment. An environmental assessment (EA) shall be prepared for proposals as...

  18. Subarcsecond imaging of the water emission in Arp 220

    Science.gov (United States)

    König, S.; Martín, S.; Muller, S.; Cernicharo, J.; Sakamoto, K.; Zschaechner, L. K.; Humphreys, E. M. L.; Mroczkowski, T.; Krips, M.; Galametz, M.; Aalto, S.; Vlemmings, W. H. T.; Ott, J.; Meier, D. S.; Fuente, A.; García-Burillo, S.; Neri, R.

    2017-06-01

    Aims: Extragalactic observations of water emission can provide valuable insight into the excitation of the interstellar medium. In particular they allow us to investigate the excitation mechanisms in obscured nuclei, that is, whether an active galactic nucleus or a starburst dominates. Methods: We use subarcsecond resolution observations to tackle the nature of the water emission in Arp 220. ALMA Band 5 science verification observations of the 183 GHz H2O 313 - 220 line, in conjunction with new ALMA Band 7 H2O 515 - 422 data at 325 GHz, and supplementary 22 GHz H2O 616 - 523 VLA observations, are used to better constrain the parameter space in the excitation modeling of the water lines. Results: We detect 183 GHz H2O and 325 GHz water emission toward the two compact nuclei at the center of Arp 220, being brighter in Arp 220 West. The emission at these two frequencies is compared to previous single-dish data and does not show evidence of variability. The 183 and 325 GHz lines show similar spectra and kinematics, but the 22 GHz profile is significantly different in both nuclei due to a blend with an NH3 absorption line. Conclusions: Our findings suggest that the most likely scenario to cause the observed water emission in Arp 220 is a large number of independent masers originating from numerous star-forming regions. Based on observations carried in ALMA programs ADS/JAO.ALMA#2011.0.00018.SV and ADS/JAO.ALMA#2012.1.00453.S, with the IRAM 30 m telescope under project numbers 189-12 and 186-13.We dedicate this work to the memory of Fred Lo.

  19. Thoron (220Rn) in the indoor environment and work places

    Science.gov (United States)

    Ramachandran, T. V.; Sahoo, B. K.

    2009-08-01

    Ever since studies on uranium miners established the presence of a positive risk coefficient for the occurrence of lung cancer in miners exposed to elevated levels of 222Rn and its progeny, there was a great upsurge of interest in the measurement of 222Rn in the environment. Subsequently, considerable data is being generated on the levels of 222Rn in the environment across the worlds and is being periodically reported by UNSCEAR reports. In contrast to this, data pertaining to 220Rn in indoors and workplace environment is scaree due to the genral perception that its levels are negligible due to its shorter half life, and subsequently its contribution to the total inhalation dose is ignored, in the presence of other significant sources of natural radiation. This may not be true. Globally many locations have higher levels of natural background radiation due to elevated levels of primordial radio nuclides in the soil and their decay products like radon (222Rn), and thoron (220Rn) in the environment. Of late, technologically enhanced naturally occurring radioactive material has also contributed to the burden of background radiation. It is estimated that inhalation of 222Rn, 220Rn and their short lived progenies contribute more than 54% of the total natural background radiation dose received by the general population. 220Rn problem exists in industries which use thorium nitrate. Including India, lamps using thoriated gas mantles are still being used for indoor and outdoor lighting and by hawkers in rural as well as urban areas. Considering the fact that large amount of thorium nitrate is being handled by these industries, contribution to the inhalation dose of workers from 220Rn gas emanated and build up of the progeny in ambient air may also be quite significant. In this paper current status of 220Rn levels in the indoor environment and workplaces as well as in other industries where large amount of 232Th is being handled is being summarized. Methods of measurement and

  20. 49 CFR 220.309 - Permitted uses; exceptions to other restrictions.

    Science.gov (United States)

    2010-10-01

    ... device that is consistent with the railroad's standards for medical fitness for duty. (f) A wireless.... 220.309 Section 220.309 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD COMMUNICATIONS Electronic Devices...

  1. ERRATUM: Measurement repetitions of the Si (220) lattice spacing

    Science.gov (United States)

    Cavagnero, G.; Fujimoto, H.; Mana, G.; Massa, E.; Nakayama, K.; Zosi, G.

    2004-12-01

    Recently, the Istituto di Metrologia 'G Colonnetti' (IMGC) and the National Metrology Institute of Japan (NMIJ) reported joint measurements of the (220) lattice plane spacing of Si. These measurements were carried out at both the IMGC and the NMIJ to resolve a discrepancy between previous determinations. It has been found subsequently that the laser beam used in the IMGC apparatus was not perfectly monochromatic, and consequently an error occurred in the IMGC's measurement. Full details are provided in the PDF file.

  2. 1,1 kilomeetri eest 220 miljonit krooni / Martti Kass

    Index Scriptorium Estoniae

    Kass, Martti

    2006-01-01

    Tartu maantee 1,1 kilomeetrise lõigu rekonstrueerimine Liivalaia ja Masina tänava vahel läheb varemnimetatud 100 miljoni krooni asemel maksma hoopis 220 miljonit krooni. Tallinna abilinnapea Olga Sõtnik põhjendab hinnatõusu tee-ehitusmaterjalide hindade tõusuga, Tallinna volikogu revisjonikomisjoni esimees Remo Holsmer aga kahtlustab tee-ehitajate omavahelist kokkulepet. Lisa: Üks kilomeeter maksab 200 miljonit krooni

  3. 25 CFR 1000.220 - What regulations apply to self-governance Tribes?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false What regulations apply to self-governance Tribes? 1000.220 Section 1000.220 Indians OFFICE OF THE ASSISTANT SECRETARY, INDIAN AFFAIRS, DEPARTMENT OF THE...-DETERMINATION AND EDUCATION ACT Waiver of Regulations § 1000.220 What regulations apply to self-governance...

  4. 7 CFR 220.22 - Information collection/recordkeeping-OMB assigned control numbers.

    Science.gov (United States)

    2010-01-01

    ...) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SCHOOL BREAKFAST PROGRAM... requirements are described Current OMB control number 220.3(e) 0584-0327 220.5 0584-0012 220.7(a)-(e) 0584-0329...

  5. 42 CFR 412.220 - Special treatment of certain hospitals located in Puerto Rico.

    Science.gov (United States)

    2010-10-01

    ... Puerto Rico. 412.220 Section 412.220 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT... SERVICES Prospective Payment System for Inpatient Operating Costs for Hospitals Located in Puerto Rico § 412.220 Special treatment of certain hospitals located in Puerto Rico. Subpart G of this part sets...

  6. 49 CFR 220.315 - Operational tests and inspections; further restrictions on use of electronic devices.

    Science.gov (United States)

    2010-10-01

    ... restrictions on use of electronic devices. 220.315 Section 220.315 Transportation Other Regulations Relating to... Electronic Devices § 220.315 Operational tests and inspections; further restrictions on use of electronic... calling the personal electronic device or the railroad-supplied electronic device used by a railroad...

  7. 40 CFR 415.220 - Applicability; description of the titanium dioxide production subcategory.

    Science.gov (United States)

    2010-07-01

    ... titanium dioxide by the sulfate process, the chloride process, and the simultaneous beneficiation... titanium dioxide production subcategory. 415.220 Section 415.220 Protection of Environment ENVIRONMENTAL... SOURCE CATEGORY Titanium Dioxide Production Subcategory § 415.220 Applicability; description of the...

  8. 76 FR 38742 - Eleventh Meeting: RTCA Special Committee 220: Automatic Flight Guidance and Control

    Science.gov (United States)

    2011-07-01

    ... Committee 220 Meeting: Automatic Flight Guidance and Control. SUMMARY: The FAA is issuing this notice to advise the public of a meeting of RTCA Special Committee 220: Automatic Flight Guidance and Control DATES... Appendix 2), notice is hereby given for a Special Committee 220, Automatic Flight Guidance and Control...

  9. 40 CFR 80.220 - What are the downstream standards for GPA gasoline?

    Science.gov (United States)

    2010-07-01

    ... GPA gasoline? 80.220 Section 80.220 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Gasoline Sulfur Geographic Phase-in Program § 80.220 What are the downstream standards for GPA gasoline? (a) GPA gasoline. (1) During...

  10. Clinical tomographic correlations of 220 patients with neurocisticercosis, Bahia, Brazil.

    Science.gov (United States)

    Andrade-Filho, Antônio de Souza; Figuerôa, Luiz Frederico da Silva; Andrade-Souza, Victor Mascarenhas

    2007-02-01

    Neurocysticercosis (NCC) is a common parasitic disease in our region, presenting diversity of neurological symptoms and signs. The present study has as primary objective an evaluation of the NCC's clinical and epidemiological profile within Bahia State, by means of a prospective study of 220 patients diagnosed from March 1988 to March 1999, with a follow-up of six months. Exams, such as Computed Cranial Tomography Scan (CT), Cerebral Spine Fluid (CSF) and Electroencephalogram (EEG), were accomplished in three distinct moments of these patients' evolution: at starting or diagnostic point (zero time), at after-intervention period (one month after treatment), and at control period (six months after treatment).

  11. Clinical tomographic correlations of 220 patients with neurocisticercosis, Bahia, Brazil

    Directory of Open Access Journals (Sweden)

    Antônio de Souza Andrade-Filho

    Full Text Available Neurocysticercosis (NCC is a common parasitic disease in our region, presenting diversity of neurological symptoms and signs. The present study has as primary objective an evaluation of the NCC's clinical and epidemiological profile within Bahia State, by means of a prospective study of 220 patients diagnosed from March 1988 to March 1999, with a follow-up of six months. Exams, such as Computed Cranial Tomography Scan (CT, Cerebral Spine Fluid (CSF and Electroencephalogram (EEG, were accomplished in three distinct moments of these patients' evolution: at starting or diagnostic point (zero time, at after-intervention period (one month after treatment, and at control period (six months after treatment.

  12. A Deep Arecibo Spectral Scan of Arp 220

    Science.gov (United States)

    Vick, Michelle; Ghosh, T.; Salter, C. J.; Minchin, R. F.

    2014-01-01

    A deep spectral scan of the prototype Ultra Luminous Infra-Red Galaxy (ULIRG), Arp 220, has been made over the frequency range 1.1 to 10.0 GHz using the 305-m Arecibo telescope. These new observations supersede a previous shallow scan of Arp 220 (Salter et al., 2008, Astron. J., 136, 389). The spectral lines seen in the previous scan were all re-detected with greatly improved signal-to-noise ratio. These lines include hydrogen cyanide (HCN v2=1) in absorption, formaldehyde (H2CO) in emission at 4.83 GHz, and hydroxyl (OH) in emission at 1.6 GHz and absorption at 4.7, 6.0 and 7.8 GHz. In addition, a large number of hydrogen recombination lines were detected, as was the H2CO line at 4.955 GHz, and two lines that are identified with excited transitions of methylidyne (CH) at 4.848 and 4.870 GHz. The identification of other possible detections is on-going.

  13. PEG site infections: a novel use for Actisorb Silver 220.

    Science.gov (United States)

    Leak, Kathy

    2002-06-01

    Any breach in the integrity of the skin, such as occurs in wounds and incisions, and intravascular catheters, can act as a portal for the ingress of microorganisms and thereby predispose the patient to infection. The infection, if unchecked, can put the patient at risk of bacteraemia. We have reviewed the care of percutaneous enterostomal gastrostomy (PEG) sites in our trust hospital and in the local community and have implemented practice guidelines to reduce infection risks. These include protocols for skin care around PEG sites, and the use of an antibacterial dressing - Actisorb Silver 220 - to manage local colonization. The preliminary results of this exercise indicate that patient comfort can be improved, hypergranulation reduced, and methicillin-resistant Staphylococcus aureus colonization and infection eradicated.

  14. CPU timing routines for a CONVEX C220 computer system

    Science.gov (United States)

    Bynum, Mary Ann

    1989-01-01

    The timing routines available on the CONVEX C220 computer system in the Structural Mechanics Division (SMD) at NASA Langley Research Center are examined. The function of the timing routines, the use of the timing routines in sequential, parallel, and vector code, and the interpretation of the results from the timing routines with respect to the CONVEX model of computing are described. The timing routines available on the SMD CONVEX fall into two groups. The first group includes standard timing routines generally available with UNIX 4.3 BSD operating systems, while the second group includes routines unique to the SMD CONVEX. The standard timing routines described in this report are /bin/csh time,/bin/time, etime, and ctime. The routines unique to the SMD CONVEX are getinfo, second, cputime, toc, and a parallel profiling package made up of palprof, palinit, and palsum.

  15. Monitoring for thorium intakes by means of thoron (RN-220) in breath measurement; Inkorporationsueberwachung auf Thorium mittels RN-220-Exhalationsanalyse

    Energy Technology Data Exchange (ETDEWEB)

    Eisenmenger, A.; Riedel, W. [Freie Univ. Berlin (Germany). Universitaetsklinikum Benjamin Franklin; Brose, J.; Scheler, R. [Bundesamt fuer Strahlenschutz, Berlin (Germany)

    1998-12-31

    Thoron (Rn-220) in Breath Measurement is a sensitive method for routine monitoring of inhaled thorium intakes. Decay products of exhaled thoron (Po-216 and Pb-212), emanating from Thorium body burdens, are collected electrostatically and their progeny (esp. Po-212) are measured subsequently by alpha-spectrometry. The method has been optimized in respect to chamber volume, collection head geometry and position, supplied high voltage, breathing rate, humidity and counting time. Actually the method is capable to detect Th-228 in the lungs at a level as high as 3% of an Annual Limit on Intake, corresponding to 6 Bq of inhaled Th-228 (class W), as required by the German radiation protection monitoring guidelines. First measurements at occupationally exposed subjects in germany showed burdens up to 7,4 Bq Thorium in lungs derived from an exhalation rate of 3,7%. The amount of Th-232 results from the ratio of Th-228/Th-232 of the handeled material. Corresponding urine excretion analysis showed similar results. With in-vivo measurements no result above detection limit was found at all. (orig.) [Deutsch] Rn-220 Exhalationsmessungen sind eine sensible Methode zur Routineueberwachung von (inhalativen) Thoriuminkorporationen. Zerfallsprodukte des aus Thoriumkoerperdepots abgeatmeten Rn-220 (Po-216 und Pb-212) werden elektrostatisch gesammelt und deren Folgeprodukte dann alpha-spektrometrisch gemessen (spez. Po-212). Die Methode wurde in bezug auf das Sammelkammervolumen, die Sammelkopfgeometrie und -position, die angelegte Hochspannung, die Atemrate, die Atemfeuchtigkeit und die Messzeit optimiert. Derzeit ist es moeglich, mit dieser Methode 3% einer Jahresaktivitaetszufuhr ueber Inhalation in Bezug auf Th-228, entsprechend 6 Bq (Klasse W), nachzuweisen. Erste Messungen an beruflich Exponierten der Thorium-verarbeitenden Industrie in Deutschland zeigten Ergebnisse von bis 7,4 Bq Th-228 Lungendepots bei einer zugrunde gelegten Abatemrate von 3.7%. Der Th-232 Anteil ergibt sich

  16. Formation of Mg2C3 phase in N220 nanocarbon containing low ...

    Indian Academy of Sciences (India)

    This paper reports a non-conventional microstructurewith sequicarbide (Mg 2 C 3 ) formation in N220 nanocarboncontaining low carbon magnesia carbon composition having magnesium metal powder as antioxidant. 5 wt% graphitecontaining MgO-C refractory with and without 1 wt% N220 nanocarbon is studied and 2 ...

  17. 20 CFR 220.58 - Objections to the designated physician or psychologist.

    Science.gov (United States)

    2010-04-01

    ... psychologist. 220.58 Section 220.58 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE... designated physician or psychologist. A claimant or his or her representative may object to his or her being examined by a designated physician or psychologist. If there is a good reason for the objection, the Board...

  18. 20 CFR 220.127 - When the only work experience is arduous unskilled physical labor.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When the only work experience is arduous unskilled physical labor. 220.127 Section 220.127 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS... education who has a life-long history of arduous physical labor. B says that he is disabled because of...

  19. 75 FR 3959 - Fifth Meeting-RTCA Special Committee 220: Automatic Flight Guidance and Control

    Science.gov (United States)

    2010-01-25

    ...: Automatic Flight Guidance and Control meeting. SUMMARY: The FAA is issuing this notice to advise the public of a meeting of RTCA Special Committee 220: Automatic Flight Guidance and Control. DATES: The meeting... hereby given for a Special Committee 220: Automatic Flight Guidance and Control meeting. The agenda will...

  20. 76 FR 22163 - Tenth Meeting: RTCA Special Committee 220: Automatic Flight Guidance and Control

    Science.gov (United States)

    2011-04-20

    ... meeting: Automatic Flight Guidance and Control. SUMMARY: The FAA is issuing this notice to advise the public of a meeting of RTCA Special Committee 220: Automatic Flight Guidance and Control. DATES: The... Committee 220, Automatic Flight Guidance and Control. Agenda Tuesday May 10-Thursday, May 12, 2011...

  1. 75 FR 80886 - Ninth Meeting-RTCA Special Committee 220: Automatic Flight Guidance and Control

    Science.gov (United States)

    2010-12-23

    ...: Automatic Flight Guidance and Control meeting. SUMMARY: The FAA is issuing this notice to advise the public of a meeting of RTCA Special Committee 220: Automatic Flight Guidance and Control. DATES: The meeting... Federal Aviation Administration Ninth Meeting--RTCA Special Committee 220: Automatic Flight Guidance and...

  2. 75 FR 59326 - Eighth Meeting-RTCA Special Committee 220: Automatic Flight Guidance and Control

    Science.gov (United States)

    2010-09-27

    ...: Automatic Flight Guidance and Control meeting. SUMMARY: The FAA is issuing this notice to advise the public of a meeting of RTCA Special Committee 220: Automatic Flight Guidance and Control. DATES: The meeting...., Appendix 2), notice is hereby given for a Special Committee 220: Automatic Flight Guidance and Control...

  3. 76 FR 50809 - Eleventh Meeting: RTCA Special Committee 220: Automatic Flight Guidance and Control

    Science.gov (United States)

    2011-08-16

    ... Federal Aviation Administration Eleventh Meeting: RTCA Special Committee 220: Automatic Flight Guidance and Control AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Correction of Notice of RTCA Special Committee 220 meeting: Automatic Flight Guidance and Control. SUMMARY: The FAA is issuing this...

  4. 75 FR 15770 - Sixth Meeting-RTCA Special Committee 220: Automatic Flight Guidance and Control

    Science.gov (United States)

    2010-03-30

    ...: Automatic Flight Guidance and Control meeting. SUMMARY: The FAA is issuing this notice to advise the public of a meeting of RTCA Special Committee 220: Automatic Flight Guidance and Control. DATES: The meeting... Committee 220: Automatic Flight Guidance and Control meeting. The agenda will include: Welcome/Agenda...

  5. 76 FR 79754 - Twelfth Meeting: RTCA Special Committee 220, Automatic Flight Guidance and Control

    Science.gov (United States)

    2011-12-22

    ... Federal Aviation Administration Twelfth Meeting: RTCA Special Committee 220, Automatic Flight Guidance and Control AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION: Notice of RTCA Special Committee 220, Automatic Flight Guidance and Control. SUMMARY: The FAA is issuing...

  6. 75 FR 36471 - Seventh Meeting-RTCA Special Committee 220: Automatic Flight Guidance and Control

    Science.gov (United States)

    2010-06-25

    ...: Automatic Flight Guidance and Control meeting. SUMMARY: The FAA is issuing this notice to advise the public of a meeting of RTCA Special Committee 220: Automatic Flight Guidance and Control. DATES: The meeting...), notice is hereby given for a Special Committee 220: Automatic Flight Guidance and ] Control meeting. The...

  7. 30 CFR 220.014 - Allocation of joint costs and credits.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Allocation of joint costs and credits. 220.014... GAS LEASES § 220.014 Allocation of joint costs and credits. (a) Joint costs shall be grouped in cost... allocation principles apply in allocating joint costs: (1) G & G. G & G shall be allocated on a line mile per...

  8. 30 CFR 220.015 - Pricing of materiel purchases, transfers, and dispositions.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Pricing of materiel purchases, transfers, and... CONTINENTAL SHELF OIL AND GAS LEASES § 220.015 Pricing of materiel purchases, transfers, and dispositions. (a... § 220.011(c)(3). (2) Transferred and disposal materiel. An item of materiel, which is acquired by the...

  9. 40 CFR 1068.220 - What are the provisions for exempting display engines/equipment?

    Science.gov (United States)

    2010-07-01

    ... heading “EMISSION CONTROL INFORMATION”. (2) Your corporate name and trademark. (3) Engine displacement... display engines/equipment? 1068.220 Section 1068.220 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR POLLUTION CONTROLS GENERAL COMPLIANCE PROVISIONS FOR ENGINE PROGRAMS Exemptions...

  10. 20 CFR 220.143 - Evaluation guides for an employed claimant.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evaluation guides for an employed claimant. 220.143 Section 220.143 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD... productivity when the Board decides whether the claimant has done substantial gainful activity. If the claimant...

  11. 7 CFR Appendix C to Part 220 - Child Nutrition (CN) Labeling Program

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Child Nutrition (CN) Labeling Program C Appendix C to... SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SCHOOL BREAKFAST PROGRAM Pt. 220, App. C Appendix C to Part 220—Child Nutrition (CN) Labeling Program 1. The Child Nutrition (CN) Labeling Program...

  12. 49 CFR 220.307 - Use of railroad-supplied electronic devices.

    Science.gov (United States)

    2010-10-01

    ... RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD COMMUNICATIONS Electronic Devices § 220.307 Use of railroad-supplied electronic devices. (a) General restriction. A railroad operating employee... 49 Transportation 4 2010-10-01 2010-10-01 false Use of railroad-supplied electronic devices. 220...

  13. 45 CFR 400.220 - Counting time-eligibility of refugees.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Counting time-eligibility of refugees. 400.220 Section 400.220 Public Welfare Regulations Relating to Public Welfare OFFICE OF REFUGEE RESETTLEMENT, ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES REFUGEE RESETTLEMENT PROGRAM...

  14. 50 CFR 665.220 - Hawaii coral reef ecosystem fisheries. [Reserved

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Hawaii coral reef ecosystem fisheries. 665.220 Section 665.220 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE (CONTINUED) FISHERIES IN THE WESTERN PACIFIC Hawaii...

  15. 46 CFR 130.220 - Design of equipment for cooking and heating.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Design of equipment for cooking and heating. 130.220 Section 130.220 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OFFSHORE SUPPLY VESSELS... Design of equipment for cooking and heating. (a) Doors on each cooking appliance must be provided with...

  16. Soluble gp350/220 and deletion mutant glycoproteins block Epstein-Barr virus adsorption to lymphocytes.

    OpenAIRE

    Tanner, J; Whang, Y.; Sample, J; Sears, A; Kieff, E

    1988-01-01

    The Epstein-Barr virus (EBV) major outer envelope glycoprotein complex, gp350/220, was known to be a ligand for CR2, a B-lymphocyte plasma membrane protein. By Scatchard analysis, soluble EBV gp350/220 binds with high affinity (KD, 1.2 x 10(-8) M) to approximately the same number of B-lymphocyte surface sites as do CR2-specific monoclonal antibodies. Soluble gp350, gp220, or an amino-terminal, 576-amino-acid gp220 derivative binds similarly to B-lymphocyte receptors. Soluble gp350/220, gp220,...

  17. Octupole collectivity in $^{220}$Rn and $^{224}$Ra

    CERN Document Server

    Gaffney, Liam Paul

    Collective properties of the radioactive nuclei $^{220}$Rn and $^{224}$Ra have been studied via Coulomb excitation of a 2.8$\\,$A.MeV radioactive ion beam (RIB) incident upon $^{60}$Ni, $^{112,114}$Cd and $^{120}$Sn targets. The experiments took place at the REX-ISOLDE RIB facility, CERN. De-excitation $\\gamma$-ray yields following multiple-step Coulomb excitation were detected in coincidence with recoiling target nuclei in the Miniball spectrometer. For the first time, B(E3;3$^+ \\rightarrow 0^+$) values have been directly measured with a radioactive ion beam. In the process, $^{224}$Ra becomes the heaviest post-accelerated RIB to date at ISOLDE (with the possible exception of the quasi-stable $^{238}$U). The measurements presented in this thesis represent a tripling of the number of nuclei around Z$\\simeq88$ and N$\\simeq134$, for which direct measurements of the octupole collectivity have been performed. The only previous measurements being for the relatively long-lived $^{226}$Ra. The $\\gamma$-ray yields, in...

  18. Poliovirus proteinase 2A induces cleavage of eucaryotic initiation factor 4F polypeptide p220.

    Science.gov (United States)

    Kräusslich, H G; Nicklin, M J; Toyoda, H; Etchison, D; Wimmer, E

    1987-01-01

    Poliovirus infection of HeLa cells induces rapid shutoff of host protein synthesis, whereas translation of poliovirus RNA is not inhibited. It is presumed that shutoff is the result of proteolytic cleavage of component p220 of eucaryotic initiation factor 4F. To study whether poliovirus proteinase 2A is involved in this cleavage, we translated synthetic RNAs that contained the coding region for poliovirus-specific polypeptides P1 and 2A in vitro and assayed for cleavage of p220. We report here that cleavage of p220 occurred in all cases when active proteinase 2A was translated and that disruption of the coding sequence of 2A by linker insertion or deletion prevented processing of p220 in vitro. Activity of 2A was determined by its ability to cleave at the P1-P2 site of a segment of the poliovirus polyprotein. We also constructed a plasmid in which the 3'-most 500 nucleotides of the nontranslated region of encephalomyocarditis virus were linked to the coding sequence for poliovirus polypeptide 2A. Translation of the RNA transcript of this clone was very efficient and yielded a fusion protein that included 2A; this polypeptide also induced cleavage of p220. In vitro translation in the presence of antibodies against 2A specifically inhibited processing of p220, whereas incubation of in vitro translation products with antibodies against 2A after translation was completed did not prevent proteolysis of p220. Images PMID:3039165

  19. Room model with three modal distributions of attached 220Rn progeny and dose conversion factor.

    Science.gov (United States)

    Nikezić, D; Stevanović, N

    2007-01-01

    Jacobi parametric room model was extended to the three modal distribution of aerosols, and applied to (220)Rn progeny. The computer program was developed to calculate ratios of progeny activity concentrations in different modes to (220)Rn concentration. The ratios are relatively small and they are given as functions on ventilation rate. Dose conversion factor (DCF) for (220)Rn progeny was calculated as 4.5 mSv WLM(-1), which is smaller by over three times than that for (222)Rn progeny.

  20. 20 CFR 220.59 - Requesting examination by a specific physician, psychologist or institution-hearings officer...

    Science.gov (United States)

    2010-04-01

    ... physician, psychologist or institution-hearings officer hearing level. 220.59 Section 220.59 Employees... Consultative Examinations § 220.59 Requesting examination by a specific physician, psychologist or institution... examination by a particular physician, psychologist or institution. Some examples include the following: (a...

  1. 20 CFR 220.61 - Informing the examining physician or psychologist of examination scheduling, report content and...

    Science.gov (United States)

    2010-04-01

    ... psychologist of examination scheduling, report content and signature requirements. 220.61 Section 220.61... DISABILITY Consultative Examinations § 220.61 Informing the examining physician or psychologist of examination scheduling, report content and signature requirements. Consulting physicians or psychologists will...

  2. 12 CFR 220.11 - Requirements for the list of marginable OTC stocks and the list of foreign margin stocks.

    Science.gov (United States)

    2010-01-01

    ... stocks and the list of foreign margin stocks. 220.11 Section 220.11 Banks and Banking FEDERAL RESERVE... (REGULATION T) § 220.11 Requirements for the list of marginable OTC stocks and the list of foreign margin... paragraph (f) of this section, OTC margin stock shall meet the following requirements: (1) Four or more...

  3. 20 CFR 30.220 - What are the criteria for eligibility for benefits relating to chronic silicosis?

    Science.gov (United States)

    2010-04-01

    ... benefits relating to chronic silicosis? 30.220 Section 30.220 Employees' Benefits OFFICE OF WORKERS... Silicosis Under Part B of Eeoicpa § 30.220 What are the criteria for eligibility for benefits relating to chronic silicosis? To establish eligibility for benefits for chronic silicosis under Part B of EEOICPA, an...

  4. 18 CFR 2.20 - Good faith requests for transmission services and good faith responses by transmitting utilities.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Good faith requests for transmission services and good faith responses by transmitting utilities. 2.20 Section 2.20 Conservation of... Power Act § 2.20 Good faith requests for transmission services and good faith responses by transmitting...

  5. Electron micrography and x-ray study of dip-lacquered LiF (220)

    DEFF Research Database (Denmark)

    Palmari, J.; Rasigni, M.; Rasigni, G.

    1991-01-01

    It has been proposed to use the 220 reflection of LiF with a multilayer deposited upon the top for simultaneous spectroscopy near Fe-k and O-k and below the C-k absorption edge (284 eV) in x-ray astronomy. We demonstrate that a substantial reduction of surface roughness is obtained by dip...... lacquering state-of-the-art polished LiF(220) surfaces. Using a microdensitometer analysis of electron micrographs of surface replicas and x-ray reflection, we have measured ∼ 10-Å rms roughness of Au-coated dip-lacquered LiF(220) crystals, as opposed to ∼ 60 Å measured on the bare LiF(220) crystal surface....

  6. 40 CFR 60.220 - Applicability and designation of affected facility.

    Science.gov (United States)

    2010-07-01

    ... Performance for the Phosphate Fertilizer Industry: Diammonium Phosphate Plants § 60.220 Applicability and... each granular diammonium phosphate plant having a design capacity of more than 15 tons of equivalent...

  7. 220D-F2 from Rubus ulmifolius kills Streptococcus pneumoniae planktonic cells and pneumococcal biofilms.

    Directory of Open Access Journals (Sweden)

    Sharmila J Talekar

    Full Text Available Streptococcus pneumoniae (pneumococcus forms organized biofilms to persist in the human nasopharynx. This persistence allows the pneumococcus to produce severe diseases such as pneumonia, otitis media, bacteremia and meningitis that kill nearly a million children every year. While bacteremia and meningitis are mediated by planktonic pneumococci, biofilm structures are present during pneumonia and otitis media. The global emergence of S. pneumoniae strains resistant to most commonly prescribed antibiotics warrants further discovery of alternative therapeutics. The present study assessed the antimicrobial potential of a plant extract, 220D-F2, rich in ellagic acid, and ellagic acid derivatives, against S. pneumoniae planktonic cells and biofilm structures. Our studies first demonstrate that, when inoculated together with planktonic cultures, 220D-F2 inhibited the formation of pneumococcal biofilms in a dose-dependent manner. As measured by bacterial counts and a LIVE/DEAD bacterial viability assay, 100 and 200 µg/ml of 220D-F2 had significant bactericidal activity against pneumococcal planktonic cultures as early as 3 h post-inoculation. Quantitative MIC's, whether quantified by qPCR or dilution and plating, showed that 80 µg/ml of 220D-F2 completely eradicated overnight cultures of planktonic pneumococci, including antibiotic resistant strains. When preformed pneumococcal biofilms were challenged with 220D-F2, it significantly reduced the population of biofilms 3 h post-inoculation. Minimum biofilm inhibitory concentration (MBIC50 was obtained incubating biofilms with 100 µg/ml of 220D-F2 for 3 h and 6 h of incubation. 220D-F2 also significantly reduced the population of pneumococcal biofilms formed on human pharyngeal cells. Our results demonstrate potential therapeutic applications of 220D-F2 to both kill planktonic pneumococcal cells and disrupt pneumococcal biofilms.

  8. Regulation of human autoimmune regulator (AIRE) gene translation by miR-220b.

    Science.gov (United States)

    Matsuo, Tomohito; Noguchi, Yukiko; Shindo, Mieko; Morita, Yoshifumi; Oda, Yoshie; Yoshida, Eiko; Hamada, Hiroko; Harada, Mine; Shiokawa, Yuichi; Nishida, Takahiro; Tominaga, Ryuji; Kikushige, Yoshikane; Akashi, Koichi; Kudoh, Jun; Shimizu, Nobuyoshi; Tanaka, Yuka; Umemura, Tsukuru; Taniguchi, Taketoshi; Yoshimura, Akihiko; Kobayashi, Takashi; Mitsuyama, Masao; Kurisaki, Hironori; Katsuta, Hitoshi; Nagafuchi, Seiho

    2013-11-01

    Although mutations of autoimmune regulator (AIRE) gene are responsible for autoimmune polyendocrinopathy-candidiasis-ectodermal dystrophy (APECED), presenting a wide spectrum of many characteristic and non-characteristic clinical features, some patients lack AIRE gene mutations. Therefore, something other than a mutation, such as dysregulation of AIRE gene, may be a causal factor for APECED or its related diseases. However, regulatory mechanisms for AIRE gene expression and/or translation have still remained elusive. We found that IL-2-stimulated CD4(+) T (IL-2T) cells showed a high expression of AIRE gene, but very low AIRE protein production, while Epstein-Barr virus-transformed B (EBV-B) cells express both AIRE gene and AIRE protein. By using microarray analysis, we could identify miR-220b as a possible regulatory mechanism for AIRE gene translation in IL-2T cells. Here we report that miR-220b significantly reduced the expression of AIRE protein in AIRE gene with 3'UTR region transfected 293T cells, whereas no alteration of AIRE protein production was observed in the open reading frame of AIRE gene alone transfected cells. In addition, anti-miR-220b reversed the inhibitory function of miR-220b for the expression of AIRE protein in AIRE gene with 3'UTR region transfected cells. Moreover, when AIRE gene transfected cells with mutated 3'UTR were transfected with miR-220b, no reduction of AIRE protein production was observed. Taken together, it was concluded that miR-220b inhibited the AIRE gene translation through the 3'UTR region of AIRE gene, indicating that miR-220b could serve as a regulator for human AIRE gene translation. © 2013.

  9. Expression of the Epstein-Barr virus gp350/220 gene in rodent and primate cells.

    OpenAIRE

    Whang, Y.; Silberklang, M; Morgan, A; Munshi, S; Lenny, A B; Ellis, R.W.; Kieff, E

    1987-01-01

    The gene encoding the Epstein-Barr virus envelope glycoproteins gp350 and gp220 was inserted downstream of the cytomegalovirus immediate-early, Moloney murine leukemia virus, mouse mammary tumor virus, or varicella-zoster virus gpI promoters in vectors containing selectable markers. Host cell and recombinant vector systems were defined which enabled the isolation of rodent or primate cell clones which expressed gp350/220 in substantial quantities. Continued expression of gp350/220 required ma...

  10. Kidins220/ARMS downregulation by excitotoxic activation of NMDARs reveals its involvement in neuronal survival and death pathways

    National Research Council Canada - National Science Library

    López-Menéndez, Celia; Gascón, Sergio; Sobrado, Mónica; Vidaurre, Oscar G; Higuero, Alonso M; Rodríguez-Peña, Angeles; Iglesias, Teresa; Díaz-Guerra, Margarita

    2009-01-01

    .... Here, we identify an association between these proteins and discover that excitotoxicity, a specific form of neuronal death induced by NMDAR overstimulation, dramatically decreases Kidins220/ARMS...

  11. Titan's Far-Infrared 220 cm-1 Cloud Seen for the First Time in the South

    Science.gov (United States)

    Jennings, Donald; Anderson, Carrie; Samuelson, Robert; Nixon, Conor; Flasar, Michael; Teanby, Nick; de Kok, Remco; Coustenis, Athena; Vinatier, Sandrine

    2013-04-01

    In 2012 an emission feature at 220 cm-1 in Titan's far-infrared spectrum was seen for the first time in the south [1]. Attributed to a stratosphere ice cloud formed at the winter pole, the 220 cm-1 emission had previously been seen only at high northern latitudes where it had been decreasing since the arrival of Cassini in 2004 [2]. Our far-infrared observations were performed with the Composite Infrared Spectrometer (CIRS) on Cassini [3]. Although it had been expected that the 220 cm-1 emission would eventually appear in the south, the emission appeared rather suddenly, increasing by a factor of at least four between February (when it was not detected) and July 2012. At the time of our observations, one Titan month after equinox, the 220 cm-1feature was present in both the north and south and showed a trend of continued slow decrease in the north and steep increase in the south. As has been the case in the north, the emission in the south was confined to high latitudes associated with winter polar shadowing. Our spectroscopic detection of the southern 220 cm-1 ice cloud coincided with the rapid formation in 2012 of a haze hood and vortex at the south pole as seen in Cassini images [4]. The 220 cm-1 feature was first observed by the Infrared Interferometer Spectrometer (IRIS) on Voyager 1 [5, 6] and has been extensively studied in the north by CIRS [7-10]. Until now the 220 cm-1 emission, like the polar hood, has been associated solely with the north, owing to the fact that Voyager and Cassini have viewed Titan only during winter-spring. In 2012 we witnessed the start of a seasonal shift of this pattern to the south. The 220 cm-1 emission arises from altitudes of 80-150 km and peaks sharply near 140 km. The material responsible for the spectral feature is not known, but indirect evidence hints at a condensate arising from complex nitriles, which also tend to be present only at high winter latitudes. References: [1] Jennings, D. E., et al., ApJ, 761, L15, 2012. [2

  12. 41 CFR 102-117.220 - What choices do I have to ship HHG?

    Science.gov (United States)

    2010-07-01

    ...-TRANSPORTATION MANAGEMENT Shipping Household Goods § 102-117.220 What choices do I have to ship HHG? (a) You may choose to ship HHG by: (1) Using the commuted rate system; (2) GSA's Centralized Household Goods Traffic... Government will incur a savings ($100 or more) using another choice listed. The use of household goods rate...

  13. 36 CFR 220.5 - Environmental impact statement and record of decision.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Environmental impact..., DEPARTMENT OF AGRICULTURE NATIONAL ENVIRONMENTAL POLICY ACT (NEPA) COMPLIANCE § 220.5 Environmental impact statement and record of decision. (a) Classes of actions normally requiring environmental impact statements...

  14. High-resolution HNC 3-2 SMA observations of Arp 220

    NARCIS (Netherlands)

    Aalto, S.; Wilner, D.; Spaans, M.; Wiedner, M. C.; Sakamoto, K.; Black, J. H.; Caldas, M.

    Aims. We study the properties of the nuclear molecular gas of the ultra luminous merger Arp 220 and effects of the nuclear source on gas excitation and chemistry. Specifically, our aim is to investigate the spatial location of the luminous HNC 3-2 line emission and address the underlying cause of

  15. 46 CFR 199.220 - Survival craft and rescue boat embarkation arrangements.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Survival craft and rescue boat embarkation arrangements... Passenger Vessels § 199.220 Survival craft and rescue boat embarkation arrangements. (a) Survival craft... rescue boat must be able to be boarded and launched directly from the stowed position with the number of...

  16. Chapter 10: Geographic information system landscape analysis using GTR 220 concepts

    Science.gov (United States)

    M. North; R.M. Boynton; P.A. Stine; K.F. Shipley; E.C. Underwood; N.E. Roth; J.H. Viers; J.F. Quinn

    2012-01-01

    Forest Service General Technical Report "An Ecosystem Management Strategy for Sierran Mixed-Conifer Forests" (hereafter GTR 220) (North et al. 2009) emphasizes increasing forest heterogeneity throughout a range of spatial scales including within-stand microsites, individual stands, watersheds, and entire landscapes. For fuels reduction, various landscape...

  17. 7 CFR Appendix B to Part 220 - Categories of Foods of Minimal Nutritional Value

    Science.gov (United States)

    2010-01-01

    ... definition. (3) Chewing gum. Flavored products from natural or synthetic gums and other ingredients which... 7 Agriculture 4 2010-01-01 2010-01-01 false Categories of Foods of Minimal Nutritional Value B Appendix B to Part 220 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND...

  18. 24 CFR 220.806 - Pro rata refund of insurance premium.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Pro rata refund of insurance... AREAS Contract Rights and Obligations-Projects Insured Project Improvement Loans § 220.806 Pro rata... equal to the pro rata portion of the current annual loan insurance premium theretofore paid which is...

  19. 30 CFR 220.011 - Schedule of allowable direct and allocable joint costs and credits.

    Science.gov (United States)

    2010-07-01

    ... reimbursed under the lessee's normal practice are allowable except as limited by § 220.013(g). (i) Allowable.... Volume. Gathering systems and pipeline Volume. ACT systems Volume. Laboratory services (excluding... approved provided they fall within the limits for a prudent operator. Approval of costs under this...

  20. 20 CFR 220.27 - What is needed to show an impairment.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false What is needed to show an impairment. 220.27... is needed to show an impairment. A physical or mental impairment must result from anatomical... diagnostic techniques. A physical or mental impairment must be established by medical evidence consisting of...

  1. 46 CFR 128.220 - Class II non-vital systems-materials and pressure design.

    Science.gov (United States)

    2010-10-01

    ... schedule in wall thickness. (c) Each Class II non-vital piping-system must be certified by the builder as... 46 Shipping 4 2010-10-01 2010-10-01 false Class II non-vital systems-materials and pressure design... SUPPLY VESSELS MARINE ENGINEERING: EQUIPMENT AND SYSTEMS Materials and Pressure Design § 128.220 Class II...

  2. 12 CFR 220.121 - Applicability of margin requirements to joint account between two creditors.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Applicability of margin requirements to joint...) Interpretations § 220.121 Applicability of margin requirements to joint account between two creditors. (a) The... Securities Dealers (“Firm Y”) are subject to the margin requirements of this part (Regulation T). It is...

  3. 41 CFR 102-85.220 - Can a customer agency forced to relocate waive the reimbursements?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Can a customer agency... Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION REAL... § 102-85.220 Can a customer agency forced to relocate waive the reimbursements? Yes, a customer agency...

  4. 75 FR 4805 - Electricity Market Transparency Provisions of Section 220 of the Federal Power Act

    Science.gov (United States)

    2010-01-29

    ... Energy Regulatory Commission 61,039] Electricity Market Transparency Provisions of Section 220 of the...,000 MWh of electricity per year) from the Commission's jurisdiction.\\3\\ However, section 201(b)(2... collect ``information about the availability and prices'' of natural gas and electricity sold at wholesale...

  5. 31 CFR 800.220 - Party or parties to a transaction.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Party or parties to a transaction..., ACQUISITIONS, AND TAKEOVERS BY FOREIGN PERSONS Definitions § 800.220 Party or parties to a transaction. The terms party to a transaction and parties to a transaction mean: (a) In the case of an acquisition of an...

  6. 49 CFR 220.43 - Radio communications consistent with federal regulations and railroad operating rules.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Radio communications consistent with federal... Radio and Wireless Communication Procedures § 220.43 Radio communications consistent with federal regulations and railroad operating rules. Radio communication shall not be used in connection with a railroad...

  7. 49 CFR 173.220 - Internal combustion engines, self-propelled vehicles, mechanical equipment containing internal...

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Internal combustion engines, self-propelled vehicles, mechanical equipment containing internal combustion engines, and battery powered vehicles or... Than Class 1 and Class 7 § 173.220 Internal combustion engines, self-propelled vehicles, mechanical...

  8. 49 CFR 220.37 - Testing radio and wireless communication equipment.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Testing radio and wireless communication equipment... RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD COMMUNICATIONS Radio and Wireless Communication Procedures § 220.37 Testing radio and wireless communication equipment. (a) Each radio, and all...

  9. the reception of galatians 2:20 in the patristic period and in the ...

    African Journals Online (AJOL)

    This article explores the reception of Galatians 2:20 in the Patristic period, and in the Reformation by Luther and Calvin. As it turns out, the interpretation of the verse does not fit into popular notions of their theological traditions. Authors from traditions as different as the Alexandrians and the Antiochians, or Eastern and.

  10. 20 CFR 627.220 - Coordination with programs under title IV of the Higher Education Act including the Pell grant...

    Science.gov (United States)

    2010-04-01

    ... the Higher Education Act including the Pell grant program. 627.220 Section 627.220 Employees' Benefits... of the Higher Education Act including the Pell grant program. (a) Coordination. Financial assistance programs under title IV of the Higher Education Act of 1965, as amended (HEA) (the Pell Grant program, the...

  11. 77 FR 68768 - Electricity Market Transparency Provisions of Section 220 of the Federal Power Act; Notice of...

    Science.gov (United States)

    2012-11-16

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. RM10-12-000] Electricity Market Transparency Provisions of Section 220 of the Federal Power Act; Notice of Technical Conference...., Washington, DC 20426. \\1\\ Electricity Market Transparency Provisions of Section 220 of the Federal Power Act...

  12. 41 CFR 102-38.220 - What must we do when the highest bids received have the same bid amount?

    Science.gov (United States)

    2010-07-01

    ... highest bids received have the same bid amount? 102-38.220 Section 102-38.220 Public Contracts and... do when the highest bids received have the same bid amount? When the highest bids received have the same bid amount, you must consider other factors of the sale (e.g., timely removal of the property...

  13. 12 CFR 516.220 - If OTS requests additional information to complete my application, how will it process my...

    Science.gov (United States)

    2010-01-01

    ... process my application? (a) You may use the following chart to determine the procedure that applies to... complete my application, how will it process my application? 516.220 Section 516.220 Banks and Banking... application is materially deficient * * * OTS will not process your application. (iv) Take no action within 15...

  14. 42 CFR 436.220 - Individuals who would meet the income and resource requirements under AFDC if child care costs...

    Science.gov (United States)

    2010-10-01

    ... Categorically Needy Options for Coverage of Families and Children and Aged, Blind, and Disabled Individuals... requirements under AFDC if child care costs were paid from earnings. 436.220 Section 436.220 Public Health... AFDC if child care costs were paid from earnings. (a) The agency may provide Medicaid to any group or...

  15. Expression of the Epstein-Barr virus gp350/220 gene in rodent and primate cells.

    Science.gov (United States)

    Whang, Y; Silberklang, M; Morgan, A; Munshi, S; Lenny, A B; Ellis, R W; Kieff, E

    1987-06-01

    The gene encoding the Epstein-Barr virus envelope glycoproteins gp350 and gp220 was inserted downstream of the cytomegalovirus immediate-early, Moloney murine leukemia virus, mouse mammary tumor virus, or varicella-zoster virus gpI promoters in vectors containing selectable markers. Host cell and recombinant vector systems were defined which enabled the isolation of rodent or primate cell clones which expressed gp350/220 in substantial quantities. Continued expression of gp350/220 required maintenance of cells under positive selection for linked markers and periodic cloning. gp350/220 expressed in various host cells varied slightly in electrophoretic mobility, probably reflecting differences in glycosylation. Insertion of a stop codon into the gp350/220 open reading frame, upstream of the putative membrane anchor sequence, resulted in efficient secretion of truncated gp350 and gp220 from rat pituitary (GH3) cells. gp350/220 expressed in mammalian cells is highly immunogenic and elicits virus-neutralizing antibodies when administered to mice.

  16. Measuring Occupational Exposure to Extremely Low-Frequency Electric Fields at 220 kV Substations.

    Science.gov (United States)

    Pirkkalainen, Herkko; Heiskanen, Timo; Tonteri, Juhani; Elovaara, Jarmo; Mika, Penttilä; Korpinen, Leena

    2017-11-01

    Earlier studies conducted at 400 and 110 kV substations in Finland have shown that the occupational exposure to electric fields can exceed the action levels (ALs) set by Directive 2013/35/EU. This is a case study investigating the level of occupational exposure experienced by workers at 220 kV substations in order to determine if the actions levels are being exceeded. The measurements were conducted at two old 220 kV substations in Finland. The higher AL of 20 kV m-1 was exceeded at both substations. © The Author 2017. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  17. ALMA IMAGING OF HCN, CS, AND DUST IN ARP 220 AND NGC 6240

    Energy Technology Data Exchange (ETDEWEB)

    Scoville, Nick; Manohar, Swarnima; Murchikova, Lena [California Institute of Technology, MC 249-17, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Sheth, Kartik [North American ALMA Science Center, National Radio Astronomy Observatory, 520 Edgemont Road, Charlottesville, VA 22901 (United States); Walter, Fabian; Zschaechner, Laura [Max-Planck-Institut fur Astronomie, Konigstuhl 17, D-69117 Heidelberg (Germany); Yun, Min [Department of Astronomy, University of Massachusetts, Amherst, MA 01003 (United States); Koda, Jin [Department of Physics and Astronomy, Stony Brook University, Stony Brook, NY 11794 (United States); Sanders, David; Barnes, Joshua [Institute for Astronomy, 2680 Woodlawn Drive, University of Hawaii, Honolulu, Hawaii, HI 96822 (United States); Thompson, Todd [Department of Astronomy, The Ohio State University, 140 West 18th Avenue, Columbus, OH 43210 (United States); Robertson, Brant; Tacconi, Linda; Narayanan, Desika [Department of Astronomy and Steward Observatory, University of Arizona, Tucson AZ 85721 (United States); Genzel, Reinhard; Davies, Richard [Max-Planck-Institut fur extraterrestrische Physik (MPE), Giessenbachstrasse, D-85748 Garching (Germany); Hernquist, Lars [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Brown, Robert [National Radio Astronomy Observatory, 520 Edgemont Road, Charlottesville, VA 22901 (United States); Hayward, Christopher C. [TAPIR 350-17, California Institute of Technology, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Kartaltepe, Jeyhan [National Optical Astronomy Observatory, 950 North Cherry Avenue, Tucson, AZ 85719 (United States); and others

    2015-02-10

    We report ALMA Band 7 (350 GHz) imaging at 0.''4-0.''6 resolution and Band 9 (696 GHz) at ∼0.''25 resolution of the luminous IR galaxies Arp 220 and NGC 6240. The long wavelength dust continuum is used to estimate interstellar medium masses for Arp 220 east and west and NGC 6240 of 1.9, 4.2, and 1.6 × 10{sup 9} M {sub ☉}within radii of 69, 65, and 190 pc. The HCN emission was modeled to derive the emissivity distribution as a function of radius and the kinematics of each nuclear disk, yielding dynamical masses consistent with the masses and sizes derived from the dust emission. In Arp 220, the major dust and gas concentrations are at radii less than 50 pc in both counter-rotating nuclear disks. The thickness of the disks in Arp 220 estimated from the velocity dispersion and rotation velocities are 10-20 pc and the mean gas densities are n{sub H{sub 2}}∼10{sup 5} cm{sup –3} at R <50 pc. We develop an analytic treatment for the molecular excitation (including photon trapping), yielding volume densities for both the HCN and CS emission with n {sub H2} ∼ 2 × 10{sup 5} cm{sup –3}. The agreement of the mean density from the total mass and size with that required for excitation suggests that the volume is essentially filled with dense gas, i.e., it is not cloudy or like swiss cheese.

  18. Inhibition of ACCase220 and ACCase240 isozymes from sethoxydim-resistant and -susceptible maize hybrids.

    Science.gov (United States)

    Incledon, B J; Hall, J C

    1999-01-01

    Acetyl-coenzyme A carboxylase (ACCase) isozymes were separated from cyclohexanedione-resistant and -susceptible maize. ACCase240 from resistant maize was 3.7-, >77-, and 12.8-fold more resistant to inhibition by clethodim, sethoxydim, and tralkoxydim, respectively, than ACCase240 from susceptible maize. The resistant ACCase240 preparation had 3.0-fold more protein and 14.5-fold lower specific activity than susceptible ACCase240. Resistant ACCase240 has a V(max) 5.5-fold lower than that of susceptible ACCase240, whereas apparent K(m) values were similar. ACCase220 from resistant maize was >25- and 7.2-fold more resistant to inhibition by sethoxydim and tralkoxydim, respectively, than susceptible ACCase220 but was inhibited to the same extent by clethodim. In summary, sethoxydim-resistant corn has an altered herbicide-resistant ACCase220 isozyme and increased expression of a less efficient, herbicide-resistant ACCase240 isozyme. However, to what extent alteration of both isozymes contributes to sethoxydim resistance is not clear.

  19. 32 CFR 26.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-07-01

    ... statement and establish my drug-free awareness program? 26.220 Section 26.220 National Defense Department of....220 By when must I publish my drug-free workplace statement and establish my drug-free awareness... and an ongoing awareness program as described in § 26.215, you must publish the statement and...

  20. 40 CFR 36.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-07-01

    ... workplace statement and establish my drug-free awareness program? 36.220 Section 36.220 Protection of....220 By when must I publish my drug-free workplace statement and establish my drug-free awareness... and an ongoing awareness program as described in § 36.215, you must publish the statement and...

  1. 38 CFR 48.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-07-01

    ... drug-free workplace statement and establish my drug-free awareness program? 48.220 Section 48.220... § 48.220 By when must I publish my drug-free workplace statement and establish my drug-free awareness... and an ongoing awareness program as described in § 48.215, you must publish the statement and...

  2. 20 CFR 220.38 - When a widow(er)'s disability determination is governed by the regulations of the Social Security...

    Science.gov (United States)

    2010-04-01

    ... is governed by the regulations of the Social Security Administration. 220.38 Section 220.38 Employees... Disability Determinations Governed by the Regulations of the Social Security Administration § 220.38 When a widow(er)'s disability determination is governed by the regulations of the Social Security...

  3. CORROSION RATE OF STEELS DX51D AND S220GD IN DIFFERENT CORROSION ENVIRONMENT

    Directory of Open Access Journals (Sweden)

    Alina Crina CIUBOTARIU

    2016-06-01

    Full Text Available Corrosion in the marine environment is an important issue because the costs causes by marine corrosion increased year upon year. It is necessary a correctly approach to materials selection, protection and corrosion control to reduce this burden of wasted materials, wasted energy and wasted money. Many different types of corrosion attack can be observed to structures, ships and other equipment used in sea water service. Shipping containers are exposed to various corrosive mediums like as airborne salt, industrial pollutants, rain and saltwater. Transport damage during loading onto and unloading off trucks, train beds and ships breaches the paint coating which further contributes to corrosion. The result is shortened container life and high costs for container repair or replacement. The paper intends to evaluate, by gravimetric method, the corrosion rate and corrosion penetration rate of two types of carbon steel DX51D and S220GD. Carbon steel DX51D and hot-dip galvanized steel S220GD are used in marine and industrial applications for buildings cargo vessels, container ships and oil tankers. For testing it was used different corrosive environments: 5% NaOH solution; 5% HCL solution and 0.5M NaCl solution. The samples were immersed in 400mL of testing solution for exposure period of 28 days. Periodically at 3 days, 7 days, 14 days, 21 days and 28 days was measured de mass loss and evaluate the corrosion rate and corrosion stability coefficient. The steel DX51D was stable in 5% NaOH solution for 28 days, the values of corrosion stability coefficient was 7 after 3 days and 6 after 28 days of immersion in corrosive medium. In 5% HCL solution steels DX51D and S220GD was completely corroded in 21 days with a corrosion stability coefficient equal with 9 for 7 days and 8 for 21 days of immersion in corrosive solution. It was observed a good resistance for 3 days in 0.5M NaCl solution with a corrosion stability coefficient equal with 5, but after that

  4. α -decay chain of the short-lived isotope 220Pa established using a digital pulse processing technique

    Science.gov (United States)

    Huang, T. H.; Zhang, W. Q.; Sun, M. D.; Liu, Z.; Wang, J. G.; Liu, X. Y.; Ding, B.; Gan, Z. G.; Ma, L.; Yang, H. B.; Zhang, Z. Y.; Yu, L.; Jiang, J.; Wang, K. L.; Wang, Y. S.; Liu, M. L.; Li, Z. H.; Li, J.; Wang, X.; Lu, H. Y.; Lin, C. J.; Sun, L. J.; Ma, N. R.; Ren, Z. Z.; Zhang, F. S.; Zou, W.; Zhou, X. H.; Xu, H. S.; Xiao, G. Q.

    2017-07-01

    The decay properties of the short-lived isotope 220Pa were re-investigated via the reaction 40Ar+187Re at the gas-filled recoil separator Spectrometer for Heavy Atoms and Nuclear Structure. The digital pulse processing technique was applied to resolve the evaporation residues-α (ER -α ) pileup signals in the decay of 220Pa. The α -decay chain of 220Pa leading to the well-known 216Ac isotope was established for the first time. The α energy and half-life were measured to be Eα=9.520 (16 ) MeV and T1 /2=0.90 (13 ) μ s , respectively. The spin parity of the ground state of 220Pa was assigned to be 1-, based on the reduced α -decay width.

  5. Efficient cleavage of p220 by poliovirus 2Apro expression in mammalian cells: effects on vaccinia virus.

    Science.gov (United States)

    Aldabe, R; Feduchi, E; Novoa, I; Carrasco, L

    1995-10-24

    Poliovirus protease 2A cleaves p220, a component of initiation factor eIF-4F. Polyclonal antibodies that recognize p220 and the cleaved products from different species have been raised. Transfection of several cell lines with poliovirus 2Apro cloned in different plasmids leads to efficient cleavage of p220 upon infection with VT7, a recombinant vaccinia virus that expresses the T7 RNA polymerase. Under these conditions vaccinia virus protein synthesis is severely inhibited, while expression of poliovirus protein 2C from a similar plasmid has no effect. These results show by the first time the effects of p220 cleavage on vaccinia virus translation in the infected cells.

  6. Intracellular synthesis of Epstein-Barr virus membrane antigen gp350/220. Inhibitory effect of monensin on its expression.

    Science.gov (United States)

    Bertoni, G; Nguyen, Q V; Humphreys, R E; Sairenji, T

    1989-01-01

    We have defined the intracellular expression and localization of gp350/220, one of the Epstein-Barr virus (EBV) induced membrane antigens, on 12-O-tetradecanoyl-phorbol-13-acetate (TPA) and n-butyrate-treated P3HR-1 cells. 1B6 monoclonal antibody (mAb) immunoprecipitated gp350/220 from [35S]-methionine-labeled cells, as confirmed with other mAbs (2L10, 72A1, and C1), to the same membrane antigen. The appearance of gp350/220 was observed about 14 h after TPA and n-butyrate activation and reached a maximal level at about 48 h. 1B6 mAb membrane immunofluorescence-positive and cytoplasmic fluorescence-positive cells appeared progressively in cell populations at the same frequencies. Cytoplasmic immunofluorescent staining with 1B6 mAb demonstrated a paranuclear complex which was identical to a rhodamine-labeled wheat germ agglutinin-stained pattern which has been ascribed to the Golgi apparatus. We investigated the effect of monensin on gp350/220 expression and processing. Monensin at 10(-7) M significantly inhibited membrane antigen expression in the Golgi apparatus and on the cell surface, but had a negligible effect on synthesis of viral capsid antigen, early antigen, and viral DNA. The inhibition of gp350/220 with monensin was further characterized by the immunoprecipitation of gp350/220 with anti-MA-positive human sera and mAbs. Monensin treatment resulted in the accumulation of a 165-kD molecule which was judged to be a precursor of gp350/220. These results were consistent with the view that the Golgi apparatus plays an important role as a place of synthesis, processing, and maturation of gp350/220.

  7. Epitope mapping of gp350/220 conserved domain of epstein barr virus to develop nasopharyngeal carcinoma (npc) vaccine.

    Science.gov (United States)

    Sitompul, Loly Sabrina; Widodo, Nashi; Djati, M Sasmito; Utomo, Didik H

    2012-01-01

    Nasopharyngeal carcinoma (NPC) is a malignant tumor in the nasopharyngeal epithelial cells that caused by many factors, one of which is the viral infection of EBV (Epstein Barr Virus). The standard treatments to cure NPC still have not been encouraging. The prevention through vaccination is an effective way to stop the disease. However, EBV vaccine being able to cover all variants of virus is still not available yet. Therefore, we identified the conserved region of glycoprotein 350/220 of EBV which has immunogenic and antigenic properties. The glycoprotein 350/220 is viral surface protein responsible to bind CR2 receptor, mediated EBV to enter the host cell. The conserved domain is crucial for EBV in infecting host cells. Further, by blocking CR2 binding domain of gp350/220 using antibody will inhibit EBV's spreading, and provoke an immune system to eliminate the virus in a patient. Glycoprotein 350/220 from all variants of Epstein-Barr virus was retrieved from NCBI. The conserved domain of gp350/220 was identified by aligning the protein sequences and structures. The polymorphic structure was used as a template for docking analysis to identify the resemblance of amino acid from polymorphic variants of gp350/220 that binds CR2. The epitope mapping of gp350/220 was done by Discotope BepiPred method. The result revealed that the conserved region of gp350/220 was predicted to have an epitope, QNPVYLIPETVPYIKWDNC residue, and it does not have any similarities to the human's cell surface protein. Therefore, it can be used as a reference to develop vaccine to prevent NPC.

  8. HRR TEA CO2 laser with 220W average output power

    Directory of Open Access Journals (Sweden)

    M. Zand

    2008-03-01

    Full Text Available In this study, the design and construction of a pulse high repetition rate (HRR, transverse atmospheric pressure (TEA CO2 laser with ultra violet preionization is presented. In this laser, normal pure, industrial gases and also a combination of spark and corona preionization are used. In semi-sealed off condition, we obtained 220 watts at 300 Hz, %7.7 efficiency, 735 mJ/pulse. The best records that we reached separately were 1.1 J/pulse, 320 Hz PRR, 11 MW peak power and 10.6% efficiency .

  9. Formation and decay of the compound nucleus *220Th within the dynamical cluster-decay model

    Science.gov (United States)

    Hemdeep, Chopra, Sahila; Kaur, Arshdeep; Gupta, Raj K.

    2017-01-01

    Background: The radioactive *220Th compound nucleus (CN) is of interest since the evaporation residue (ER) cross sections are available for various entrance channels 16O+204Pb , 40Ar+180Hf , 48Ca+172Yb , and 82Se+138Ba at near barrier energies. Within the dynamical cluster-decay model (DCM), the radioactive CNs *215Fr, *242Pu, *246Bk, and *254Fm are studied where the main decay mode is fission, with very small predicted ER cross section. *220Th provides a first case with experimentally observed ER cross section instead of fission. Purpose: To look for the optimum "hot-compact" target-projectile (t-p) combinations for the synthesis of "cold"*. For best fitting of the measured ER cross sections, with quasifission (qf) content, if any, the fusion-fission (ff) component is predicted. The magic-shell structure and entrance channel mass-asymmetry effects are analyzed, and the behavior of CN formation and survival probabilities PCN and Psurv is studied. Methods: The quantum-mechanical fragmentation theory (QMFT) is used to predict the possible cold t-p combinations for synthesizing *220Th, and the QMFT-based DCM is used to analyze its decay channels for the experimentally studied entrance channels. The only parameter of the model, the neck length Δ R , varies smoothly with the excitation energy E* of CN and is used to best fit the ER data and predict qf and ff cross sections. Results: The hot-compact and "cold-elongated" fragmentation paths show dissimilar results, whose comparisons with measured fission yields result in t-p combinations, the cold reaction valleys. For the decay process, the fixed Δ R fit the measured ER cross section nicely, but not the individual decay-channel cross sections, which require the presence of qf effects, less so for asymmetric t-p combinations, and large (predicted) ff cross section. Conclusions: The calculated yields for hot-compact fragmentation path compared favorably with the observed asymmetric fission-mass distribution, resulting in

  10. Photoselective vaporization of the prostate: outcomes and adverse events of 220 consecutive patients

    Science.gov (United States)

    Robson, C.; Mueller, E. J.

    2010-02-01

    Purpose: To evaluate the short term outcomes of 220 consecutive patients who underwent the 532 nm KTP photoselective vaporization of the prostate (PVP) procedure and to evaluate and categorize the complications of the procedure. Materials and Methods: A total of 220 patients with symptomatic benign prostatic obstruction were treated with KTP photoselective vaporization of the prostate. Evaluation measures included the AUA Symptom Score (AUASS)/Quality of Life Score (QOL), peak urinary flow rate (Qmax), post void residual urine (PVR) and adverse events. Results: Symptoms were evaluated at 3 months and adverse events at 1 and 3 months. 181 patients returned for their 1 month visit and 152 returned for their 3 month visit. The American Urological Association Symptom Score (AUASS) decreased from 21.8 to 6.7. The Quality of Life Score (QOL) decreased from 3.8 to 0.7. The peak urinary flow rate (Qmax) increased from 10.7 cc/sec to 22.7 cc/sec. And the post void residual urine (PVR) decreased from 262 cc to 105 cc. Most common adverse events lasting more than 10 days were mild hematuria in 45%, dysuria in 32%, and urgency/frequency in31%. Conclusion: These results confirm that photoselective vaporization of the prostate (PVP) is a safe and effective therapy for benign prostatic obstruction. However, there is frequent, but mild, hematuria and irritative voiding symptoms during the early postoperative period.

  11. An analytical method based on multipole moment expansion to calculate the flux distribution in Gammacell-220

    Science.gov (United States)

    Rezaeian, P.; Ataenia, V.; Shafiei, S.

    2017-12-01

    In this paper, the flux of photons inside the irradiation cell of the Gammacell-220 is calculated using an analytical method based on multipole moment expansion. The flux of the photons inside the irradiation cell is introduced as the function of monopole, dipoles and quadruples in the Cartesian coordinate system. For the source distribution of the Gammacell-220, the values of the multipole moments are specified by direct integrating. To confirm the validation of the presented methods, the flux distribution inside the irradiation cell was determined utilizing MCNP simulations as well as experimental measurements. To measure the flux inside the irradiation cell, Amber dosimeters were employed. The calculated values of the flux were in agreement with the values obtained by simulations and measurements, especially in the central zones of the irradiation cell. In order to show that the present method is a good approximation to determine the flux in the irradiation cell, the values of the multipole moments were obtained by fitting the simulation and experimental data using Levenberg-Marquardt algorithm. The present method leads to reasonable results for the all source distribution even without any symmetry which makes it a powerful tool for the source load planning.

  12. Static and dynamic analysis of 1 220 mm steel last stage blade for steam turbine

    Directory of Open Access Journals (Sweden)

    Kubín Z.

    2009-06-01

    Full Text Available The 3 000 rpm 1 220 mm blade for a steam turbine was developed with application of new design features. The last stage moving blade is designed with an integral cover, a mid-span tie-boss connection and a fir-tree dovetail. With this configuration the blades are continuously coupled by the blade untwist due to the centrifugal force when the blades rotate at high speed, so that vibration control and increased structural damping are provided. Blade was tuned in order to eigen-frequencies were safely far from possible excitation. Because of connection members, the number of the resonant vibration modes can be reduced by virtue of the vibration characteristics of the circumferentially continuous blades. The last stage airfoil was optimalized from view of minimalization of its centrifugal force. In order to develop the 3 000 rpm 1 220 mm blade, the advanced analysis methods to predict dynamics behavior of the bladed structure were applied. Coupled rotor-blade analysis was also aim of the attention. To validate calculated results the verification measurement such as rotational vibration tests was carried out in the high-speed test rig. Relation of the friction damping of the bladed structure on amount of excitation level was also monitored and evaluated.

  13. Laser driven single shock compression of fluid deuterium from 45 to 220 GPa

    Energy Technology Data Exchange (ETDEWEB)

    Hicks, D; Boehly, T; Celliers, P; Eggert, J; Moon, S; Meyerhofer, D; Collins, G

    2008-03-23

    The compression {eta} of liquid deuterium between 45 and 220 GPa under laser-driven shock loading has been measured using impedance matching to an aluminum (Al) standard. An Al impedance match model derived from a best fit to absolute Hugoniot data has been used to quantify and minimize the systematic errors caused by uncertainties in the high-pressure Al equation of state. In deuterium below 100 GPa results show that {eta} {approx_equal} 4.2, in agreement with previous impedance match data from magnetically-driven flyer and convergent-explosive shock wave experiments; between 100 and 220 GPa {eta} reaches a maximum of {approx}5.0, less than the 6-fold compression observed on the earliest laser-shock experiments but greater than expected from simple extrapolations of lower pressure data. Previous laser-driven double-shock results are found to be in good agreement with these single-shock measurements over the entire range under study. Both sets of laser-shock data indicate that deuterium undergoes an abrupt increase in compression at around 110 GPa.

  14. Early B-lymphocyte precursor cells in mouse bone marrow: Subosteal localization of B220+ cells during postirradiation regeneration

    Energy Technology Data Exchange (ETDEWEB)

    Jacobsen, K.; Tepper, J.; Osmond, D.G. (McGill Univ., Montreal, Quebec (Canada))

    1990-05-01

    The localization of early B-lymphocyte precursor cells in the bone marrow of young mice has been studied during recovery from sublethal whole body gamma-irradiation (150 rad). Initial studies by double immunofluorescence labeling of the B-lineage-associated cell surface glycoprotein, B220, and of mu heavy chains in bone marrow cell suspensions, demonstrated a sequential wave of regeneration of early B precursor cells, pre-B cells, and B cells. Early B precursor cells expressing B220 but not mu chains were enriched at 1-3 days following irradiation. After in vivo administration of 125I-labeled monoclonal antibody 14.8 to detect B220+ cells in situ, light and electron microscope radioautography of femoral bone marrow sections revealed concentrations of labeled B220+ cells located peripherally near the cortical bone at 1-3 days following irradiation, increasing in numbers in more central areas by 5-7 days. Proliferative B220+ precursor cells were found within layers of bone-lining cells and in a subosteal area characterized by a prominent electron-dense extracellular matrix, often associated with stromal reticular cells. The results demonstrate that the precursor cells that are active in the bone marrow early in the recovery of B lymphopoiesis after gamma-irradiation are located both within and near the endosteum of the surrounding bone. The distinctive extracellular matrix and stromal cell associations noted in this region may contribute to a supportive local microenvironment for early hemopoietic progenitor cells.

  15. Antibodies to gp350/220 enhance the ability of Epstein-Barr virus to infect epithelial cells.

    Science.gov (United States)

    Turk, Susan M; Jiang, Ru; Chesnokova, Liudmila S; Hutt-Fletcher, Lindsey M

    2006-10-01

    Epstein-Barr virus (EBV) is a persistent, orally transmitted herpesvirus that replicates in B cells and epithelial cells and is associated with lymphoid and epithelial malignancies. The virus binds to CD21 on B cells via glycoprotein gp350/220 and infects efficiently. Infection of cultured epithelial cells has not typically been efficient but can occur in the absence of gp350/220 and CD21 and in vivo is thought to be important to the development of nasopharyngeal carcinoma. We report here that antibodies to gp350/220, which inhibit EBV infection of B cells, enhance infection of epithelial cells. The effect is not mediated by Fc receptor binding but is further enhanced by antibody cross-linking, which may patch gp350/220 in the virus envelope. Saliva from EBV-seropositive individuals has similar effects that can be reversed by depletion of antibody. The results are consistent with a model in which gp350/220 interferes with the access of other important players to the epithelial cell surface. The results may have implications for the development of nasopharyngeal carcinoma in high-risk populations in which elevated titers of antibody to EBV lytic cycle proteins are prognostic.

  16. MutS HOMOLOG1 silencing mediates ORF220 substoichiometric shifting and causes male sterility in Brassica juncea.

    Science.gov (United States)

    Zhao, Na; Xu, Xinyue; Wamboldt, Yashitola; Mackenzie, Sally A; Yang, Xiaodong; Hu, Zhongyuan; Yang, Jinghua; Zhang, Mingfang

    2016-01-01

    Cytoplasmic male sterility (CMS) has consistently been associated with the expression of mitochondrial open reading frames (ORFs) that arise from genomic rearrangements. Spontaneous fertility reversion in CMS has been observed in several cases, but a clear understanding of fertility reversion controlled by nuclear genetic influences has been lacking. Here, we identified spontaneous fertile revertant lines for Brassica juncea CMS cytoplasm in which the mitochondrial genome has undergone substoichiometric shifting (SSS) to suppress ORF220 copy number. We placed ORF220, with or without a mitochondrial targeting presequence, under the control of the CaMV35S and AP3 promoters in Arabidopsis to confirm that ORF220 causes male sterility when mitochondrially localized. We found that copy number of the ORF220 gene was altered under conditions that suppress MSH1, a nuclear gene that controls illegitimate recombination in plant mitochondria. MSH1-RNAi lines with increased ORF220 copy number were male sterile compared with wild type. We found that a wide range of genes involved in anther development were up- and down-regulated in revertant and MSH1-RNAi lines, respectively. The system that we have developed offers valuable future insight into the interplay of MSH1 and SSS in CMS induction and fertility reversion as a mediator of nuclear-mitochondrial crosstalk. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  17. Characterization of Epstein-Barr virus gp350/220 gene variants in virus isolates from gastric carcinoma and nasopharyngeal carcinoma.

    Science.gov (United States)

    Luo, Bing; Liu, Mengyang; Chao, Yan; Wang, Yun; Jing, Yongzheng; Sun, Zhifu

    2012-02-01

    To characterize the sequence variation of the gp350/220 and explore its potential association with EBV-associated tumors, the gp350/220 gene was sequenced from 41 EBV-associated gastric carcinoma (EBVaGC) and 81 nasopharyngeal carcinoma (NPC) biopsies as well as 35 throat washing (TW) samples from healthy donors. Preferential linkages between variants of the N-terminus of gp350/220 and EBNA3C variants were detected, and type A/BLLF1-a was the dominant variant in this study. The dominant variant in the C-terminal region of gp350/220 was 9P. The similar distribution of gp350/220 variants in NPC, EBVaGC and healthy donors suggest that gp350/220 variations are geographically restricted rather than tumor-specific polymorphisms.

  18. Zooming in on Extreme Environments: Using JVLA Observations and Kinematic Models of Arp 220 to Study Physical Conditions in ULIRGs

    Science.gov (United States)

    Zschaechner, Laura K.; Walter, Fabian; Ott, Juergen; Momjian, Emmanuel; Meier, David S.

    2015-01-01

    Using new Jansky VLA capabilities we observe Arp 220, the nearest ULIRG. With a high star formation rate similar to high-z galaxies, but at a close distance from the Milky Way, Arp 220 allows us to explore these extreme conditions at high resolution. With the availability of high-frequency (K, Ka, and Q band) receivers and wide bandwidths, we detect multiple line species, in particular multiple metastable ammonia inversions which are excellent tracers of kinetic temperature and density. Conditions and composition vary greatly throughout Arp 220, especially when offset from the two bright nuclei. By characterizing the temperature and density throughout the system, we can better understand the conditions associated with high star formation rates, which can then be applied to ULIRGs at high-z. Additionally, the strength and isolation of some lines allows for detailed kinematic modeling in both absorption and emission, allowing us to isolate anomalous material and characterize the dynamics of the system.

  19. rsfMRI effects of KB220Z™ on Neural Pathways in Reward Circuitry of Abstinent Genotyped Heroin Addicts

    Science.gov (United States)

    Blum, Kenneth; Liu, Yijun; Wang, Wei; Wang, Yarong; Zhang, Yi; Oscar-Berman, Marlene; Smolen, Andrew; Febo, Marcelo; Han, David; Simpatico, Thomas; Cronjé, Frans J; Demetrovics, Zsolt; Gold, Mark S.

    2016-01-01

    Recently Willuhn et al. reported that cocaine use and even non-substance related addictive behavior, increases, as dopaminergic function is reduced. Chronic cocaine exposure has been associated with decreases in D2/D3 receptors, also associated with lower activation to cues in occipital cortex and cerebellum in a recent PET study from Volkow’s group. Therefore, treatment strategies, like dopamine agonist therapy, that might conserve dopamine function may be an interesting approach to relapse prevention in psychoactive drug and behavioral addictions. To this aim, we evaluated the effect of KB220Z™ on reward circuitry of ten heroin addicts undergoing protracted abstinence, an average 16.9 months. In a randomized placebo-controlled crossover study of KB220Z™ five subjects completed a triple blinded–experiment in which the subject, the person administering the treatment and the person evaluating the response to treatment were blinded as to which treatment any particular subject was receiving. In addition, nine subjects total were genotyped utilizing the GARSRX™ test. We preliminarily report that KB220Z ™ induced an increase in BOLD activation in caudate-accumbens-dopaminergic pathways compared to placebo following one-hour acute administration. Furthermore, KB220Z™ also reduced resting state activity in the putamen of abstinent heroin addicts. In the second phase of this pilot study of all ten abstinent heroin-dependent subjects, three brain regions of interest (ROIs) we observed to be significantly activated from resting state by KB220Z compared to placebo (P addiction by direct or indirect dopaminergic interaction. Due to small sample size, we caution definitive interpretation of these preliminary results and confirmation with additional research and ongoing rodent and human studies of KB220Z, is required. PMID:25526228

  20. Attached, unattached fraction of progeny concentrations and equilibrium factor for dose assessments from {sup 222}Rn and {sup 220}Rn

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Parminder; Saini, Komal; Bajwa, Bikramjit Singh [Guru Nanak Dev University, Department of Physics, Amritsar, Punjab (India); Mishra, Rosaline; Sahoo, Bijay Kumar [Bhabha Atomic Research Centre, Radiological Physics and Advisory Division, Mumbai (India)

    2016-08-15

    In this study, measurements of indoor radon ({sup 222}Rn), thoron ({sup 220}Rn) and their equilibrium equivalent concentration (EEC) were carried out in 96 dwellings from 22 different villages situated in Hamirpur district, Himachal Pradesh, India, by using LR-115 type II-based pinhole twin cup dosimeters and deposition-based progeny sensors (DRPS/DTPS). The annual average indoor {sup 222}Rn and {sup 220}Rn concentrations observed in these dwellings were 63.82 and 89.59 Bq/m{sup 3}, respectively, while the average EEC (attached + unattached) for {sup 222}Rn and {sup 220}Rn was 29.28 and 2.74 Bq/m{sup 3}. For {sup 222}Rn (f{sub Rn}) and {sup 220}Rn (f{sub Tn}), the average values of unattached fraction were 0.11 and 0.09, respectively. The equilibrium factors for radon (F{sub Rn}) and thoron (F{sub Tn}) varied from 0.12 to 0.77 with an average of 0.50, and from 0.01 to 0.34 with an average of 0.05, respectively. The annual inhalation dose due to mouth and nasal breathing was calculated using dose conversion factors and unattached fractions. The indoor annual effective doses for {sup 222}Rn (AEDR) and {sup 220}Rn (AEDT) were found to be 1.92 and 0.83 mSv a{sup -1}, respectively. The values of {sup 222}Rn/{sup 220}Rn concentrations and annual effective doses obtained in the present study are within the safe limits as recommended by the International Commission on Radiological Protection for indoor dwelling exposure conditions. (orig.)

  1. Thermo-mechanical description of a nuclear pin, BACO code version 2.20

    Energy Technology Data Exchange (ETDEWEB)

    Marino, A.C. [Comision Nacional de Energia Atomica, San Carlos de Bariloche (Argentina). Gerencia de Area Ciclo de Combustible; Savino, E.; Harriague, S. [Comision Nacional de Energia Atomica, Buenos Aires (Argentina). Gerencia de Area Investigacion y Desarrollo

    1995-12-31

    BACO code, version 2.20 and some applications are presented. BACO (BArra COmbustible) is a code for the simulation of the thermo-mechanical and fission gas behavior of a cylindrical fuel rod under operation. The new version was developed in connection with the CRP FUMEX of the IAEA (Coordinated Research Project on Fuel Modelling at Extended Burnup). The project originated a conceptual revision of the original code. The revision includes convergence criteria, mathematical treatments and fuel behavior modelling. The code use domain is in PHWR fuel but it may be extended to other applications. The BACO code has a good performance in the range of low-intermediate burnup. We include the study of pore migration and restructuring, relocation of pellet fragments and gap heat conductance, fuel MOX rod analysis, and an example of FUMEX case. (author). 19 refs., 9 figs., 1 tab.

  2. The effectiveness of heat pumps as part of CCGT-190/220 Tyumen CHP-1

    Directory of Open Access Journals (Sweden)

    Tretyakova Polina

    2017-01-01

    Full Text Available The article considers the possibility of increasing the energy efficiency of CCGT-190/220 Tyumen CHP-1 due to the utilization of low-grade heat given off in the condenser unit of the steam turbine. To assess the effectiveness of the proposed system, the indexes of thermal efficiency are given. As a result of a research the following conclusions are received: The heat-transfer agent heat pump, when heated uses low-grade heat TPP and increases heat output, but consumes the electricity. Using a heat pump is effective for a small temperature difference between the condenser and the evaporator. Good example is heating water before chemical treatment. This method is more efficient than using a replacement boiler and it is used in steam selection.

  3. Identification and isolation of the main component (gp350-gp220) of Epstein-Barr virus responsible for generating neutralizing antibodies in vivo.

    OpenAIRE

    Thorley-Lawson, D A; Poodry, C A

    1982-01-01

    The majority of hybridomas we have characterized against Epstein-Barr virions react with the major glycoproteins gp350 and gp220 (gp350/220). One of these antibodies, ID4C-1, neutralizes virus infection in vitro. The presence of gp350/220 on the viral envelope could be confirmed directly by immunoelectron microscopy. We used lectin affinity (ricin) and immunoaffinity (ID4C-1) to purify gp350/220 and show that this material is able to induce potent virus-neutralizing antibodies. Absorption of ...

  4. Antibodies to gp350/220 Enhance the Ability of Epstein-Barr Virus To Infect Epithelial Cells

    OpenAIRE

    Turk, Susan M.; Jiang, Ru; Chesnokova, Liudmila S.; Hutt-Fletcher, Lindsey M.

    2006-01-01

    Epstein-Barr virus (EBV) is a persistent, orally transmitted herpesvirus that replicates in B cells and epithelial cells and is associated with lymphoid and epithelial malignancies. The virus binds to CD21 on B cells via glycoprotein gp350/220 and infects efficiently. Infection of cultured epithelial cells has not typically been efficient but can occur in the absence of gp350/220 and CD21 and in vivo is thought to be important to the development of nasopharyngeal carcinoma. We report here tha...

  5. Molecular profile of a human monoclonal antibody Fab fragment specific for Epstein-Barr virus gp350/220 antigen.

    Science.gov (United States)

    Bugli, F; Bastidas, R; Burton, D R; Williamson, R A; Clementi, M; Burioni, R

    2001-04-01

    Experimental evidence indicates Epstein Barr virus (EBV) envelope glycoprotein gp350/220 elicits a potent virus neutralizing response in the infected human host that may play an important role in restricting viral pathogenesis. In this study, we report the molecular cloning in combinatorial phage display vectors, of the IgG1 repertoire of an individual naturally infected with EBV, and describe the recovery and characterization of a monoclonal antibody recognizing gp350/220. A detailed understanding of the human antibody response in EBV infection will identify antibodies of potential use in anti-viral prophylaxis and will advance the production of more effective vaccine candidates.

  6. 33 CFR 162.220 - Hoover Dam, Lake Mead, and Lake Mohave (Colorado River), Ariz.-Nev.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Hoover Dam, Lake Mead, and Lake... REGULATIONS § 162.220 Hoover Dam, Lake Mead, and Lake Mohave (Colorado River), Ariz.-Nev. (a) Lake Mead and... the axis of Hoover Dam and that portion of Lake Mohave (Colorado River) extending 4,500 feet...

  7. Identification of three gp350/220 regions involved in Epstein-Barr virus invasion of host cells.

    Science.gov (United States)

    Urquiza, Mauricio; Lopez, Ramses; Patiño, Helena; Rosas, Jaiver E; Patarroyo, Manuel E

    2005-10-21

    Epstein-Barr virus (EBV) invasion of B-lymphocytes involves EBV gp350/220 binding to B-lymphocyte CR2. The anti-gp350 monoclonal antibody (mAb)-72A1 Fab inhibits this binding and therefore blocks EBV invasion of target cells. However, gp350/220 regions interacting with mAb 72A1 and involved in EBV invasion of target cells have not yet been identified. This work reports three gp350/220 regions, defined by peptide 11382, 11389, and 11416 sequences, that are involved in EBV binding to B-lymphocytes. Peptides 11382, 11389, and 11416 bound to CR2(+) but not to CR2(-) cells, inhibited EBV invasion of cord blood lymphocytes (CBLs), were recognized by mAb 72A1, and inhibited mAb 72A1 binding to EBV. Peptides 11382 and 11416 binding to peripheral blood lymphocytes (PBLs) induced interleukin-6 protein synthesis in these cells, this phenomenon being inhibited by mAb 72A1. The same behavior has been reported for gp350/220 binding to PBLs. Anti-peptide 11382, 11389, and 11416 antibodies inhibited EBV binding and EBV invasion of PBLs and CBLs. Peptide 11382, 11389, and 11416 sequences presented homology with the C3dg regions coming into contact with CR2 (C3dg and gp350 bound to similar CR2 regions). These peptides could be used in designing strategies against EBV infection.

  8. 12 CFR 220.119 - Applicability of margin requirements to credit extended to corporation in connection with...

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Applicability of margin requirements to credit... DEALERS (REGULATION T) Interpretations § 220.119 Applicability of margin requirements to credit extended... underlying objectives of the margin regulations are considered, it appears that they do not encompass a...

  9. Evaluation of the ID220 single photon avalanche diode for extended spectral range of photon time-of-flight spectroscopy

    DEFF Research Database (Denmark)

    Nielsen, Otto Højager Attermann; Dahl, Anders Bjorholm; Anderson-Engels, Stefan

    This paper describe the performance of the ID220 single photon avalanche diode for single photon counting, and investigates its performance for photon time-of-flight (PToF) spectroscopy. At first this report will serve as a summary to the group for PToF spectroscopy at the Department of Physics...

  10. 25 CFR 171.220 - What must I do to my farm unit to receive irrigation service?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false What must I do to my farm unit to receive irrigation... WATER IRRIGATION OPERATION AND MAINTENANCE Irrigation Service § 171.220 What must I do to my farm unit to receive irrigation service? You must meet the following requirements for us to provide service: (a...

  11. 12 CFR 250.220 - Whether member bank acting as trustee is prohibited by section 20 of the Banking Act of 1933 from...

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Whether member bank acting as trustee is prohibited by section 20 of the Banking Act of 1933 from acquiring majority of shares of mutual fund. 250.220 Section 250.220 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL...

  12. 29 CFR 1472.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-07-01

    ... establish my drug-free awareness program? 1472.220 Section 1472.220 Labor Regulations Relating to Labor... my drug-free workplace statement and establish my drug-free awareness program? If you are a new recipient that does not already have a policy statement as described in § 1472.205 and an ongoing awareness...

  13. 22 CFR 312.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-04-01

    ... statement and establish my drug-free awareness program? 312.220 Section 312.220 Foreign Relations PEACE... establish my drug-free awareness program? If you are a new recipient that does not already have a policy statement as described in § 312.205 and an ongoing awareness program as described in § 312.215, you must...

  14. 49 CFR 32.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-10-01

    ... statement and establish my drug-free awareness program? 32.220 Section 32.220 Transportation Office of the... statement and establish my drug-free awareness program? If you are a new recipient that does not already have a policy statement as described in § 32.205 and an ongoing awareness program as described in § 32...

  15. 13 CFR 147.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-01-01

    ...-free workplace statement and establish my drug-free awareness program? 147.220 Section 147.220 Business... workplace statement and establish my drug-free awareness program? If you are a new recipient that does not already have a policy statement as described in § 147.205 and an ongoing awareness program as described in...

  16. 43 CFR 43.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-10-01

    ... workplace statement and establish my drug-free awareness program? 43.220 Section 43.220 Public Lands... drug-free workplace statement and establish my drug-free awareness program? If you are a new recipient that does not already have a policy statement as described in § 43.205 and an ongoing awareness program...

  17. 22 CFR 1008.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-04-01

    ... statement and establish my drug-free awareness program? 1008.220 Section 1008.220 Foreign Relations INTER... statement and establish my drug-free awareness program? If you are a new recipient that does not already have a policy statement as described in § 1008.205 and an ongoing awareness program as described in...

  18. 45 CFR 1155.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-10-01

    ... statement and establish my drug-free awareness program? 1155.220 Section 1155.220 Public Welfare Regulations... statement and establish my drug-free awareness program? If you are a new recipient that does not already have a policy statement as described in § 1155.205 and an ongoing awareness program as described in...

  19. 45 CFR 630.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-10-01

    ... statement and establish my drug-free awareness program? 630.220 Section 630.220 Public Welfare Regulations... when must I publish my drug-free workplace statement and establish my drug-free awareness program? If... ongoing awareness program as described in § 630.215, you must publish the statement and establish the...

  20. 29 CFR 94.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-07-01

    ... establish my drug-free awareness program? 94.220 Section 94.220 Labor Office of the Secretary of Labor... awareness program? If you are a new recipient that does not already have a policy statement as described in § 94.205 and an ongoing awareness program as described in § 94.215, you must publish the statement and...

  1. 31 CFR 20.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-07-01

    ... workplace statement and establish my drug-free awareness program? 20.220 Section 20.220 Money and Finance... drug-free workplace statement and establish my drug-free awareness program? If you are a new recipient that does not already have a policy statement as described in § 20.205 and an ongoing awareness program...

  2. 21 CFR 1405.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-04-01

    ... statement and establish my drug-free awareness program? 1405.220 Section 1405.220 Food and Drugs OFFICE OF... statement and establish my drug-free awareness program? If you are a new recipient that does not already have a policy statement as described in § 1405.205 and an ongoing awareness program as described in...

  3. 28 CFR 83.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-07-01

    ... workplace statement and establish my drug-free awareness program? 83.220 Section 83.220 Judicial... statement and establish my drug-free awareness program? If you are a new recipient that does not already have a policy statement as described in § 83.205 and an ongoing awareness program as described in § 83...

  4. 14 CFR 1267.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-01-01

    ... workplace statement and establish my drug-free awareness program? 1267.220 Section 1267.220 Aeronautics and... my drug-free workplace statement and establish my drug-free awareness program? If you are a new recipient that does not already have a policy statement as described in § 1267.205 and an ongoing awareness...

  5. 34 CFR 84.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-07-01

    ... and establish my drug-free awareness program? 84.220 Section 84.220 Education Office of the Secretary... statement and establish my drug-free awareness program? If you are a new recipient that does not already have a policy statement as described in § 84.205 and an ongoing awareness program as described in § 84...

  6. 2 CFR 182.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-01-01

    ... workplace statement and establish my drug-free awareness program? 182.220 Section 182.220 Grants and... awareness program? If you are a new recipient that does not already have a policy statement as described in § 182.205 and an ongoing awareness program as described in § 182.215, you must publish the statement and...

  7. 10 CFR 607.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-01-01

    ... and establish my drug-free awareness program? 607.220 Section 607.220 Energy DEPARTMENT OF ENERGY... statement and establish my drug-free awareness program? If you are a new recipient that does not already have a policy statement as described in § 607.205 and an ongoing awareness program as described in...

  8. 45 CFR 1173.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-10-01

    ... statement and establish my drug-free awareness program? 1173.220 Section 1173.220 Public Welfare Regulations... statement and establish my drug-free awareness program? If you are a new recipient that does not already have a policy statement as described in § 1173.205 and an ongoing awareness program as described in...

  9. 20 CFR 439.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-04-01

    ... statement and establish my drug-free awareness program? 439.220 Section 439.220 Employees' Benefits SOCIAL... statement and establish my drug-free awareness program? If you are a new recipient that does not already have a policy statement as described in § 439.205 and an ongoing awareness program as described in...

  10. 15 CFR 29.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-01-01

    ... workplace statement and establish my drug-free awareness program? 29.220 Section 29.220 Commerce and Foreign... workplace statement and establish my drug-free awareness program? If you are a new recipient that does not already have a policy statement as described in § 29.205 and an ongoing awareness program as described in...

  11. 24 CFR 21.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-04-01

    ... workplace statement and establish my drug-free awareness program? 21.220 Section 21.220 Housing and Urban... must I publish my drug-free workplace statement and establish my drug-free awareness program? If you... ongoing awareness program as described in § 21.215, you must publish the statement and establish the...

  12. 7 CFR 3021.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-01-01

    ... statement and establish my drug-free awareness program? 3021.220 Section 3021.220 Agriculture Regulations of... establish my drug-free awareness program? If you are a new recipient that does not already have a policy statement as described in § 3021.205 and an ongoing awareness program as described in § 3021.215, you must...

  13. 22 CFR 1509.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-04-01

    ... statement and establish my drug-free awareness program? 1509.220 Section 1509.220 Foreign Relations AFRICAN... statement and establish my drug-free awareness program? If you are a new recipient that does not already have a policy statement as described in § 1509.205 and an ongoing awareness program as described in...

  14. 36 CFR 1212.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-07-01

    ... drug-free workplace statement and establish my drug-free awareness program? 1212.220 Section 1212.220... awareness program? If you are a new recipient that does not already have a policy statement as described in § 1212.205 and an ongoing awareness program as described in § 1212.215, you must publish the statement...

  15. 22 CFR 133.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-04-01

    ... statement and establish my drug-free awareness program? 133.220 Section 133.220 Foreign Relations DEPARTMENT... statement and establish my drug-free awareness program? If you are a new recipient that does not already have a policy statement as described in § 133.205 and an ongoing awareness program as described in...

  16. 22 CFR 210.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-04-01

    ... statement and establish my drug-free awareness program? 210.220 Section 210.220 Foreign Relations AGENCY FOR... statement and establish my drug-free awareness program? If you are a new recipient that does not already have a policy statement as described in § 210.205 and an ongoing awareness program as described in...

  17. Gestational Diabetes Mellitus: Maternal and Perinatal Outcomes in 220 Saudi Women 

    Directory of Open Access Journals (Sweden)

    Turki Gasim

    2012-03-01

    Full Text Available  Objectives: To assess the maternal and fetal complications of pregnancy in mothers with gestational diabetes mellitus (GDM compared with non-diabetic patients who delivered in the hospital during the study period.Methods: The outcome of pregnancy in 220 Saudi patients with GDM identified from the delivery register/hospital database and matched for age, parity and body mass index with 220 non-diabetic controls were studied retrospectively from their case files. Patients with multiple pregnancies and abnormal presentation of the fetus were excluded from the study.Results: The GDM patients were treated with either diet alone or with additional insulin in some patients who required better control of their blood sugar levels. Patients with GDM had a significantly higher incidence of pre-eclampsia (p<0.0001; preterm delivery (p=0.0226; induction of labor (p<0.0001; cesarean section (p=0.0019; higher mean birth weight (p<0.0001 of babies; large for gestational age infants (p=0.0011; macrosomia (p=0.0186; and admission to the neonatal intensive care unit (p=0.0003, compared with the control group. However, the rates of Apgarscore <7 at 5 minutes, respiratory distress syndrome, neonatal hypoglycemia, hyperbilirubinemia and the need for phototherapy were similar in both groups of patients. Congenital anomalies and perinatal mortality rates were not significantly different in the two groups.Conclusion: GDM is recognized to be associated with increased rates of adverse maternal and neonatal outcomes, which are supported by the findings of this study. Even the mild form of GDM seems to have significant consequences for women and their offspring and is recommended to be aggressively treated. Evidence suggests that early diagnosis and strict control of blood sugar levels throughout the pregnancy can significantly reduce maternal and fetal complications. A multicenter, randomized controlled trial, based on universally accepted criteria for GDM screening test

  18. Adsorption isotherms for hydrogen chloride (HCl) on ice surfaces between 190 and 220 K.

    Science.gov (United States)

    Zimmermann, S; Kippenberger, M; Schuster, G; Crowley, J N

    2016-05-18

    The interaction of hydrogen chloride (HCl) with ice surfaces at temperatures between 190 and 220 K was investigated using a coated-wall flow-tube connected to a chemical ionization mass spectrometer. Equilibrium surface coverages of HCl were determined at gas phase concentrations as low as 2 × 10(9) molecules cm(-3) (∼4 × 10(-8) Torr at 200 K) to derive Langmuir adsorption isotherms. The data are described by a temperature independent partition coefficient: KLang = (3.7 ± 0.2) × 10(-11) cm(3) molecule(-1) with a saturation surface coverage Nmax = (2.0 ± 0.2) × 10(14) molecules cm(-2). The lack of a systematic dependence of KLang on temperature contrasts the behaviour of numerous trace gases which adsorb onto ice via hydrogen bonding and is most likely related to the ionization of HCl at the surface. The results are compared to previous laboratory studies, and the equilibrium partitioning of HCl to ice surfaces under conditions relevant to the atmosphere is evaluated.

  19. Theoretical models for designing a 220-GHz folded waveguide backward wave oscillator

    Science.gov (United States)

    Cai, Jin-Chi; Hu, Lin-Lin; Ma, Guo-Wu; Chen, Hong-Bin; Jin, Xiao; Chen, Huai-Bi

    2015-06-01

    In this paper, the basic equations of beam-wave interaction for designing the 220 GHz folded waveguide (FW) backward wave oscillator (BWO) are described. On the whole, these equations are mainly classified into small signal model (SSM), large signal model (LSM), and simplified small signal model (SSSM). Using these linear and nonlinear one-dimensional (1D) models, the oscillation characteristics of the FW BWO of a given configuration of slow wave structure (SWS) can be calculated by numerical iteration algorithm, which is more time efficient than three-dimensional (3D) particle-in-cell (PIC) simulation. The SSSM expressed by analytical formulas is innovatively derived for determining the initial values of the FW SWS conveniently. The dispersion characteristics of the FW are obtained by equivalent circuit analysis. The space charge effect, the end reflection effect, the lossy wall effect, and the relativistic effect are all considered in our models to offer more accurate results. The design process of the FW BWO tube with output power of watt scale in a frequency range between 215 GHz and 225 GHz based on these 1D models is demonstrated. The 3D PIC method is adopted to verify the theoretical design results, which shows that they are in good agreement with each other. Project supported by the Innovative Research Foundation of China Academy of Engineering Physics (Grant No. 426050502-2).

  20. [Qianlieping capsule plus alpha-blocker for chronic non-bacterial prostatitis: analysis of 220 cases].

    Science.gov (United States)

    Li, Jian-Ping; Chong, Tie; Chen, Hai-Wen; Li, He-Cheng; Cao, Jun; Zhang, Peng; Li, Hong-Liang

    2012-09-01

    To investigate the clinical effects of Qianlieping Capsule combined with alpha-receptor blocker tamsulosin on chronic non-bacterial prostatitis (CNBP). We assigned 220 CNBP patients to three groups to receive oral Qianlieping Capsule (2.0 g tid) plus alpha-receptor blocker tamsulosin (0.2 mg qd) (n = 98), Qianlieping Capsule alone at 2.0 g tid (n = 66), and tamsulosin alone at 0.2 mg qd (n = 56) , respectively. After 6 weeks of medication, we assessed the therapeutic effects according to the NIH-CPSI scores and the number of small particles of lecithin (SPL) in the prostatic fluid after treatment. Qianlieping Capsule alone increased the number of SPL by 46.9% and reduced the NIH-CPSI score by 24.4%. Combination of Qianlieping and tamsulosin more significantly increased the number of SPL (61.4%) and decreased the NIH-CPSI score (42.3%) than tamsulosin alone (33.7% and 28.6%) (P Capsule chronic is effective for chronic non-bacterial prostatitis, and the combination of Qianlieping Capsule with tamsulosin produces even better effect than tamsulosin alone.

  1. PdBI U/LIRG Survey (PULS): Dense Molecular Gas in Arp 220 and NGC 6240

    OpenAIRE

    Sliwa, Kazimierz; Downes, Dennis

    2017-01-01

    Aims. We present new IRAM Plateau de Bure Interferometer observations of Arp 220 in HCN, HCO$^{+}$, HN$^{13}$C J=1-0, C$_{2}$H N=1-0, SiO J = 2-1, HNCO J$_{k,k'}$ = 5$_{0,4}$ - 4$_{0,4}$, CH$_{3}$CN(6-5), CS J=2-1 and 5-4 and $^{13}$CO J=1-0 and 2-1 and of NGC 6240 in HCN, HCO$^{+}$ J = 1-0 and C$_{2}$H N = 1-0. In addition, we present Atacama Large Millimeter/submillmeter Array science verification observations of Arp 220 in CS J = 4-3 and CH$_{3}$CN(10-9). Various lines are used to analyse ...

  2. Excitation Potentials and Shell Corrections for the Elements Z2=20 to Z2=30

    DEFF Research Database (Denmark)

    Andersen, H.H.; Sørensen, H.; Vadja, P.

    1969-01-01

    Excitation potentials and shell corrections for the elements Z 2=20 to Z2=30 are evaluated from experimental stopping-power data for 5-12-MeV protons and deuterons. Use is made of Walske's K- and L-shell corrections and shell corrections calculated by Bonderup (1967) on the basis of the Thomas-Fe...... are found by means of Bonderup's shell corrections. Within the Z2 interval treated here, it is found that I/Z2 increases with increasing Z2, contrary to the general trend through the periodic system of elements......Excitation potentials and shell corrections for the elements Z 2=20 to Z2=30 are evaluated from experimental stopping-power data for 5-12-MeV protons and deuterons. Use is made of Walske's K- and L-shell corrections and shell corrections calculated by Bonderup (1967) on the basis of the Thomas...

  3. Do nuclei go pear-shaped? Coulomb excitation of 220Rn and 224Ra at REX-ISOLDE (CERN

    Directory of Open Access Journals (Sweden)

    Scheck M.

    2015-01-01

    Full Text Available The IS475 collaboration conducted Coulomb-excitation experiments with post-accelerated radioactive 220Rn and 224Ra beams at the REX-ISOLDE facility. The beam particles (Ebeam: 2.83 MeV/u were Coulomb excited using 60Ni, 114Cd, and 120Sn scattering targets. De-excitation γ-rays were detected employing the Miniball array and scattered particles were detected in a silicon detector. Exploiting the Coulomb-excitation code GOSIA for each nucleus several matrix elements could be obtained from the measured γ-ray yields. The extracted ‹3−||E3||0+› matrix element allows for the conclusion that, while 220Rn represents an octupole vibrational system, 224Ra has already substantial octupole correlations in its ground state. This finding has implications for the search of CP-violating Schiff moments in the atomic systems of the adjacent odd-mass nuclei.

  4. Rapid communication: first clinical experience with Doli S 220F-XP extracorporeal lithotripter for urinary lithiasis.

    Science.gov (United States)

    Heretis, John; Daskalopoulos, George; Delibaltidis, Odisseas; Kalivianakis, Dimitrios; Papadimitriou, Vaios; Sofras, Frank

    2006-07-01

    To assess the initial results of the Dornier Doli S 220F-XP extracorporeal lithotripter for the management of solitary urinary calculi. We prospectively examined the outcome of shockwave lithotripsy (SWL) in the first 140 patients with solitary renal and ureteral lithiasis treated by one urologist with the new power Doli S lithotripter. Ninety-one patients (group A) had renal stones, and 49 patients (group B) had ureteral stones. Data were collected with respect to stone size, location, and fragmentation. In group A, clinical success was documented in 77 patients (84%) at 1 month after lithotripsy. Three months after lithotripsy, 69 patients (75.2%) were stone free and 8 (8.8%) had fragments pain during lithotripsy. The majority (91%) mentioned that they were satisfied with this treatment modality for urinary lithiasis (mean visual analog scale satisfaction score 8). The Doli S 220 F-XP is a safe and effective device for managing calculi throughout the urinary tract.

  5. Resolved Structure of the Arp 220 Nuclei at λ ≈ 3 mm

    Science.gov (United States)

    Sakamoto, Kazushi; Aalto, Susanne; Barcos-Muñoz, Loreto; Costagliola, Francesco; Evans, Aaron S.; Harada, Nanase; Martín, Sergio; Wiedner, Martina; Wilner, David

    2017-11-01

    We analyze the 3 mm emission of the ultraluminous infrared galaxy Arp 220 for the spatially resolved structure and the spectral properties of the merger nuclei. ALMA archival data at ˜0.″05 resolution are used for extensive visibility fitting and deep imaging of the continuum emission. The data are fitted well by two concentric components for each nucleus, such as two Gaussians or one Gaussian plus one exponential disk. The larger components in the individual nuclei are similar in shape and extent, ˜100-150 pc, to the centimeter wave emission due to supernovae. They are therefore identified with the known starburst nuclear disks. The smaller components in both nuclei have about a few 10 pc sizes and peak brightness temperatures ({T}{{b}}) more than twice higher than those in previous single-Gaussian fitting. They correspond to the dust emission that we find centrally concentrated in both nuclei by subtracting the plasma emission measured at 33 GHz. The dust emission in the western nucleus is found to have a peak {T}{{b}}≈ 530 K and an FWHM of about 20 pc. This component is estimated to have a bolometric luminosity on the order of {10}12.5 {L}⊙ and a 20 pc scale luminosity surface density {10}15.5 {{L}}⊙ {{{k}}{{p}}{{c}}}-2. A luminous active galactic nucleus is a plausible energy source for these high values while other explanations remain to be explored. Our continuum image also reveals a third structural component of the western nucleus—a pair of faint spurs perpendicular to the disk major axis. We attribute it to a bipolar outflow from the highly inclined (I≈ 60^\\circ ) western nuclear disk.

  6. A Tripler to 220 GHz Using a Back-to-Back Barrier-N-N+ Varactor Diode

    Science.gov (United States)

    Choudhury, D.; Siegel, P.; Raisanen, A.; Martin, S.; Smith, R.

    1994-01-01

    The back-to-back barrier-N-N+ (bbBNN) varactor is a nonlinear device being developed for frequency multiplier applications above 100 GHz. Its symmetrical C-V characteristic, low series resistance and suitability to planarization make it ideal choice for high frequency, low power, odd harmonic generation. In this paper, the performance of a 220 GHz tripler using integrated planar bbBNN devices is presented.

  7. Indolediketopiperazine Alkaloids from Eurotium cristatum EN-220, an Endophytic Fungus Isolated from the Marine Alga Sargassum thunbergii

    OpenAIRE

    Du, Feng-Yu; Li, Xin; Li, Xiao-Ming; Zhu, Li-Wei; Wang, Bin-Gui

    2017-01-01

    Four new indolediketopiperazine derivatives (1–4), along with nine known congeners (5–13), were isolated and identified from the culture extract of Eurotium cristatum EN-220, an endophytic fungus obtained from the marine alga Sargassum thunbergii. The structures of thesecompounds were elucidated on the basis of extensive spectroscopic analysis and the absolute configurations of compounds 1–4 were established by NOESY experiments and by chiral HPLC analyses of their acid hydrolysates. The abso...

  8. [The jokes are vectors of stereotypes. Example of the medical profession from 220 jokes].

    Science.gov (United States)

    Maurin, Damien; Pacault, Clément; Galès, Brieuc

    2014-12-01

    Sociological studies have shown the link between humor and unconscious ideas that we have of the society in which we evolve. We conducted a survey to answer the question: "What were the stereotypes of our medical profession that emerge from a transcript of jokes collected in a medical population?" Recruitment of the source population (doctors and medical students) was done through different personal and professional mailing lists, Twitter, Facebook, medical press. The inclusion period was six weeks (from June 6 to July 14, 2013). Each physician recruited received the link to our blog: http://humourmedical.overblog.com which contained a link to the questionnaire. Physicians responded to the following proposition: "tell the joke involving doctors you laugh the most". Analysis of jokes was made by three investigators. Firstly, two investigators (DM and CP) and pooled of results to generate a stereotype for each joke. Then a triangulation was made with a third investigator (BG), to determine the final stereotype. Five hundred and twelve jokes have been collected on the site and 448 were included in the analysis, representing 220 jokes. The gender of respondents was 284 men (63%) and 164 women (37%), a ratio of 1.7. One hundred and fifty-six different stereotypes were classified into six themes: 46 stereotypes 'the vicissitudes of the medical profession'; 45 'hospital', the war of the block; 34 'personality traits doctor'; 14 'psychiatrist'; 12 'physician and sexuality'; 5 'medical studies and carabin woes'. Anesthetists were represented as lazy, inveterate coffee drinkers and less awakened than their sleeping patients. Surgeons were seen as megalomaniacal, tyrannical with other professions, operating without thinking, as their brain down to a neuron. Medical students appeared docile and absurd. Psychiatrists were as crazy as their patients, sometimes passing them to the consultation and looking only at their past relationship. Other stereotypes of doctors were used

  9. En Bloc Resections in the Spine: The Experience of 220 Patients During 25 Years.

    Science.gov (United States)

    Boriani, Stefano; Gasbarrini, Alessandro; Bandiera, Stefano; Ghermandi, Riccardo; Lador, Ran

    2017-02-01

    En bloc resections aim at surgically removing a tumor in a single, intact piece. Approach must be planned for the complete removal of the tumor without violation of its margins. The shared knowledge of the morbidity, mortality, risk assessment for local disease recurrence, complications, and death, related to spine tumors excised en bloc could improve the treating physician's apprehension of the diseases and decision making process before, during, and after surgical treatment. The purpose of this study was to review and report the experience gained during 25 years in one of the world's biggest spine oncologic centers. A retrospective study of prospective collected data of 1681 patients affected by spine tumors, of whom 220 had en bloc resections performed. Most tumors were primary-165 cases (43 benign and 122 malignant); metastases occurred in 55 patients. A total of 60 patients died from the disease and 33 local recurrences were recorded. A total of 153 complications were observed in 100 of 216 patients (46.2%); 64 of these patients (30%) suffered 1 complication, whereas the rest had 2 or more. All complications were categorized according to temporal distribution and severity. These were further divided into 7 groups according to the type of complication. There were 105 major and 48 minor complications. Seven patients (4.6%) died as a result of complications. There were 33 local recurrences (15.28%) recorded. Contaminated cases, surgical margins of the resected tumor-intralesional, marginal, and malignant tumors-were statistically significant independent risk factors for local recurrence of the tumor. Contamination, local recurrence, neoadjuvant radiotherapy, number of levels resected, and metastatic tumors compared with primary malignant tumor were shown to be independent risk factors for a patient's death. Treatment of spinal aggressive benign and malignant bone tumors with en bloc resection is beneficial in terms of better local control and prognosis

  10. Election Districts and Precincts, PrecinctPoly-The data set is a polygon feature consisting of 220 segments representing voter precinct boundaries., Published in 1991, Davis County Government.

    Data.gov (United States)

    NSGIC Local Govt | GIS Inventory — Election Districts and Precincts dataset current as of 1991. PrecinctPoly-The data set is a polygon feature consisting of 220 segments representing voter precinct...

  11. Book review: Ham radio's technical culture. By K. Haring. Cambridge, MA: The MIT Press. 2007. xvii + 220 pp. #18.95. cloth. ISBN: 0262083558

    OpenAIRE

    Geoghegan, Hilary

    2008-01-01

    Book review: Ham radio's technical culture. By K. Haring. Cambridge, MA: The MIT Press. 2007. xvii + 220 pp. #18.95. cloth. ISBN: 0262083558 Department of Geography Royal Holloway, University of London - (Geoghegan, Hilary)

  12. 75 FR 32773 - Auction of 218-219 MHz Service and Phase II 220 MHz Service Licenses Scheduled for December 7...

    Science.gov (United States)

    2010-06-09

    ... licenses covering a total of 727 Cellular Market Areas (CMAs). ii. Phase II 220 MHz Service Licenses 4... three percent will be more effective in deterring defaults. Given the history of these services and the...

  13. Seasonal Variation of Unattached fraction and Equilibrium factor of 222Rn and 220Rn using DRPS/DTPS and Pin -hole cup dosimeters.

    Science.gov (United States)

    Bangotra, P.; Mehra, R.; Jakhu, R.

    2015-12-01

    222Rn (Radon), 220Rn (Thoron) and their progenies are naturally occurring radionuclides in environment and responsible for the radiological dose to population. The 222Rn, 220Rn concentration and their separate attached and unattached progeny concentration (season-wise) in units of EEC have been measured in the dwellings of Muktsar and Mansa districts of Punjab (India), using Pin- hole cup dosimeters and deposition based progeny sensors (DTPS/DRPS). The indoor 222Rn concentration was maximum in the rainy season (60 Bqm-3) while 220Rn concentration was maximum in winter season (57 Bqm-3). However EEC of 222Rn and 220Rn has distinct seasonal demeanour than their parent nuclides. The unattached EEC for both 222Rn and 220Rn (EERCU and EETCU) were higher in summer and rainy season as compared to winter season. The equilibrium factor ( for 222Rn and for 220Rn) and unattached fraction ( for 222Rn and for 220Rn) has been calculated separately. The (0.44 ± 0.04) in the studied area was similar to 0.4 that proposed by UNSCEAR and for (0.05 ± 0.01) it was greater than specified value 0.02 by UNSCEAR. The was higher in summer season as compared to rainy and winter season. Due to very smaller value of , a proper relation has not been observed seasonally. The unattached fraction in environment may increase the risk of radiological exposure and absorbed at faster rate into blood then the attached 222Rn and 220Rn progeny. The overall arithmetic mean (rainy, winter and summer seasons) of and were 0.09 ± 0.02 and 0.10 ± 0.03 respectively. The and were lower in winter season as compared to rainy and summer seasons due to higher value of attached EEC present in winter season. A positive and significant correlation (0.56) has been observed between the and aerosol concentration (Z (cm-3)).

  14. A chimeric EBV gp350/220-based VLP replicates the virion B-cell attachment mechanism and elicits long-lasting neutralizing antibodies in mice

    OpenAIRE

    Ogembo, Javier Gordon; Muraswki, Matthew R; McGinnes, Lori W.; Parcharidou, Agapi; Sutiwisesak, Rujapak; Tison, Timelia; Avendano, Juan; Agnani, Deep; Finberg, Robert W.; Morrison, Trudy G.; Fingeroth, Joyce D.

    2015-01-01

    Epstein-Barr virus (EBV), an oncogenic gammaherpesvirus, causes acute infectious mononucleosis (AIM) and is linked to the development of several human malignancies. There is an urgent need for a vaccine that is safe, prevents infection and/or limits disease. Unique among human herpesviruses, glycoprotein (gp)350/220, which initiates EBV attachment to susceptible host cells, is the major ligand on the EBV envelope and is highly conserved. Interaction between gp350/220 and complement receptor t...

  15. CDK inhibitors selectively diminish cell cycle controlled activation of the histone H4 gene promoter by p220NPAT and HiNF-P

    Science.gov (United States)

    Mitra, Partha; Ghule, Prachi N.; van der Deen, Margaretha; Medina, Ricardo; Xie, Rong-lin; Holmes, William F.; Ye, Xin; Nakayama, Keiichi I.; Harper, J. Wade; Stein, Janet L.; Stein, Gary S.; van Wijnen, Andre J.

    2010-01-01

    Cell cycle progression into S phase requires the induction of histone gene expression to package newly synthesized DNA as chromatin. Cyclin E stimulation of CDK2 at the Restriction point late in G1 controls both histone gene expression by the p220NPAT/HiNF-P pathway and initiation of DNA replication through the pRB/E2F pathway. The three CDK inhibitors (CKIs) p21CIP1/WAF1, p27KIP1 and p57KIP2 attenuate CDK2 activity. Here we find that γ-irradiation induces p21CIP1/WAF1 but not the other two CKIs, while reducing histone H4 mRNA levels but not histone H4 gene promoter activation by the p220NPAT/HiNF-P complex. We also show that p21CIP1/WAF1 is less effective than p27KIP1 and p57KIP2 in inhibiting the CDK2 dependent phosphorylation of p220NPAT at subnuclear foci and transcriptional activation of histone H4 genes. The greater effectiveness of p57KIP2 in blocking the p220NPAT/HiNF-P pathway is attributable in part to its ability to form a specific complex with p220NPAT that may suppress CDK2/cyclin E phosphorylation through direct substrate inhibition. We conclude that CKIs selectively control stimulation of the histone H4 gene promoter by the p220NPAT/HiNF-P complex. PMID:19170105

  16. Diverse IgG serum response to novel glycopeptide epitopes detected within immunodominant stretches of Epstein-Barr virus glycoprotein 350/220

    DEFF Research Database (Denmark)

    D'Arrigo, Isotta; Cló, Emiliano; Bergström, Tomas

    2013-01-01

    The Epstein-Barr virus (EBV) envelope glycoprotein 350/220 (gp350/220) is the most abundant molecule on the viral surface and it is responsible for the initial viral attachment to cell surface of the host. As many other viral envelope proteins, it is highly glycosylated, not least with O-linked g......The Epstein-Barr virus (EBV) envelope glycoprotein 350/220 (gp350/220) is the most abundant molecule on the viral surface and it is responsible for the initial viral attachment to cell surface of the host. As many other viral envelope proteins, it is highly glycosylated, not least with O......-linked glycans, most of which essential for EBV life cycle. EBV gp350/220 is also a primary target for neutralizing antibodies in the human hosts and a promising candidate for an EBV vaccine. Here we showed that recombinant GalNAc transferases can glycosylate scan peptides of the EBV gp350/220 envelope protein...... immobilized on microarray glass slides. We also identified serum IgG antibodies to a selection of peptides and O-glycopeptides, whereas sera from EBV-IgG negative individuals remained negative. We here describe novel glycopeptide epitopes present within immunodominant stretches of EBV gp350...

  17. Specific racemization of heavy-chain cysteine-220 in the hinge region of immunoglobulin gamma 1 as a possible cause of degradation during storage.

    Science.gov (United States)

    Amano, Masato; Hasegawa, Jun; Kobayashi, Naoki; Kishi, Naoyuki; Nakazawa, Takashi; Uchiyama, Susumu; Fukui, Kiichi

    2011-05-15

    Therapeutic antibodies often suffer from degradation due to various modifications during storage. We detected a degradation of immunoglobulin gamma 1 (IgG1) stored for 6 month at 40 °C, and identified the modification as the racemization of Cys220 in the hinge sequence S(219)CDKTHT(225) of the heavy chain by tryptic peptide mapping and tandem mass spectrometry. The rate of racemization at Cys220 was enhanced deliberately by incubating the protein at 50 °C and pH 9.0, while all the other cysteine residues were not affected. The racemization of Cys220 was confirmed by mass spectrometry in conjunction with extracted ion chromatography of the tryptic digest of IgG1 forced to degrade in D(2)O and a series of synthetic hinge fragments containing D-amino acid, as well as the detection of D-cysteine in the acid hydrolysate. To rationalize the possible relationship between the racemization of Cys220 and isopeptide formation at the neighboring residue of Asp221, we suggest a new reaction mechanism that assumes a base catalyst to initiate these reactions by activating the amide nitrogen of Lys222. Due to the highly flexible nature of the hinge region, Lys222 can participate in either the formation of a cyclic imidazoline intermediate involving the α-carbonyl carbon of Cys220 to facilitate the racemization of Cys220 or that of a succinimide structure leading to the isomerization of Asp221.

  18. Dimensional verification and location of the reactive static compensator in 220 kV; Verificacion del dimensionamiento y ubicacion del compensador estatico de reactivos en 220 kV

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez Krekeler, Ubaldo [Administracion Nacional de Electricidad (ANDE), Asuncion (Paraguay)]. E-mail: ufernandez@ieee.org; Cardozo Sanchez, Freddy [Mirant Americas (United States)

    2001-07-01

    This work presents a determination verification of the compensation range and the location of reactive static compensator (RSC) in 220 kV. The verification is accomplished by analyses of the RSC effects in relation to the losses, loading and system voltage stability. The needed compensation range is investigated in full details, whereas that the required conversion level is directly related to this range. It is concluded that the RSC installation, foreseen for 2002, might be postponed for 2005/10 still without reinforcements in 500 kV. The Limpio substation seems to be the more suitable location in relation to the most analysed cases.

  19. Invasive ductal carcinoma: relationship between pathological characteristics and the presence of axillary metastasis in 220 cases.

    Science.gov (United States)

    Aquino, Ranniere Gurgel Furtado DE; Vasques, Paulo Henrique Diógenes; Cavalcante, Diane Isabelle Magno; Oliveira, Ayane Layne DE Sousa; Oliveira, Bruno Masato Kitagawa DE; Pinheiro, Luiz Gonzaga Porto

    2017-01-01

    to analyze the relation of anatomopathological features and axillary involvement in cases of invasive ductal carcinoma. this is a cross-sectional study of 220 breast cancer patients submitted to radical mastectomy or quadrantectomy with axilar emptying, from the Mastology Service of the Assis Chateaubriand Maternity School, Ceará, Brazil. We submitted the tumors to histological processing and determined the histological (HG), tubular (TG) and nuclear (NG) grades, and the mitotic index (MI) by the classification of Scarff-Bloom-Richadson, verified the presence of angiolymphatic invasion (AI) and measured the largest tumor diameter (TD). We then correlated these variables with the presence of axillary metastases. the mean patients'age was 56.81 years ± 13.28. Tumor size ranged from 0.13 to 22 cm, with an average of 2.23cm ± 2.79. HG3, TG3 and NG3 prevailed, respectively 107 (48.6%), 160 (72.7%) and 107 (48.6%). Mitotic indexes 1, 2 and 3 presented a homogeneous distribution, respectively 82 (37.2%), 68 (31%) and 70 (31.8%). We observed no relation between the HG, TG and NG with the occurrence of axillary metastases (p=0.07, p=0.22 and p=0.21, respectively). Mitotic indices 2 and 3 were related with the occurrence of axillary metastases (p=0.03). Tumors larger than 2cm and cases that presented angiolymphatic invasion had a higher index of axillary metastases (p=0.0003 and pmastectomia radical ou quadrantectomia com esvaziamento axilar, oriundos do Serviço de Mastologia da Maternidade Escola Assis Chateaubriand, Ceará, Brasil. Os tumores foram submetidos a processamento histológico e, em seguida, foram determinados os graus histológico (GH), tubular (GT), nuclear (GN), índice mitótico (IM) pela classificação de Scarff-Bloom-Richadson, verificada a presença de invasão angiolinfática (IA) e mensurado o maior diâmetro do tumor (DT). Tais variáveis foram correlacionadas com a presença de metástases axilares. a média de idade das pacientes foi 56,81 anos

  20. 220 patients with autosomal dominant spastic paraplegia do not display mutations in the SLC33A1-gene (SPG42)

    OpenAIRE

    Bauer, Peter; Schlipf, Nina; Beetz, Christian; Schüle, Rebecca; Stevanin, Giovanni; Erichsen, Anne Kjersti; Forlani, Sylvie; Zaros, Cécile; Karle, Kathrin; Klebe, Stephan; Klimpe, Sven; Durr, Alexandra; Otto, Susanne; Tallaksen, Chantal; Riess, Olaf

    2010-01-01

    Abstract The most frequent causes of autosomal dominant HSP (ADHSP) are mutations in the SPAST-gene (SPG4 locus). However, roughly 60% of the patients are negative for SPAST-mutations despite their family history is compatible with autosomal dominant inheritance. A mutation in the gene for an acetyl-CoA transporter (SLC33A1) has recently been reported in one Chinese family to cause ADHSP type SPG42. Here we screened 220 independent SPAST-mutation-negative ADHSP samples for mutation...

  1. Measurements of octupole collectivity in $^{220,222}$Rn and $^{222,224}$Ra using Coulomb excitation

    CERN Multimedia

    Kruecken, R; Larsen, A; Hurst, A M; Voulot, D; Grahn, T; Clement, E; Wadsworth, R; Gernhaeuser, R A; Siem, S; Huyse, M L; Iwanicki, J S

    2008-01-01

    We propose to exploit the unique capability of ISOLDE to provide post-accelerated $^{220,222}$Rn and $^{222,224}$Ra ion beams from the REX facility to enable the Coulomb excitation of the first 3$^{-}$ states in these nuclei. By measuring the $\\gamma$-ray yields of the E1 decays from the 3$^{-}$ state using the MINIBALL array we can obtain the transition matrix elements. This will give quantitative information about octupole correlations in these nuclei. We require 22 shifts to fulfil the aims of the experiment.

  2. Empleo de la Tarjeta Amarilla y el Formato NOM220 para las notificaciones de sospechas de reacciones adversas a medicamentos

    Directory of Open Access Journals (Sweden)

    Lourdes Cristina Carrillo-Alarcón

    Full Text Available Introducción: la notificación de reacciones adversas a medicamentos es una obligación a nivel mundial. Aunque se han establecido muchas metodologías para esta acción, en la actualidad existen problemas. Objetivo: determinar la frecuencia de sospecha de reacciones adversas a la administración de medicamentos en pacientes y comparar la accesibilidad del llenado del formato de la NOM220 de la Secretaría de Salud y la Tarjeta Amarilla propuesta por la Organización Mundial de la Salud. Métodos: estudio transversal y observacional. Participaron 50 médicos responsables de las clínicas de diabetes del Estado de Hidalgo. Inicialmente, los médicos fueron capacitados para identificar las sospechas de reacciones adversas a la administración de medicamentos en los pacientes atendidos. Se realizó un diseño cruzado, en el que el 50 % de los médicos utilizaron por tres meses el formato de la NOM220 y 50 % la Tarjeta Amarilla. Después intercambiaron formatos y los utilizaron durante los tres meses siguientes. Al cabo de este periodo, respondieron un cuestionario para determinar la utilidad, claridad, tiempo de llenado y practicidad de ambos formatos. Se realizó estadística descriptiva y análisis bivariado para determinar los factores asociados a las sospecha de reacciones adversas a medicamentos, con el software SPSS (versión 17. Resultados: se registraron 46 sospechas de reacciones adversas a medicamentos en 46 pacientes con el formato de la NOM220 y 78 sospechas de reacciones adversas a medicamentos con la Tarjeta Amarilla en 78 pacientes. Todas las sospechas de reacciones adversas a la administración de medicamentos fueron tipo A. Los médicos recomiendan la utilización de la Tarjeta Amarilla, consideran claro el formato, sencillo, legible, fácil de llenar, entendible y accesible (p< 0,05. Conclusiones: los resultados permiten proponer la Tarjeta Amarilla como una alternativa más accesible para la notificación de sospechas de

  3. Impact of SSSC on Measured Impedance in Single Phase to Ground Fault Condition on 220 kV Transmission Line

    Directory of Open Access Journals (Sweden)

    Mohamed ZELLAGUI

    2012-08-01

    Full Text Available This paper presents and compares the impact of SSSC on measured impedance for single phase to ground fault condition. The presence of Static Synchronous SSSC on a transmission line has a great influence on the ZRelay in distance protection. The protection of the high voltage 220 kV single circuit transmission line in eastern Algerian electrical transmission networks is affected in the case with resistance fault RF. The paper investigate the effect of Static Synchronous Series Compensator (SSSC on the measured impedance (Relay taking into account the distance fault point (n and fault resistance (RF. The resultants simulation is performed in MATLAB software environment.

  4. Cristatumins A-D, new indole alkaloids from the marine-derived endophytic fungus Eurotium cristatum EN-220.

    Science.gov (United States)

    Du, Feng-Yu; Li, Xiao-Ming; Li, Chun-Shun; Shang, Zhuo; Wang, Bin-Gui

    2012-07-15

    Four new indole alkaloids, namely, cristatumins A-D (1-4), along with six known congeners (5-10) were identified from the culture extract of Eurotium cristatum EN-220, an endophytic fungus isolated from the marine alga Sargassum thunbergii. The structures of these compounds were established on the basis of extensive spectroscopic analysis. Each of these compounds was evaluated for antimicrobial and insecticidal activity. Compounds 1 and 9 showed antibacterial activity against Escherichia coli and Staphyloccocus aureus, respectively, while compounds 2, 6, and 7 exhibited moderate lethal activity against brine shrimp. Preliminary structure-activity relationships were also discussed. Copyright © 2012 Elsevier Ltd. All rights reserved.

  5. Mitochondrially-targeted expression of a cytoplasmic male sterility-associated orf220 gene causes male sterility in Brassica juncea

    Directory of Open Access Journals (Sweden)

    Liu Xunyan

    2010-10-01

    Full Text Available Abstract Background The novel chimeric open reading frame (orf resulting from the rearrangement of a mitochondrial genome is generally thought to be a causal factor in the occurrence of cytoplasmic male sterility (CMS. Both positive and negative correlations have been found between CMS-associated orfs and the occurrence of CMS when CMS-associated orfs were expressed and targeted at mitochondria. Some orfs cause male sterility or semi-sterility, while some do not. Little is currently known about how mitochondrial factor regulates the expression of the nuclear genes involved in male sterility. The purpose of this study was to investigate the biological function of a candidate CMS-associated orf220 gene, newly isolated from cytoplasmic male-sterile stem mustard, and show how mitochondrial retrograde regulated nuclear gene expression is related to male sterility. Results It was shown that the ORF220 protein can be guided to the mitochondria using the mitochondrial-targeting sequence of the β subunit of F1-ATPase (atp2-1. Transgenic stem mustard plants expressed the chimeric gene containing the orf220 gene and a mitochondrial-targeting sequence of the β subunit of F1-ATPase (atp2-1. Transgenic plants were male-sterile, most being unable to produce pollen while some could only produce non-vigorous pollen. The transgenic stem mustard plants also showed aberrant floral development identical to that observed in the CMS stem mustard phenotype. Results obtained from oligooarray analysis showed that some genes related to mitochondrial energy metabolism were down-regulated, indicating a weakening of mitochondrial function in transgenic stem mustard. Some genes related to pollen development were shown to be down-regulated in transgenic stem mustard and the expression of some transcription factor genes was also altered. Conclusion The work presented furthers our understanding of how the mitochondrially-targeted expression of CMS-associated orf220 gene causes

  6. A chimeric EBV gp350/220-based VLP replicates the virion B-cell attachment mechanism and elicits long-lasting neutralizing antibodies in mice.

    Science.gov (United States)

    Ogembo, Javier Gordon; Muraswki, Matthew R; McGinnes, Lori W; Parcharidou, Agapi; Sutiwisesak, Rujapak; Tison, Timelia; Avendano, Juan; Agnani, Deep; Finberg, Robert W; Morrison, Trudy G; Fingeroth, Joyce D

    2015-02-06

    Epstein-Barr virus (EBV), an oncogenic gammaherpesvirus, causes acute infectious mononucleosis (AIM) and is linked to the development of several human malignancies. There is an urgent need for a vaccine that is safe, prevents infection and/or limits disease. Unique among human herpesviruses, glycoprotein (gp)350/220, which initiates EBV attachment to susceptible host cells, is the major ligand on the EBV envelope and is highly conserved. Interaction between gp350/220 and complement receptor type 2 (CR2)/CD21 and/or (CR1)/CD35 on B-cells is required for infection. Potent antibody responses to gp350/220 occur in animal models and humans. Thus, gp350/220 provides an attractive candidate for prophylactic subunit vaccine development. However, in a recent Phase II clinical trial immunization with soluble recombinant gp350 reduced the incidence of AIM, but did not prevent infection. Despite various attempts to produce an EBV vaccine, no vaccine is licensed. Herein we describe a sub-unit vaccine against EBV based on a novel Newcastle disease virus (NDV)-virus-like particle (VLP) platform consisting of EBVgp350/220 ectodomain fused to NDV-fusion (F) protein. The chimeric protein EBVgp350/220-F is incorporated into the membrane of a VLP composed of the NDV matrix and nucleoprotein. The particles resemble native EBV in diameter and shape and bind CD21 and CD35. Immunization of BALB/c mice with EBVgp350/220-F VLPs elicited strong, long-lasting neutralizing antibody responses when assessed in vitro. This chimeric VLP is predicted to provide a superior safety profile as it is efficiently produced in Chinese hamster ovary (CHO) cells using a platform devoid of human nucleic acid and EBV-transforming genes.

  7. Demonstration of a High-Order Mode Input Coupler for a 220-GHz Confocal Gyrotron Traveling Wave Tube

    Science.gov (United States)

    Guan, Xiaotong; Fu, Wenjie; Yan, Yang

    2018-02-01

    A design of high-order mode input coupler for 220-GHz confocal gyrotron travelling wave tube is proposed, simulated, and demonstrated by experimental tests. This input coupler is designed to excite confocal TE 06 mode from rectangle waveguide TE 10 mode over a broadband frequency range. Simulation results predict that the optimized conversion loss is about 2.72 dB with a mode purity excess of 99%. Considering of the gyrotron interaction theory, an effective bandwidth of 5 GHz is obtained, in which the beam-wave coupling efficiency is higher than half of maximum. The field pattern under low power demonstrates that TE 06 mode is successfully excited in confocal waveguide at 220 GHz. Cold test results from the vector network analyzer perform good agreements with simulation results. Both simulation and experimental results illustrate that the reflection at input port S11 is sensitive to the perpendicular separation of two mirrors. It provides an engineering possibility for estimating the assembly precision.

  8. Tensile properties and fracture toughness of Zr–2.5Nb alloy pressure tubes of IPHWR220

    Energy Technology Data Exchange (ETDEWEB)

    Khandelwal, H.K. [Mechanical Metallurgy Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India); Homi Bhabha National Institute, Anushaktinagar, Mumbai 400094 (India); Singh, R.N., E-mail: rnsingh@barc.gov.in [Mechanical Metallurgy Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India); Homi Bhabha National Institute, Anushaktinagar, Mumbai 400094 (India); Bind, A.K.; Sunil, S.; Chakravartty, J.K. [Mechanical Metallurgy Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India); Ghosh, A.; Dhandharia, P.; Bhachawat, D. [Engineering Directorate, Nuclear Power Corporation of India Ltd., NUB, Anushaktinagar, Mumbai 400094 (India); Shekhar, R.; Kumar, Sunil Jai [National Centre for Compositional Characterisation of Materials, Bhabha Atomic Research Centre, ECIL (PO), Hyderabad 500 062 (India)

    2015-11-15

    Highlights: • Evaluated tensile properties & fracture toughness of Zr–2.5Nb pressure tube alloy. • Studied the effect of test temperature, sample location and ingot melting. • Quadruple melting improves fracture toughness despite variation in fabrication route. • Fracture toughness of IPHWR220 pressure tubes compared with CANDU material. - Abstract: The pressure tubes of Indian Pressurized Heavy Water Reactor (IPHWR) of 220 MWe are made of Zr–2.5Nb alloy manufactured either from Double Melted (DM) or from Quadruple Melted (QM) ingots. These pressure tubes are manufactured by hot extrusion, two stages of cold pilgering with intermediate annealing and autoclaving. To achieve good in-reactor performance, it is required to have minimum variability in the mechanical properties of the pressure tube across its length and between tube to tube. In this work, tensile properties and fracture toughness parameters (J{sub max}, dJ/da and CCL determined as per ASTM E1820-11 standard) of unirradiated Zr–2.5Nb alloy pressure tubes manufactured from DM and QM ingots using samples obtained from front and back end of the tubes is presented. The mechanical properties were evaluated in temperature range of 25–450 °C and compared with the corresponding data reported in literature for CANDU pressure tubes.

  9. A niche construction approach on the central Netherlands covering the last 220,000 years.

    Science.gov (United States)

    van den Biggelaar, Don F A M; Kluiving, Sjoerd J

    This paper shows what a niche construction theory (NCT) approach can contribute to the long-term social and environmental history of an area when applied to both sedentary and non-sedentary communities. To understand how communities create and respond to environmental change, hominin presence of the central Netherlands within the last 220,000 years is used as a case study. For this case study we studied the interrelationship between hominins, water and landscape gradients for four periods of interest within this long-term hominin presence. During each of these periods the study area had a specific environmental setting and (possible) traces of hominin presence. These periods cover the (1) Middle to Late Saalian (~220-170 ka), (2) Late Glacial (~14.7-11.7 ka, (3) Mid-Holocene (6000-5400 BP) and (4) Late Holocene (1200-8 BP). This review shows that traces of niche construction behaviour related to water and landscape gradients in the central Netherlands can be shown for both sedentary and non-sedentary communities. Furthermore, in this review it is shown that the transition from inceptive to counteractive change in ecosystem management style in the central Netherlands took place between the Mid- and Late Holocene periods.

  10. [A novel double heterozygote of HBB c.[219T>A;220G>T]: gene diagnosis and pedigree analysis].

    Science.gov (United States)

    Lv, Jiezhong; Luo, Zhaofan; Fang, Jianpei; Du, Tao; Xue, Hongman; Liu, Yong; Zhang, Jianping

    2017-08-10

    To identify a novel hemoglobinopathy applied by direct sequencing and clone sequencing. EDTA anticoagulated blood of proband and his parents were analyzed by hematology analyzers and Capillarys hemoglobin electrophoresis (CE). Then thalassemia genetypes were screened by gap-PCR and reverse dot blot (RDB). Proband was suspected with abnormal hemoglobin combine alpha beta compound thalassemia. The mutation of beta-globin was identified by direct sequencing and clone sequencing. Hb analysis showed that probands Hb A2 variant was eluted in Z (C) zone and his father's in Z (A2) zone on CE,and proband's mother elevated HbA2 of 4.6%. Screened by RDB, the proband was CD71-72(+A) homozygote and showed the mismatch with his parents. Through direct sequencing and clone sequencing, we deduced that our proband inherited the mutations of HBB c.[219T>A;220G>T] from his father and inherited the Southeast-Asian deletion and HBB c.216-217insA from his mother. A novel double heterozygote of HBB c.[219T>A; 220G>T] was identified in south China. This mutation enriches the beta-thalassemia gene mutation spectrum in Chinese population.

  11. Effectiveness of the Top-Down Nanotechnology in the Production of Ultrafine Cement (~220 nm

    Directory of Open Access Journals (Sweden)

    Byung-Wan Jo

    2014-01-01

    Full Text Available The present investigation is dealing with the communition of the cement particle to the ultrafine level (~220 nm utilizing the bead milling process, which is considered as a top-down nanotechnology. During the grinding of the cement particle, the effect of various parameters such as grinding time (1–6 h and grinding agent (methanol and ethanol on the production of the ultrafine cement has also been investigated. Performance of newly produced ultrafine cement is elucidated by the chemical composition, particle size distribution, and SEM and XRD analyses. Based on the particle size distribution of the newly produced ultrafine cement, it was assessed that the size of the cement particle decreases efficiently with increase in grinding time. Additionally, it is optimized that the bead milling process is able to produce 90% of the cement particle <350 nm and 50% of the cement particle < 220 nm, respectively, after 6.3 h milling without affecting the chemical phases. Production of the ultrafine cement utilizing this method will promote the construction industries towards the development of smart and sustainable construction materials.

  12. Wrapping effects within a proposed function-rescue strategy for the Y220C oncogenic mutation of protein p53.

    Directory of Open Access Journals (Sweden)

    Sebastián R Accordino

    Full Text Available Soluble proteins must protect their structural integrity from water attack by wrapping interactions which imply the clustering of nonpolar residues around the backbone hydrogen bonds. Thus, poorly wrapped hydrogen bonds constitute defects which have been identified as promoters of protein associations since they favor the removal of hydrating molecules. More specifically, a recent study of our group has shown that wrapping interactions allow the successful identification of protein binding hot spots. Additionally, we have also shown that drugs disruptive of protein-protein interfaces tend to mimic the wrapping behavior of the protein they replace. Within this context, in this work we study wrapping three body interactions related to the oncogenic Y220C mutation of the tumor suppressor protein p53. Our computational results rationalize the oncogenic nature of the Y220C mutation, explain the binding of a drug-like molecule already designed to restore the function of p53 and provide clues to help improve this function-rescue strategy and to apply in other drug design or re-engineering techniques.

  13. Loss of P2X7 receptor plasma membrane expression and function in pathogenic B220+ double-negative T lymphocytes of autoimmune MRL/lpr mice.

    Directory of Open Access Journals (Sweden)

    Sylvain M Le Gall

    Full Text Available Lupus is a chronic inflammatory autoimmune disease influenced by multiple genetic loci including Fas Ligand (FasL and P2X7 receptor (P2X7R. The Fas/Fas Ligand apoptotic pathway is critical for immune homeostasis and peripheral tolerance. Normal effector T lymphocytes up-regulate the transmembrane tyrosine phosphatase B220 before undergoing apoptosis. Fas-deficient MRL/lpr mice (lpr mutation exhibit lupus and lymphoproliferative syndromes due to the massive accumulation of B220(+ CD4(-CD8(- (DN T lymphocytes. The precise ontogeny of B220(+ DN T cells is unknown. B220(+ DN T lymphocytes could be derived from effector CD4(+ and CD8(+ T lymphocytes, which have not undergone activation-induced cell death due to inactivation of Fas, or from a special cell lineage. P2X7R is an extracellular ATP-gated cell membrane receptor involved in the release of proinflammatory cytokines and TNFR1/Fas-independent cell death. P2X7R also regulate early signaling events involved in T-cell activation. We show herein that MRL/lpr mice carry a P2X7R allele, which confers a high sensitivity to ATP. However, during aging, the MRL/lpr T-cell population exhibits a drastically reduced sensitivity to ATP- or NAD-mediated stimulation of P2X7R, which parallels the increase in B220(+ DN T-cell numbers in lymphoid organs. Importantly, we found that this B220(+ DN T-cell subpopulation has a defect in P2X7R-mediated responses. The few B220(+ T cells observed in normal MRL(+/+ and C57BL/6 mice are also resistant to ATP or NAD treatment. Unexpectedly, while P2X7R mRNA and proteins are present inside of B220(+ T cells, P2X7R are undetectable on the plasma membrane of these T cells. Our results prompt the conclusion that cell surface expression of B220 strongly correlates with the negative regulation of the P2X7R pathway in T cells.

  14. Scientific Opinion on Flavouring Group Evaluation 220 Revision 3 (FGE.220Rev3): Consideration of genotoxic potential for α,β-unsaturated 3(2H)-Furanones from subgroup 4.4 of FGE.19

    DEFF Research Database (Denmark)

    Beltoft, Vibe Meister; Nørby, Karin Kristiane

    for genotoxicity could not be ruled out, therefore the Panel requested a repetition of the submitted micronucleus study in the presence of S9-mix, or a combined in vivo micronucleus and Comet assay, including analysis of the liver. The Flavour Industry has tested again 4-acetyl-2,5-dimethylfuran-3(2H)-one [FL......-no: 13.175] in an in vitro micronucleus assay as was requested by the Panel. This new study is evaluated in FGE.220, Revision 3, where the Panel concluded that [FL-no: 13.175] does not give rise to concern with respect to genotoxicity and can be evaluated using the Procedure. This is also applicable...

  15. A 220 kyr record of Pb isotopes at Dome C Antarctica from analyses of the EPICA ice core

    Science.gov (United States)

    Vallelonga, P.; Gabrielli, P.; Rosman, K. J. R.; Barbante, C.; Boutron, C. F.

    2005-01-01

    Pb isotopic compositions and Pb and Ba concentrations are reported in EPICA Dome C ice core samples dating to 220 kyr BP, indicating that Pb isotopic compositions in Antarctic ice vary with changing climate. 206Pb/207Pb ratios decrease during glacial periods, with the lowest values occurring during colder climatic periods (stages 2, 4 and 6) and the Holocene. Low Pb concentrations (10 pg/g) were found during cold climatic periods. Ba, a proxy for mineral dust, was used to determine that dust usually accounts for ~70% of Pb in Dome C ice, while the remaining ~30% was attributed to volcanic emissions. Pb isotopic compositions at Dome C differ from those reported in pre-industrial ice from other Antarctic locations, due to greater proportions of dust Pb at Dome C.

  16. Quantum efficiency of cesium iodide photocathodes in the 120-220 nm spectral range traceable to a primary detector standard

    CERN Document Server

    Rabus, H; Richter, M; Ulm, G; Friese, J; Gernhäuser, R; Kastenmüller, A; Maier-Komor, P; Zeitelhack, K

    1999-01-01

    Differently prepared CsI samples have been investigated in the 120-220 nm spectral range for their quantum efficiency, spatial uniformity and the effect of radiation aging. The experiments were performed at the PTB radiometry laboratory at the Berlin synchrotron radiation facility BESSY. A calibrated GaAsP Schottky photodiode was used as transfer detector standard to establish traceability to the primary detector standard, because this type of photodiode - unlike silicon p-on-n photodiodes - proved to be of sufficiently stable response when exposed to vacuum ultraviolet radiation. The paper reviews the experimental procedures that were employed to characterize and calibrate the GaAsP photodiode and reports the results that were obtained on the investigated CsI photocathodes.

  17. Overview on Workpackage 220: Modeling of aircraft emissions and their transformation on the wake and regional scales

    Energy Technology Data Exchange (ETDEWEB)

    Kaercher, B. [Deutsche Forschungsanstalt fuer Luft- und Raumfahrt e.V. (DLR), Wessling (Germany). Inst. fuer Physik der Atmosphaere

    1997-12-01

    Exhaust plumes disperse due to the combined effect of advection and diffusion, resulting in an effective diffusion. The flow field behind an aircraft is a superposition of aircraft induced and atmospheric flows. Advective transport, mixing, and diffusion of aircraft exhaust from the scale of the airplane up to the range of atmospheric mesoscale flows has been investigated with large-eddy simulations. The study of near-field processes in aircraft wakes involves various branches of physics and chemistry. In concert with in situ measurements, it was the aim of the working group 220 to put together the different pieces of information and to develop a coherent picture. In this way, we have learned much about near-field interactions, provided important information for modelers studying processes at larger scales, and hopefully contributed essentially to the task of assessing the overall effects of aviation on chemistry and climate. (orig./AKF) 144 figs., 42 tabs., 497 refs.

  18. Indolediketopiperazine Alkaloids from Eurotium cristatum EN-220, an Endophytic Fungus Isolated from the Marine Alga Sargassum thunbergii.

    Science.gov (United States)

    Du, Feng-Yu; Li, Xin; Li, Xiao-Ming; Zhu, Li-Wei; Wang, Bin-Gui

    2017-01-25

    Four new indolediketopiperazine derivatives (1-4), along with nine known congeners (5-13), were isolated and identified from the culture extract of Eurotium cristatum EN-220, an endophytic fungus obtained from the marine alga Sargassum thunbergii. The structures of thesecompounds were elucidated on the basis of extensive spectroscopic analysis and the absolute configurations of compounds 1-4 were established by NOESY experiments and by chiral HPLC analyses of their acid hydrolysates. The absolute configuration of C-8 (a quaternary carbon substituted with a hydroxyl group) in 5 of preechinulin class was firstly determined by electronic circular dichroism (ECD) calculations. All these compounds were evaluatedfor brine shrimp (Artemia salina) lethality and nematicidal activity as well as antioxidativeand antimicrobial potency.

  19. Indolediketopiperazine Alkaloids from Eurotium cristatum EN-220, an Endophytic Fungus Isolated from the Marine Alga Sargassum thunbergii

    Directory of Open Access Journals (Sweden)

    Feng-Yu Du

    2017-01-01

    Full Text Available Four new indolediketopiperazine derivatives (1–4, along with nine known congeners (5–13, were isolated and identified from the culture extract of Eurotium cristatum EN-220, an endophytic fungus obtained from the marine alga Sargassum thunbergii. The structures of thesecompounds were elucidated on the basis of extensive spectroscopic analysis and the absolute configurations of compounds 1–4 were established by NOESY experiments and by chiral HPLC analyses of their acid hydrolysates. The absolute configuration of C-8 (a quaternary carbon substituted with a hydroxyl group in 5 of preechinulin class was firstly determined by electronic circular dichroism (ECD calculations. All these compounds were evaluatedfor brine shrimp (Artemia salina lethality and nematicidal activity as well as antioxidativeand antimicrobial potency.

  20. An Epstein-Barr virus DNA fragment encodes messages for the two major envelope glycoproteins (gp350/300 and gp220/200).

    OpenAIRE

    Hummel, M; Thorley-Lawson, D; Kieff, E

    1984-01-01

    The genes encoding the two major Epstein-Barr virus glycoproteins (gp350/300 and gp220/200) have been mapped to a 5-kilobase fragment of the viral genome (BamHI-L). This fragment encodes 3.4- and 2.8-kilobase RNAs which translate proteins of 135 and 100 kilodaltons, respectively. Both proteins react with antiserum specific for gp350/300 and gp220/200. The 135-kilodalton protein is identical in size to the nascent polypeptide precursor to gp350/300, and the 100-kilodalton protein is the expect...

  1. Pro-dopamine regulator, KB220Z, attenuates hoarding and shopping behavior in a female, diagnosed with SUD and ADHD.

    Science.gov (United States)

    McLaughlin, Thomas; Blum, Kenneth; Steinberg, Bruce; Modestino, Edward J; Fried, Lyle; Baron, David; Siwicki, David; Braverman, Eric R; Badgaiyan, Rajendra D

    2018-01-10

    Background Addictive-like behaviors (e.g., hoarding and shopping) may be the result of the cumulative effects of dopaminergic and other neurotransmitter genetic variants as well as elevated stress levels. We, therefore, propose that dopamine homeostasis may be the preferred goal in combating such challenging and unwanted behaviors, when simple dopaminergic activation through potent agonists may not provide any resolution. Case presentation C.J. is a 38-year-old, single, female, living with her mother. She has a history of substance use disorder as well as attention deficit hyperactivity disorder, inattentive type. She had been stable on buprenorphine/naloxone combination and amphetamine, dextroamphetamine mixed salts for many years when unexpectedly she lost her job for oversleeping and not calling into work. KB200z (a pro-dopamine compound) was added to her regimen for complaints of low drive and motivation. After taking this nutraceutical for 4 weeks, she noticed a marked improvement in her mental status and many behaviors. She noted that her shopping and hoarding addictions had appreciably decreased. Furthermore, her lifelong history of terrifying lucid dreams was eliminated. Finally, she felt more in control; her locus of control shifted from external to more internal. Discussion The hypothesis is that C.J.'s reported, behavioral, and psychological benefits resulted from the pro-dopamine-regulating effect of KB220Z across the brain reward system. Conclusions This effect, we surmise, could be the result of a new dopamine balance, across C.J.'s brain reward system. Dopamine homeostasis is an effect of KB220Z seen in both animal and human placebo-controlled fMRI experiments.

  2. Estimating Maximal Heart Rate with the ‘220-Age’ Formula in Adolescent Female Volleyball Players: A Preliminary Study

    Directory of Open Access Journals (Sweden)

    Nikolaidis Pantelis Theodoros

    2014-09-01

    Full Text Available Purpose. Although maximal heart rate (HRmax is used widely to assess exercise intensity in training, there are limited data with regards to the validity of age-based prediction equations of HRmax in volleyball players. Therefore, the aim of the present study was to compare the measured-HRmax of two prediction equations (Fox-HRmax = 220 − age and Tanaka-HRmax = 208 − 0.7 × age in young female volleyball players. Methods. The study involved 47 volleyball players (age 13.39 ± 2.01 years, body mass 54.0 ± 10.8 kg, height 162.7 ± 10.2 cm who performed a graded exercise field test (20 m shuttle run endurance test to assess HRmax. Measured-HRmax values were compared with the Fox and Tanaka prediction equations. Results. The results showed that mean scores for HRmax significantly differed between measured and predicted values (p < 0.001, ŋ2 = 0.49. Post-hoc tests revealed that Fox-HRmax overestimated measured-HRmax (mean difference 5.7 bpm; 95% CI [3.0, 8.5], whereas Tanaka-HRmax was similar to measured-HRmax (-2.2 bpm; 95% CI [-4.9, 0.4]. HRmax did not correlate with age (r = 0.16, p = 0.291. Conclusions. The results of this study failed to validate the widely used ‘220−age’ formula in volleyball players. Coaches and fitness trainers should take into account that the overestimation of HRmax by the Fox equation might lead to prescribing exercise at a higher intensity than what is targeted. Therefore, the Tanaka equation appears to offer a more accurate prediction equation of HRmax than the Fox equation in young female volleyball players.

  3. The Hewlett-Packard 1000--Vitalmetrics VM220 connection: a description of the automated ultrasonic urine output measurement system in the CICU of Genolier Clinic.

    Science.gov (United States)

    Shotts, J F; Hauf, E

    1986-01-01

    After over eighteen years experience using an automated weighing technique to monitor the urine output, we have changed our system in favor of the Vitalmetrics VM220 ultrasonic urine/bladder temperature measurement devices. Last year we began with one VM220 interfaced directly to the Hewlett-Packard 1000 computer's standard ASCII circuit card (H-P 12966A ASCII BACI). We found that we could read and interpret the ASCII string transmitted by the VM220; then started a search for a suitable multiplexing device through which we could manage all six of our VM220's with only one interface card. Perhaps there are many more, but we found two which we shall discuss in this report: 1. The Baytech Associates model 528-B 8 channel switching device and 2. the SEA Corporation signal distribution controller (also known as the cluster controller) which has 16 channels. In our post-operative cardiovascular intensive care unit (CICU), we have used the Baytech 528-B multiplexer to monitor the urine output for over 250 open heart surgery patients. Later this year, we acquired a cluster controller from SEA Corporation in Birmingham, Alabama (USA). We have written software for testing and incorporating this application into a Hewlett-Packard Patient Data Management System (PDMS).

  4. 41 CFR 105-74.220 - By when must I publish my drug-free workplace statement and establish my drug-free awareness...

    Science.gov (United States)

    2010-07-01

    ... my drug-free workplace statement and establish my drug-free awareness program? 105-74.220 Section 105... awareness program? If you are a new recipient that does not already have a policy statement as described in § 105-74.205 and an ongoing awareness program as described in § 105-74.215, you must publish the...

  5. 12 CFR 220.128 - Treatment of simultaneous long and short positions in the same margin account when put or call...

    Science.gov (United States)

    2010-01-01

    ... positions in the same margin account when put or call options or combinations thereof on such stock are also...) Interpretations § 220.128 Treatment of simultaneous long and short positions in the same margin account when put...), if there are simultaneous long and short positions in the same security in the same margin account...

  6. THE FIRST DETECTION OF GeV EMISSION FROM AN ULTRALUMINOUS INFRARED GALAXY: Arp 220 AS SEEN WITH THE FERMI LARGE AREA TELESCOPE

    Energy Technology Data Exchange (ETDEWEB)

    Peng, Fang-Kun; Wang, Xiang-Yu [School of Astronomy and Space Science, Nanjing University, Nanjing 210093 (China); Liu, Ruo-Yu [Max-Planck-Institut für Kernphysik, D-69117 Heidelberg (Germany); Tang, Qing-Wen [School of Science, Nanchang University, Nanchang 330031 (China); Wang, Jun-Feng, E-mail: xywang@nju.edu.cn [Department of Astronomy and Institute of Theoretical Physics and Astrophysics, Xiamen University, Xiamen, Fujian 361005 (China)

    2016-04-20

    Cosmic rays (CRs) in starburst galaxies produce high-energy gamma-rays by colliding with the dense interstellar medium. Arp 220 is the nearest ultraluminous infrared galaxy that has star formation at extreme levels, so it has long been predicted to emit high-energy gamma-rays. However, no evidence of gamma-ray emission was found despite intense search efforts. Here we report the discovery of high-energy gamma-ray emission above 200 MeV from Arp 220 at a confidence level of ∼6.3σ using 7.5 years of Fermi Large Area Telescope observations. The gamma-ray emission shows no significant variability over the observation period and it is consistent with the quasi-linear scaling relation between the gamma-ray luminosity and total infrared luminosity for star-forming galaxies, suggesting that these gamma-rays arise from CR interactions. As the high-density medium of Arp 220 makes it an ideal CR calorimeter, the gamma-ray luminosity can be used to measure the efficiency of powering CRs by supernova (SN) remnants given a known supernova rate in Arp 220. We find that this efficiency is about 4.2 ± 2.6% for CRs above 1 GeV.

  7. 47 CFR 90.259 - Assignment and use of frequencies in the bands 216-220 MHz and 1427-1432 MHz.

    Science.gov (United States)

    2010-10-01

    ... 216-220 MHz and 1427-1432 MHz. 90.259 Section 90.259 Telecommunication FEDERAL COMMUNICATIONS... performed in the 1427-1429 MHz and 1431.5-1432 MHz bands. The maximum ERP limitations are as follows...) For all other locations, primary operations are performed in the 1429.5-1432 MHz band. The maximum ERP...

  8. 41 CFR 102-118.220 - If a transportation debt is owed to my agency by a TSP because of loss or damage to property...

    Science.gov (United States)

    2010-07-01

    ... is owed to my agency by a TSP because of loss or damage to property, does my agency report it to GSA....220 If a transportation debt is owed to my agency by a TSP because of loss or damage to property, does my agency report it to GSA? No, if your agency has administratively determined that a TSP owes a debt...

  9. 6,220 institutionalised people with intellectual disability referred for visual assessment between 1993 and 2003: overview and trends.

    Science.gov (United States)

    van Isterdael, C E D; Stilma, J S; Bezemer, P D; Tijmes, N T

    2006-10-01

    To summarise the results of visual performance tests and other data of institutionalised people with intellectual disability referred to a visual advisory centre (VAC) between 1993 and 2003, and to determine trends in these data. A retrospective medical record review was undertaken of 6,220 consecutive people examined ophthalmologically according to a standard protocol by one VAC that specialised in visual assessment and treatment of people with intellectual disability, between 1993 and 2003. chi2 test for linear trend was used and linear regression coefficients were calculated. The proportion of people aged > or =50 years increased from 19.3% to 34.2% between 1995 and 2003 (pdisability decreased from 80.0% to 52.6% (pvisual impairment or blindness decreased from 70.9% to 22.9% (pvisual disorders decreased from 89.6% to 75.3% (pdisability were identified in 58.4% people; 20.8% had Down's syndrome. Many ocular diagnoses were found, indicating the need for ophthalmological monitoring. Specialised centres are helpful, because assessment and treatment of people with intellectual disability is complicated and time consuming. Protocols for efficient referral will have to be developed. A major task lies ahead to improve the treatment rates of refractive errors, cataract and strabismus, and to find specific causes of intellectual disability.

  10. Addendum: Measurement of charged particle yields from PMMA irradiated by a 220 MeV/u 12C beam.

    Science.gov (United States)

    Mattei, Ilaria; Battistoni, Giuseppe; Collini, Francesco; De Lucia, Erika; Durante, Marco; Fiore, Salvatore; Latessa, Chiara; Mancini-Terracciano, Carlo; Marafini, Michela; Mirabelli, Riccardo; Muraro, Silvia; Paramatti, Riccardo; Piersanti, Luca; Rucinski, Antoni; Russomando, Andrea; Sarti, Alessio; Schuy, Christoph; Sciubba, Adalberto; Solfaroli Camillocci, Elena; Toppi, Marco; Traini, Giacomo; Valle, Serena Marta; Vanstalle, Marie; Patera, Vincenzo

    2017-09-08

    In this paper we report the re-analysis of the data published in (Piersanti et al. 2014) documenting the charged secondary particles production induced by the interaction of a 220 MeV/u 12C ion beam impinging on a polymethyl methacrylate (PMMA) target, measured in 2012 at the GSI facility in Darmstadt (Germany). This re-analysis takes into account the inhomogeneous light response of the LYSO crystal in the experimental setup measured in a subsequent experiment (2014) performed in the Heidelberg Ion- Beam Therapy Center. A better description of the detector and re-calculation of the geometrical efficiencies have been implemented as well, based on an improved approach that accounts also for the energy dependence of the emission spectrum. The new analysis has small effect on the total secondary charged flux, but has an impact on the production yield and emission velocity distributions of the different particle species (protons, deuterons and tritons) at different angles with respect to the beam direction (60° and 90°). All these observables indeed depend on the particle identification algorithms and hence on the LYSO detector energy response. The results of the data re-analysis presented here are intended to supersede and replace the results published in (Piersanti et al. 2014). © 2017 Institute of Physics and Engineering in Medicine.

  11. Addendum: Measurement of charged particle yields from PMMA irradiated by a 220 MeV/u 12C beam

    Science.gov (United States)

    Mattei, I.; Battistoni, G.; Collini, F.; De Lucia, E.; Durante, M.; Fiore, S.; La Tessa, C.; Mancini-Terracciano, C.; Marafini, M.; Mirabelli, R.; Muraro, S.; Paramatti, R.; Piersanti, L.; Rucinski, A.; Russomando, A.; Sarti, A.; Schuy, C.; Sciubba, A.; Solfaroli Camillocci, E.; Toppi, M.; Traini, G.; Valle, S. M.; Vanstalle, M.; Patera, V.

    2017-11-01

    In this paper we report the re-analysis of the data published in Piersanti et al (2014 Phys. Med. Biol. 59 1857) documenting the charged secondary particles production induced by the interaction of a 220 MeV/u 12C ion beam impinging on a polymethyl methacrylate (PMMA) target, measured in 2012 at the GSI facility in Darmstadt (Germany). This re-analysis takes into account the inhomogeneous light response of the LYSO crystal in the experimental setup measured in a subsequent experiment (2014) performed in the Heidelberg Ion-Beam Therapy Center. A better description of the detector and re-calculation of the geometrical efficiencies have been implemented as well, based on an improved approach that accounts also for the energy dependence of the emission spectrum. The new analysis has little effect on the total secondary charged flux, but has an impact on the production yield and emission velocity distributions of the different particle species (protons, deuterons and tritons) at different angles with respect to the beam direction (60^\\circ and 90^\\circ ). All these observables indeed depend on the particle identification algorithms and hence on the LYSO detector energy response. The results of the data re-analysis presented here are intended to supersede and replace the results published in Piersanti et al (2014 Phys. Med. Biol. 59 1857).

  12. Three-dimensional numerical study on thermal performance of a super large natural draft cooling tower of 220m height

    Science.gov (United States)

    Jin, Tai; Zhang, Li; Luo, Kun; Fan, Jianren

    2013-06-01

    Based on the heat and mass transfer theory and the characteristics of general-purpose software FLUENT, a three-dimensional numerical simulation platform, composed of lots of user defined functions(UDF), has been developed to simulate the thermal performance of natural draft wet cooling towers(NDWCTs). After validation, this platform is used to analyse thermal performances of a 220m high super large cooling tower designed for inland nuclear plant under different operational conditions. Variations of outlet temperature of the cooling tower caused by changes of water flow rates, inlet water temperatures are investigated. Effects of optimization through non-uniform water distributions on outlet water temperature are discussed, and the influences on the flow field inside the cooling tower are analyzed in detail. It is found that the outlet water temperature will increase as the water flow rate increases, but the air flow rate will decrease. The outlet water temperature will decrease 0.095K and 0.205K, respectively, if two non-uniform water distribution approaches are applied.

  13. Mutational analysis of the Sonic Hedgehog gene in 220 newborns with oral clefts in a South American (ECLAMC) population.

    Science.gov (United States)

    Orioli, Iêda M; Vieira, Alexandre R; Castilla, Eduardo E; Ming, Jeffrey E; Muenke, Maximilian

    2002-02-15

    Oral clefts generally have a multifactorial etiology. A number of genes contribute to the formation of the face and palate. Cleft lip and/or palate can occur in pedigrees with autosomal dominant holoprosencephaly due to mutations in Sonic Hedgehog (SHH). In addition, animal models have shown that SHH is involved in face development. We thus examined the human SHH gene in 220 newborn infants with nonsyndromic oral clefts registered by the Estudio Colaborativo Latinoamericano de Malformaciones Congenitas: ECLAMC (Latin American Collaborative Study of Congenital Malformations). We found 15 variant bands in 13 patients with oral clefts, representing five different base changes, all of which were found by sequencing to represent silent polymorphisms. Four occurred in introns. The alteration occurring in an exon, Ser190Ser, may create a consensus sequence for the 3'splice site 6 bp downstream of the original consensus sequence. Thus, we did not identify any clearly disease-causing mutation in SHH in these patients, and conclude that SHH mutations are not a frequent cause of isolated oral clefts in humans. Published 2002 Wiley-Liss, Inc.

  14. Measurement of charged particle yields from PMMA irradiated by a 220 MeV/u12Cbeam

    CERN Document Server

    Piersanti, L; Bini, FU. Rome La Sapienza (main); Collamati, F; De Lucia, E; Durante, M; Faccini, R; Ferroni, F; Fiore, S; Iarocci, E; La Tessa, C; Marafini, M; Mattei, I; Patera, V; Ortega, P G; Sarti, A; Schuy, C; Sciubba, A; Vanstalle, M; Voena, C

    2014-01-01

    The radiation used in hadrontherapy treatments interacts with the patient body producing secondary particles, either neutral or charged, that can be used for dose and Bragg peak monitoring and to provide a fast feedback on the treatment plans. Recent results obtained from the authors on simplified setups (mono-energetic primary beams interacting with homogeneous tissue like target) have already indicated the correlation that exists between the flux of these secondaries coming from the target (e.g. protons and photons) and the position of the primary beam Bragg peak. In this paper, the measurements of charged particle fluxes produced by the interaction of a 220 MeV/u carbon ion beam at GSI, Darmstadt, with a polymethyl methacrylate target are reported. The emission region of protons (p), deuterons (d) and tritons (t) has been characterized using a drift chamber while the particle time-of-flight, used to compute the kinetic energy spectra, was measured with a LYSO scintillator.The energy released in the LYSO cr...

  15. Synthesis and quality control of fluorodeoxyglucose and performance assessment of Siemens MicroFocus 220 small animal PET scanner

    Science.gov (United States)

    Phaterpekar, Siddhesh Nitin

    The scope of this article is to cover the synthesis and quality control procedures involved in production of Fludeoxyglucose (18F--FDG). The article also describes the cyclotron production of 18F radioisotope and gives a brief overview on operations and working of a fixed energy medical cyclotron. The quality control procedures for FDG involve radiochemical and radionuclidic purity tests, pH tests, chemical purity tests, sterility tests, endotoxin tests. Each of these procedures were carried out for multiple batches of FDG with a passing rate of 95% among 20 batches. The article also covers the quality assurance steps for the Siemens MicroPET Focus 220 Scanner using a Jaszczak phantom. We have carried out spatial resolution tests on the scanner, with an average transaxial resolution of 1.775mm with 2-3mm offset. Tests involved detector efficiency, blank scan sinograms and transmission sinograms. A series of radioactivity distribution tests are also carried out on a uniform phantom, denoting the variations in radioactivity and uniformity by using cylindrical ROIs in the transverse region of the final image. The purpose of these quality control tests is to make sure the manufactured FDG is biocompatible with the human body. Quality assurance tests are carried on PET scanners for efficient performance, and to make sure the quality of images acquired is according to the radioactivity distribution in the subject of interest.

  16. Hypothesizing that a Pro-Dopaminergic Regulator (KB220z(™) Liquid Variant) can Induce "Dopamine Homeostasis" and Provide Adjunctive Detoxification Benefits in Opiate/Opioid Dependence.

    Science.gov (United States)

    Blum, Kenneth; Whitney, Debra; Fried, Lye; Febo, Marcelo; Waite, Roger L; Braverman, Eric R; Dushaj, Kristina; Li, Mona; Giordano, John; Demetrovics, Zsolt; Badgaiyan, Rajendra D

    2016-01-01

    In order to explore the initiation of detoxification of addictive patients to opiates/opioids (along with some other anti-withdrawal agents), we developed a protocol to be utilized in treatment centers particularly with heavily dependent opiate/opioid subjects. Out of 17 subjects, only three received Buprenorphine/Naloxone (Bup/nx) along with KB220Z. In this pilot, we first used a dose of KB220Z of 2 oz twice daily before meals along with clonidine and benzodiazepines and other anti-nausea and sleep aids including Gabapentin. The dose of KB220Z was maintained for 6 days in five individuals. In a second scenario, we utilized a higher dose of 4 oz every 6 hours, over a 6-day period. The higher dose was employed in another 12 patients. It is noteworthy that only 3 people have relapsed utilizing these two protocols during the first two weeks of the study, allowing for the remaining 82% to be maintained on KB220Z. The patients have been maintained without any additional Bup/nx for a minimum of 120 days and in one subject, 214 days. We are in the process of testing this hypothesis in multiple treatment centers across the United Sates utilizing data from the Clinical opiate Withdrawal Scale (COWS) pre and post KB220Z. We are in the process of testing this hypothesis in multiple treatment centers across the United Sates. While this does not constitute an acceptable controlled experiment, it does provide some preliminary evidence that agrees with an earlier study. Moreover, because of the utilization of standard detoxifying agents in this detoxification protocol, we cannot make any inference to KB220Z's effects. However, out of 17 subjects, only three required Bup/nx suggesting an interesting finding. If further confirmed in larger studies, the utilization for opiate/opioid detoxification may provide a novel way to eliminate the need for addictive opioids during withdrawal and detoxification. This paradigm shift may translate to a reduction in utilizing powerful and

  17. Complex refractive indices of thin films of secondary organic materials by spectroscopic ellipsometry from 220 to 1200 nm.

    Science.gov (United States)

    Liu, Pengfei; Zhang, Yue; Martin, Scot T

    2013-01-01

    The complex refractive indices of three different types of secondary organic material (SOM) were obtained for 220 to 1200 nm using a variable angle spectroscopic ellipsometer. Aerosol particles were produced in a flow tube reactor by ozonolysis of volatile organic compounds, including the monoterpenes α-pinene and limonene and the aromatic catechol (benzene-1,2-diol). Optically reflective thin films of SOM were grown by electrostatic precipitation of the aerosol particles onto silicon substrates. The ellipsometry analysis showed that both the real and imaginary components of the refractive indices decreased with increasing wavelength. The real part n(λ) could be parametrized by the three-term form of Cauchy's equation, as follows: n(λ) = B + C/λ(2) + D/λ(4) where λ is the wavelength and B, C, and D are fitting parameters. The real refractive indices of the three SOMs ranged from 1.53 to 1.58, 1.49-1.52, and 1.48-1.50 at 310, 550, and 1000 nm, respectively. The catechol-derived SOM absorbed light in the ultraviolet (UV) range. By comparison, the UV absorption of the monoterpene-derived SOMs was negligible. On the basis of the measured refractive indices, optical properties were modeled for a typical atmospheric particle population. The results suggest that the wavelength dependence of the refractive indices can vary the Angstrom exponent by up to 0.1 across the range 310 to 550 nm. The modeled single-scattering albedo can likewise vary from 0.97 to 0.85 at 310 nm (UV-B). Variability in the optical properties of different types of SOMs can imply important differences in the relative effects of atmospheric particles on tropospheric photochemistry, as well as possible inaccuracies in some satellite-retrieved properties such as optical depth and mode diameter.

  18. Solitary fibrous tumor of the central nervous system: a 15-year literature survey of 220 cases (August 1996-July 2011).

    LENUS (Irish Health Repository)

    Bisceglia, Michele

    2011-09-01

    We reviewed the world literature on solitary fibrous tumors of the central nervous system from August 1996 to July 2011, focusing on both clinicopathological features and diagnostic findings. The anatomical distribution of the 220 cases reported so far reveals that most are intracranial and just over one-fifth are intraspinal. In decreasing frequency, intracranial tumors involve the supratentorial and infratentorial compartments, the pontocerebellar angle, the sellar and parasellar regions, and the cranial nerves. Intraspinal tumors are mainly located in the thoracic and cervical segments. Although most solitary fibrous tumors of the central nervous system are dural based, a small subset presents as subpial, intraparenchymal, intraventricular, or as tumors involving the nerve rootlets with no dural connection. Preoperative imaging and intraoperative findings suggest meningioma, schwannoma or neurofibroma, hemangiopericytoma, or pituitary tumors. Immunohistochemistry is critical to establish a definitive histopathological diagnosis. Vimentin, CD34, BCL2, and CD99 are the most consistently positive markers. The usual histologic type generally behaves in a benign manner if complete removal is achieved. Recurrence is anticipated when resection is subtotal or when the tumor exhibits atypical histology. The proliferative index as assessed by MIB1 labeling is of prognostic significance. Occasionally, tumors featuring conventional morphology may recur, perhaps because of minimal residual disease left behind during surgical extirpation. Rare extracranial metastases and tumor-related deaths are on record. Surgery is the treatment of choice. Stereotactic and external beam radiation therapy may be indicated for postsurgical tumor remnants and for unresectable recurrences. Long-term active surveillance of the patients is mandatory.

  19. C22:0- and C24:0-dihydroceramides confer mixed cytotoxicity in T-cell acute lymphoblastic leukemia cell lines.

    Directory of Open Access Journals (Sweden)

    Michael W Holliday

    Full Text Available We previously reported that fenretinide (4-HPR was cytotoxic to acute lymphoblastic leukemia (ALL cell lines in vitro in association with increased levels of de novo synthesized dihydroceramides, the immediate precursors of ceramides. However, the cytotoxic potentials of native dihydroceramides have not been defined. Therefore, we determined the cytotoxic effects of increasing dihydroceramide levels via de novo synthesis in T-cell ALL cell lines and whether such cytotoxicity was dependent on an absolute increase in total dihydroceramide mass versus an increase of certain specific dihydroceramides. A novel method employing supplementation of individual fatty acids, sphinganine, and the dihydroceramide desaturase-1 (DES inhibitor, GT-11, was used to increase de novo dihydroceramide synthesis and absolute levels of specific dihydroceramides and ceramides. Sphingolipidomic analyses of four T-cell ALL cell lines revealed strong positive correlations between cytotoxicity and levels of C22:0-dihydroceramide (ρ = 0.74-0.81, P ≤ 0.04 and C24:0-dihydroceramide (ρ = 0.84-0.90, P ≤ 0.004, but not between total or other individual dihydroceramides, ceramides, or sphingoid bases or phosphorylated derivatives. Selective increase of C22:0- and C24:0-dihydroceramide increased level and flux of autophagy marker, LC3B-II, and increased DNA fragmentation (TUNEL assay in the absence of an increase of reactive oxygen species; pan-caspase inhibition blocked DNA fragmentation but not cell death. C22:0-fatty acid supplemented to 4-HPR treated cells further increased C22:0-dihydroceramide levels (P ≤ 0.001 and cytotoxicity (P ≤ 0.001. These data demonstrate that increases of specific dihydroceramides are cytotoxic to T-cell ALL cells by a caspase-independent, mixed cell death mechanism associated with increased autophagy and suggest that dihydroceramides may contribute to 4-HPR-induced cytotoxicity. The targeted increase of specific acyl chain dihydroceramides

  20. Book review: Ham radio's technical culture. By K. Haring. Cambridge, MA: The MIT Press. 2007. xvii + 220 pp. £18.95. cloth. ISBN: 0262083558

    OpenAIRE

    Geoghegan, Hilary

    2008-01-01

    284 Book reviewHam radio's technical culture. By K. Haring. Cambridge, MA: The MIT Press. 2007. xvii + 220 pp. £18.95. cloth. ISBN: 0262083558 SAGE Publications, Inc.2008DOI: 10.1177/14744740080150020805 HilaryGeoghegan Department of Geography Royal Holloway, University of London `G4PDH, G4PDH, this is 2M1QQQ calling you. How do you copy?' Music to the amateur radio enthusiast's ears. Radio hams are the subject of Kristen Haring's enjoyab...

  1. Design and evaluation of protein expression in a recombinant plasmid encoding epitope gp 350/220 of the Epstein-Barr virus (EBV)

    Science.gov (United States)

    Himmah, Karimatul; Dluha, Nurul; Anyndita, Nadya V. M.; Rifa'i, Muhaimin; Widodo

    2017-05-01

    The Epstein - Barr virus (EBV) causes severe infections that may lead to cancers such as nasopharyngeal carcinoma. Development of effective EBV vaccines is necessary to prevent the virus spreading throughout the community. TheEBV has a surface protein gp 350/220, which serves as an antigen to help interact with host cells. Epitopes of the protein can potentially serve as bases for a vaccine. In a previous study, we have found a conserved epitope of gp 350/220 from all strains EBV through an in silico approach. The aim of this study is to design and overproduce a recombinant peptide of epitope gp 350/220 in E. coli. DNA encoding the conserved epitope was synthesized and cloned into plasmid pET-22b(+); the recombinant plasmid was transformed into E. coli strains DH5α and BL21. The transformed plasmid DNA was isolated and confirmed by restriction using XbaI and PstI enzymes followed by DNA sequencing. Protein expression was induced by isopropyl-D-thiogalactopyranoside (IPTG) with final concentrations of 0.1, 0.2, 1, and 2 mM in consecutive times. An osmotic shock method was used to isolate protein from periplasmic fraction of E. coli DH5α and BL21. The SDS-PAGE analysis was carried out to detect peptide target (3.4 kDa). Based on this result, the induction process did not work properly, and thus needs further investigation.

  2. [A clinical study on the comparison of the performance of stainless steel ring (SSR), uterine cavity-shaped device (UCD), MLCu250 and TCu220C].

    Science.gov (United States)

    Li, Y

    1988-01-01

    In Dafeng County, Jiangsu Province, 710 healthy peasant women, ages 22- 32, were randomly allocated to the use of several different IUDs for periods of 3-9 months postpartum. Although this single-blind study continued for 2 years, only 1 year's worth of data is presented in this paper. The total termination rate was lowest with the MLCu 250, followed by the UCD, and then the TCu220c. The UCD is an inert, stainless steel device which assumes an isosceles shape to conform to the uterine cavity. The SSR had the highest termination rate (see table 1). There was a significant difference between the total termination rates of the SSR and each of the other 3 IUDs, while no significant difference was seen between those of the 3 themselves. The removals due to bleeding and pain were much higher in the TCu220c than in the MLCu250. The results of this study seem dissimilar to those obtained in IUD trials carried out among housewives and office workers. Clearly, in women performing strenuous physical tasks, the straight and rigid transverse arms of the TCu220c may impose more stimulation on the uterine wall than the soft and curved arms of the MLCu250. (author's modified)

  3. Maximum Heart Rate during exercise: Reliability of the 220-age and Tanaka formulas in healthy young people at a moderate elevation

    Directory of Open Access Journals (Sweden)

    Luis Eduardo Cruz-Martínez

    2014-10-01

    Full Text Available Background. The formulas to predict maximum heart rate have been used for many years in different populations. Objective. To verify the significance and the association of formulas of Tanaka and 220-age when compared to real maximum heart rate. Materials and methods. 30 subjects -22 men, 8 women- between 18 and 30 years of age were evaluated on a cycle ergometer and their real MHR values were statistically compared with the values of formulas currently used to predict MHR. Results. The results demonstrate that both Tanaka p=0.0026 and 220-age p=0.000003 do not predict real MHR, nor does a linear association exist between them. Conclusions. Due to the overestimation with respect to real MHR value that these formulas make, we suggest a correction of 6 bpm to the final result. This value represents the median of the difference between the Tanaka value and the real MHR. Both Tanaka (r=0.272 and 220-age (r=0.276 are not adequate predictors of MHR during exercise at the elevation of Bogotá in subjects of 18 to 30 years of age, although more study with a larger sample size is suggested.

  4. Induction of interleukin-6 after stimulation of human B-cell CD21 by Epstein-Barr virus glycoproteins gp350 and gp220.

    Science.gov (United States)

    Tanner, J E; Alfieri, C; Chatila, T A; Diaz-Mitoma, F

    1996-01-01

    The cellular receptor for Epstein-Barr virus (EBV) is the type 2 complement receptor, CD21. At initial infection, EBV virion glycoproteins gp350 and gp220 bind to CD21. We report here that the cross-linking of CD21 by gp350/220 results in increased amounts of interleukin 6 (IL-6) RNA and IL-6 protein. This effect could be blocked with anti-gp350/220 and anti-CD21 monoclonal antibodies. Induction of IL-6 in B cells by EBV could be mimicked by treatment with the protein kinase C (PKC) activator phorbol 12,13-dibutyrate but not with the calcium ionophore ionomycin. IL-6 induction by EBV was inhibited with the PKC-specific inhibitor bisindolylmaleimide or the protein tyrosine kinase inhibitors methyl 2,5-dihydroxycinnamate and herbimycin A, indicating that the induction of IL-6 following CD21 cross-linking is mediated through PKC- and protein tyrosine kinase-dependent pathways.

  5. Isolation, development and identification of salt-tolerant bacterial consortium from crude-oil-contaminated soil for degradation of di-azo dye Reactive Blue 220.

    Science.gov (United States)

    Patel, Vipul R; Bhatt, Nikhil

    2015-01-01

    The objective of this study was development and characterization of a halophilic bacterial consortium for rapid decolorization and degradation of a wide range of dyes and their mixtures. The 16S rRNA gene analysis of developed halophilic consortium VN.1 showed that the bacterial consortium contained six bacterial strains, which were identified as Pseudomonas fluorescens HM480360, Enterobacter aerogenes HM480361, Shewanella sp. HM589853, Arthrobacter nicotianae HM480363, Bacillus beijingensis HM480362 and Pseudomonas aeruginosa JQ659549. Halophilic consortium VN.1 was able to decolorize up to 2,500 mg/L RB220 with >85% chemical oxygen demand (COD) reduction under static condition at 30 °C and pH 8.0 in the presence of 7% NaCl. VN.1 also exhibited more than 85% COD reduction with >25 mg/(L h) rate of decolorization in the case of different reactive dye mixtures. We propose the symmetric cleavage of RB220 using Fourier transform infrared, high-performance liquid chromatography (HPLC), nuclear magnetic resonance and gas chromatography-mass spectrometry analysis, and confirmed the formation of sodium-4-aminobenzenesulfonate, sodium-6-aminonepthalenesulfonate, and sodiumbenzene/nepthalenesulfonate. Toxicity studies confirm that the biodegraded products of RB220 effluent stimulate the growth of plants as well as the bacterial community responsible for soil fertility.

  6. EFSA CEF Panel (EFSA Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids), 2013. Scientific Opinion on Flavouring Group Evaluation 220, Revision 2 (FGE.220Rev1): α,β-Unsaturated ketones and precursors from chemical subgroup 4.4 of FGE.19: 3(2H)-Furanones

    DEFF Research Database (Denmark)

    Beltoft, Vibe Meister; Binderup, Mona-Lise; Lund, Pia

    The Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids of the European Food Safety Authority was requested to evaluate the genotoxic potential of 10 flavouring substances from subgroup 4.4 of FGE.19 in the Flavouring Group Evaluation 220 (FGE.220). FGE.220 is subdivided...... additional genotoxicity data were requested. In FGE.220, Revision 1, the Panel concluded, based on new submitted data, that for the substances in subgroup 4.4b there is no concern for genotoxicity. The Flavour Industry has now provided additional genotoxicity studies for two representative substances......, including analysis of liver. This is also applicable to 2,5-dimethyl-4-methoxyfuran-3(2H)-one [FL-no:13.089] and 2,5-dimethyl-4-ethoxyfuran-3(2H)-one [FL-no:13.117], which are covered by the representative substance 4-acetyl-2,5-dimethylfuran-3(2H)-one [FL-no:13.175]. The Flavour Industry has informed...

  7. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  8. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  9. Diverse IgG serum response to novel glycopeptide epitopes detected within immunodominant stretches of Epstein-Barr virus glycoprotein 350/220: diagnostic potential of O-glycopeptide microarrays.

    Science.gov (United States)

    D'Arrigo, Isotta; Cló, Emiliano; Bergström, Tomas; Olofsson, Sigvard; Blixt, Ola

    2013-10-01

    The Epstein-Barr virus (EBV) envelope glycoprotein 350/220 (gp350/220) is the most abundant molecule on the viral surface and it is responsible for the initial viral attachment to cell surface of the host. As many other viral envelope proteins, it is highly glycosylated, not least with O-linked glycans, most of which essential for EBV life cycle. EBV gp350/220 is also a primary target for neutralizing antibodies in the human hosts and a promising candidate for an EBV vaccine. Here we showed that recombinant GalNAc transferases can glycosylate scan peptides of the EBV gp350/220 envelope protein immobilized on microarray glass slides. We also identified serum IgG antibodies to a selection of peptides and O-glycopeptides, whereas sera from EBV-IgG negative individuals remained negative. We here describe novel glycopeptide epitopes present within immunodominant stretches of EBV gp350/220 and demonstrate a remarkable variability between individual samples with respect to their reactivity patterns to peptides and glycopeptides. The study provides additional insights into the complex B-cell response towards the EBV gp350/220 envelope protein, which may have implications for diagnostic and vaccine developments.

  10. Putative Dopamine Agonist (KB220Z) Attenuates Lucid Nightmares in PTSD Patients: Role of Enhanced Brain Reward Functional Connectivity and Homeostasis Redeeming Joy

    Science.gov (United States)

    McLaughlin, Thomas; Blum, Kenneth; Oscar-Berman, Marlene; Febo, Marcelo; Agan, Gozde; Fratantonio, James L.; Simpatico, Thomas; Gold, Mark S.

    2015-01-01

    Background Lucid dreams are frequently pleasant and training techniques have been developed to teach dreamers to induce them. In addition, the induction of lucid dreams has also been used as a way to ameliorate nightmares. On the other hand, lucid dreams may be associated with psychiatric conditions, including Post-Traumatic Stress Disorder (PTSD) and Reward Deficiency Syndrome-associated diagnoses. In the latter conditions, lucid dreams can assume an unpleasant and frequently terrifying character. Case Presentations We present two cases of dramatic alleviation of terrifying lucid dreams in patients with PTSD. In the first case study, a 51-year-old, obese woman, diagnosed with PTSD and depression, had attempted suicide and experienced terrifying lucid nightmares linked to sexual/physical abuse from early childhood by family members including her alcoholic father. Her vivid “bad dreams” remained refractory in spite of 6 months of treatment with Dialectical Behavioral Therapy (DBT) and standard pharmaceutical agents which included prazosin, clonidie and Adderall. The second 39-year-old PTSD woman patient had also suffered from lucid nightmares. Results The medication visit notes reveal changes in the frequency, intensity and nature of these dreams after the complex putative dopamine agonist KB220Z was added to the first patient’s regimen. The patient reported her first experience of an extended period of happy dreams. The second PTSD patient, who had suffered from lucid nightmares, was administered KB220Z to attenuate methadone withdrawal symptoms and incidentally reported dreams full of happiness and laughter. Conclusions These cases are discussed with reference to the known effects of KB220Z including enhanced dopamine homeostasis and functional connectivity of brain reward circuitry in rodents and humans. Their understanding awaits intensive investigation involving large-population, double-blinded studies. PMID:26132915

  11. Putative dopamine agonist (KB220Z) attenuates lucid nightmares in PTSD patients: role of enhanced brain reward functional connectivity and homeostasis redeeming joy.

    Science.gov (United States)

    McLaughlin, Thomas; Blum, Kenneth; Oscar-Berman, Marlene; Febo, Marcelo; Agan, Gozde; Fratantonio, James L; Simpatico, Thomas; Gold, Mark S

    2015-06-01

    Lucid dreams are frequently pleasant and training techniques have been developed to teach dreamers to induce them. In addition, the induction of lucid dreams has also been used as a way to ameliorate nightmares. On the other hand, lucid dreams may be associated with psychiatric conditions, including Post-Traumatic Stress Disorder (PTSD) and Reward Deficiency Syndrome-associated diagnoses. In the latter conditions, lucid dreams can assume an unpleasant and frequently terrifying character. We present two cases of dramatic alleviation of terrifying lucid dreams in patients with PTSD. In the first case study, a 51-year-old, obese woman, diagnosed with PTSD and depression, had attempted suicide and experienced terrifying lucid nightmares linked to sexual/physical abuse from early childhood by family members including her alcoholic father. Her vivid "bad dreams" remained refractory in spite of 6 months of treatment with Dialectical Behavioral Therapy (DBT) and standard pharmaceutical agents which included prazosin, clonidie and Adderall. The second 39-year-old PTSD woman patient had also suffered from lucid nightmares. The medication visit notes reveal changes in the frequency, intensity and nature of these dreams after the complex putative dopamine agonist KB220Z was added to the first patient's regimen. The patient reported her first experience of an extended period of happy dreams. The second PTSD patient, who had suffered from lucid nightmares, was administered KB220Z to attenuate methadone withdrawal symptoms and incidentally reported dreams full of happiness and laughter. These cases are discussed with reference to the known effects of KB220Z including enhanced dopamine homeostasis and functional connectivity of brain reward circuitry in rodents and humans. Their understanding awaits intensive investigation involving large-population, double-blinded studies.

  12. Characterization of genes for synthesis and catabolism of a new rhizopine induced in nodules by Rhizobium meliloti Rm220-3: extension of the rhizopine concept.

    OpenAIRE

    Saint, C P; Wexler, M; Murphy, P J; Tempé, J; Tate, M E; Murphy, P J

    1993-01-01

    Rhizopines are selective growth substrates synthesized in nodules only by strains of rhizobia capable of their catabolism. We report the isolation and study of genes for the synthesis and catabolism of a new rhizopine, scyllo-inosamine (sIa), from alfalfa nodules induced by Rhizobium meliloti Rm220-3. This compound is similar in structure to the previously described rhizopine 3-O-methyl-scyllo-inosamine from R. meliloti L5-30 (P.J. Murphy, N. Heycke, Z. Banfalvi, M.E. Tate, F.J. de Bruijn, A....

  13. Mass distributions of 22.0 MeV neutron-induced fission of sup 2 sup 3 sup 8 U

    CERN Document Server

    LiuYongHui; Cui An Zhi; Feng Jing; Guo Jing Ru; Li Ze; Qi Bu Jia; Ruan Xi Chao; Sun Hong Qing; Tang Hong Qing; Yang Yi; Zhang Sheng Dong; Zhou Zu Ying

    2001-01-01

    Chain yields of 32 chains were determined for the fission of sup 2 sup 3 sup 8 U induced by 22.0 MeV mono-energetic neutrons for the first time. Fission product activities were measured by HPGe gamma ray spectrometry without chemical separation. Absolute fission rate was monitored with a double fission chamber. The efficiency of the fission chamber was checked by determination of sup 1 sup 9 sup 8 Au activity from sup 1 sup 9 sup 7 Au(n, gamma) sup 1 sup 9 sup 8 Au reaction

  14. METHODICAL APPROACHES TO THE CHOICE OF THE NEW GENERATION OF HIGH-VOLTAGE POWER TRANSMISSION LINE 220 kV OPTIONS

    Directory of Open Access Journals (Sweden)

    POSTOLATI V.M.

    2010-08-01

    Full Text Available The Transmission Power Lines of new generation are described in the article (single- compact, double-circuit compact, double-circuit Controlled Self-compensating High Voltage Transmission Power Lines (CSHVL. Basic principles of creation, design elements and comparative characteristics of the transmission lines of the new generation are described, the advantages of its are showed. Methodical approaches to the choosing of a new generation of transmission lines and facilities management FACTS are formulated. Methodical approaches to the choice of options for transmission lines 220 kV and facilities management are shown.

  15. EFSA Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids (CEF); Scientific Opinion on Flavouring Group Evaluation 220, Revision 1 (FGE.220Rev1): alpha,beta-Unsaturated ketones and precursors from chemical subgroup 4.4 of FGE.19: 3(2H)-Furanones

    DEFF Research Database (Denmark)

    Larsen, John Christian; Nørby, Karin Kristiane; Beltoft, Vibe Meister

    The European Food Safety Authority (EFSA) asked the Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids (the Panel) to provide scientific advice to the Commission on the implications for human health of chemically defined flavouring substances used in or on foodstuffs...... bond can be involved in keto-enol tautomerism (subgroup 4.4b). For the substances in subgroup 4.4a [FL-no: 13.089, 13.117, 13.119, 13.157 and 13.175], the previous conclusions of the Panel in FGE.220 were that the available data on genotoxicity were too limited to evaluate these substances through...... was requested. In March 2009 the Flavouring Industry submitted new data in reply to the above requested data for subgroup 4.4b of FGE.220. These data have now been examined by the Panel which has concluded the following. The results of a valid rat fertility and dominant lethal study have shown...

  16. A Naturally Occurring Mutation K220T in the Pleiotropic Activator PrfA of Listeria Monocytogenes Results in a Loss of Virulence Due to Decreasing DNA-Binding Affinity

    Energy Technology Data Exchange (ETDEWEB)

    Velge,P.; Herler, M.; Johansson, J.; Roches, S.; Temoin, S.; Fedorov, A.; Gracieux, P.; Almo, S.; Goebel, W.; Cossart, P.

    2007-01-01

    The sequencing of prfA, encoding the transcriptional regulator of virulence genes, in 26 low-virulence field Listeria monocytogenes strains showed that eight strains exhibited the same single amino-acid substitution: PrfAK220T. These strains exhibited no expression of PrfA-regulated proteins and thus no virulence. This substitution inactivated PrfA, since expression of the PrfAK220T mutant gene in an EGD{Delta}prfA strain did not restore the haemolytic and phosphatidylcholine phospholipase C activities, in contrast to the wild-type prfA gene. The substitution of the lysine at position 220 occurred in the helix H. However, the data showed that the PrfAK220T protein is dimerized just as well as its wild-type counterpart, but does not bind to PrfA-boxes. PrfAK220T did not form a PrfA-DNA complex in electrophoretic mobility shift assays, but low concentrations of CI complexes (PrfAK220T-RNA polymerase-DNA complex) were formed by adding RNA polymerase, suggesting that PrfA interacted with RNA polymerase in solution in the absence of DNA. Formation of some transcriptionally active complexes was confirmed by in vitro runoff transcription assays and quantitative RT-PCR. Crystallographic analyses described the structure of native PrfA and highlighted the key role of allosteric changes in the activity of PrfA and especially the role of the Lys220 in the conformation of the helix-turn-helix (HTH) motif.

  17. The evolution of Epstein-Barr virus inferred from the conservation and mutation of the virus glycoprotein gp350/220 gene.

    Science.gov (United States)

    Kawaguchi, Asako; Kanai, Kyosuke; Satoh, Yukio; Touge, Chizu; Nagata, Keiko; Sairenji, Takeshi; Inoue, Yoshitsugu

    2009-04-01

    To study variations of Epstein-Barr virus (EBV), we analyzed the gp350/220 gene for several cell lines and Japanese wild isolates using direct sequencing. The N-terminal region was highly conserved in all EBVs except for Jijoye/P3HR-1 and a few isolates. The variation of the region coincided with EBV types A and B (also referred to as types 1 and 2) and were, respectively, designated as the types a and b. The type A/a was detected in most Japanese cell lines and wild isolates, and was classified as China1 type with latent membrane protein (LMP) 1 gene. The type B/b was detected in only a few wild isolates with the Med and China2 types. The C-terminus had more diversity than the N-terminus and lacked the divergence between types A/a and B/b. The phylogenetic analyses of the gp350/220 and LMP1 genes may suggest a mode of EBV evolution into types A/a and B/b and then to LMP1 subtypes.

  18. Early Intervention of Intravenous KB220IV- Neuroadaptagen Amino-Acid Therapy (NAAT)™ Improves Behavioral Outcomes in a Residential Addiction Treatment Program: A Pilot Study

    Science.gov (United States)

    Miller, Merlene; Chen, Amanda LC; Stokes, Stan D.; Silverman, Susan; Bowirrat, Abdalla; Manka, Matthew; Manka, Debra; Miller, David K.; Perrine, Kenneth; Chen, Thomas JH; Bailey, John A.; Downs, William; Waite, Roger L.; Madigan, Margaret A.; Braverman, Eric R.; Damle, Uma; Kerner, Mallory; Giordano, John; Morse, Siobhan; Oscar-Berman, Marlene; Barh, Debmalya; Blum, Kenneth

    2014-01-01

    Substance use disorders (SUD) are inheritable and the culprit is hypodopaminergic function regulated by reward genes. We evaluated a natural dopaminergic agonist; KB220 intravenous (IV) and oral variants, to improve dopaminergic function in SUD. Our pilot experiment found a significant reduction of chronic symptoms, measured by the Chronic Abstinence Symptom Severity (CASS) Scale. The combined group (IV and oral) did significantly better than the oral-only group over the first week and 30-day follow-up period. Next, the combination was given to129 subjects and three factors; Emotion, Somatic, and Impaired Cognition, with eigenvalues greater than one were extracted for baseline CASS-Revised (CASS-R) variables. Paired sample t-tests for pre and post-treatment scales showed significant declines (p = .00001) from pre- to post-treatment: t = 19.1 for Emotion, t = 16.1 for Somatic, and t = 14.9 for Impaired Cognition. In a two-year follow-up of 23 subjects who underwent KB220IV therapy (at least five IV treatments over seven days) plus orals for 30+ days: 21 (91%) were sober at six months, 19 (82%) having no relapse; 19 (82%) were sober at one year, 18 (78%) having no relapse; and 21 (91%) were sober two-years post-treatment, 16 (70%) having no relapse. We await additional research and advise caution in interpreting these encouraging results. PMID:23457891

  19. Enhanced functional connectivity and volume between cognitive and reward centers of naïve rodent brain produced by pro-dopaminergic agent KB220Z.

    Directory of Open Access Journals (Sweden)

    Marcelo Febo

    Full Text Available Dopaminergic reward dysfunction in addictive behaviors is well supported in the literature. There is evidence that alterations in synchronous neural activity between brain regions subserving reward and various cognitive functions may significantly contribute to substance-related disorders. This study presents the first evidence showing that a pro-dopaminergic nutraceutical (KB220Z significantly enhances, above placebo, functional connectivity between reward and cognitive brain areas in the rat. These include the nucleus accumbens, anterior cingulate gyrus, anterior thalamic nuclei, hippocampus, prelimbic and infralimbic loci. Significant functional connectivity, increased brain connectivity volume recruitment (potentially neuroplasticity, and dopaminergic functionality were found across the brain reward circuitry. Increases in functional connectivity were specific to these regions and were not broadly distributed across the brain. While these initial findings have been observed in drug naïve rodents, this robust, yet selective response implies clinical relevance for addicted individuals at risk for relapse, who show reductions in functional connectivity after protracted withdrawal. Future studies will evaluate KB220Z in animal models of addiction.

  20. Low-Resolution Electromagnetic Tomography (LORETA) of changed Brain Function Provoked by Pro-Dopamine Regulator (KB220z) in one Adult ADHD case

    Science.gov (United States)

    Steinberg, Bruce; Blum, Kenneth; McLaughlin, Thomas; Lubar, Joel; Febo, Marcelo; Braverman, Eric R.; Badgaiyan, Rajendra D

    2016-01-01

    Attention Deficit-Hyperactivity Disorder (ADHD) often continues into adulthood. Recent neuroimaging studies found lowered baseline dopamine tone in the brains of affected individuals that may place them at risk for Substance Use Disorder (SUD). This is an observational case study of the potential for novel management of Adult ADHD with a non-addictive glutaminergic-dopaminergic optimization complex KB200z. Low-resolution electromagnetic tomography (LORETA) was used to evaluate the effects of KB220z on a 72-year-old male with ADHD, at baseline and one hour following administration. The resultant z-scores, averaged across Eyes Closed, Eyes Open and Working Memory conditions, increased for each frequency band, in the anterior, dorsal and posterior cingulate regions, as well as the right dorsolateral prefrontal cortex during Working Memory, with KB220z. These scores are consistent with other human and animal neuroimaging studies that demonstrated increased connectivity volumes in reward circuitry and may offer a new approach to ADHD treatment. However, larger randomized trials to confirm these results are required. PMID:27610420

  1. KB220Z™ a Pro-Dopamine Regulator Associated with the Protracted, Alleviation of Terrifying Lucid Dreams. Can We Infer Neuroplasticity-induced Changes in the Reward Circuit?

    Science.gov (United States)

    McLaughlin, Thomas; Febo, Marcelo; Badgaiyan, Rajendra D; Barh, Debmalya; Dushaj, Kristina; Braverman, Eric R; Li, Mona; Madigan, Margaret A; Blum, Kenneth

    2016-01-01

    Recent reports by our laboratory have indicated that lucid dreams may be linked to psychiatric conditions, including Attention Deficit Hyperactivity Disorder (ADHD) and other Reward Deficiency Syndrome-related diagnoses. In the latter case, it has been our observation that such lucid dreams can be unpleasant and frequently terrifying. We present four cases of a dramatic and persistent alleviation of terrifying, lucid dreams in patients diagnosed with ADHD/PTSD and/or opiate/opioid addiction. The amelioration of such dreams could well be permanent, since the patients had stopped taking the nutraceutical for between 10 to 12 months, without their recollection or recurrence. In the first case, the patient is a 47-year-old, married male who required continued Buprenorphine/ Naloxone (Suboxone) treatment. The second case involved a 32-year-old female with the sole diagnosis of ADHD. The third case involves a 38-year-old male who carried the diagnoses of Substance Use Dependence and ADHD. The fourth case involved a 50-year-old female with the diagnoses of Alcohol Abuse, ADHD and Posttraumatic Stress Disorder. In order to attempt to understand the possibility of neuroplasticity, we evaluated the effect of KB220Z in non-opioid-addicted rats utilizing functional Magnetic Resonance Imaging methodology. While we cannot make a definitive claim because rat brain functional connectivity may not be exactly the same as humans, it does provide some interesting clues. We did find following seeding of the dorsal hippocampus, enhanced connectivity volume across several Regions of Interest (ROI), with the exception of the pre- frontal cortex. Interestingly, the latter region is only infrequently activated in lucid human dreaming, when the dreamer reports that he/she had the thought that they were dreaming during the lucid dream. The four patients initially reported a gradual but, then, complete amelioration of their long-term, terrifying, lucid dreams, while taking KB220Z. The

  2. KB220Z™ a Pro-Dopamine Regulator Associated with the Protracted, Alleviation of Terrifying Lucid Dreams. Can We Infer Neuroplasticity-induced Changes in the Reward Circuit?

    Science.gov (United States)

    McLaughlin, Thomas; Febo, Marcelo; Badgaiyan, Rajendra D.; Barh, Debmalya; Dushaj, Kristina; Braverman, Eric R.; Li, Mona; Madigan, Margaret A.; Blum, Kenneth

    2017-01-01

    Background Recent reports by our laboratory have indicated that lucid dreams may be linked to psychiatric conditions, including Attention Deficit Hyperactivity Disorder (ADHD) and other Reward Deficiency Syndrome-related diagnoses. In the latter case, it has been our observation that such lucid dreams can be unpleasant and frequently terrifying. Case presentations We present four cases of a dramatic and persistent alleviation of terrifying, lucid dreams in patients diagnosed with ADHD/PTSD and/or opiate/opioid addiction. The amelioration of such dreams could well be permanent, since the patients had stopped taking the nutraceutical for between 10 to 12 months, without their recollection or recurrence. In the first case, the patient is a 47-year-old, married male who required continued Buprenorphine/ Naloxone (Suboxone) treatment. The second case involved a 32-year-old female with the sole diagnosis of ADHD. The third case involves a 38-year-old male who carried the diagnoses of Substance Use Dependence and ADHD. The fourth case involved a 50-year-old female with the diagnoses of Alcohol Abuse, ADHD and Posttraumatic Stress Disorder. Results In order to attempt to understand the possibility of neuroplasticity, we evaluated the effect of KB220Z in non-opioid-addicted rats utilizing functional Magnetic Resonance Imaging methodology. While we cannot make a definitive claim because rat brain functional connectivity may not be exactly the same as humans, it does provide some interesting clues. We did find following seeding of the dorsal hippocampus, enhanced connectivity volume across several Regions of Interest (ROI), with the exception of the pre- frontal cortex. Interestingly, the latter region is only infrequently activated in lucid human dreaming, when the dreamer reports that he/she had the thought that they were dreaming during the lucid dream. Conclusions The four patients initially reported a gradual but, then, complete amelioration of their long

  3. Intracranial inertial cavitation threshold and thermal ablation lesion creation using MRI-guided 220-kHz focused ultrasound surgery: preclinical investigation.

    Science.gov (United States)

    Xu, Zhiyuan; Carlson, Carissa; Snell, John; Eames, Matt; Hananel, Arik; Lopes, M Beatriz; Raghavan, Prashant; Lee, Cheng-Chia; Yen, Chun-Po; Schlesinger, David; Kassell, Neal F; Aubry, Jean-Francois; Sheehan, Jason

    2015-01-01

    In biological tissues, it is known that the creation of gas bubbles (cavitation) during ultrasound exposure is more likely to occur at lower rather than higher frequencies. Upon collapsing, such bubbles can induce hemorrhage. Thus, acoustic inertial cavitation secondary to a 220-kHz MRI-guided focused ultrasound (MRgFUS) surgery is a serious safety issue, and animal studies are mandatory for laying the groundwork for the use of low-frequency systems in future clinical trials. The authors investigate here the in vivo potential thresholds of MRgFUS-induced inertial cavitation and MRgFUS-induced thermal coagulation using MRI, acoustic spectroscopy, and histology. Ten female piglets that had undergone a craniectomy were sonicated using a 220-kHz transcranial MRgFUS system over an acoustic energy range of 5600-14,000 J. For each piglet, a long-duration sonication (40-second duration) was performed on the right thalamus, and a short sonication (20-second duration) was performed on the left thalamus. An acoustic power range of 140-300 W was used for long-duration sonications and 300-700 W for short-duration sonications. Signals collected by 2 passive cavitation detectors were stored in memory during each sonication, and any subsequent cavitation activity was integrated within the bandwidth of the detectors. Real-time 2D MR thermometry was performed during the sonications. T1-weighted, T2-weighted, gradient-recalled echo, and diffusion-weighted imaging MRI was performed after treatment to assess the lesions. The piglets were killed immediately after the last series of posttreatment MR images were obtained. Their brains were harvested, and histological examinations were then performed to further evaluate the lesions. Two types of lesions were induced: thermal ablation lesions, as evidenced by an acute ischemic infarction on MRI and histology, and hemorrhagic lesions, associated with inertial cavitation. Passive cavitation signals exhibited 3 main patterns identified as

  4. Electromagnetic characterization of nonevaporable getter properties between 220–330 and 500–750 GHz for the Compact Linear Collider damping rings

    Directory of Open Access Journals (Sweden)

    E. Koukovini-Platia

    2017-01-01

    Full Text Available Due to its effective pumping ability, nonevaporable getter (NEG coating is considered for the vacuum chambers of the Compact Linear Collider (CLIC electron damping rings (EDR. The aim is to suppress fast beam ion instabilities. The electromagnetic (EM characterization of the NEG properties up to ultra-high frequencies is required for the correct impedance modeling of the damping ring (DR components. The properties are determined using rectangular waveguides which are coated with NEG. The method is based on a combination of complex transmission coefficient S_{21} measurements with a vector network analyzer (VNA and 3D simulations using CST Microwave Studio® (CST MWS. The frequency ranges discussed in this paper are 220–330 and 500–750 GHz.

  5. 220 μJ monolithic single-frequency Q-switched fiber laser at 2 μm by using highly Tm-doped germanate fibers.

    Science.gov (United States)

    Shi, Wei; Petersen, Eliot B; Nguyen, Dan T; Yao, Zhidong; Chavez-Pirson, Arturo; Peyghambarian, N; Yu, Jirong

    2011-09-15

    We report a unique all fiber-based single-frequency Q-switched laser in a monolithic master oscillator power amplifier configuration at ~1920 nm by using highly Tm-doped germanate fibers for the first time. The actively Q-switched fiber laser seed was achieved by using a piezo to press the fiber in the fiber Bragg grating cavity and modulate the fiber birefringence, enabling Q-switching with pulse width and repetition rate tunability. A single-mode polarization maintaining large core 25 μm highly Tm-doped germanate fiber was used in the power amplifier stage. For 80 ns pulses with 20 kHz repetition rate, we achieved 220 μJ pulse energy, which corresponds to a peak power of 2.75 kW with transform-limited linewidth.

  6. The luminescence dating chronology of a deep core from Bosten Lake (NW China) in arid central Asia reveals lake evolution over the last 220 ka

    DEFF Research Database (Denmark)

    Li, Guoqiang; Duan, Yanwu; Huang, Xiaozhong

    2016-01-01

    in the southern Tianshan Mountains in central ACA. A 51.6-m-deep lacustrine succession was retrieved from the lake and 30 samples from the succession were used for luminescence dating to establish a chronology based on multi-grain quartz OSL and K-feldspar post-IR IRSL (pIRIR290) dating. Quartz OSL ages were only....... A stable deep lake occurred at c. 220, 210–180, c. 165, 70–60, 40–30 and 20–5 ka, while shallow levels occurred at c. 215, 180–165, 100–70, 60–40 and 30–20 ka. Bosten Lake levels decreased by at least ~29 m and possibly the lake even dried up between c. 160 and c. 100 ka. We suggest that the water...

  7. UV spectroscopy of Titan's atmosphere, planetary organic chemistry and prebiological synthesis. II - Interpretation of new IUE observations in the 220-335 nm range

    Science.gov (United States)

    Courtin, Regis; Wagener, Richard; Mckay, Christopher P.; Caldwell, John; Fricke, Karl-Heinrich

    1991-01-01

    The theoretical model developed by McKay et al. (1989) to characterize the size distribution, thermal structure, and chemical composition of the stratospheric haze of Titan is applied to new 220-335-nm albedo measurements obtained with the long-wavelength prime camera of the IUE during August 1987. Data and model predictions are presented in extensive graphs and discussed in detail. It is shown that a simple model with particles of one size at a given altitude does not accurately reproduce the observed features in all spectral regions, but that good general agreement is obtained using a model with a uniformly mixed layer at 150-600 km and a bimodal distribution of small 'polymer' haze particles (radius less than 20 nm) and larger haze particles (radius 100-500 nm). The number densities implied by this model require, however, a mechanism such as electrostatic charging or reaction kinetics to inhibit coagulation of the smaller particles.

  8. An in silico algorithm for identifying stabilizing pockets in proteins: test case, the Y220C mutant of the p53 tumor suppressor protein.

    Science.gov (United States)

    Bromley, Dennis; Bauer, Matthias R; Fersht, Alan R; Daggett, Valerie

    2016-09-01

    The p53 tumor suppressor protein performs a critical role in stimulating apoptosis and cell cycle arrest in response to oncogenic stress. The function of p53 can be compromised by mutation, leading to increased risk of cancer; approximately 50% of cancers are associated with mutations in the p53 gene, the majority of which are in the core DNA-binding domain. The Y220C mutation of p53, for example, destabilizes the core domain by 4 kcal/mol, leading to rapid denaturation and aggregation. The associated loss of tumor suppressor functionality is associated with approximately 75 000 new cancer cases every year. Destabilized p53 mutants can be 'rescued' and their function restored; binding of a small molecule into a pocket on the surface of mutant p53 can stabilize its wild-type structure and restore its function. Here, we describe an in silico algorithm for identifying potential rescue pockets, including the algorithm's integration with the Dynameomics molecular dynamics data warehouse and the DIVE visual analytics engine. We discuss the results of the application of the method to the Y220C p53 mutant, entailing finding a putative rescue pocket through MD simulations followed by an in silico search for stabilizing ligands that dock into the putative rescue pocket. The top three compounds from this search were tested experimentally and one of them bound in the pocket, as shown by nuclear magnetic resonance, and weakly stabilized the mutant. © The Author 2016. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  9. Chemical and physical evolution of dolomite precipitation at 180°C and 220°C from calcite and aragonite seeds

    Science.gov (United States)

    Kell-Duivestein, Isaac; Dietzel, Martin; Mavromatis, Vasileios

    2016-04-01

    In this present study an experimental approach is taken to gain a better understanding of secondary dolomite formation under diagenetic hydrothermal conditions. A series of 60 experiments were set up in closed bomb reactors with Teflon inserts to simulate exposure of calcium carbonate materials of (i) aragonite and (ii) calcite to hydrothermal conditions. 30 reactors were prepared using calcite as a seed material and 30 using aragonite. In each experiment 330mg of the seed calcium carbonate was placed in 30mL of 0.2M MgCl2 solution along with 252mg NaHCO3 to balance charges. 15 of each the calcite and aragonite prepared reactors were placed in an oven at 180°C and 15 of each at 220°C. Samples were then progressively removed from the ovens beginning in short time intervals and increasing the time apart as the phase transformations became less rapid (ie. after 3, 6, 13, 21, 31, 56 days *ongoing*). Samples were separated into fluid and solid phases by filtration for separate analysis. Fluids were analysed by titration for alkalinity and ICP-OES for elemental concentrations of major cations to determine the migration of major cations between the calcium carbonate seed material and the reaction fluid. Solid samples were analysed with FTIR-spectroscopy and X-ray diffraction of powdered smears on glass loading slides to identify the present mineral phases. Rietveld analysis was conducted on the XRD patterns to quantify the mineral phases and to determine the stoichiometry and the superstructure of the formed magnesite and dolomite. Although experiments are still running, several trends have been identified. Transformation of the aragonite seed material occurs at a much faster rate than transformation of the calcite seed material, with each precursor material first transforming into a Ca-rich magnesite. With increased reaction time the Ca-rich magnesite recrystallizes to purer phases of magnesite, the Ca concentration of the fluid increases as the Ca is liberated into

  10. The evolution of the Dead Sea brine during the last 220 ky as revealed by porewater Cl-, Na+ and δ18O in ICDP deep core

    Science.gov (United States)

    Lazar, Boaz; Levy, Elan J.; Sivan, Orit; Yechieli, Joseph; Antler, Gilad; Gavrieli, Ittai; Stein, Mordechai

    2016-04-01

    The chemical composition of pore brines extracted from 456 m long core drilled by the ICDP during 2011 in the deep basin (water depth of 300 m) of the Dead Sea provides a history of the evolution of the Dead Sea brine during the last 220 ky. The vertical profiles of chloride (Cl-) sodium (Na+) and oxygen isotopes (δ18O) in the core show that during that period the bottom water mass (hypolimnion) of the lake was always hyper-saline and its salinity did not dropped below ~70 % of that of the modern Dead Sea. The lake underwent three major hyper-arid periods that lasted altogether about 30 ky and deposited ~150 m of halite and gypsum. These periods were the last two interglacials and the postglacial till present. During the last glacial and particularly during MIS2 (~31-17 ka BP) the salinity of the lake dropped substantially due to excess input of freshwater as indicated by the decrease in Cl- and Na+ of the hypolimnion. The δ18O at the same period increased to maximum of ~7‰ (3‰ higher than today). The variations in Na+ and Cl- during the "freshening" period suggest that halite dissolution, probably due to the rise of mount Sedom diapir, "buffered" the brine from further drop in salinity. The dilution of the brine was slow and lasted more than 10 ky probably due to continuous turbulent mixing of the hypolimnion with the less saline high δ18O epilimnetic brine that underwent "normal" evaporation. The low δ18O during high salinity -halite deposition- periods is attributed to "reversed" behavior of δ18O during evaporation of high salinity brine. Massive precipitation of halite during the last 10 ky decreased sharply the Na+/Cl- ratio of the Dead Sea from ~0.7 to its present value of ~0.2. A similar low value was reached during the last interglacial, at ~120 ky. Both periods mark the most mature evaporative state of the lake during the last 220 ky.

  11. Lactobacillus gasseri [corrected] CHO-220 and inulin reduced plasma total cholesterol and low-density lipoprotein cholesterol via alteration of lipid transporters.

    Science.gov (United States)

    Ooi, L-G; Ahmad, R; Yuen, K-H; Liong, M-T

    2010-11-01

    This randomized, double-blind, placebo-controlled, and parallel-designed study was conducted to investigate the effect of a synbiotic product containing Lactobacillus gasseri [corrected] CHO-220 and inulin on lipid profiles of hypercholesterolemic men and women. Thirty-two hypercholesterolemic men and women with initial mean plasma cholesterol levels of 5.7±0.32 mmol/L were recruited for the 12-wk study. The subjects were randomly allocated to 2 groups; namely the treatment group (synbiotic product) and the control group (placebo), and each received 4 capsules of synbiotic or placebo daily. Our results showed that the mean body weight, energy, and nutrient intake of the subjects did not differ between the 2 groups over the study period. The supplementation of synbiotic reduced plasma total cholesterol and low-density lipoprotein (LDL)-cholesterol by 7.84 and 9.27%, respectively, compared with the control over 12 wk. Lipoproteins were subsequently subfractionated and characterized. The synbiotic supplementation resulted in a lower concentration of triglycerides in the very low, intermediate, low, and high-density lipoprotein particles compared with the control over 12 wk. The concentration of triglycerides in lipoproteins is positively correlated with an increased risk of atherosclerosis. Our results showed that the synbiotic might exhibit an atheropreventive characteristic. Cholesteryl ester (CE) in the high-density lipoprotein particles of the synbiotic group was also higher compared with the control, indicating greater transport of cholesterol in the form of CE to the liver for hydrolysis. This may have led to the reduced plasma total cholesterol level of the synbiotic group. The supplementation of synbiotic also reduced the concentration of CE in the LDL particles compared with the control, leading to the formation of smaller and denser particles that are more easily removed from blood. This supported the reduced LDL-cholesterol level of the synbiotic group

  12. Infectious Epstein-Barr virus lacking major glycoprotein BLLF1 (gp350/220) demonstrates the existence of additional viral ligands.

    Science.gov (United States)

    Janz, A; Oezel, M; Kurzeder, C; Mautner, J; Pich, D; Kost, M; Hammerschmidt, W; Delecluse, H J

    2000-11-01

    The binding of the viral major glycoprotein BLLF1 (gp350/220) to the CD21 cellular receptor is thought to play an essential role during infection of B lymphocytes by the Epstein-Barr virus (EBV). However, since CD21-negative cells have been reported to be infectible with EBV, additional interactions between viral and cellular molecules seem to be probable. Based on a recombinant genomic EBV plasmid, we deleted the gene that encodes the viral glycoprotein BLLF1. We tested the ability of the viral mutant to infect different lymphoid and epithelial cell lines. Primary human B cells, lymphoid cell lines, and nearly all of the epithelial cell lines that are susceptible to wild-type EBV infection could also be successfully infected with the viral mutant in vitro, although the efficiency of infection with BLLF1-negative virus was clearly lower than the one observed with wild-type EBV. Our studies show that the interaction between BLLF1 and CD21 is not absolutely required for the infection of lymphocytes and epithelial cells, indicating that viral molecules other than BLLF1 can mediate the binding of EBV to its target cells. In this context, our results further suggest the hypothesis that additional cellular molecules, apart from CD21, allow virus entry into these cells.

  13. Highly-ordered TiO{sub 2} nanotube arrays up to 220 {mu}m in length: use in water photoelectrolysis and dye-sensitized solar cells

    Energy Technology Data Exchange (ETDEWEB)

    Shankar, Karthik [Department of Electrical Engineering, Pennsylvania State University, University Park, PA 16802 (United States); Mor, Gopal K [Materials Research Institute, Pennsylvania State University, University Park, PA 16802 (United States); Prakasam, Haripriya E [Department of Electrical Engineering, Pennsylvania State University, University Park, PA 16802 (United States); Yoriya, Sorachon [Department of Materials Science and Engineering, Pennsylvania State University, University Park, PA 16802 (United States); Paulose, Maggie [Materials Research Institute, Pennsylvania State University, University Park, PA 16802 (United States); Varghese, Oomman K [Materials Research Institute, Pennsylvania State University, University Park, PA 16802 (United States); Grimes, Craig A [Department of Electrical Engineering, Pennsylvania State University, University Park, PA 16802 (United States)

    2007-02-14

    The fabrication of highly-ordered TiO{sub 2} nanotube arrays up to 134 {mu}m in length by anodization of Ti foil has recently been reported (Paulose et al 2006 J. Phys. Chem. B 110 16179). This work reports an extension of the fabrication technique to achieve TiO{sub 2} nanotube arrays up to 220 {mu}m in length, with a length-to-outer diameter aspect ratio of {approx}1400, as well as their initial application in dye-sensitized solar cells and hydrogen production by water photoelectrolysis. The highly-ordered TiO{sub 2} nanotube arrays are fabricated by potentiostatic anodization of Ti foil in fluoride ion containing baths in combination with non-aqueous organic polar electrolytes including N-methylformamide, dimethyl sulfoxide, formamide, or ethylene glycol. Depending upon the anodization voltage, the inner pore diameters of the resulting nanotube arrays range from 20 to 150 nm. As confirmed by glancing angle x-ray diffraction and HRTEM studies, the as-prepared nanotubes are amorphous but crystallize with annealing at elevated temperatures.

  14. Rediscovery of the 220-year-old holotype of the Banded Iguana, Brachylophus fasciatus (Brongniart, 1800) in the Paris Natural History Museum

    Science.gov (United States)

    Ineich, Ivan; Fisher, Robert N.

    2016-01-01

    The Paris Natural History Museum herpetological collection (MNHN-RA) has seven historical specimens of Brachylophus spp. collected late in the 18th and early in the 19th centuries. Brachylophus fasciatus was described in 1800 by Brongniart but its type was subsequently considered as lost and never present in MNHN-RA collections. We found that 220 year old holotype among existing collections, registered without any data, and we show that it was donated to MNHN-RA from Brongniart’s private collection after his death in 1847. It was registered in the catalogue of 1851 but without any data or reference to its type status. According to the coloration (uncommon midbody saddle-like dorsal banding pattern) and morphometric data given in its original description and in the subsequent examination of the type in 1802 by Daudin and in 1805 by Brongniart we found that lost holotype in the collections. Another MNHN-RA specimen has Horn Islands (Wallis and Futuna) as the collection location but we show that most of the collections given to MNHN-RA by its collector, Louis Arnoux, have mixed localities in the MNHN-RA catalogues. We thus conclude that the locality is wrong and that the species never inhabited those islands located west of Western Samoa and north-east of Fiji.

  15. Integrated 220 GHz Source Development

    Science.gov (United States)

    2014-05-27

    the VE interaction structure. A CPW -waveguide transition is integrated at the MMIC input and output. The original Phase 3 plan was to use NGAS’s...causes resonances that result in reflected power, a complex RF output spectrum, and possible spurious oscillations. The best way to avoid this problem is

  16. 220 EAST AFRICAN MEDICAL JOURNAL

    African Journals Online (AJOL)

    2001-04-04

    Apr 4, 2001 ... PATIENTS' ATTITUDES TO WEARING OF GLOVES BY DENTISTS IN NIGERIA. O.D. OTUYEMI, A.O. OGINNI, E.O. OGUNBODEDE, F.O. OGINNI and AD. OLUSILE. ABSTRACT. Objective: To evaluate patient's attitudes to the use of gloves by dentists. Design: This consisted of a four-item questionnaire ...

  17. Theoretical Modelling of the Diffuse Emission of (gamma)-rays From Extreme Regions of Star Formation: The Case of Arp 220

    Energy Technology Data Exchange (ETDEWEB)

    Torres, D F

    2004-07-09

    Our current understanding of ultraluminous infrared galaxies suggest that they are recent galaxy mergers in which much of the gas in the former spiral disks, particularly that located at distances less than 5 kpc from each of the pre-merger nuclei, has fallen into a common center, triggering a huge starburst phenomenon. This large nuclear concentration of molecular gas has been detected by many groups, and estimates of molecular mass and density have been made. Not surprisingly, these estimates were found to be orders of magnitude larger than the corresponding values found in our Galaxy. In this paper, a self-consistent model of the high energy emission of the super-starburst galaxy Arp 220 is presented. The model also provides an estimate of the radio emission from each of the components of the central region of the galaxy (western and eastern extreme starbursts, and molecular disk). The predicted radio spectrum is found as a result of the synchrotron and free-free emission, and absorption, of the primary and secondary steady population of electrons and positrons. The latter is output of charged pion decay and knock-on leptonic production, subject to a full set of losses in the interstellar medium. The resulting radio spectrum is in agreement with sub-arcsec radio observations, what allows to estimate the magnetic field. In addition, the FIR emission is modeled with dust emissivity, and the computed FIR photon density is used as a target for inverse Compton process as well as to give account of losses in the {gamma}-ray scape. Bremsstrahlung emission and neutral pion decay are also computed, and the {gamma}-ray spectrum is finally predicted. Future possible observations with GLAST, and the ground based Cherenkov telescopes are discussed.

  18. Dynamical decay process of {sup 219,} {sup 220}Ra{sup *} formed in {sup 10,} {sup 11}B+{sup 209}Bi reactions

    Energy Technology Data Exchange (ETDEWEB)

    Sawhney, G.; Sharma, M.K. [Thapar University, School of Physics and Materials Science, Punjab (India)

    2012-05-15

    The excitation functions for both the evaporation residue and fission have been calculated for {sup 10}B +{sup 209}Bi and {sup 11}B+{sup 209}Bi reactions forming compound systems {sup 219,220}Ra{sup *}, using the dynamical cluster-decay model (DCM) with effects of deformations and orientations of the nuclei included in it. In addition to this, the excitation functions for complete fusion (CF) are obtained by summing the fission cross-sections, neutron evaporation and charged particle evaporation residue cross-sections produced through the {alpha}xn and pxn (x = 2, 3, 4) emission channels for the {sup 219}Ra system at various incident centre-of-mass energies. Experimentally the CF cross-sections are suppressed and the observed suppression is attributed to the low binding energy of {sup 10,11}B which breaks up into charged fragments. The reported complete fusion (CF) and incomplete fusion (ICF) excitation functions for the {sup 219}Ra system are found to be nicely fitted by the calculations performed in the framework of DCM, without invoking a significant contribution from quasi-fission. Although DCM has been applied for a number of compound nucleus decay studies in the recent past, the same is being used here in reference to ICF and subsequent decay processes along with the CF process. Interestingly the main contribution to complete fusion cross-section comes from the fission cross-section at higher incident energies, which in DCM is found to consist of an asymmetric fission window, shown to arise due to the deformation and orientation effects of formation and decay fragments. (orig.)

  19. Knee Confidence as It Relates to Self-reported and Objective Correlates of Knee Osteoarthritis: A Cross-sectional Study of 220 Patients.

    Science.gov (United States)

    Skou, Søren T; Rasmussen, Sten; Simonsen, Ole; Roos, Ewa M

    2015-10-01

    Cross-sectional study. The objective was to validate, if possible, previously reported associations and to investigate other potential associations between knee confidence and various self-reported and objective measures in an independent cohort of patients with knee osteoarthritis (OA). Lack of knee confidence is a frequent symptom in patients with knee OA, but little is known of associations between knee confidence and other common correlates of knee OA. Baseline data from 220 patients with knee OA were applied in ordinal regression analyses, with knee confidence, assessed using item Q3 of the Knee injury and Osteoarthritis Outcome Score, as the dependent variable and self-reported (pain on walking, general health, fear of movement, self-efficacy, function, and previous serious injury) and objective measures (muscle strength, 20-m walk time, and radiographic severity of tibiofemoral OA) as predictor variables. Most (95%) of the participants reported lack of knee confidence, and 54% experienced severe or extreme lack of knee confidence. Fear of movement (odds ratio [OR] = 2.06; 95% confidence interval [CI]: 1.15, 3.68), pain on walking (OR = 1.21; 95% CI: 1.09, 1.34), and general health (OR = 0.024; 95% CI: 0.002, 0.259) explained 19% of the variance in knee confidence (Pconfidence is a common finding in individuals with knee OA. Pain on walking was confirmed as a correlate of knee confidence, whereas muscle strength was not. Fear of movement and poor general health were new variables associated with lack of knee confidence. The noncorrelations or poor correlations with other tested variables suggest that a lack of knee confidence may represent an independent treatment target in knee OA of importance to improve mobility. Trials registered at ClinicalTrials.gov (NCT01410409 and NCT01535001).

  20. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  1. Investigation of mixed ion fields in the forward direction for 220.5 MeV/u helium ion beams: comparison between water and PMMA targets

    Science.gov (United States)

    Aricò, G.; Gehrke, T.; Jakubek, J.; Gallas, R.; Berke, S.; Jäkel, O.; Mairani, A.; Ferrari, A.; Martišíková, M.

    2017-10-01

    Currently there is a rising interest in helium ion beams for radiotherapy. For benchmarking of the physical beam models used in treatment planning, there is a need for experimental data on the composition and spatial distribution of mixed ion fields. Of particular interest are the attenuation of the primary helium ion fluence and the build-up of secondary hydrogen ions due to nuclear interactions. The aim of this work was to provide such data with an enhanced precision. Moreover, the validity and limits of the mixed ion field equivalence between water and PMMA targets were investigated. Experiments with a 220.5 MeV/u helium ion pencil beam were performed at the Heidelberg Ion-Beam Therapy Center in Germany. The compact detection system used for ion tracking and identification was solely based on Timepix position-sensitive semiconductor detectors. In comparison to standard techniques, this system is two orders of magnitude smaller, and provides higher precision and flexibility. The numbers of outgoing helium and hydrogen ions per primary helium ion as well as the lateral particle distributions were quantitatively investigated in the forward direction behind water and PMMA targets with 5.2-18 cm water equivalent thickness (WET). Comparing water and PMMA targets with the same WET, we found that significant differences in the amount of outgoing helium and hydrogen ions and in the lateral particle distributions arise for target thicknesses above 10 cm WET. The experimental results concerning hydrogen ions emerging from the targets were reproduced reasonably well by Monte Carlo simulations using the FLUKA code. Concerning the amount of outgoing helium ions, significant differences of 3-15% were found between experiments and simulations. We conclude that if PMMA is used in place of water in dosimetry, differences in the dose distributions could arise close to the edges of the field, in particular for deep seated targets. The results presented in this publication are

  2. The changing contribution of top-down and bottom-up limitation of mesopredators during 220 years of land use and climate change.

    Science.gov (United States)

    Pasanen-Mortensen, Marianne; Elmhagen, Bodil; Lindén, Harto; Bergström, Roger; Wallgren, Märtha; van der Velde, Ype; Cousins, Sara A O

    2017-05-01

    Apex predators may buffer bottom-up driven ecosystem change, as top-down suppression may dampen herbivore and mesopredator responses to increased resource availability. However, theory suggests that for this buffering capacity to be realized, the equilibrium abundance of apex predators must increase. This raises the question: will apex predators maintain herbivore/mesopredator limitation, if bottom-up change relaxes resource constraints? Here, we explore changes in mesopredator (red fox Vulpes vulpes) abundance over 220 years in response to eradication and recovery of an apex predator (Eurasian lynx Lynx lynx), and changes in land use and climate which are linked to resource availability. A three-step approach was used. First, recent data from Finland and Sweden were modelled to estimate linear effects of lynx density, land use and winter temperature on fox density. Second, lynx density, land use and winter temperature was estimated in a 22 650 km2 focal area in boreal and boreo-nemoral Sweden in the years 1830, 1920, 2010 and 2050. Third, the models and estimates were used to project historic and future fox densities in the focal area. Projected fox density was lowest in 1830 when lynx density was high, winters cold and the proportion of cropland low. Fox density peaked in 1920 due to lynx eradication, a mesopredator release boosted by favourable bottom-up changes - milder winters and cropland expansion. By 2010, lynx recolonization had reduced fox density, but it remained higher than in 1830, partly due to the bottom-up changes. Comparing 1830 to 2010, the contribution of top-down limitation decreased, while environment enrichment relaxed bottom-up limitation. Future scenarios indicated that by 2050, lynx density would have to increase by 79% to compensate for a projected climate-driven increase in fox density. We highlight that although top-down limitation in theory can buffer bottom-up change, this requires compensatory changes in apex predator abundance

  3. Optimized Generation of Functional Neutrophils and Macrophages from Patient-Specific Induced Pluripotent Stem Cells: Ex Vivo Models of X0-Linked, AR220- and AR470- Chronic Granulomatous Diseases

    Science.gov (United States)

    Goutagny, Erwan; Telugu, Narasimha; Shao, Kaifeng; Baquié, Mathurin; Satre, Véronique; Coutton, Charles; Grunwald, Didier; Brion, Jean-Paul; Barlogis, Vincent; Stephan, Jean-Louis; Plantaz, Dominique; Hescheler, Jürgen; Krause, Karl-Heinz; Šarić, Tomo

    2014-01-01

    Abstract Chronic granulomatous disease (CGD) is an inherited orphan disorder caused by mutations in one of the five genes encoding reduced nicotinamide-adenine-dinucleotide-phosphate oxidase subunits, which subsequently lead to impairment in the production of microbicidal reactive oxygen species (ROS). In order to offer several cell line models of CGD and therefore support research on pathophysiology and new therapeutic approaches, we optimized protocols to differentiate induced pluripotent stem cells (iPSCs) from wild-type, X0-, AR220- and AR470-CGD patient's fibroblasts into neutrophils and into macrophages. Aberrant genetic clones were discarded after chromosome karyotyping and array-comparative genomic hybridization analysis. All remaining iPSC lines showed human embryonic stem cell–like morphology, expressed all tested pluripotency markers and formed embryoid bodies that contained cells originating from all three primary germ layers. Furthermore, each CGD patient-specific iPSC line retained the gp91phox, p47phox, and p22phox mutations found in the corresponding patient's neutrophils. The average production of CD34+ progenitors was of 1.5×106 cells after 10 days of differentiation of 10×106 iPSCs. They were terminally differentiated into about 3×105 neutrophils or into 3×107 macrophages. Based on morphological, phenotypical, and functional criteria both phagocyte types were mature and indistinguishable from the native human neutrophils and macrophages. However, neutrophils and macrophages derived from X0-, AR220-, and AR470-CGD patient-specific iPSC lines lacked ROS production and the corresponding mutated proteins. To simplify the phagocytes' production upon request, progenitors can be cryopreserved. In conclusion, we describe a reproducible, simple, and efficient way to generate neutrophils and macrophages from iPSCs and provide a new cellular model for the AR220-CGD genetic form that has not been described before. PMID:25469316

  4. Optimized Generation of Functional Neutrophils and Macrophages from Patient-Specific Induced Pluripotent Stem Cells: Ex Vivo Models of X(0)-Linked, AR22(0)- and AR47(0)- Chronic Granulomatous Diseases.

    Science.gov (United States)

    Brault, Julie; Goutagny, Erwan; Telugu, Narasimha; Shao, Kaifeng; Baquié, Mathurin; Satre, Véronique; Coutton, Charles; Grunwald, Didier; Brion, Jean-Paul; Barlogis, Vincent; Stephan, Jean-Louis; Plantaz, Dominique; Hescheler, Jürgen; Krause, Karl-Heinz; Sarić, Tomo; Stasia, Marie José

    2014-12-01

    Chronic granulomatous disease (CGD) is an inherited orphan disorder caused by mutations in one of the five genes encoding reduced nicotinamide-adenine-dinucleotide-phosphate oxidase subunits, which subsequently lead to impairment in the production of microbicidal reactive oxygen species (ROS). In order to offer several cell line models of CGD and therefore support research on pathophysiology and new therapeutic approaches, we optimized protocols to differentiate induced pluripotent stem cells (iPSCs) from wild-type, X(0)-, AR22(0)- and AR47(0)-CGD patient's fibroblasts into neutrophils and into macrophages. Aberrant genetic clones were discarded after chromosome karyotyping and array-comparative genomic hybridization analysis. All remaining iPSC lines showed human embryonic stem cell-like morphology, expressed all tested pluripotency markers and formed embryoid bodies that contained cells originating from all three primary germ layers. Furthermore, each CGD patient-specific iPSC line retained the gp91 (phox) , p47 (phox) , and p22 (phox) mutations found in the corresponding patient's neutrophils. The average production of CD34(+) progenitors was of 1.5×10(6) cells after 10 days of differentiation of 10×10(6) iPSCs. They were terminally differentiated into about 3×10(5) neutrophils or into 3×10(7) macrophages. Based on morphological, phenotypical, and functional criteria both phagocyte types were mature and indistinguishable from the native human neutrophils and macrophages. However, neutrophils and macrophages derived from X(0)-, AR22(0)-, and AR47(0)-CGD patient-specific iPSC lines lacked ROS production and the corresponding mutated proteins. To simplify the phagocytes' production upon request, progenitors can be cryopreserved. In conclusion, we describe a reproducible, simple, and efficient way to generate neutrophils and macrophages from iPSCs and provide a new cellular model for the AR22(0)-CGD genetic form that has not been described before.

  5. Overvoltages transferred from a network of 220 kV to 15.65 kV level of the step-up transformer in HPP 'Bajina Bašta'

    Directory of Open Access Journals (Sweden)

    Vukelja Petar

    2011-01-01

    Full Text Available The paper presents the results of research in lightning surge waves and switching overvoltages transferred from a network of 220 kV to the 15.65 kV level of the step-up transformer in HPP 'Bajina Bašta'. Analysis of survey results lead to conclusion that transferred overvoltages can endanger 15.65 kV transformer windings and stator winding insulation. It was therefore suggested for the protection of the 15.65 kV isolation to install metal oxide surge arresters at a suitable place between the power generator bus bars and earthing.

  6. Induction of Mitochondrial Changes Associated with Oxidative Stress on Very Long Chain Fatty Acids (C22:0, C24:0, or C26:0-Treated Human Neuronal Cells (SK-NB-E

    Directory of Open Access Journals (Sweden)

    Amira Zarrouk

    2012-01-01

    Full Text Available In Alzheimer's disease, lipid alterations point towards peroxisomal dysfunctions. Indeed, a cortical accumulation of saturated very long chain fatty acids (VLCFAs: C22:0, C24:0, C26:0, substrates for peroxisomal β-oxidation, has been found in Alzheimer patients. This study was realized to investigate the effects of VLCFAs at the mitochondrial level since mitochondrial dysfunctions play crucial roles in neurodegeneration. On human neuronal SK-NB-E cells treated with C22:0, C24:0, or C26:0 (0.1–20 μM; 48 h, an inhibition of cell growth and mitochondrial dysfunctions were observed by cell counting with trypan blue, MTT assay, and measurement of mitochondrial transmembrane potential (Δψm with DiOC6(3. A stimulation of oxidative stress was observed with DHE and MitoSOX used to quantify superoxide anion production on whole cells and at the mitochondrial level, respectively. With C24:0 and C26:0, by Western blotting, lower levels of mitochondrial complexes III and IV were detected. After staining with MitoTracker and by transmission electron microscopy used to study mitochondrial topography, mass and morphology, major changes were detected in VLCFAs treated-cells: modification of the cytoplasmic distribution of mitochondria, presence of large mitochondria, enhancement of the mitochondrial mass. Thus, VLCFAs can be potential risk factors contributing to neurodegeneration by inducing neuronal damages via mitochondrial dysfunctions.

  7. The behavior of ZrO{sub 2}/20%Y{sub 2}O{sub 3} and Al{sub 2}O{sub 3} coatings deposited on aluminum alloys at high temperature regime

    Energy Technology Data Exchange (ETDEWEB)

    Pintilei, G.L., E-mail: laura_rares082008@yahoo.com [Pitesti University, Faculty of Mechanics and Technology, Str. Targu din Vale nr.1, 110040 Pitesti, Arges (Romania); Technical University “Gheorghe Asachi” of Iasi, Faculty of Mechanics, Bld D. Mangeron nr. 61, 700050 Iasi (Romania); Crismaru, V.I. [Technical University “Gheorghe Asachi” of Iasi, Faculty of Mechanics, Bld D. Mangeron nr. 61, 700050 Iasi (Romania); Abrudeanu, M. [Pitesti University, Faculty of Mechanics and Technology, Str. Targu din Vale nr.1, 110040 Pitesti, Arges (Romania); Munteanu, C. [Technical University “Gheorghe Asachi” of Iasi, Faculty of Mechanics, Bld D. Mangeron nr. 61, 700050 Iasi (Romania); Baciu, E.R. [University of Medicine and Pharmacy “Gr.T.Popa”, Department Implantology, Removable Restorations, Technology, Str. Universitatii nr. 16, 700115 Iasi (Romania); Istrate, B.; Basescu, N. [Technical University “Gheorghe Asachi” of Iasi, Faculty of Mechanics, Bld D. Mangeron nr. 61, 700050 Iasi (Romania)

    2015-10-15

    Highlights: • In both the ZrO{sub 2}/20%Y{sub 2}O{sub 3} and Al{sub 2}O{sub 3} coatings the high temperature caused a decrease of pores volume and a lower thickness of the interface between successive splats. • The NiCr bond layer in the sample with a ZrO{sub 2}/20%Y{sub 2}O{sub 3} suffered a fragmentation due to high temperature exposure and thermal expansion which can lead to coating exfoliation. • The NiCr bond layer in the sample with an Al{sub 2}O{sub 3} coating showed an increase of pore volume due to high temperature. - Abstract: Aluminum alloy present numerous advantages like lightness, high specific strength and diversity which recommend them to a high number of applications from different fields. In extreme environments the protection of aluminum alloys is difficult and requires a high number of requirements like high temperature resistance, thermal fatigue resistance, corrosion fatigue resistance and galvanic corrosion resistance. To obtain these characteristics coatings can be applied to the surfaces so they can enhance the mechanical and chemical properties of the parts. In this paper two coatings were considered for deposition on an AA2024 aluminum alloy, ZrO{sub 2}/20%Y{sub 2}O{sub 3} and Al{sub 2}O{sub 3}. To obtain a better adherence of the coating to the base material an additional bond layer of NiCr is used. Both the coatings and bond layer were deposited by atmospheric plasma spraying on the samples. The samples were subjected to a temperature of 500 °C and after that slowly cooled to room temperature. The samples were analyzed by electron microscopy and X-ray diffraction to determine the morphological and phase changes that occurred during the temperature exposure. To determine the stress level in the parts due to thermal expansion a finite element analysis was performed in the same conditions as the tests.

  8. Internal Tandem Duplication in FLT3 Attenuates Proliferation and Regulates Resistance to the FLT3 Inhibitor AC220 by Modulating p21Cdkn1a and Pbx1 in Hematopoietic Cells.

    Directory of Open Access Journals (Sweden)

    Mariko Abe

    Full Text Available Internal tandem duplication (ITD mutations in the Fms-related tyrosine kinase 3 (FLT3 gene (FLT3-ITD are associated with poor prognosis in patients with acute myeloid leukemia (AML. Due to the development of drug resistance, few FLT3-ITD inhibitors are effective against FLT3-ITD+ AML. In this study, we show that FLT3-ITD activates a novel pathway involving p21Cdkn1a (p21 and pre-B cell leukemia transcription factor 1 (Pbx1 that attenuates FLT3-ITD cell proliferation and is involved in the development of drug resistance. FLT3-ITD up-regulated p21 expression in both mouse bone marrow c-kit+-Sca-1+-Lin- (KSL cells and Ba/F3 cells. The loss of p21 expression enhanced growth factor-independent proliferation and sensitivity to cytarabine as a consequence of concomitantly enriching the S+G2/M phase population and significantly increasing the expression of Pbx1, but not Evi-1, in FLT3-ITD+ cells. This enhanced cell proliferation following the loss of p21 was partially abrogated when Pbx1 expression was silenced in FLT3-ITD+ primary bone marrow colony-forming cells and Ba/F3 cells. When FLT3-ITD was antagonized with AC220, a selective inhibitor of FLT3-ITD, p21 expression was decreased coincident with Pbx1 mRNA up-regulation and a rapid decline in the number of viable FLT3-ITD+ Ba/F3 cells; however, the cells eventually became refractory to AC220. Overexpressing p21 in FLT3-ITD+ Ba/F3 cells delayed the emergence of cells that were refractory to AC220, whereas p21 silencing accelerated their development. These data indicate that FLT3-ITD is capable of inhibiting FLT3-ITD+ cell proliferation through the p21/Pbx1 axis and that treatments that antagonize FLT3-ITD contribute to the subsequent development of cells that are refractory to a FLT3-ITD inhibitor by disrupting p21 expression.

  9. Regional mapping of short tandem repeats on human chromosome 10: Cytochrome P450 gene CYP2E, D10S196, D10S220, and D10S225

    Energy Technology Data Exchange (ETDEWEB)

    Koelble, K. (Univ. of Oxford (United Kingdom))

    1993-12-01

    Human CYP2E encodes an ethanol-inducible cytochrome P450 monooxygenase that metabolizes various carcinogens and may therefore play a role in cancer susceptibility. An intronic (GGAT)[sub n] [center dot] (CCTA)[sub n] repeat element was found to display limited polymorphism in Caucasoids and was used as a sequence-tagged site for genomic amplification from somatic cell hybrids to localize CYP2E to 10q24.3-qter; using the same panel, three microsatellite markers, D10S196, D10S220, and D10S225, were mapped to 10q21. The close synteny of CYP2E, CYP2C, and CYP17 belonging to two different cytochrome P450 families suggests a central role for the long arm of chromosome 10 in the evolution of this large gene superfamily. 18 refs., 2 figs.

  10. A novel missense variant (Gln220Arg) of GNB4 encoding guanine nucleotide-binding protein, subunit beta-4 in a Japanese family with autosomal dominant motor and sensory neuropathy.

    Science.gov (United States)

    Miura, Shiroh; Morikawa, Takuya; Fujioka, Ryuta; Noda, Kazuhito; Kosaka, Kengo; Taniwaki, Takayuki; Shibata, Hiroki

    2017-09-01

    Dominant intermediate Charcot-Marie-Tooth disease F (CMTDIF) is an autosomal dominant hereditary form of Charcot-Marie-Tooth disease (CMT) caused by variations in the guanine nucleotide-binding protein, subunit beta-4 gene (GNB4). We examined two Japanese familial cases with CMT. Case 1 was a 49-year-old male whose chief complaint was slowly progressive gait disturbance and limb dysesthesia that appeared at the age of 47. On neurological examination, he showed hyporeflexia or areflexia, distal limb muscle weakness, and distal sensory impairment with lower dominancy. Nerve conduction studies demonstrated demyelinating sensorimotor neuropathy with reduced action potentials in the lower limbs. Case 2 was an 80-year-old man, Case 1's father, who reported difficulty in riding a bicycle at the age of 76. On neurological examination, he showed areflexia in the upper and lower limbs. Distal sensory impairment in the lower limbs was also observed. Nerve conduction studies revealed mainly axonal involvement. Exome sequencing identified a novel heterozygous nonsynonymous variant (NM_021629.3:c.659T > C [p.Gln220Arg]) in GNB4 exon 8, which is known to be responsible for CMT. Sanger sequencing confirmed that both patients are heterozygous for the variation, which causes an amino acid substitution, Gln220Arg, in the highly conserved region of the WD40 domain of GNB4. The frequency of this variant in the Exome Aggregation Consortium Database was 0.000008247, and we confirmed its absence in 502 Japanese control subjects. We conclude that this novel GNB4 variant is causative for CMTDIF in these patients, who represent the first record of the disease in the Japanese population. Copyright © 2017. Published by Elsevier Masson SAS.

  11. Hypothesizing that, A Pro-Dopamine Regulator (KB220Z) Should Optimize, but Not Hyper-Activate the Activity of Trace Amine-Associated Receptor 1 (TAAR-1) and Induce Anti-Craving of Psychostimulants in the Long-Term

    Science.gov (United States)

    Blum, Kenneth; Badgaiyan, Rajendra D.; Braverman, Eric R.; Dushaj, Kristina; Li, Mona; Thanos, Peter K.; Demetrovics, Zsolt; Febo, Marcelo

    2017-01-01

    Unlike other drugs of abuse such as alcohol, nicotine, opiates/opioids, the FDA has not approved any agent to treat psychostimulant dependence. Certainly, it is widely acceptable that dopaminergic signaling is a key factor in both the initiation and continued motivation to abuse this class of stimulant substances. It is also well accepted that psychostimulants such as cocaine affect not only the release of neuronal dopamine at the nucleus accumbens (NAc), but also has powerful inhibitory actions on the dopamine transporter system. Understandably, certain individuals are at high risk and very vulnerable to abuse this class of substances. Trace-amine-associated receptor 1 (TAAR1) is a G -protein coupled receptor activated by trace amines. The encoded protein responds little or not at all to dopamine, serotonin, epinephrine, or histamine, but responds well to beta-phenylethylamine, p-tyramine, octopamine, and tryptamine. This gene is thought to be intronless. TAAR1 agonists reduce the neurochemical effects of cocaine and amphetamines as well as attenuate addiction and abuse associated with these two psychostimulants. The mechanism involves blocking the firing rate of dopamine in the limbic system thereby decreasing a hyperdopaminergic trait/state, whereby the opposite is true for TAAR1 antagonists. Based on many studies, it is accepted that in Reward Deficiency Syndrome (RDS), there is weakened tonic and improved phasic dopamine discharge leading to a hypodopaminergic/glutamatergic trait. The dopamine pro-complex mixture KB220, following many clinical trials including neuroimaging studies, has been shown to enhance resting state functional connectivity in humans (abstinent heroin addicts), naïve rodent models, and regulates extensive theta action in the cingulate gyrus of abstinent psychostimulant abusers. In this article, we are hypothesizing that KB220 may induce its action on resting state functional connectivity, for example, by actually balancing (optimizing

  12. Measurement of charge- and mass-changing cross sections for 4He+12C collisions in the energy range 80-220 MeV/u for applications in ion beam therapy

    Science.gov (United States)

    Horst, Felix; Schuy, Christoph; Weber, Uli; Brinkmann, Kai-Thomas; Zink, Klemens

    2017-08-01

    4He ions are considered to be used for hadron radiotherapy due to their favorable physical and radiobiological properties. For an accurate dose calculation the fragmentation of the primary 4He ions occurring as a result of nuclear collisions must be taken into account. Therefore precise nuclear reaction models need to be implemented in the radiation transport codes used for dose calculation. A fragmentation experiment using thin graphite targets was conducted at the Heidelberg Ion Beam Therapy Center (HIT) to obtain new and precise 4He-nucleus cross section data in the clinically relevant energy range. Measured values for the charge-changing cross section, mass-changing cross section, as well as the inclusive 3He production cross section for 4He+12C collisions at energies between 80 and 220 MeV /u are presented. These data are compared to the 4He-nucleus reaction model by DeVries and Peng as well as to the parametrizations by Tripathi et al. and by Cucinotta et al., which are implemented in the treatment planning code trip98 and several other radiation transport codes.

  13. Ultrasensitive, simple and solvent-free micro-assay for determining sulphite preservatives (E220-228) in foods by HS-SDME and UV-vis micro-spectrophotometry.

    Science.gov (United States)

    Gómez-Otero, E; Costas, M; Lavilla, I; Bendicho, C

    2014-03-01

    A new method based on headspace single-drop microextraction in combination with UV-vis micro-spectrophotometry has been developed for the ultrasensitive determination of banned sulphite preservatives (E220-228) in fruits and vegetables. Sample acidification was used for SO2 generation, which is collected onto a 5,5'-dithiobis-(2-nitrobenzoic acid) microdrop for spectrophotometric measurement. A careful study of this reaction was necessary, including conditions for SO2 generation from different sulphating salts, drop pH, 5,5'-dithiobis-(2-nitrobenzoic acid) concentration and potential interference effects. Variables influencing mass transfer (stirring, sample volume and addition of salt) and microextraction time were also studied. A simple sulphite extraction was carried out, and problems caused by oxidation during the extraction process were addressed. A high enrichment factor (380) allows the determination of low levels of free SO2 in fruits and vegetables (limit of detection 0.06 μg g(-1), limit of quantification 0.2 μg g(-1)) with an adequate precision (repeatability, relative standard deviation 5 %). In addition, the sulphiting process was studied through the monitoring of residual SO2 in a vegetal sample, thus showing the importance of a sensitive tool for SO2 detection at low levels.

  14. Measurements of 222Rn, 220Rn, and CO2 Emissions in Natural CO2 Fields in Wyoming: MVA Techniques for Determining Gas Transport and Caprock Integrity

    Energy Technology Data Exchange (ETDEWEB)

    Kaszuba, John [Univ. of Wyoming, Laramie, WY (United States); Sims, Kenneth [Univ. of Wyoming, Laramie, WY (United States)

    2014-09-30

    An integrated field-laboratory program evaluated the use of radon and CO2 flux measurements to constrain source and timescale of CO2 fluxes in environments proximate to CO2 storage reservoirs. By understanding the type and depth of the gas source, the integrity of a CO2 storage reservoir can be assessed and monitored. The concept is based on correlations of radon and CO2 fluxes observed in volcanic systems. This fundamental research is designed to advance the science of Monitoring, Verification, and Accounting (MVA) and to address the Carbon Storage Program goal of developing and validating technologies to ensure 99 percent storage performance. Graduate and undergraduate students conducted the research under the guidance of the Principal Investigators; in doing so they were provided with training opportunities in skills required for implementing and deploying CCS technologies. Although a final method or “tool” was not developed, significant progress was made. The field program identified issues with measuring radon in environments rich in CO2. Laboratory experiments determined a correction factor to apply to radon measurements made in CO2-bearing environments. The field program also identified issues with radon and CO2-flux measurements in soil gases at a natural CO2 analog. A systematic survey of radon and CO2 flux in soil gases at the LaBarge CO2 Field in Southwest Wyoming indicates that measurements of 222Rn (radon), 220Rn (thoron), and CO2 flux may not be a robust method for monitoring the integrity of a CO2 storage reservoir. The field program was also not able to correlate radon and CO2 flux in the CO2-charged springs of the Thermopolis hydrothermal system. However, this part of the program helped to motivate the aforementioned laboratory experiments that determined

  15. 32 CFR 220.8 - Reasonable charges.

    Science.gov (United States)

    2010-07-01

    ... in the Burn Center at Brooke Army Medical Center, the Assistant Secretary of Defense for Health... under this section to reflect unique attributes of the Burn Center. (3) Charges for dental services..., oral surgery, orthodontics, pediatric dentistry and endodontics) will be based on a full cost of the...

  16. 20 CFR 220.35 - Introduction.

    Science.gov (United States)

    2010-04-01

    ... term is defined in the Social Security Act. In making these decisions the Board must apply the... Services in making disability decisions under the Social Security Act. Regulations of the Social Security...' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT DETERMINING DISABILITY...

  17. 49 CFR 220.5 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... or receive a telephone call; send or read an electronic mail message or text message; look at pictures; read a book or other written material; play a game; navigate the Internet; navigate the physical...

  18. 45 CFR 148.220 - Excepted benefits.

    Science.gov (United States)

    2010-10-01

    ... insurance. These benefits include the following: (1) Limited scope dental or vision benefits. These benefits are dental or vision benefits that are limited in scope to a narrow range or type of benefits that are... expected to be chronic. (3) Coverage only for a specified disease or illness (for example, cancer policies...

  19. 38 CFR 52.220 - Transportation.

    Science.gov (United States)

    2010-07-01

    ... family of a veteran may decline transportation offered by the adult day health care program management... and from adult day health care must be equipped with a device for two-way communication. (d) All...

  20. Publications | Page 220 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    This guide provides you with an overview of the key concepts you''ll need to understand about communicating climate risk. Throughout the guide the main ideas and lessons learned on risk communication are outlined, and examples are used to illustrate ways in which risk communication strategies... Researching the urban ...

  1. 7 CFR 220.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    .... Applicable credits shall have the meaning established in Office of Management and Budget Circulars A-87, C(4... percent of the Reference Daily Intake (RDI) for each of eight specified nutrients per serving; (2) in the... specified nutrients per 100 calories and less than five percent of the RDI for each of eight specified...

  2. 2 CFR 220.20 - Applicability.

    Science.gov (United States)

    2010-01-01

    ... and Agreements OFFICE OF MANAGEMENT AND BUDGET CIRCULARS AND GUIDANCE Reserved COST PRINCIPLES FOR... of Appendix A to this part in determining the costs incurred for such work. The principles shall also... with an educational institution shall require the FFRDC to comply with the Cost Accounting Standards...

  3. 45 CFR 2541.220 - Allowable costs.

    Science.gov (United States)

    2010-10-01

    ... accounting standards that comply with cost principles acceptable to the Federal agency. ... the grantee or subgrantee. (b) Applicable cost principles. For each kind of organization, there is a set of Federal principles for determining allowable costs. Allowable costs will be determined in...

  4. 2 CFR 220.15 - Policy.

    Science.gov (United States)

    2010-01-01

    ... accounting principles, except where restricted or prohibited by law. Agencies are not expected to place additional restrictions on individual items of cost. The successful application of cost accounting principles... Agreements OFFICE OF MANAGEMENT AND BUDGET CIRCULARS AND GUIDANCE Reserved COST PRINCIPLES FOR EDUCATIONAL...

  5. Reference: 220 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available t exoskeletons. Plants produce chitinases upon pathogen attack and chito-oligomers induce defense responses in plants, though the exa...ct mechanism behind this response is unknown. Using the

  6. 20 CFR 220.64 - Program integrity.

    Science.gov (United States)

    2010-04-01

    ..., embezzlement, breach of fiduciary responsibility or financial abuse; who has been convicted under Federal or...; whose license to provide health care services is revoked or suspended by any State licensing authority...

  7. Publications | Page 220 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Konseling ibu hamil pada bidan praktik swasta dan puskesmas di kabupaten Bantul (restricted access). Background: One of the factors of Maternal and Neonatal Mortality is the lack of knowledge on the cause and how to deal with important complications during pregnancy, labor, and post natal. Counseling is an effort to ...

  8. 24 CFR 91.220 - Action plan.

    Science.gov (United States)

    2010-04-01

    ..., and competitive McKinney-Vento Homeless Assistance Act funds, expected to be available to address... Dream Downpayment Initiative (ADDI) (see 24 CFR part 92, subpart M), it must include: (A) A description...

  9. 220 AUTOMATED CLEARING SYSTEM AND THE BANKING ...

    African Journals Online (AJOL)

    clearing system. The result revealed that automated clearing system has a significant positive impact on the general payment system. The paper concludes that the post NACS era is more efficient and hence we recommend the ..... Nzotta S.M. (2004) Money Banking and Finance: Theory and Practice Bon Publishers. Owerri.

  10. Publications | Page 220 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Impact of maternal and child health private expenditure on poverty and inequity in Bangladesh : out-of-pocket payments by patients at Ministry of Health and Family Welfare Facilities in Bangladesh and the impact of the maternal voucher scheme on ... Objectified cultural capital and the tale of two students (restricted access).

  11. Neurobiology of KB220Z-Glutaminergic-Dopaminergic Optimization Complex [GDOC] as a Liquid Nano: Clinical Activation of Brain in a Highly Functional Clinician Improving Focus, Motivation and Overall Sensory Input Following Chronic Intake.

    Science.gov (United States)

    Duquette, Lucien L; Mattiace, Frank; Blum, Kenneth; Waite, Roger L; Boland, Teresa; McLaughlin, Thomas; Dushaj, Kristina; Febo, Marcelo; Badgaiyan, Rajendra D

    2016-01-01

    With neurogenetic and epigenetic tools utilized in research and neuroimaging, we are unraveling the mysteries of brain function, especially as it relates to Reward Deficiency (RDS). We encourage the development of pharmaceuticals or nutraceuticals that promote a reduction in dopamine resistance and balance brain neurochemistry, leading to dopamine homeostasis. We disclose self-assessment of a highly functional professional under work-related stress following KB220Z use, a liquid (aqua) nano glutaminergic-dopaminergic optimization complex (GDOC). Subject took GDOC for one month. Subject self-administered GDOC using one-half-ounce twice a day. During first three days, unique brain activation occurred; resembling white noise after 30 minutes and sensation was strong for 45 minutes and then dissipated. He described effect as if his eyesight improved slightly and pointed out that his sense of smell and sleep greatly improved. Subject experienced a calming effect similar to meditation that could be linked to dopamine release. He also reported control of going over the edge after a hard day's work, which was coupled with a slight increase in energy, increased motivation to work, increased focus and multi-tasking, with clearer purpose of task at hand. Subject felt less inhibited in a social setting and suggested Syndrome that GDOC increased his Behavior Activating System (reward), while having a decrease in the Behavior Inhibition System (caution). These results and other related studies reveal an improved mood, work-related focus, and sleep. These effects as a subjective feeling of brain activation maybe due to direct or indirect dopaminergic interaction. While this case is encouraging, we must await more research in a larger randomized placebo-controlled study to map the role of GDOC, especially in a nano-sized product, to determine the possible effects on circuit inhibitory control and memory banks and the induction of dopamine homeostasis independent of either hypo- or

  12. Low recurrence rate and low chronic pain associated with inguinal hernia repair by laparoscopic placement of Parietex ProGrip™ mesh: clinical outcomes of 220 hernias with mean follow-up at 23 months.

    Science.gov (United States)

    Birk, D; Hess, S; Garcia-Pardo, C

    2013-06-01

    The aim of this study was to demonstrate the safety and the efficacy of the self-gripping Parietex ProGrip™ mesh (Sofradim Production, Trévoux, France) used with the laparoscopic approach for inguinal hernia repair. The incidence of chronic pain, post-operative complications, patient satisfaction and hernia recurrence at follow-up after 12 months was evaluated. Data were collected retrospectively from patient files and were analyzed for 169 male and female patients with 220 primary inguinal hernias. All patients included had undergone surgical repair for inguinal hernia by the laparoscopic transabdominal preperitoneal approach using Parietex ProGrip™ meshes performed in the same clinical center in Germany. Pre-, per- and post-operative data were collected, and a follow-up after 12 months was performed prospectively. Complications, pain scored on a 0-10 numeric rating scale (NRS), patient satisfaction and hernia recurrence were assessed. The only complications were minor and were post-operative: hematoma/seroma (3 cases), secondary hemorrhage through the trocar's site (2 cases), hematuria, emphysema in the inguinal regions (both sides) and swelling above the genital organs (1 case for each). At mean follow-up at 22.8 months, there were only 3 reports of hernia recurrence: 1.4 % of the hernias. Most patients (95.9 %) were satisfied or very satisfied with their hernia repair with only 1.2 % reporting severe pain (NRS score 7-10) and 3.6 % reported mild pain. This study demonstrates that in experienced hands, inguinal hernia repair surgery performed by laparoscopic transabdominal preperitoneal hernioplasty using Parietex ProGrip™ self-gripping meshes is rapid, efficient and safe with low pain and low hernia recurrence rate.

  13. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  14. The preoperative serum ratio of total prostate specific antigen (PSA to free testosterone (FT, PSA/FT index ratio, and prostate cancer. Results in 220 patients undergoing radical prostatectomy

    Directory of Open Access Journals (Sweden)

    Antonio B. Porcaro

    2016-03-01

    Full Text Available Objectives: To evaluate associations of preoperative total prostate specific antigen (PSA to free testosterone (FT, the PSA/FT index ratio, with features of pathology prostate cancer (PCA and to investigate its prognostic potential in clustering the PCA population. Patients and methods: After excluding criteria, the records of 220 patients who underwent radical prostatectomy (RP were retrospectively reviewed. Serum samples of PSA, total testosterone (TT and FT were collected at 8.00 A.M., one month after biopsies and before RP. The PSA/FT ratio was computed in the population of patients who were clustered in groups according to ranking intervals of the PSA/FT ratio which identified at least 4 clusters which were coded as A, B, C, and D. The independent associations of the PSA/FT index ratio were assessed by statistical methods and a two-sided P < 0.05 was considered to indicate statistical significance. Results: TT correlated to FT which was a significant predictor of PSA in the population of patients who were subsequently clustered, according to increasing interval values of the PSA/FT index ratio, in groups that showed a stronger linear association of FT with PSA. The PSA/FT index ratio significantly associated with pathology features of prostate cancer such as pathology Gleason score (pGS, invasion of the seminal vesicles (pT3b, proportion of positive cores (P+ and proportion of cancer involving the volume of the prostate. In the population of patients, TT, PSA/FT index ratio and P+ independently associated with pGS ≥ 7 and pT3b; moreover, the odds ratio (OR of the PSA/FT index ratio resulted 9.11 which was stronger than TT (OR = 1.11 and P+ (OR = 8.84. In the PCA population, TT, PSA/FT index ratio and P+ also independently associated with pT3b PCA; interestingly, the OR of PSA/FT index resulted 54.91 which was stronger than TT (OR = 1.31 and P+ (26.43. Conclusions: Preoperative PSA/FT index ratio is an independent strong factor which

  15. The preoperative serum ratio of total prostate specific antigen (PSA) to free testosterone (FT), PSA/FT index ratio, and prostate cancer. Results in 220 patients undergoing radical prostatectomy.

    Science.gov (United States)

    Porcaro, Antonio B; Caruso, Beatrice; Terrin, Alessandro; De Luyk, Nicolò; Cacciamani, Giovanni; Corsi, Paolo; Inverardi, Davide; De Marchi, Davide; Baldassarre, Roberto; Cerruto, Mariangela; Ghimenton, Claudio; Brunelli, Matteo; Zecchini Antoniolli, Stefano; Petrozziello, Aldo; Artibani, Walter

    2016-03-31

    To evaluate associations of preoperative total prostate specific antigen (PSA) to free testosterone (FT), the PSA/FT index ratio, with features of pathology prostate cancer (PCA) and to investigate its prognostic potential in clustering the PCA population. After excluding criteria, the records of 220 patients who underwent radical prostatectomy (RP) were retrospectively reviewed. Serum samples of PSA, total testosterone (TT) and FT were collected at 8.00 A.M., one month after biopsies and before RP. The PSA/FT ratio was computed in the population of patients who were clustered in groups according to ranking intervals of the PSA/FT ratio which identified at least 4 clusters which were coded as A, B, C, and D. The independent associations of the PSA/FT index ratio were assessed by statistical methods and a two-sided P < 0.05 was considered to indicate statistical significance. TT correlated to FT which was a significant predictor of PSA in the population of patients who were subsequently clustered, according to increasing interval values of the PSA/FT index ratio, in groups that showed a stronger linear association of FT with PSA. The PSA/FT index ratio significantly associated with pathology features of prostate cancer such as pathology Gleason score (pGS), invasion of the seminal vesicles (pT3b), proportion of positive cores (P+) and proportion of cancer involving the volume of the prostate. In the population of patients, TT, PSA/FT index ratio and P+ independently associated with pGS ≥ 7 and pT3b; moreover, the odds ratio (OR) of the PSA/FT index ratio resulted 9.11 which was stronger than TT (OR = 1.11) and P+ (OR = 8.84). In the PCA population, TT, PSA/FT index ratio and P+ also independently associated with pT3b PCA; interestingly, the OR of PSA/FT index resulted 54.91 which was stronger than TT (OR = 1.31) and P+ (26.43). Preoperative PSA/FT index ratio is an independent strong factor which directly associates with aggressive features of pathology PCA

  16. Series of selenoid valve pneumatic AC 220 volts with disposable contra angle as a replacement for micromotor in preclinic laboratory (experimental study on the health ministry of health polytechnic course D-III department of dental nursing Tasikmalaya

    Directory of Open Access Journals (Sweden)

    Hadiyat Miko

    2016-06-01

    Full Text Available To report on the essential performance characteristics of disposable air turbine handpiece and on aspect of their convenience and safety for preclinical use. The disposable handpiece is not recommended drilling in oral cavity. We use for student practical  in Operative Dentistry at preclinic laboratory. The other side micromotor low speed handpiece used as bur device on the phantom, the problem usually found in preclinik laboratory on practical conservation with the use of micromotor frequent damage to the handpiece (contra angel. Micromotor tend to heat up faster and have a low-speed, so it took a long time to complete the drilling, using the micromotor tend to be less safe because of the power generated from the flow of electricity at any time could damage. The price of  micromotor also is quite expensive. The limitations of the budget funds for maintenance, repair and procurement of mikromotor also became a problem. Based on these problems, the research team made a solution in the form of a replacement tool (substitute micromotor with the aim to resolve the existing problems as well as creating practices preclinic more effectively and efficiently. The use of a simple drill tool in the form of a series of Pneumatic Valve 220 volt (include electric compressor and Selenoid Disposible Handpiece Contra-angles as a new innovation in the laboratory of Dental Nursing. Majors preclinik Health Polytechnic Tasikmalaya  have been applied for last 3 years and have been able to more efficient cost of procurement tool of 70%. This disposible tool is apparently able to drill up to 20 times preparasicavity. This research uses descriptive method. Data collection techniques are used through the question form or questionnaire. Population and sample the study is a students collage 2nd years D-III of department of dental nursing Health Polytechnic Tasikmalaya. From the results of research that the majority of students expressed pleased and satisfied. This

  17. 220-IJBCS-Article-Prof Jean Cossi Ganglo

    African Journals Online (AJOL)

    Dr Gatsing

    Other forest species can also be considered, mainly those naturally found in the phytocoenose: Lonchocarpus sericeus,. Pterocarpus erinaceus, Anogeissus leiocarpus and Daniellia oliveri… • Nauclea latifolia – Mitragyna inermis phytocoenose. This phytocoenose is found in hygrophile site with muddy soils periodically.

  18. 20 CFR 220.135 - Exertional and nonexertional limitations.

    Science.gov (United States)

    2010-04-01

    ... Department of Labor, to determine the exertional requirements of work which exists in the national economy... other work which exists in the national economy in order to decide whether the claimant is disabled or... functioning because the claimant is nervous, anxious, or depressed; (ii) Difficulty maintaining attention or...

  19. 20 CFR 220.62 - Reviewing reports of consultative examinations.

    Science.gov (United States)

    2010-04-01

    .... Whether all the diseases, impairments and complaints described in the history are adequately assessed and... or claw hands, etc.). (4) Whether the report is properly signed. (b) If the report is inadequate or...

  20. 220 MC Somasekhara Reddy and A Kamalakara Murthy

    Indian Academy of Sciences (India)

    Reed TM and Gubbins K E 1973 Applied Statistical Mechanics (New York: McGraw-Hill Book. Co. Inc.) p. 124. Rowlinson J S 1964 Mol. Phys. 7349. Smith R B and Alder B J 1959 J. Chem. Phys. 30 1190 m. Somasekhara Reddy M C and Murthy A K 1982 Chen. Phys. Lett, 88 177. Thiele E 1965 J. Chem. Phys. 39 321.

  1. 20 CFR 220.177 - Terms and definitions.

    Science.gov (United States)

    2010-04-01

    ... claimant was awarded a disability annuity due to a herniated disc. At the time of the Board's prior... shows evidence of a persistant deficit in his lumbar spine. He had pain in his back, and pain and a...

  2. 40 CFR 1065.220 - Fuel flow meter.

    Science.gov (United States)

    2010-07-01

    .... (a) Application. You may use fuel flow in combination with a chemical balance of carbon (or oxygen... system, such as a partial-flow dilution system. (ii) For multiplying with continuously sampled gas... measures mass directly, such as one that relies on gravimetric or inertial measurement principles. This may...

  3. 32 CFR 220.7 - Remedies and procedures.

    Science.gov (United States)

    2010-07-01

    ... and procedures. (a) Pursuant to 10 U.S.C. 1095(e)(1), the United States may institute and prosecute legal proceedings against a third party payer to enforce a right of the United States under 10 U.S.C... States may compromise, settle or waive a claim of the United States under 10 U.S.C. 1095 and this part...

  4. Dicty_cDB: VHI220 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *ksx*sxfsxqkkkxfspxnpxx*qiprk txnxlsrplsfq Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value... update 2009. 4. 4 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N M26017...date 2003. 1. 9 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value ( P2899

  5. The Far-Infrared Spectrum of ARP 220

    Science.gov (United States)

    2004-05-27

    the OH lines were obtained also show far-infrared molecular absorption ( Kegel et al. 1999; Harvey et al. 1999), the rich molecular LWS spec- trum of...ApJ, 527, 795 Kegel , W. H., Hertenstein, T., & Quirrenbach, A. 1999, A&A, 351, 472 Kessler, M. F., et al. 1996, A&A, 315, L27 Launay, J.-M., & Roueff

  6. 7 CFR 220.6 - Use of funds.

    Science.gov (United States)

    2010-01-01

    ... per centum of the funds earned in any fiscal year under the School Breakfast Program. Advance payments... current obligations. (b) Whoever embezzles, willfully misapplies, steals, or obtains by fraud any funds... property have been embezzled, willfully misapplied, stolen, or obtained by fraud, shall be subject to the...

  7. 7 CFR 220.15 - Management evaluations and audits.

    Science.gov (United States)

    2010-01-01

    ... school. (c) In conducting management evaluations, reviews, or audits in a fiscal year, the State agency... within a fiscal year. However, no overpayment is to be disregarded where there is substantial evidence of violations of criminal law or civil fraud statutes. (Secs. 805 and 819, Pub. L. 97-35, 95 Stat. 521-535 (42 U...

  8. Dicty_cDB: SSA220 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ERIQEACDELTKMLNEDELRDAV LLVFCNKQDLPNAMSVAEVTDKLNLHSLRSRKWYIQSTCATSGDGLYEGLDWLSNTLTSS SK*mt*evnliefirffnylii*lnycclil...SNTLTSS SK*mt*evnliefirffnylii*lnycclilk*kkkkpclyk** Frame B: ---lygmlvvkikfvhygdiiskilkvlsllliqtiekefkklvmn

  9. 220 213 Effects of Weeds on the Profitabili

    African Journals Online (AJOL)

    2008-12-02

    Dec 2, 2008 ... This signifies that lack of weeding decreased farm profit more than the cost of weeding. Hence, the contribution of weeding cost to farm revenue is more important than its opportunity cost. However, the production of both crops will be more profitable if the cost weeding is reduced or saved since it cannot be.

  10. 46 CFR 402.220 - Registration of pilots.

    Science.gov (United States)

    2010-10-01

    ..., and local port authorities. (5) Instruction in basic helm and engine telegraph orders in the Greek... subjects including man-overboard recovery (i.e. Williamson turn); collision, fire, and explosion procedures...

  11. 40 CFR 52.220 - Identification of plan.

    Science.gov (United States)

    2010-07-01

    ... Burning. (B) Previously approved on May 11, 1977 and now deleted without replacement Rule 41. (viii) Yuba... paragraph (c)(26)(iv)(A) of this section and now deleted without replacement, Rule 3.1. (v) Yuba County APCD...) Rule 66. (iii) Yuba County APCD (A) Rule 1.1. (iv) Calaveras County APCD. (A) Rules 102, 201-215, 301...

  12. 20 CFR 220.132 - Physical exertion requirements.

    Science.gov (United States)

    2010-04-01

    ... determine the physical exertion requirements of work in the national economy, jobs are classified as... determinations the Board uses the following definitions: (a) Sedentary work. Sedentary work involves lifting no...

  13. Dicty_cDB: VSF220 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VHRDLKPENLLLKSKENHLEVAIADFGLSKIIG QTLVMQTACGTPSYVAPEVLNATGYDKEVDMWSIGVITYILLCGFPPFYGDTVPEIFEQI MEANY...VHRDLKPENLLLKSKENHLEVAIADFGLSKIIG QTLVMQTACGTPSYVAPEVLNATGYDKEVDMWSIGVITYILLCGFPPFYGDTVPEIFEQI MEANY...VHRDLKPENLLLKSKENHLEVAIADFGLSKIIG QTLVMQTACGTPSYVAPEVLNATGYDKEVDMWSIGVITYILLCGFPPFYGDTVPEIFEQI MEANY...VHRDLKPENLLLKSKENHLEVAIADFGLSKIIG QTLVMQTACGTPSYVAPEVLNATGYDKEVDMWSIGVITYILLCGFPPFYGDTVPEIFEQI MEANY

  14. Dicty_cDB: VFO220 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASG...GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASG

  15. Dicty_cDB: AFF220 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DQLSDDPIIHSHLTELYSNLLEQNLCRIIEPFSRVEISHIAKLIDLPVDVVERKLSLMIL DKKYNGILDQGTGTLIVFEEQKEDKLFNCSLETIGALSRVVIYFXKNKQTFLN...DQLSDDPIIHSHLTELYSNLLEQNLCRIIEPFSRVEISHIAKLIDLPVDVVERKLSLMIL DKKYNGILDQGTGTLIVFEEQKEDKLFNCSLETIGALSRVVIYFXKNKQTFLN

  16. 20 CFR 220.145 - Impairment-related work expenses.

    Science.gov (United States)

    2010-04-01

    ... cancer patients; corrective surgery for spinal impairments; electroencephalograms and brain scans related... or her employment or by reducing the number of hours he or she worked. (B) The Board considers a... condition; and immunosuppressive medications that kidney transplant patients regularly take to protect...

  17. 20 CFR 220.120 - The claimant's residual functional capacity.

    Science.gov (United States)

    2010-04-01

    ... limitations that go beyond the symptoms, such as pain, that are important in the diagnosis and treatment of... with a low back disorder may be fully capable of the physical demands consistent with those of... functional capacity. (a) General. The claimant's impairment(s), and any related symptoms, such as pain, may...

  18. Dicty_cDB: AFI220 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available update 2001. 6. 2 Translated Amino Acid sequence ---DWELLPSXQIKDPKQSKPVDWVDVKEIDDPEDVKPAGHDDIPASIVDPEAVKPEDWN...rrfs*n**qkrrsqkinqks*s*rtlneink**k Frame B: ---DWELLPSXQIKDPKQSKPVDWVDVKEIDDPEDVKPAGHDDIPASIVDPEAVKPEDWN

  19. 21 CFR 556.220 - 3,5-Dinitrobenzamide.

    Science.gov (United States)

    2010-04-01

    ...-exchange resin—Dowex 50W-X8, 200-400 mesh, Baker Analyzed Reagent, or equivalent, prepared as follows: 1... tissues” published in “Journal of Agricultural and Food Chemistry,” volume 9, pages 201-204 (1961). H...

  20. 1935 15' Quad #220 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  1. 24 CFR 266.220 - Nondiscrimination in housing and employment.

    Science.gov (United States)

    2010-04-01

    ... AUTHORITIES HOUSING FINANCE AGENCY RISK-SHARING PROGRAM FOR INSURED AFFORDABLE MULTIFAMILY PROJECT LOANS.... 3607(b)(2)); (b) Not discriminate against any family because of the sex of the head of household; (c...

  2. 20 CFR 220.114 - Evaluation of symptoms, including pain.

    Science.gov (United States)

    2010-04-01

    ... physician or psychologist, and others about the claimant's medical history, diagnosis, prescribed treatment... aggravate the claimant's symptoms, what medications, treatments or other methods he or she uses to alleviate... the claimant takes or has taken to alleviate the claimant's pain or other symptoms; (v) Treatment...

  3. 220 213 Effects of Weeds on the Profitabili

    African Journals Online (AJOL)

    2008-12-02

    Dec 2, 2008 ... grown in mixture, proportions based on the cropping patterns were used to arrive at the cost of each operation per respondent. The cost of fixed assets used was valued by using straight line method of depreciation. Since the assets were used for crops grown in mixture, the depreciated value of each asset.

  4. 220-IJBCS-Article-Prof Jean Cossi Ganglo

    African Journals Online (AJOL)

    Dr Gatsing

    Bruno de FOUCAULT 3 and Victor ADJAKIDJÈ 4. 1 Université d'Abomey-Calavi, Faculté des Sciences Agronomiques, Département d'Aménagement et Gestion de l'Environnement, 01 BP 526, Cotonou, République du Bénin. 2 Institut national des recherches agricoles du Bénin, 01 BP 884 Recette Principale,. Cotonou ...

  5. Mongrel: Essays. William Dicey. Cape Town: Umuzi, 2016. 220 pp ...

    African Journals Online (AJOL)

    Orange River, from Orania to the sea. It's by turns lyrical and funny, and rich with historical perspectives stimulated by people and places Dicey encounters en route. Some of Borderline's raffish quirkiness and range reappears in Mongrel, Dicey's first book since then—a welcome return by a gifted observer and writer. It is a.

  6. MPACT Theory Manual, Version 2.2.0

    Energy Technology Data Exchange (ETDEWEB)

    Downar, Thomas [Univ. of Michigan, Ann Arbor, MI (United States); Collins, Benjamin S. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Gehin, Jess C. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Godfrey, Andrew T. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Jabaay, Daniel [Univ. of Michigan, Ann Arbor, MI (United States); Kelley, Blake W. [Univ. of Michigan, Ann Arbor, MI (United States); Clarno, Kevin T. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Kim, Kang [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Kochunas, Brendan [Univ. of Michigan, Ann Arbor, MI (United States); Larsen, Edward W. [Univ. of Michigan, Ann Arbor, MI (United States); Liu, Yuxuan [Univ. of Michigan, Ann Arbor, MI (United States); Liu, Zhouyu [Univ. of Michigan, Ann Arbor, MI (United States); Martin, William R. [Univ. of Michigan, Ann Arbor, MI (United States); Palmtag, Scott [Core Physics, Inc., Cary, NC (United States); Rose, Michael [Univ. of Michigan, Ann Arbor, MI (United States); Saller, Thomas [Univ. of Michigan, Ann Arbor, MI (United States); Stimpson, Shane [Univ. of Michigan, Ann Arbor, MI (United States); Trahan, Travis [Univ. of Michigan, Ann Arbor, MI (United States); Wang, J. W. [Univ. of Michigan, Ann Arbor, MI (United States); Wieselquist, William A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Young, Mitchell [Univ. of Michigan, Ann Arbor, MI (United States); Zhu, Ang [Univ. of Michigan, Ann Arbor, MI (United States)

    2016-06-09

    This theory manual describes the three-dimensional (3-D) whole-core, pin-resolved transport calculation methodology employed in the MPACT code. To provide sub-pin level power distributions with sufficient accuracy, MPACT employs the method of characteristics (MOC) solutions in the framework of a 3-D coarse mesh finite difference (CMFD) formulation. MPACT provides a 3D MOC solution, but also a 2D/1D solution in which the 2D planar solution is provided by MOC and the axial coupling is resolved by one-dimensional (1-D) lower order (diffusion or P3) solutions. In Chapter 2 of the manual, the MOC methodology is described for calculating the regional angular and scalar fluxes from the Boltzmann transport equation. In Chapter 3, the 2D/1D methodology is described, together with the description of the CMFD iteration process involving dynamic homogenization and solution of the multigroup CMFD linear system. A description of the MPACT depletion algorithm is given in Chapter 4, followed by a discussion of the subgroup and ESSM resonance processing methods in Chapter 5. The final Chapter 6 describes a simplified thermal hydraulics model in MPACT.

  7. Publications | Page 220 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, de la mise en commun des connaissances et de la formation. Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons à ...

  8. CompTIA A+ Complete Deluxe Study Guide, Exams 220-701/220-702 Essentials/Practical Application

    CERN Document Server

    Docter, Quentin; Skandier, Toby

    2009-01-01

    An arsenal of study aids for anyone preparing to take the CompTIA A+ certification exams. The CompTIA A+ certification is the industry standard in terms of measuring a technician's hardware and software knowledge. As the most popular entry-level certification, it is particularly popular among individuals switching from another career to computers. This Deluxe Edition of the bestselling CompTIA A+ Study Guide features bonus practice exams, flashcards, and more than an hour of instructional video of key hands-on tasks. Covering all exam objectives, study guide focuses on the new best practices a

  9. Ferroresonance in 220/420-kV-voltage transformers during switching; Ferroresonanz an 220/420-kV-Spannungswandlern bei Schalthandlungen

    Energy Technology Data Exchange (ETDEWEB)

    Braeunlich, R. [Fachkommission fuer Hochspannungsfragen (FKH), Zurich (Switzerland); Daeumling, H. [Ritz Messwandler (Germany). Bereich Entwicklung, Qualitaetsmanagement und Prueffelder; Hofstetter, M. [Elektrizitaetswerk der Stadt Zuerich (EWZ) (Switzerland). Abt. Projektierung und Bau Unterwerke; Prucker, U. [Trench-Germany GmbH (Germany); Schmid, J. [Trench Switzerland AG, Basel (Switzerland); Minkner, R. [Trench Switzerland AG, Basel (Switzerland); Haefely AG, Basel (Switzerland); Hochschule fuer Technik und Informatik, Burgdorf (Switzerland); Schlierf, H.W. [RWE Transportnetz Strom GmbH (Germany). Abt. fuer Hochspannungsbetriebsmittel

    2007-07-15

    Ferroresonances occure usually in small from grid decoupled parts of a switch device and its circuits. Due to capacitive coupling by the grid voltage a manyfold of complex and nonlinear oscillations are affected if the transformer kernel is saturated. In this contribution a complex three-phase ferroresonance process is described and remedy measures are presented. (GL)

  10. 20 CFR 645.220 - What activities are allowable under this part?

    Science.gov (United States)

    2010-04-01

    ... LABOR PROVISIONS GOVERNING WELFARE-TO-WORK GRANTS General Program and Administrative Requirements § 645...) Transportation assistance; (2) Substance abuse treatment (except that WtW funds may not be used to provide...

  11. energy and exergy evaluation of a 220mw thermal power plant

    African Journals Online (AJOL)

    HOD

    environmental or dead state temperature, there were no appreciable changes in the values of exergy efficiency of the boiler/steam generator. The outcomes of this work provide the exergy consumption and distribution profiles of the thermal power plant, making it possible to adopt effective energy-saving measures.

  12. 42 CFR 440.220 - Required services for the medically needy.

    Science.gov (United States)

    2010-10-01

    ... following services: (1) Prenatal care and delivery services for pregnant women. (2) Ambulatory services, as... or § 440.160) or in an intermediate care facility for the mentally retarded (§ 440.150(c)) for any...: (i) The services contained in §§ 440.10 through 440.50 and (to the extent nurse-midwives are...

  13. 33 CFR 106.220 - Security training for all other OCS facility personnel.

    Science.gov (United States)

    2010-07-01

    ... OCS facility personnel. All other OCS facility personnel, including contractors, whether part-time, full-time, temporary, or permanent, must have knowledge, through training or equivalent job experience...

  14. Electronics and Trigger developments for the Diffractive Physics Proposal at 220 m from LHC-ATLAS

    CERN Document Server

    Le Dû, P; Kepka, O; Kupco, A; Royon, Christophe; Tic, T; Vrba, Vaclav

    2007-01-01

    The instrumentation consists of two sets of Roman Pots installed respectively at 216 and 224m on both sides from the ATLAS IP to measure with precision the position (< 10 micrometers) and the timing (< 5ps) of the two back to back diffracted protons tracks. Each Roman Pot is equipped with several planes of Silicon strips detectors read out by a new version of the ATLAS Silicon tracker ABCD readout chip with a longer latency (6.4 microseconds) and fast OR outputs defining a track segment. Theses inputs are to be combined in time with the ATLAS level 1 trigger accept signal. In addition, these tracks are time filtered with a very fast timing detector (MCP-PMT) allowing to constraint further at the level 2 the position of the IP within a one millimetre precision., The description of the electronics and trigger system as well as the various technical issues associated with such challenging experiments (clocks, cabling,, time monitoring) will be presented.

  15. An evaluation of the Daisy II-220 technique for determining in vitro ...

    African Journals Online (AJOL)

    Unknown

    determinations of digestibility using rumen fluid/cellulase have been used extensively in laboratories world- wide. These techniques use individual digestion ... from each other in that neutral detergent fibre (NDF) is determined in the rumen digesta (Daisy) instead of a pepsin digestion, The rumen digesta is shaken ...

  16. 20 CFR 220.112 - Conclusions by physicians concerning the claimant's disability.

    Science.gov (United States)

    2010-04-01

    ... may have to consider such factors as age, education and past work experience. Such vocational factors.... Example: In a case involving an organic mental disorder caused by trauma to the head, a consultative...

  17. 40 CFR 158.220 - Experimental use permit data requirements for product performance.

    Science.gov (United States)

    2010-07-01

    ... Note No. Efficacy of antimicrobial agents 91-8 Products for treating water systems NR NR CR NR NR NR NR... pesticide product bears a claim to control pest microorganisms that pose a threat to human health and whose presence cannot readily be observed by the user including, but not limited to, microorganisms infectious to...

  18. Environmental impact case study : Route 220, Fincastle to Eagle Rock : Project 0220-002-106.

    Science.gov (United States)

    1971-01-01

    At the request of the Environmental Quality Division, the Environmental and Economics Section of the Virginia Highway Research Council conducted a study to determine the probable socioeconomic and environmental impact of the proposed dual-laning of R...

  19. MPACT Standard Input User s Manual, Version 2.2.0

    Energy Technology Data Exchange (ETDEWEB)

    Collins, Benjamin S. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Downar, Thomas [Univ. of Michigan, Ann Arbor, MI (United States); Fitzgerald, Andrew [Univ. of Michigan, Ann Arbor, MI (United States); Gehin, Jess C. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Godfrey, Andrew T. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Graham, Aaron [Univ. of Michigan, Ann Arbor, MI (United States); Jabaay, Daniel [Univ. of Michigan, Ann Arbor, MI (United States); Kelley, Blake W. [Univ. of Michigan, Ann Arbor, MI (United States); Kim, Kang [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Kochunas, Brendan [Univ. of Michigan, Ann Arbor, MI (United States); Kulesza, Joel A. [Univ. of Michigan, Ann Arbor, MI (United States); Larsen, Edward W. [Univ. of Michigan, Ann Arbor, MI (United States); Liu, Yuxuan [Univ. of Michigan, Ann Arbor, MI (United States); Liu, Zhouyu [Univ. of Michigan, Ann Arbor, MI (United States); Martin, William R. [Univ. of Michigan, Ann Arbor, MI (United States); Nelson, Adam G. [Univ. of Michigan, Ann Arbor, MI (United States); Palmtag, Scott [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Rose, Michael [Univ. of Michigan, Ann Arbor, MI (United States); Saller, Thomas [Univ. of Michigan, Ann Arbor, MI (United States); Stimpson, Shane G. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Trahan, Travis [Univ. of Michigan, Ann Arbor, MI (United States); Wang, J. W. [Univ. of Michigan, Ann Arbor, MI (United States); Wieselquist, William A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Young, Mitchell [Univ. of Michigan, Ann Arbor, MI (United States); Zhu, Ang [Univ. of Michigan, Ann Arbor, MI (United States)

    2016-08-01

    The MPACT (Michigan PArallel Charactistics based Transport) code is designed to perform high-fidelity light water reactor (LWR) analysis using whole-core pin-resolved neutron transport calculations on modern parallel-computing hardware. The code consists of several libraries which provide the functionality necessary to solve steady-state eigenvalue problems. Several transport capabilities are available within MPACT including both 2-D and 3-D Method of Characteristics (MOC). A three-dimensional whole core solution based on the 2D-1D solution method provides the capability for full core depletion calculations.

  20. A modification of the Daisy II - 220 technique for the determination of ...

    African Journals Online (AJOL)

    Unknown

    The means (n = 5) for dry matter digestibility of kikuyu, ryegrass, maize and eragrotis hay are presented in. Table 1. No significant differences were observed between the different bags when maize and eragrotis hay were analysed. A significant (P < 0.05) difference was observed for kikuyu between the Daisy and the lining ...

  1. 32 CFR 220.10 - Special rules for Medicare supplemental plans.

    Science.gov (United States)

    2010-07-01

    ... Services (or other authorized representative of the United States) makes a determination, based on... DEFENSE (CONTINUED) MISCELLANEOUS COLLECTION FROM THIRD PARTY PAYERS OF REASONABLE CHARGES FOR HEALTHCARE... Medicare-certified hospital. (c) Charges for Healthcare services other than inpatient deductible amount. (1...

  2. 32 CFR 220.13 - Special rules for workers' compensation programs.

    Science.gov (United States)

    2010-07-01

    ... workers' compensation program or plan generally has an obligation to pay the United States the reasonable charges for healthcare services provided in or through any facility of the Uniformed Services to a... DEFENSE (CONTINUED) MISCELLANEOUS COLLECTION FROM THIRD PARTY PAYERS OF REASONABLE CHARGES FOR HEALTHCARE...

  3. W-026 acceptance test report plant control system hardware (submittal {number_sign} 220.C)

    Energy Technology Data Exchange (ETDEWEB)

    Watson, T.L., Fluor Daniel Hanford

    1997-02-14

    Acceptance Testing of the WRAP1 Plant Control System Hardware was conducted throughout the construction of WRAPI with the final testing on the Process Area hardware being completed in November 1996. The hardware tests were broken out by the following functional areas; Local Control Units, Operator Control Stations in the WRAP Control Room, DMS Server, PCS Server, Operator Interface Units, printers, DMS terminals, WRAP Local Area Network/Communications, and bar code equipment. This document contains a completed copy of each of the hardware tests along with the applicable test logs and completed test exception reports.

  4. TUNL Nuclear Structure Data Evaluation on A = 2-20 Nuclides

    Science.gov (United States)

    Truong, Thinh; Kelley, John; Sheu, Grace

    2016-09-01

    Nuclear data represents measured or evaluated probabilities of various physical interactions involving the nuclei of atoms. The nuclear data group at Triangle Universities Nuclear Laboratory (TUNL) compiles, evaluates and disseminates nuclear structure data relevant to light nuclei in the mass region of A = 2 - 20. Our activities primarily involve surveying literature articles and producing recommended values for inclusion into various United States Nuclear Data Program databases, such as Experimental Unevaluated Nuclear Data List (XUNDL) and Evaluated Nuclear Structure Data File (ENSDF). We have projects related to analyzing beta-decay lifetimes, compiling structure data from recently published articles, and producing full nuclear structure data evaluations of nuclides based on all existing literature. The nuclear data disseminated is used for theoretical model development of nuclear physics and for applications involving radiation and nuclear power technologies. This work is supported by the U.S. National Science Foundation Grant No. NSF-PHY-1461204 and Duke/TUNL.

  5. Amino acids and hexosamines in the Hess Rise core during the past 220,000 years

    Science.gov (United States)

    Gupta, Lallan Prasad; Kawahata, Hodaka

    2003-11-01

    Core sediment samples collected from the Hess Rise, North Pacific, were analyzed for 20 common amino acids (AA) and two hexosamines (HA) to understand the relation between glacial-interglacial variations and deposition/preservation of sedimentary organic matter (OM). The sediments are predominantly carbonaceous (carbonates 35-80%). AA-based parameters—aspartic acid/glycine ratio and serine+threonine relative mole content—suggest that calcareous plankton was the major source of OM in these sediments. This inference is supported by the similarity in distribution patterns of AA and HA contents with that of organic carbon. Low values of AA/HA and glucosamine/galactosamine ratios (average 4.4 and 1.1, respectively) imply that much of the planktonic OM was replaced by microbial OM. The relative molar concentration of two nonprotein AA (β-alanine and γ-aminobutyric acid) varied with age of sediments; i.e., they were less abundant in recent sediments and more abundant in the oldest sediments. This trend is an indicator of extremely slow but continuous enzymatic degradation of proteinaceous OM within the sediments. So far, bulk OM has been believed to be one of the best proxies for estimation of primary productivity. However, it may be an underestimate, even for the late Quaternary sediments. Comparison of AA and HA content variations with SPECMAP stack revealed their enhanced deposition and preservation during glacial periods relative to interglacial periods. This, in turn, affected not only the planktonic production in surface waters but also the benthic community, including bacteria on the seafloor.

  6. 20 CFR Appendix 3 to Part 220 - Railroad Retirement Board Occupational Disability Standards

    Science.gov (United States)

    2010-04-01

    ... PART: ENDOCRINE CONFIRMATORY TESTS Diabetes, requiring insulin (IDDM): Medical record review... classification BODY PART: ENDOCRINE JOB TITLE: ENGINEER Diabetes, requiring insulin (IDDM): Medical record review.... Silicosis: Medical record review Occupational exposure for at least 1 year Highly recommended. Tuberculosis...

  7. the reception of galatians 2:20 in the patristic period and in the ...

    African Journals Online (AJOL)

    subsequently compare this with the commentaries of Luther and Calvin. 1 I thank Prof. Dr. R.B. ter ... There are two references to this text in his works: one in his ..... theological thought and its reception will portray a more dynamic history of theology than the stated oppositions of traditional conflicts. BIBLIOGRAPHY. Ambrose.

  8. Clinical and laboratory findings in 220 children with recurrent abdominal pain

    NARCIS (Netherlands)

    Gijsbers, C. F. M.; Benninga, M. A.; Büller, H. A.

    2011-01-01

    Aim: To investigate the clinical and laboratory findings in children with recurrent abdominal pain (RAP). Methods: Consecutive patients with RAP (Apley criteria), age 4-16 years, referred to a secondary medical centre were evaluated by a standardized history, physical examination and laboratory

  9. Suitsupaki omahind on vaid 2.20 / Toivo Tänavsuu

    Index Scriptorium Estoniae

    Tänavsuu, Toivo

    2007-01-01

    Tubakafirmad kinnitavad üheselt, et vaatamata riiklikele keeldudele ja piirangutele on nende ärid kasumlikud. Lisa: Tubakareklaami lipulaev Saksamaa. Vt. samas: Portugalis ei lasta sportlasi suitsuruumidesse

  10. Yeast Interacting Proteins Database: YLR052W, YGL220W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available transcription of iron regulon; forms an iron independent complex with Fra2p, Grx3p, and Grx4p; null mutant...transcription of iron regulon; forms an iron independent complex with Fra2p, Grx3p, and Grx4p; null mutant

  11. Geomagnetic Absolute Mean Values at Hourly Intervals from 220 Observatories Worldwide

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This file is comprised of absolute mean hourly values of the geomagnetic components D, H and Z or X, Y and Z. These values, on magnetic tape, are available from...

  12. [Quality of life and influencing factors for patients with silicosis: an analysis of 220 cases].

    Science.gov (United States)

    Cheng, Wenhong

    2015-02-01

    To investigate the quality of life and influencing factors for patients with silicosis and to provide a basis for treatment of silicosis. Two hundred and twenty stone workers with silicosis from June 1999 to June 2014 were enrolled into observation group, while healthy stone workers within the same period were used as controls. The quality of life was evaluated using the Chinese version of the World Health Organization Quality of Life Assessment (WHOQOL-100), and the influencing factors were determined using stepwise multivariate regression analysis. The scores for psychological function, physiological, independence, spiritual realm, the overall quality of life, and physical condition in the observation group were significantly lower than those in the control group (t = 7.1168, P silicosis stage, recreation, age, reliance on health care, pain, discomfort, and spiritual beliefs were all influencing factors for the quality of life, which resulted in 68.3% of variation in the quality of life. Besides clinical treatment, health and psychological education and recreation are important for patients with silicosis to improve their quality of life.

  13. 20 CFR 220.26 - Disability for any regular employment, defined.

    Science.gov (United States)

    2010-04-01

    ... employment since before age 22. To meet this definition of disability, a claimant must have a severe... exists in the national economy. To determine whether a claimant is able to do any other work, the Board...

  14. 20 CFR 220.134 - Medical-vocational guidelines in appendix 2 of this part.

    Science.gov (United States)

    2010-04-01

    ... economy. Appendix 2 of this part provides rules using this data reflecting major functional and vocational... definitions and discussions under vocational considerations. However, if the findings of fact made about all...

  15. 25 CFR 170.220 - What is the Population Adjustment Factor?

    Science.gov (United States)

    2010-04-01

    ... the Population Adjustment Factor? The Population Adjustment Factor (PAF) is a special portion of the... Program funding). The PAF is based upon the population ranges and distribution factors in appendix B to... PAF is derived. The funds generated by the PAF can be used for transportation planning or IRR projects. ...

  16. Formation of Mg2C3 phase in N220 nanocarbon containing low ...

    Indian Academy of Sciences (India)

    2017-08-18

    Aug 18, 2017 ... In this report, nail-type sequicarbide (Mg2C3) appeared in magnesia carbon refractory. Besides that, with reference to the literature, crystalized graphite can be obtained from mag- nesium carbide at relatively low temprature, which reflects in our hot strength and corrosion resistance study. 2. Materials and ...

  17. 28 CFR 2.20 - Paroling policy guidelines: Statement of general policy.

    Science.gov (United States)

    2010-07-01

    ... Person Subchapter A—Homicide Offenses Subchapter B—Assault Offenses Subchapter C—Kidnaping and Related... not less than Category Five. Subchapter C—Kidnaping and Related Offenses 221Kidnaping (a) If the purpose of the kidnaping is for ransom or terrorism, grade as Category Eight; (b) If a person is held...

  18. UV-LIGA Microfabrication of 220 GHz Sheet Beam Amplifier Gratings with SU-8 Photoresists

    Science.gov (United States)

    2010-01-01

    etching (DRIE) is not effective on copper substrates, but was used to fabricate metalized silicon test pieces [11]. This paper begins with a detailed...figure 9(b)). After an ultrasonic bath in Microclean 90 R© and water, only half of a dozen blackened bits of SU-8 remained. The remaining SU-8 residue... metallization Master of Science Thesis Dept of Chem. Eng., Case Western Reserve University [22] Pasquale M A, Gassa L M and Arvia A J 2008 Copper

  19. Evaluation of recycled hot mix asphalt concrete on Route 220 : final report.

    Science.gov (United States)

    1985-01-01

    This report describes the performance of an approximately 8-mi section of roadway on which the rod two layers of asphalt concrete were milled, recycled through a conventional asphalt batch plant, and relaid. The recycled mix consisted of about 40% re...

  20. Installation report : evaluation of recycled hot mix asphaltic concrete on Route 220.

    Science.gov (United States)

    1982-01-01

    This report describes a project in which the bituminous pavement on an approximately 8-mi. (13-km) section of roadway was removed, recycled through a conventional asphalt batch plant, and relaid. The project was accomplished with little difficulty an...

  1. 7 CFR Appendix A to Part 220 - Alternate Foods for Meals

    Science.gov (United States)

    2010-01-01

    ... alternate protein products must be safe and suitable edible products produced from plant or animal sources... percent that of casein, determined by performing a Protein Digestibility Corrected Amino Acid Score.... Manufacturers seeking acceptance of their product shall furnish FNS a chemical analysis, protein efficiency...

  2. 20 CFR 220.10 - Disability for work in an employee's regular railroad occupation.

    Science.gov (United States)

    2010-04-01

    ... supplemented by an Occupational Disability Claims Manual (Manual) 1 which was also developed with the cooperation of employers and employees. 1 The Manual may be obtained from the Board's headquarters at 844 North Rush Street, Chicago, IL 60611. (b) In accordance with section 2(a)(2) of the Railroad Retirement...

  3. Page 1 220 K. Chandra Sekharan and - dea (t)= }, (t). When K= 1, u ...

    Indian Academy of Sciences (India)

    dea (t)= }, (t). When K= 1, u = }, \\, = n, the definition reads as follows:–. A series 2 a, is said to be summable (Ji n) to the sum S, if the series f co sin nt. 2 an (**) r; : 0 Plf converges for real t > 0, and if. - sin nt 6. Lim 2 a. (*). S,. # -}. () Pl which is Lebesgue's summability. When K+ 2, u = }, \\, = n, the definition reads thus: A series 2 ...

  4. 29 CFR 825.220 - Protection for employees who request leave or otherwise assert FMLA rights.

    Science.gov (United States)

    2010-07-01

    ... otherwise assert FMLA rights. (a) The FMLA prohibits interference with an employee's rights under the law, and with legal proceedings or inquiries relating to an employee's rights. More specifically, the law... with” the exercise of an employee's rights would include, for example, not only refusing to authorize...

  5. 20 CFR 220.56 - Securing medical evidence at the hearings officer hearing level.

    Science.gov (United States)

    2010-04-01

    ... reasoning will be explained in the decision rationale. Where such resolution is not possible, the hearings officer will secure additional medical evidence (e.g., clinical findings, laboratory test, diagnosis...

  6. 20 CFR 220.131 - Work which exists in the national economy.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Work which exists in the national economy... economy. (a) General. The Board considers that work exists in the national economy when it exists in... for work. (b) How the Board determines the existence of work. Work exists in the national economy when...

  7. Energy and exergy evaluation of a 220MW thermal power plant ...

    African Journals Online (AJOL)

    At the variation of environmental or dead state temperature, ther e were no appreciable changes in the values of exergy efficiency of the boiler/steam generator. The outcomes of this work provide the exergy consumption and distribution profile s of the thermal power plant, making it possible to adopt effective energy - saving ...

  8. 33 CFR 104.220 - Company or vessel personnel with security duties.

    Science.gov (United States)

    2010-07-01

    ... measures; (e) Crowd management and control techniques; (f) Security related communications; (g) Knowledge... duties must maintain a TWIC, and must have knowledge, through training or equivalent job experience, in the following, as appropriate: (a) Knowledge of current security threats and patterns; (b) Recognition...

  9. 20 CFR 637.220 - Eligibility criteria for individuals to be counted in determining incentive bonuses.

    Science.gov (United States)

    2010-04-01

    ... participation in programs under the Act; (3) Has participated in education, training, or other activities... incentive bonus payment under this part if the individual: (a)(1) Was an absent parent of any child receiving AFDC at the time such individual was determined to be eligible for participation in programs under...

  10. 77 FR 61895 - Electricity Market Transparency Provisions of Section 220 of the Federal Power Act

    Science.gov (United States)

    2012-10-11

    .... Specifically, the Commission has proposed to replace the Visual FoxPro-based EQR software with two new filing... anti-competitive, discriminatory, and manipulative practices. \\12\\ See, e.g., Revised Public Utility...'s ability to monitor its retail markets for anti-competitive and manipulative behavior.\\45\\ \\45...

  11. 7 CFR 2.20 - Under Secretary for Natural Resources and Environment.

    Science.gov (United States)

    2010-01-01

    ... related lands; and derivative values such as economic strength and social well-being). (ii) Protect...) Administer a program for providing loans to eligible units of local government to finance the purchase of...

  12. 7 CFR 220.8 - Nutrition standards and menu planning approaches for breakfasts.

    Science.gov (United States)

    2010-01-01

    ... time consistent with the infant's eating habits. For those infants whose dietary needs are more...); (3) These applicable recommendations of the 1995 Dietary Guidelines for Americans: (i) Eat a variety... reasons. Schools must make substitutions in breakfasts for students who are considered to have a...

  13. 76 FR 24187 - Electricity Market Transparency Provisions of Section 220 of the Federal Power Act

    Science.gov (United States)

    2011-04-29

    .... Information Collection Statement 123 IV. Environmental Analysis 131 V. Regulatory Flexibility Act... Commission adopted an Electric Quarterly Report Data Dictionary, which provides in one document the... changes associated with the EQR Data Dictionary). \\13\\ Order No. 2001-G, 120 FERC ] 61,270. \\14...

  14. 20 CFR 220.13 - Establishment of permanent disability for work in regular railroad occupation.

    Science.gov (United States)

    2010-04-01

    ... the physical requirements and environmental factors relating to the employee's regular railroad... consult other sources such as the Dictionary of Occupational Titles and the job descriptions of...

  15. 20 CFR Appendix 2 to Part 220 - Medical-Vocational Guidelines

    Science.gov (United States)

    2010-04-01

    ... the “Dictionary of Occupational Titles” and the “Occupational Outlook Handbook,” published by the... environmental restrictions. Environmental restrictions are those restrictions which result in inability to... which would have already provided a basis for a decision of “not disabled”. Environmental restrictions...

  16. MPACT VERA Input User s Manual, Version 2.2.0

    Energy Technology Data Exchange (ETDEWEB)

    Collins, Benjamin S. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Downar, Thomas [Univ. of Michigan, Ann Arbor, MI (United States); Fitzgerald, Andrew [Univ. of Michigan, Ann Arbor, MI (United States); Gehin, Jess C. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Godfrey, Andrew T. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Graham, Aaron [Univ. of Michigan, Ann Arbor, MI (United States); Jabaay, Daniel [Univ. of Michigan, Ann Arbor, MI (United States); Kelley, Blake W. [Univ. of Michigan, Ann Arbor, MI (United States); Kim, Kang [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Kochunas, Brendan [Univ. of Michigan, Ann Arbor, MI (United States); Kulesza, Joel A. [Univ. of Michigan, Ann Arbor, MI (United States); Larsen, Edward W. [Univ. of Michigan, Ann Arbor, MI (United States); Liu, Yuxuan [Univ. of Michigan, Ann Arbor, MI (United States); Liu, Zhouyu [Univ. of Michigan, Ann Arbor, MI (United States); Martin, William R. [Univ. of Michigan, Ann Arbor, MI (United States); Nelson, Adam G. [Univ. of Michigan, Ann Arbor, MI (United States); Palmtag, Scott [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Rose, Michael [Univ. of Michigan, Ann Arbor, MI (United States); Saller, Thomas [Univ. of Michigan, Ann Arbor, MI (United States); Stimpson, Shane G. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Trahan, Travis [Univ. of Michigan, Ann Arbor, MI (United States); Wang, J. W. [Univ. of Michigan, Ann Arbor, MI (United States); Wieselquist, William A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Young, Mitchell [Univ. of Michigan, Ann Arbor, MI (United States); Zhu, Ang [Univ. of Michigan, Ann Arbor, MI (United States)

    2016-06-09

    The MPACT (Michigan PArallel Charactistics based Transport) code is designed to perform high-fidelity light water reactor (LWR) analysis using whole-core pin-resolved neutron transport calculations on modern parallel-computing hardware. The code consists of several libraries which provide the functionality necessary to solve steady-state eigenvalue problems. Several transport capabilities are available within MPACT including both 2-D and 3-D Method of Characteristics (MOC). A three-dimensional whole core solution based on the 2D-1D solution method provides the capability for full core depletion calculations.

  17. 20 CFR 220.144 - Evaluation guides for a self-employed claimant.

    Science.gov (United States)

    2010-04-01

    ... performed in making managerial decisions about the production of the crop, such as when to plant, cultivate... hours, skills, energy output, efficency, duties, and responsibilities, is comparable to that of... the claimant materially participates in the production or the management of the production of the...

  18. Understanding the source of dielectric loss in Titania/polypropylene nanocomposites up to 220 GHz

    Science.gov (United States)

    Womble, Michael D.; Herbsommer, Juan; Lee, Yun-Ju; Hsu, Julia

    2017-02-01

    Nanocomposites are a promising new dielectric material for on-chip and chip-to-chip waveguides that operate at millimeter (mm)-wave frequencies because of their higher relative permittivity compared to neat polymers and their compatibility with printed circuit board processing. For dielectric waveguides, extremely low loss is critical; thus, understanding the origins of loss is an important step for these applications. In this paper, we investigate the sources of loss in TiO2/polypropylene (PP) nanocomposites, in which polypropylene-graft-maleic anhydride (PP-g-MA) is added as a compatibilizer. Compared to nanocomposites made without PP-g-MA, we find that PP-g-MA improves the distribution of nanoparticles in the PP matrix and significantly lowers loss. We also examine the contribution to dielectric loss from PP-g-MA by measuring samples that contain no TiO2 nanoparticles, and find that while increasing the amount of PP-g- MA in PP results in a higher loss, it is small compared to the loss that comes from the addition of TiO2 nanoparticles.

  19. 32 CFR 220.2 - Statutory obligation of third party payer to pay.

    Science.gov (United States)

    2010-07-01

    ... Uniformed Services makes a claim, appeal, representation, or other filing under the authority of this part... claim, appeal, representation, or other filing must be deemed to be satisfied. A copy of the completed... provision of a law or regulation of a State or political subdivision thereof that purports to establish any...

  20. 49 CFR 220.311 - Railroad operating employees in deadhead status.

    Science.gov (United States)

    2010-10-01

    ...) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD COMMUNICATIONS Electronic Devices... controlling locomotive may use an electronic device only if the employee is not using the device in such a way... controlling locomotive must have each electronic device turned off with any earpiece removed from the ear— (1...

  1. Derivation of Soil Screening Guidelines for Gross Alpha/Beta Radioactivity for United States Air Force Deployment Sites

    Science.gov (United States)

    2007-04-19

    the emission of 7 alpha particles and 4 beta particles. Three radionuclides ( francium -223, astatine-215, and polonium-211) are not listed below...no no Uranium-233 159,200 y alpha yes no Thorium-229 7,300 y alpha yes no Radium-225 14.9 d beta no no Actinium-225 10.0 d alpha no no Francium

  2. δ37Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine.

  3. δ³⁷Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine. This thesis presents the first chlorine

  4. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  5. The Mounting process and dielectric tests of the Parque Caballero armored substation in SF6(220 Kv); Montaje y pruebas dielectricas de la estacion blindada en gas SF6 (220 kV) 'Parque Caballero'

    Energy Technology Data Exchange (ETDEWEB)

    Decoud, Carlos; Bobadilla, Alberto [ANDE - Administracion Nacional de Electricidad, Assuncion (Paraguay)

    2001-07-01

    This document approaches the aspects referring to the mounting and also dielectric tests for the Parque Caballero armored substation in SF6. This type of installation represents a innovation regarding substations in urban centres. The most relevant items in relation to the mounting process are shown in a summarized way, as well as the aspects related to dielectric tests executed during the substation commissioning.

  6. Design, construction and integration of hybrid drive components in commercial vehicles. The MAN hybrid drive truck TGL 12.220; Auslegung, Aufbau und Integration von Hybrid-Antriebskomponenten im Nutzfahrzeug. Der MAN Hybrid-Verteiler-Lkw TGL 12.220

    Energy Technology Data Exchange (ETDEWEB)

    Kerschl, Stefan; Hipp, Eberhand; Doebereiner, Rolf [MAN Nutzfahrzeuge AG, Muenchen (Germany)

    2009-07-01

    In contrast to the passenger car the drive train of commercial vehicles is designed basically in view of a maximum efficiency, because the fuel consumption has a determining portion in the vehicle operating expenses of the operators. The pay load of the vehicle also has a high value, in particular in the small and middle segment from 8 t of total weight. In view of pollutant issues the environmental zones which may be also driven by commercial vehicles only from a certain pollutant class were already furnished by many local authority districts. Additional demands for a purely, emission free electric short distance operation can result from suitable emission editions in bigger towns in future. MAN Nutzfahrzeuge AG meet these topical challenges with the development of a hybriddelivery truck of the 12 t - class. At this the aim is to meet to the demands after low CO{sub 2} issue and purely electric operation by a powerful battery system and the recuperation of brake energy. For the integration of the hybrid components in the vehicle it was respected to preserve the pay load of the vehicle without limiting the functionality. The dimensioning of the hybrid drive train for a delivery truck vehicle, the vehicle integration and the effects on the lifecycle economics are lighted up in the following. (orig.)

  7. 12 CFR 220.124 - Installment sale of tax-shelter programs as “arranging” for credit.

    Science.gov (United States)

    2010-01-01

    ... partnership. In the case of the programs under consideration, the investor would commit himself to purchase and the partnership would commit itself to sell the interests. The investor would be entitled to the...) does not permit any loan value to be given securities that are not registered on a national securities...

  8. BASIC PRINCIPLES OF ORGANIZING OF REPAIR OF A NEW GENERATION OF ELECTRIC POWER LINES 220 kV AND ABOVE

    Directory of Open Access Journals (Sweden)

    Postolaty V.M.

    2011-08-01

    Full Text Available The article describes the requirements for repair work on single circuit and double circuit overhead transmission lines of compact (VL and controlled self-compensating high voltage transmission power lines (CSHVL.These include overhead power lines to a new generation. They differ from traditional overhead using compact designs of supports, the convergence phase of the spans, circuits and substations connections to ways of regulation. With this new generation have the overhead compared to conventional overhead increased bandwidth and improved technical and economic indicators. The design and features of the new circuit overhead lines require a series of new campaigns for the organization of repairs, which are discussed in this article.

  9. Alleviation of Water Stress Effects on MR220 Rice by Application of Periodical Water Stress and Potassium Fertilization

    Directory of Open Access Journals (Sweden)

    Nurul Amalina Mohd Zain

    2014-02-01

    Full Text Available The use of periodical water stress and potassium fertilization may enhance rice tolerance to drought stress and improve the crop’s instantaneous water use efficiency without much yield reduction. This study was conducted to assess the effects of different periodical water stress combined with potassium fertilization regimes on growth, yield, leaf gas exchanges and biochemical changes in rice grown in pots and compare them with standard local rice grower practices. Five treatments including (1 standard local grower’s practice (control, 80CF = 80 kg K2O/ha + control flooding; (2 120PW15 = 120 kg K2O/ha + periodical water stress for 15 days; (3 120DS15V = 120 kg K2O/ha + drought stress for 15 days during the vegetative stage; (4 120DS25V = 120 kg K2O/ha + drought stress for 25 days and (5 120DS15R = 120 kg K2O/ha + drought stress for 15 days during the reproductive stage, were evaluated in this experiment. Control and 120PW15 treatments were stopped at 100 DAS, and continuously saturated conditions were applied until harvest. It was found that rice under 120PW15 treatment showed tolerance to drought stress evidenced by increased water use efficiency, peroxidase (POX, catalase (CAT and proline levels, maximum efficiency of photosystem II (fv/fm and lower minimal fluorescence (fo, compared to other treatments. Path coefficient analysis revealed that most of parameters contribute directly rather than indirectly to rice yield. In this experiment, there were four factors that are directly involved with rice yield: grain soluble sugar, photosynthesis, water use efficiency and total chlorophyll content. The residual factors affecting rice yield are observed to be quite low in the experiment (0.350, confirming that rice yield was mostly influenced by the parameters measured during the study.

  10. 2 CFR Appendix A to Part 220 - Principles for Determining Costs Applicable to Grants, Contracts, and Other Agreements With...

    Science.gov (United States)

    2010-01-01

    ... expenses 6. Departmental administration expenses 7. Sponsored projects administration 8. Library expenses 9... with certain buildings, equipment and capital improvements, operation and maintenance expenses, and library expenses. “Administration” is defined as general administration and general expenses, departmental...

  11. 20 CFR 666.220 - What information must be included in a State Board's application for an Incentive Grant?

    Science.gov (United States)

    2010-04-01

    ... Education, we will issue instructions annually which will include the amount of funds available to be awarded for each State and provide instructions for submitting applications for an Incentive Grant. (b... State Board, containing the following assurances: (1) The State legislature was consulted regarding the...

  12. APSTNG: Associated particle sealed-tube neutron generator studies for arms control. Final report on NN-20 Project ST220

    Energy Technology Data Exchange (ETDEWEB)

    Rhodes, E.; Dickerman, C.E.; Brunner, T.; Hess, A.; Tylinski, S.

    1994-12-01

    Argonne National Laboratory has performed research and development on the use of Associated Particle Sealed-Tube Neutron Generator (APSTNG) technology for treaty verification and non-proliferation applications, under funding from the DOE Office of Nonproliferation and National Security. Results indicate that this technology has significant potential for nondestructively detecting elemental compositions inside inspected objects or volumes. The final phase of this project was placement of an order for commercial procurement of an advanced sealed tube, with its high-voltage supply and control systems. Procurement specifications reflected lessons learned during the study. The APSTNG interrogates a volume with a continuous 14-MeV neutron flux. Each neutron is emitted coincident with an {open_quotes}associated{close_quotes} alpha-particle emitted in the opposite direction. Thus detection of an alpha-particle marks the emission of a neutron in a cone opposite to that defined by the alpha detector. Detection of a gamma ray coincident with the alpha indicates that the gamma was emitted from a neutron-induced reaction inside the neutron cone: the gamma spectra can be used to identify fissionable materials and many isotopes having an atomic number larger than that of boron. The differences in gamma-ray and alpha-particle detection times yield a coarse measurement of the distance along the cone axis from the APSTNG emitter to each region containing the identified nuclide. A position-sensitive alpha detector would permit construction of coarse three-dimensional images. The source and emission-detection systems can be located on the same side of the interrogated volume. The neutrons and gamma rays are highly penetrating. A relatively high signal-to-background ratio allows the use of a relatively small neutron source and conventional electronics.

  13. 32 CFR 220.11 - Special rules for automobile liability insurance and no-fault automobile insurance.

    Science.gov (United States)

    2010-07-01

    ... many cases covered by this section, the United States has a right to collect under both 10 U.S.C. 1095... cases, the authority is concurrent and the United States may pursue collection under both statutory authorities. (2) Cases involving tort liability. In cases in which the right of the United States to collect...

  14. Overluminous HNC line emission in Arp 220, NGC 4418 and Mrk 231. Global IR pumping or XDRs?

    NARCIS (Netherlands)

    Aalto, S.; Spaans, M.; Wiedner, M. C.; Huettemeister, S.

    Context. In recent studies of 3 mm J = 1 - 0 HNC emission from galaxies it is found that the emission is often bright which is unexpected in warm, star forming clouds. We propose that the main cause for the luminous HNC line emission is the extreme radiative and kinematical environment in starburst

  15. Faroe Islands Wind-Powered Space Heating Microgrid Using Self-Excited 220 kW Induction Generator

    DEFF Research Database (Denmark)

    Thomsen, Bjarti; Guerrero, Josep M.; Thogersen, Paul

    2014-01-01

    energy and required space heating and mismatches can be reduced by using simple water tanks as heat storages. A traditional Danish induction generator wind turbine has been erected on the island of Nólsoy to produce energy for space heating. The system is designed as a stand-alone Microgrid which needs......Energy is fundamental to modern society. Increase in the oil price as well as environmental concerns have spurred the use of alternative renewable energy sources. In the Faroe Islands the readily available wind energy is an obvious source for space heating. Seasonal correlation exists between wind...

  16. 42 CFR 413.220 - Methodology for calculating the per-treatment base rate under the ESRD prospective payment system...

    Science.gov (United States)

    2010-10-01

    ...; OPTIONAL PROSPECTIVELY DETERMINED PAYMENT RATES FOR SKILLED NURSING FACILITIES Payment for End-Stage Renal..., or 2009. CMS removes the effects of enrollment and price growth from total expenditures for 2007...

  17. 75 FR 25291 - Outer Continental Shelf (OCS) Mid-Atlantic Proposed Oil and Gas Lease Sale 220

    Science.gov (United States)

    2010-05-07

    ... State University Fine Arts Complex in Elizabeth City, North Carolina. These meetings are cancelled... 5410), Minerals Management Service, Gulf of Mexico OCS Region, 1201 Elmwood Park Boulevard, New Orleans...

  18. Extracting 220 Hz information from 55 Hz field data by near-field superresolution imaging

    KAUST Repository

    Dutta, Gaurav

    2016-05-31

    Field experiments are used to unequivocally demonstrate seismic superresolution imaging of subwavelength objects in the near-field region of the source. The field test is for a conventional hammer source striking a metal plate near subwavelength scatterers and the seismic data are recorded by vertical-component geophones in the far-field locations of the sources. Time-reversal mirrors (TRMs) are then used to refocus the scattered energy with subwavelength resolution to the position of the original source. A spatial resolution of lambda/10, where lambda is the dominant wavelength associated with the data, is seen in the field tests that exceeds the Abbe resolution limit of lambda/2.

  19. 77 FR 27417 - Foreign-Trade Zone 220-Sioux Falls, SD; Notification of Proposed Production Activity, Rosenbauer...

    Science.gov (United States)

    2012-05-10

    ..., spray guns, other sprayers, hand-held pneumatic tools and parts, powered hose reels, safety and relief..., flashlight parts, electrical foam proportioning system and parts, tank suspension assemblies, swing-out shelf...

  20. Coaxial 30 kV Connectors for the RG220/U Cable 20 Years of Operational Experience

    CERN Document Server

    Mayer, M

    2000-01-01

    For the fast pulsed magnet system of CERN's SPS and LEP particle accelerators, a special type of moulded coaxial high voltage cable connector is used in large quantities. These connectors are mounted on coaxial transmission lines, which connect pulse generators in buildings at ground level to the fast pulsed magnets situated in an underground tunnel. Well over 1500 such connectors have already been installed and many more will be needed for the construction of the LHC. This 14 TeV Large Hadron Collider, which has a circumference of 27 km, is now under construction at CERN. The paper summarizes the operational experience over the last 20 years and the design principles of the connector. It explains how the excellent reliability and the extremely low failure rate were achieved and outlines the causes of the rare replacements. The paper also discusses the ageing effects caused by radiation, as well as wear and tear during installation and manipulation. Finally it gives a report on our experience with coaxial con...