WorldWideScience

Sample records for astatine 218

  1. Organic chemistry of astatine

    International Nuclear Information System (INIS)

    The paper surveys the investigations on the chemical behaviour of astatine in organic systems and deals with the preparation and identification of its organic compounds. A discussion is given on some of the physico-chemical properties of these compounds determined by extrapolation techniques as well as by direct measurement. The biomedical importance of 211At-labelled compounds is briefly referred to. (authors)

  2. Bibliography of astatine chemistry and biomedical applications

    International Nuclear Information System (INIS)

    An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)

  3. CGD 218 Tutorials / cgd218dotcom

    OpenAIRE

    nodutejakamsissss

    2015-01-01

    CGD 218 Entire Course For more course tutorials visit www.cgd218.com   CGD 218 Week 1 Assignment Why is Visual Literacy Important CGD 218 Week 1 Journal The Evolution of Media CGD 218 Week 1 DQ 1 Using Visuals to Communicate CGD 218 Week 2 Assignment Final Project - Step Two CGD 218 Week 2 DQ 1 Typography in Business CGD 218 Week 2 DQ 2 Bauhaus Manifesto CGD 218 Week 3 Assignment Using Photographs from the Web CGD 218 Week 3 Journal Visual Comm...

  4. Astatine-211: production and availability.

    Science.gov (United States)

    Zalutsky, Michael R; Pruszynski, Marek

    2011-07-01

    The 7.2-h half life radiohalogen (211)At offers many potential advantages for targeted α-particle therapy; however, its use for this purpose is constrained by its limited availability. Astatine-211 can be produced in reasonable yield from natural bismuth targets via the (209)Bi(α,2n)(211)At nuclear reaction utilizing straightforward methods. There is some debate as to the best incident α-particle energy for maximizing 211At production while minimizing production of (210)At, which is problematic because of its 138.4-day half life α-particle emitting daughter, (210)Po. The intrinsic cost for producing (211)At is reasonably modest and comparable to that of commercially available (123)I. The major impediment to (211)At availability is attributed to the need for a medium energy α-particle beam for its production. On the other hand, there are about 30 cyclotrons in the world that have the beam characteristics required for (211)At production. PMID:22201707

  5. Recent advances in the organic chemistry of astatine

    International Nuclear Information System (INIS)

    Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211At species, 211At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs

  6. CGD 218 COURSE TUTORIAL/ snaptutorial

    OpenAIRE

    mounish

    2015-01-01

    For more classes visit www.snaptutorial.com CGD 218 Week 1 Assignment Why is Visual Literacy Important CGD 218 Week 1 Journal The Evolution of Media   CGD 218 Week 1 DQ 1 Using Visuals to Communicate   CGD 218 Week 2 Assignment Final Project - Step Two   CGD 218 Week 2 DQ 1 Typography in Business   CGD 218 Week 2 DQ 2 Bauhaus Manifesto   CGD 218 Week 3 Assignment Using Photographs from the Web   CGD 218 ...

  7. CGD 218 ASH Course Tutorial / cgd218dotcom

    OpenAIRE

    vasanthi05

    2015-01-01

    CGD 218 Entire Course For more course tutorials visit www.cgd218.com   CGD 218 Week 1 Assignment Why is Visual Literacy Important CGD 218 Week 1 Journal The Evolution of Media CGD 218 Week 1 DQ 1 Using Visuals to Communicate CGD 218 Week 2 Assignment Final Project - Step Two CGD 218 Week 2 DQ 1 Typography in Business CGD 218 Week 2 DQ 2 Bauhaus Manifesto CGD 218 Week 3 Assignment Using Photographs from the Web CGD 218 Week 3 Journal Visual Comm...

  8. Dosimetrical considerations in astatine-211 radioimmunotherapy

    International Nuclear Information System (INIS)

    Several dosimetrical quantities have been suggested for use in alpha-particle dosimetry. To evaluate the expected biological effect when using these quantities, a Monte Carlo program was set to register the single-event distribution of both specific energy and alpha-particle track length to a cell nucleus (r=5.6 μm). Distributions were acquired for both 'bound' (simulating the effect of 211At-labelled antibodies bound to antigens on cell surfaces (r=7.0 μm)) as well as 'non-bound' (simulating 211At-labelled antibodies that have not bound to a cell) astatine-211. From these distributions, various theoretical cell survival curves were established for 3 different dosimetrical quantities, i.e. specific energy, number of alpha-particle hits and total track length. The survival curves for all quantities are presented for the corresponding mean absorbed dose in order to facilitate comparisons of the expected effects of using the 3 different quantities for both distributions of 211At decays. The theoretical survival curves presented here could, combined with experiments using 'bound' and 'non-bound' 211At in a single-cell suspension, reveal which dosimetrical quantity is most suitable for 211 At-radioimmunotherapy. (author)

  9. 49 CFR 571.218 - Standard No. 218; Motorcycle helmets.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 6 2010-10-01 2010-10-01 false Standard No. 218; Motorcycle helmets. 571.218 Section 571.218 Transportation Other Regulations Relating to Transportation (Continued) NATIONAL HIGHWAY... Motor Vehicle Safety Standards § 571.218 Standard No. 218; Motorcycle helmets. S1. Scope. This...

  10. Discovery of the astatine, radon, francium, and radium isotopes

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  11. Extraction of astatine isotopes for development of radiopharmaceuticals using a 211Rn-211At generator

    International Nuclear Information System (INIS)

    In order to utilize a 211At isotope, a promising α-emitter for radionuclide therapy, the chemical properties of astatine isotopes are studied. We have examined wet chemistry methods through the distribution ratios of astatine in liquid-liquid extraction. The astatine isotopes have been found to be well extracted into DIPE and MIBK. We observed that the distribution ratio of astatine isotopes increases with concentrations of HCl greater than 3 M, while it decreases with the HCl concentration less than 2 M. The results will be useful for development of the 211Rn-211At generator. (author)

  12. Astatine-211-Labeled Targeted Radiotherapeutics: An Update

    International Nuclear Information System (INIS)

    The heavy halogen 211At was first proposed for use in α-particle targeted radiotherapy more than 30 years ago and continues to be one of the most promising radionuclides for this purpose. Although its 7.2-h half life is not ideal for intravenously administered whole antibodies, it is compatible with the pharmacokinetics of antibody fragments, peptides, aptamers and organic molecules. Its diverse chemistry allows its incorporation into a wide array of targeting vehicles, relying on its chemical similarity to iodine to provide a useful point of departure. On the other hand, the relatively low carbon-astatine bond strength is challenging. In common with the other α-emitters being discussed at this symposium, lack of reliable availability is one of the biggest hurdles in the use of 211At for targeted radiotherapy. However, in the case of 211At, it is not a question of production cost or availability of target material, because 211At can be produced in reasonable yield from natural bismuth targets. Rather, the difficulty is the lack of cyclotrons equipped with the medium energy α-particle beams required for its production. If the infrastructure for producing 211At is to be improved to the stage where 211At-labeled radiopharmaceuticals can have a meaningful impact, several developments must occur. First, the ability to produce clinically relevant levels of 211At that can be shipped to remote locations in chemically tractable form must be demonstrated. Approaches under consideration include compensating for radiolysis-mediated effects and the consideration of alternative chemistries. Second, strategies for compensating for heterogeneities in dose deposition must be developed, hopefully in a way that is compatible with approval for human use. And third, it is essential that more clinical trials be performed with 211At-labeled therapeutics, particularly in settings of minimum residual disease where the radiobiological advantages of α-particles can be best exploited. Our

  13. Scrutinizing "Invisible" astatine: A challenge for modern density functionals.

    Science.gov (United States)

    Sergentu, Dumitru-Claudiu; David, Grégoire; Montavon, Gilles; Maurice, Rémi; Galland, Nicolas

    2016-06-01

    The main-group 6p elements did not receive much attention in the development of recent density functionals. In many cases it is still difficult to choose among the modern ones a relevant functional for various applications. Here, we illustrate the case of astatine species (At, Z = 85) and we report the first, and quite complete, benchmark study on several properties concerning such species. Insights on geometries, transition energies and thermodynamic properties of a set of 19 astatine species, for which reference experimental or theoretical data has been reported, are obtained with relativistic (two-component) density functional theory calculations. An extensive set of widely used functionals is employed. The hybrid meta-generalized gradient approximation (meta-GGA) PW6B95 functional is overall the best choice. It is worth noting that the range-separated HSE06 functional as well as the old and very popular B3LYP and PBE0 hybrid-GGAs appear to perform quite well too. Moreover, we found that astatine chemistry in solution can accurately be predicted using implicit solvent models, provided that specific parameters are used to build At cavities. © 2016 Wiley Periodicals, Inc. PMID:27059181

  14. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  15. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates.

    Science.gov (United States)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Svedhem, Sofia; Lindegren, Sture

    2016-03-16

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single cancer cells. A promising radioactive nuclide for this type of therapy is astatine-211. Astatine-211 attached to tumor-specific antibodies as carrier molecules is a system currently under investigation for use in targeted alpha therapy. In the common radiolabeling procedure, astatine is coupled to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies. PMID:26791409

  16. Astatine-211: production, injection into monoclonal antibodies radiological effect, possible application to cancer treatment

    International Nuclear Information System (INIS)

    Methods developed in the Laboratory of Nuclear Problems, JINR, for producing astatine-211 and injecting it into monoclonal antibodies are described. The use of its diethylene triamine penta-acetic acid complex is shown to be the most effective method of injecting astatine into a biomolecules. The biological effect of the α-particles emitted from the astatine-211 is investigated using Chinese hamster fibroblasts and Ehrlich carcinoma cells. It is established that the mitotic activity depression, number of degenerating cells, number of cells with chromosome aberrations, and cellular surviving fraction depend on the concentration of the radionuclide in the medium 'in vitro'. The RBE of α-particles in comparison with 60Co γ-rays is 3. Injection of astatine-211 absorbed on tellurium particles into mice with ascitic tumors resulted in prolongation of their life or elimination of the tumors. (author). 39 refs, 7 figs

  17. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    OpenAIRE

    Rothe, S.; A. N. Andreyev; Antalic, S; Borschevsky, A.; Capponi, L.; Cocolios, T.E.; Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the io...

  18. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    Science.gov (United States)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-07-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and physical properties for use in targeted therapies for cancer. Due to the very short range of the emitted α-particles, this therapy is particularly suited to treating occult, disseminated cancers. Astatine is not intrinsically tumour-specific; therefore, it requires an appropriate tumour-specific targeting vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method that combines dry distillation of astatine-211 and a synthesis module for producing radiopharmaceuticals into a process platform. This platform will standardize production of astatinated radiopharmaceuticals, and hence, it will facilitate large clinical studies focused on this promising, but chemically challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies.

  19. CGD 218 ASH COURSES TUTORIAL/UOPHELP

    OpenAIRE

    BROADY

    2015-01-01

    For more course tutorials visit www.uophelp.com       CGD 218 Week 1 Assignment Why is Visual Literacy Important CGD 218 Week 1 Journal The Evolution of Media   CGD 218 Week 1 DQ 1 Using Visuals to Communicate   CGD 218 Week 2 Assignment Final Project - Step Two   CGD 218 Week 2 DQ 1 Typography in Business   CGD 218 Week 2 DQ 2 Bauhaus Manifesto   CGD 218 Week 3 Assignment Using Photographs...

  20. CGD 218 ash course tutorial / uophelp

    OpenAIRE

    uophelp

    2015-01-01

    For more course tutorials visit www.uophelp.com CGD 218 Week 1 Assignment Why is Visual Literacy Important CGD 218 Week 1 Journal The Evolution of Media   CGD 218 Week 1 DQ 1 Using Visuals to Communicate   CGD 218 Week 2 Assignment Final Project - Step Two   CGD 218 Week 2 DQ 1 Typography in Business   CGD 218 Week 2 DQ 2 Bauhaus Manifesto   CGD 218 Week 3 Assignment Using Photographs from the Web   CGD ...

  1. CGD 218 UOP Course Tutorial/ Tutorialrank

    OpenAIRE

    SICEN

    2015-01-01

                      For more course tutorials visit www.tutorialrank.com Tutorial Purchased: 4 Times, Rating: A+     CGD 218 Week 1 Assignment Why is Visual Literacy Important CGD 218 Week 1 Journal The Evolution of Media CGD 218 Week 1 DQ 1 Using Visuals to Communicate CGD 218 Week 2 Assignment Final Project - Step Two CGD 218 Week 2 DQ 1 Typography in Business CGD 218 Week 2 DQ 2 Bauhaus Manife...

  2. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-01-01

    vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method......To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....

  3. Study of Astatine (III) reactions with O, S and N ligands in solution

    International Nuclear Information System (INIS)

    Full text of publication follows. Astatine (At, Z=85: [Xe]4f145d106s26p5) belongs to the halogen group and is located below iodine in the periodic table. One of its isotopes (211At) appears promising as a therapeutic agent in nuclear medicine (Ref.1) owing to the energy of the alpha particles emitted during the disintegration of its nucleus and its short physical half-life (7.2 h). Since there are no stable isotopes of astatine, the chemistry of this element remains poorly understood. Generally, At is supposed to behave as a halogen (Ref.2) but it has been shown recently in our group that astatine presents a metallic behaviour in aqueous solution: it notably exists as At+ and AtO+ species under the oxidation states +I and +III (Ref.3). At the present time, the number of studies dealing with the complexation properties of the cationic forms of astatine remains limited (Ref.4), owing to its low availability. In this work, we have investigated the reactions of AtO+ species with different hetero-atomic (N, S, O) model ligands. A combined approach based on experimental and theoretical studies has been used (Ref.5). On account of the difficulties of experimental investigations of astatine species, the reactivity of AtO+ was explored using a competition method founded on astatine distributions between two distinct phases. Furthermore, for each AtO+/ ligand complex, the nature of the species formed and the associated thermodynamic constants were determined by computational modeling (DFT calculations). In this framework, an original computational methodology was developed to take into account the specificities of astatine, notably the associated relativistic effects. The computed equilibrium constants have been confronted with the experimental results. This comparison demonstrates an outstanding coherence between experience and theory. Furthermore, the analysis of the results shows a key role of solvent effects on astatine chemistry. Lastly, a specific reactivity for the

  4. Some aspects of the organic, biological and inorganic chemistry of astatine

    International Nuclear Information System (INIS)

    Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments (209At, 210At, 211At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)

  5. Astatine-211 Pathway from Radiochemistry to Clinical Investigation

    International Nuclear Information System (INIS)

    Particularly in clinical settings where tumour burden is low and cancers are located in close proximity to essential normal tissue structures, α-particle emitting radionuclides can offer significant advantages for targeted radionuclide therapy. One of the first alpha emitters to be evaluated for this purpose is the 7.2-h half-life radiohalogen Astatine-211 (211At). From a commercialization-potential perspective 211At, is less appealing than the longer half-life alpha particle emitters Radium-223, Actinium-225 and Thorium-227, which have become the focus of many laboratories. However, if methods for providing a better supply of 211At could be developed, this alpha emitter would be the radionuclide of choice for many potential therapeutic applications. With regard to the production of 211At, this can be readily be accomplished by bombarding natural bismuth targets with 28−29.5 MeV alpha particles via the 209Bi(α,2n)211At reaction. The goal is to utilize an alpha particle beam energy that provides the required balance for maximizing 211At production while minimizing creation of 210At, which is problematic because of its 138.4-day half life alpha-particle emitting daughter, 210Po. For most intended clinical applications, alpha particle beam energy of about 29 MeV offers the best compromise between maximizing yield and providing 211At with sufficient radionuclidic purity for clinical use. Clinically relevant levels of 211At have been produced at several institutions using both internal and external cyclotron targets

  6. 49 CFR 218.35 - Yard limits.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Yard limits. 218.35 Section 218.35 Transportation... TRANSPORTATION RAILROAD OPERATING PRACTICES Protection of Trains and Locomotives § 218.35 Yard limits. (a) After August 1, 1977, yard limits must be designated by— (1) Yard limit signs, and (2) Timetable, train...

  7. 36 CFR 218.6 - Reviewing officer.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Reviewing officer. 218.6 Section 218.6 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE PREDECISIONAL... Authorized by the Healthy Forests Restoration Act of 2003 § 218.6 Reviewing officer. The reviewing...

  8. 22 CFR 218.33 - Mediation.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Mediation. 218.33 Section 218.33 Foreign... § 218.33 Mediation. (a) Referral of complaints for mediation. The agency will refer to the Federal Mediation and Conciliation Service all complaints that: (1) fall within the jurisdiction of...

  9. 27 CFR 24.218 - Other wine.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Other wine. 24.218 Section 24.218 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Production of Other Than Standard Wine § 24.218 Other wine. (a) General. Other than standard wine not included in...

  10. 36 CFR 21.8 - Employee certification.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Employee certification. 21.8 Section 21.8 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR HOT SPRINGS NATIONAL PARK; BATHHOUSE REGULATIONS § 21.8 Employee certification. (a) Employees engaged...

  11. 42 CFR 438.218 - Enrollee information.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Enrollee information. 438.218 Section 438.218 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES... and Operation Standards § 438.218 Enrollee information. The requirements that States must meet...

  12. 49 CFR 218.9 - Civil penalty.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Civil penalty. 218.9 Section 218.9 Transportation... TRANSPORTATION RAILROAD OPERATING PRACTICES General § 218.9 Civil penalty. Any person (an entity of any type... requirement of this part or causes the violation of any such requirement is subject to a civil penalty of...

  13. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  14. Dicty_cDB: SLA218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLA218 (Link to dictyBase) - - - Contig-U16455-1 SLA218Z (Link... to Original site) - - SLA218Z 592 - - - - Show SLA218 Library SL (Link to library) Clone ID SLA218 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLA2-A/SLA218Q.Seq.d/ Representative seq. ID SLA21...8Z (Link to Original site) Representative DNA sequence >SLA218 (SLA218Q) /CSM/SL/SLA2-A/SLA218Q.Seq.d/ XXXXX...TAATAATTTT AA sequence update 1997. 5. 7 Translated Amino Acid sequence ---LSTEVKSVEMHHEQLPEARPGDNVGFNVKNVSV

  15. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    International Nuclear Information System (INIS)

    A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)

  16. Neutralization kinetics for polonium-218

    International Nuclear Information System (INIS)

    In a well-defined experimental system the neutralization of polonium-218 ions was investigated as a function of the physical and chemical properties of the controlled composition atmosphere. The diffusion coefficient of polonium-218 under various concentrations of trace gas NO2 in nitrogen was measured. The mobilities of Po+ and PoO2+ are determined by combining experimental results with a computer model of the system. Three neutralization mechanisms were individually studied. The small-ion recombination rate has been found to be proportional to the square root of radon concentration. The electron-scavenging mechanism is responsible for the neutralization of Po+ in NO2 or H2O in nitrogen. When PoO2+ is formed, the electron-transfer mechanism dominates the neutralization process. The electron is transferred to PoO2+ from molecules with lower ionization potentials. The ionization molecules with lower ionization potentials. The ionization potential of PoO2+ is also determined to be 10.44 +/- 0.05 eV

  17. 10 CFR 218.32 - Review.

    Science.gov (United States)

    2010-01-01

    ... requirements stated in 10 CFR 205.9 in addition to the requirements stated in this section. (2) If the... documents submitted under this subpart, the procedures set out in 10 CFR 205.9(f) shall apply. (c) When to... 10 Energy 3 2010-01-01 2010-01-01 false Review. 218.32 Section 218.32 Energy DEPARTMENT OF...

  18. 9 CFR 381.218 - Criminal offenses.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Criminal offenses. 381.218 Section 381... CERTIFICATION POULTRY PRODUCTS INSPECTION REGULATIONS Detention; Seizure and Condemnation; Criminal Offenses § 381.218 Criminal offenses. The Act contains criminal provisions with respect to numerous...

  19. 22 CFR 218.11 - Standards.

    Science.gov (United States)

    2010-04-01

    ... prohibited are set out in part 90 (primarily subpart B) of 45 CFR. ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Standards. 218.11 Section 218.11 Foreign... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Standards for Determining Age Discrimination §...

  20. Labelling prospects of astatine-211 with immunoglobulins (IgG): some general considerations

    International Nuclear Information System (INIS)

    The tumour therapeutic potential of the short lived alpha emitting radiohalogen 211At has been already been well recognised in the field of radioimmuno therapy. There is no evidence as such to show that astatine itself is a tumour seeking isotope. Therefore it has to be tagged to tumour seeking compound such as a drug or a protein preferably an antibody (IgG). In this communication, the labelling parameters which are required to be investigated for obtaining a stable product which could be useful as radioimmuno therapeutic agent, are described. (author). 6 refs

  1. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron anity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photodetachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral linewidth of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in o-line tests by the clear observation of the photodetachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148 [1].

  2. Extraction of 211At-astatine from hydrochloric acid solutions by means of TOPO, TBP, and triphenylphosphine

    International Nuclear Information System (INIS)

    The extraction behaviour of astatine was studied under defined conditions from hydrochloride acid solutions (cHCl>0.1 M or 1 and 2M). Therefore other effects like adsorption, reduction or hydrolysis can be excluded. The present work describes the extraction with tri- n- octylphosphinoxide (TOPO), tri- n-butylphosphate (TBP) and tri-phenylphosphine in chloroform. (orig.)

  3. No-carrier-added astatination of N-succinimidyl-3-(tri-n-butylstannyl) benzoate (ATE) via electrophilic destannylation

    International Nuclear Information System (INIS)

    The no-carrier-added synthesis of N-succinimidyl 3-[211At]astato-benzoate from N-succinimidyl 3-(tri-n-butylstannyl)benzoate (ATE) is described. The nature of the solvent in which the 211At was isolated from the target was an important factor influencing both the radiochemical yields and the nature of the incorporated astatine activity. (orig.)

  4. CGD 218 ASHFORD Course Tutorial/TutorialRank

    OpenAIRE

    makenz

    2015-01-01

    For more course tutorials visit www.tutorialrank.com Tutorial Purchased: 4 Times, Rating: A+   CGD 218 Week 1 Assignment Why is Visual Literacy Important CGD 218 Week 1 Journal The Evolution of Media CGD 218 Week 1 DQ 1 Using Visuals to Communicate CGD 218 Week 2 Assignment Final Project - Step Two CGD 218 Week 2 DQ 1 Typography in Business CGD 218 Week 2 DQ 2 Bauhaus Manifesto CGD 218 Week 3 Assignment Using Photographs from the Web CGD 218 We...

  5. 211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    211At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At- to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At- anions, but first of all because of the kinetic inertness of low spin rhodium(III) d6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh3+. The experiments related to optimization of the reaction conditions were performed with the 131I, basing on a chemical similarity of I- to At-. The experiments with 211At were then carried out under the conditions found optimal for I-. The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211At-Rh(16-S4-diol) complex

  6. 49 CFR 218.22 - Utility employee.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION RAILROAD OPERATING PRACTICES Blue Signal Protection of Workers § 218.22 Utility... uncouple air hoses and other electrical or mechanical connections; prepare rail cars for coupling; set... railroad rolling equipment must be provided with blue signal protection in accordance with §§...

  7. 14 CFR 21.8 - Approval of articles.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Approval of articles. 21.8 Section 21.8 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT CERTIFICATION PROCEDURES FOR PRODUCTS AND PARTS General § 21.8 Approval of articles. If an article is required to...

  8. 5 CFR 179.218 - Additional administrative collection action.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Additional administrative collection action. 179.218 Section 179.218 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS Salary Offset § 179.218 Additional administrative collection...

  9. 32 CFR 724.218 - Limitation-Continuance and Postponements.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 5 2010-07-01 2010-07-01 false Limitation-Continuance and Postponements. 724.218 Section 724.218 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY PERSONNEL NAVAL DISCHARGE REVIEW BOARD Authority/Policy for Departmental Discharge Review § 724.218 Limitation—Continuance and Postponements. (a)...

  10. 30 CFR 218.201 - Method of payment.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Method of payment. 218.201 Section 218.201... Method of payment. You must tender all payments in accordance with § 218.51, except as follows: (a) For... and your customer document identification numbers on your payment document, rather than...

  11. 30 CFR 218.301 - Method of payment.

    Science.gov (United States)

    2010-07-01

    ... Method of payment. The payor shall tender all payments in accordance with 30 CFR 218.51. ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Method of payment. 218.301 Section 218.301 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE...

  12. 7 CFR 2.18 - Under Secretary for Food Safety.

    Science.gov (United States)

    2010-01-01

    ..., pesticide, and environmental contaminants in food products as covered by the Federal Insecticide, Fungicide... 7 Agriculture 1 2010-01-01 2010-01-01 false Under Secretary for Food Safety. 2.18 Section 2.18... Secretaries and Assistant Secretaries § 2.18 Under Secretary for Food Safety. (a) The following delegations...

  13. 49 CFR 218.80 - Movement of occupied camp cars.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Movement of occupied camp cars. 218.80 Section 218... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD OPERATING PRACTICES Protection of Occupied Camp Cars § 218.80 Movement of occupied camp cars. Occupied cars may not be humped or flat switched unless coupled...

  14. Unexpected Behavior of the Heaviest Halogen Astatine in the Nucleophilic Substitution of Aryliodonium Salts.

    Science.gov (United States)

    Guérard, François; Lee, Yong-Sok; Baidoo, Kwamena; Gestin, Jean-François; Brechbiel, Martin W

    2016-08-22

    Aryliodonium salts have become precursors of choice for the synthesis of (18) F-labeled tracers for nuclear imaging. However, little is known on the reactivity of these compounds with heavy halides, that is, radioiodide and astatide, at the radiotracer scale. In the first comparative study of radiohalogenation of aryliodonium salts with (125) I(-) and (211) At(-) , initial experiments on a model compound highlight the higher reactivity of astatide compared to iodide, which could not be anticipated from the trends previously observed within the halogen series. Kinetic studies indicate a significant difference in activation energy (Ea =23.5 and 17.1 kcal mol(-1) with (125) I(-) and (211) At(-) , respectively). Quantum chemical calculations suggest that astatination occurs via the monomeric form of an iodonium complex whereas iodination occurs via a heterodimeric iodonium intermediate. The good to excellent regioselectivity of halogenation and high yields achieved with diversely substituted aryliodonium salts indicate that this class of compounds is a promising alternative to the stannane chemistry currently used for heavy radiohalogen labeling of tracers in nuclear medicine. PMID:27305065

  15. Yeast Interacting Proteins Database: YJL218W, YJL218W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YJL218W - Putative pro tein o f unkno wn functio n, similar to ... bacterial galacto side O -acetyltransfe ... rases; induced by o leate in an O AF1/PIP2-dependent manner; pro mo ter co ... ntains an o leate respo nse element co nsensus sequence; no n-esse ... ntial gene Ro ws with this bait as bait (1) Ro ws with this bait a ... s prey (3) YJL218W - Putative pro tein o f unkno wn functio n, similar to ... bacterial gala ...

  16. Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

    CERN Document Server

    Andreyev, Andrei

    2013-01-01

    Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

  17. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  18. Factor Analysis Applied the VFY-218 RCS Data

    Science.gov (United States)

    Woo, Alex; Chancellor, Marisa K. (Technical Monitor)

    1997-01-01

    Present statistical factor analysis of computer simulations and measurement data for the VFY-218 configuration. Factor analysis try to quantify the statistical grouping of measurements and simulations.

  19. Kinetics of neutralization of Po-218

    International Nuclear Information System (INIS)

    In a well-defined experimental system the neutralization of polonium-218 ions was investigated as a function of the physical and chemical properties of the controlled composition atmosphere. The mobilities of Po+ and PoO2+ are determined by combining experimental results with a computer model of the system. Three neutralization mechanisms were individually studied. The small ion recombination rate has been found to be proportional to the square root of radon concentration. The electron scavenging mechanism is responsible for the neutralization of Po+ in NO2 or H2O in nitrogen. When PoO2+ is formed, the electron transfer mechanism dominates the neutralization process. The electron is transferred to PoO2+ from molecules with lower ionization potentials. The ionization potential of PoO2+ is also determined to be 10.44 +/- 0.05 eV

  20. 29 CFR 825.218 - Substantial and grievous economic injury.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Substantial and grievous economic injury. 825.218 Section... Medical Leave Act § 825.218 Substantial and grievous economic injury. (a) In order to deny restoration to... cause “substantial and grievous economic injury” to the operations of the employer, not whether...

  1. 49 CFR 173.218 - Fish meal or fish scrap.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Fish meal or fish scrap. 173.218 Section 173.218... Fish meal or fish scrap. (a) Except as provided in Column (7) of the HMT in § 172.101 of this subchapter, fish meal or fish scrap, containing at least 6%, but not more than 12% water, is authorized...

  2. 36 CFR 218.10 - Objection time periods and process.

    Science.gov (United States)

    2010-07-01

    ... process. 218.10 Section 218.10 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE PREDECISIONAL ADMINISTRATIVE REVIEW PROCESSES Predecisional Administrative Review Process for... Objection time periods and process. (a) Time to file an objection. Written objections, including...

  3. Dicty_cDB: VFN218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFN218 (Link to dictyBase) - - - Contig-U13884-1 VFN218P (Link to Original ... AHHQGDKKAGLNMRDGCIGNAEELGVIESFKVKQQVLVSAHEAAERS*el mis *ellqdrevifnikk Translated Amino Acid sequence (All ... AHHQGDKKAGLNMRDGCIGNAEELGVIESFKVKQQVLVSAHEAAERS*el mis *ellqdrevifnikk Frame C: iilyi*qcqvn*lqyqf*vkmplkke ...

  4. 30 CFR 218.155 - Method of payment.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Method of payment. 218.155 Section 218.155....155 Method of payment. (a) Payment of royalties and rentals. With the exception of first-year rental... notice of each lease offering. EFT may be used as a method of payment for the one-fifth bonus bid...

  5. Dicty_cDB: CHC218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHC218 (Link to dictyBase) - - - Contig-U16243-1 CHC218P (Link to Original ... o... 365 0.0 X75329_1( X75329 |pid:none) M.indica (Manila ) THMF5 mRNA for 3-ket... 215 e-102 AM474896_9( AM4 ...

  6. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  7. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  8. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    International Nuclear Information System (INIS)

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  9. 50 CFR 218.184 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... Surface Warfare Center Panama City Division § 218.184 Requirements for monitoring and reporting. (a) The... course/speed, floating on surface and not swimming, etc.); and (xv) An evaluation of the effectiveness...

  10. Snail-Killing Effects of Streptomyces 218 Powder

    Directory of Open Access Journals (Sweden)

    V.O. Aina

    2012-12-01

    Full Text Available This study is aimed at finding out the snail-killing effects of Streptomyces 218 powder on Oncomelania hupensis snails which are the vectors or intermediate host of Schiltosoma Japonicum (intestinal schistosomiasis in china the tests were carried out in the laboratory and on the field. The snail-killing effects of Streptomyces218 powder, isolated from snail habitat at Anchang Village of Anxiang country in China was tested using the immersion and spraying methods. The tests on the Oncomelania hupensis snails which are intermediate host of Streptomyces japonicum infection were carried out in the laboratory and in the field. The mean corrected snail mortalities of the immersion technique in the laboratory were 81.70 and 98.63% in 10 ppm of 218 solutions after 24 and 48 h, respectively. The mean corrected snail mortalities of the spraying tests in the laboratory were 82.90 and 87.90% at 3 and 5 days, respectively with 10 g/m2 218 powders. The snail-killing ability of 218 powders on the field determines by immersion and spraying methods were comparable to that of the chemical molluscicide-Niclosamide. The corrected snail mortality at 150 ppm of 218 powder (g/m2 and at 2 ppm of Niclosamide by immersion was 100% at the second time test after 24, 48 and 72 h. In the field spraying test, the mean corrected snail mortality at 100 ppm of 218 powders were 61.96 and 70.00% after 3 and 7 days of spraying respectively. At 2 ppm niclosamide, this was found to be 65.58 and 63.81%, respectively. The effective ingredients for the snail-killing are found to be located in the spore chains. Streptomyces 218 powder, although at higher concentrations, seems to be a promising mollusciciding biological agent. If developed further, this could compliment existing mollusciciding agents.

  11. Snail-Killing Effects of Streptomyces 218 Powder

    OpenAIRE

    V.O. Aina; A.A.J. Adewumi; C.O. Yao; M.Z. Shi; Hu, D. Y.; W.H. Chai

    2012-01-01

    This study is aimed at finding out the snail-killing effects of Streptomyces 218 powder on Oncomelania hupensis snails which are the vectors or intermediate host of Schiltosoma Japonicum (intestinal schistosomiasis) in china the tests were carried out in the laboratory and on the field. The snail-killing effects of Streptomyces218 powder, isolated from snail habitat at Anchang Village of Anxiang country in China was tested using the immersion and spraying methods. The tests on the Oncomelania...

  12. Stability and in vivo behavior of Rh[16aneS4-diol]211At complex: A potential precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    Introduction: The heavy halogen 211At is of great interest for targeted radiotherapy because it decays by the emission of short-range, high-energy α-particles. However, many astatine compounds that have been synthesized are unstable in vivo, providing motivation for seeking other 211At labeling strategies. One relatively unexplored approach is to utilize prosthetic groups based on astatinated rhodium (III) complex stabilized with a tetrathioether macrocyclic ligand – Rh[16aneS4-diol]211At. The purpose of the current study was to evaluate the in vitro and in vivo stability of this complex in comparison to its iodine analog – Rh[16aneS4-diol]131I. Methods: Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I complexes were synthesized and purified by HPLC. The stability of both complexes was evaluated in vitro by incubation in phosphate-buffered saline (PBS) and human serum at different temperatures. The in vivo behavior of the two radiohalogenated complexes was assessed by a paired-label biodistribution study in normal Balb/c mice. Results: Both complexes were synthesized in high yield and purity. Almost no degradation was observed for Rh[16aneS4-diol]131I in PBS over a 72 h incubation. The astatinated analog exhibited good stability in PBS over 14 h. A slow decline in the percentage of intact complex was observed for both tracers in human serum. In the biodistribution study, retention of 211At in most tissues was higher than that of 131I at all time points, especially in spleen and lungs. Renal clearance of Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I predominated, with 84.1 ± 2.3% and 94.6 ± 0.9% of injected dose excreted via the urine at 4 h. Conclusions: The Rh[16aneS4-diol]211At complex might be useful for constructing prosthetic groups for the astatination of biomolecules and further studies are planned to evaluate this possibility

  13. 18 CFR 157.218 - Changes in customer name.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Changes in customer... Act for Certain Transactions and Abandonment § 157.218 Changes in customer name. (a) Automatic... reflect the change in the name of an existing customer, if the certificate holder has filed any...

  14. MiR-218 Mediates tumorigenesis and metastasis: Perspectives and implications

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Ying-fei [Institute Guangzhou of Advanced Technology, Chinese Academy of Sciences, Guangzhou (China); Department of Orthopaedics & Traumatology, The Chinese University of Hong Kong, Prince of Wales Hospital, Shatin, Hong Kong (China); Zhang, Li [School of Biomedical Sciences, Faculty of Medicine, The Chinese University of Hong Kong, Hong Kong (China); Department of Anatomical and Cellular Pathology, State Key Laboratory of Oncology in South China, Prince of Wales Hospital, The Chinese University of Hong Kong, Hong Kong (China); Waye, Mary Miu Yee [School of Biomedical Sciences, Faculty of Medicine, The Chinese University of Hong Kong, Hong Kong (China); Fu, Wei-ming, E-mail: wm.fu@giat.ac.cn [Institute Guangzhou of Advanced Technology, Chinese Academy of Sciences, Guangzhou (China); School of Biomedical Sciences, Faculty of Medicine, The Chinese University of Hong Kong, Hong Kong (China); Zhang, Jin-fang, E-mail: zhangjf06@cuhk.edu.hk [Department of Orthopaedics & Traumatology, The Chinese University of Hong Kong, Prince of Wales Hospital, Shatin, Hong Kong (China); School of Biomedical Sciences, Faculty of Medicine, The Chinese University of Hong Kong, Hong Kong (China); Shenzhen Research Institute, The Chinese University of Hong Kong, Shenzhen (China)

    2015-05-15

    MicroRNAs (miRNAs) are a class of small non-coding RNAs that negatively regulate gene expression at the post-transcriptional level. As a highly conserved miRNA across a variety of species, microRNA-218 (miR-218) was found to play pivotal roles in tumorigenesis and progression. A group of evidence has demonstrated that miR-218 acts as a tumor suppressor by targeting many oncogenes related to proliferation, apoptosis and invasion. In this review, we provide a complex overview of miR-218, including its regulatory mechanisms, known functions in cancer and future challenges as a potential therapeutic target in human cancers. - Highlights: • miR-218 is frequently down regulated in multiple cancers. • miR-218 plays pivotal roles in carcinogenesis. • miR-218 mediates proliferation, apoptosis, metastasis, invasion, etc. • miR-218 mediates tumorigenesis and metastasis via multiple pathways.

  15. MiR-218 Mediates tumorigenesis and metastasis: Perspectives and implications

    International Nuclear Information System (INIS)

    MicroRNAs (miRNAs) are a class of small non-coding RNAs that negatively regulate gene expression at the post-transcriptional level. As a highly conserved miRNA across a variety of species, microRNA-218 (miR-218) was found to play pivotal roles in tumorigenesis and progression. A group of evidence has demonstrated that miR-218 acts as a tumor suppressor by targeting many oncogenes related to proliferation, apoptosis and invasion. In this review, we provide a complex overview of miR-218, including its regulatory mechanisms, known functions in cancer and future challenges as a potential therapeutic target in human cancers. - Highlights: • miR-218 is frequently down regulated in multiple cancers. • miR-218 plays pivotal roles in carcinogenesis. • miR-218 mediates proliferation, apoptosis, metastasis, invasion, etc. • miR-218 mediates tumorigenesis and metastasis via multiple pathways

  16. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D., Scott

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  17. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    International Nuclear Information System (INIS)

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET α-emitter astatine-211 (211At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 (123I), 340-fold for technetium-99m pertechnetate (99mTcO4-) and 60-fold for 211At. Cellular 211At accumulation was found to be dependent on extracellular Na+ ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and 99mTcO4- uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated 211At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and 211At were rapidly (apparent t1/2 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times (123I), 25 times (99mTcO4-) and 10 times (211At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of 123I and 211At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for 123I, 5.2 h for 211At) and preliminary dosimetric calculations indicate high tumour absorbed doses (3.5 Gy/MBqtumour for 131I and 50.3 Gy/MBqtumour for 211At). In

  18. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    Energy Technology Data Exchange (ETDEWEB)

    Petrich, T.; Helmeke, H.-J.; Meyer, G.J.; Knapp, W.H.; Poetter, E. [Department of Nuclear Medicine, Medizinische Hochschule Hannover (Germany)

    2002-07-01

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET {alpha}-emitter astatine-211 ({sup 211}At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 ({sup 123}I), 340-fold for technetium-99m pertechnetate ({sup 99m}TcO{sub 4}{sup -}) and 60-fold for {sup 211}At. Cellular {sup 211}At accumulation was found to be dependent on extracellular Na{sup +} ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and {sup 99m}TcO{sub 4}{sup -} uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated {sup 211}At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and {sup 211}At were rapidly (apparent t{sub 1/2} 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times ({sup 123}I), 25 times ({sup 99m}TcO{sub 4}{sup -}) and 10 times ({sup 211}At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of {sup 123}I and {sup 211}At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for {sup 123}I, 5.2 h for {sup 211}At) and

  19. Reduced miRNA-218 expression in pancreatic cancer patients as a predictor of poor prognosis.

    Science.gov (United States)

    Li, B-S; Liu, H; Yang, W-L

    2015-01-01

    microRNA-218 (miR-218) is a vertebrate-specific miRNA that plays a crucial role in tumorigenesis and tumor progression. This study analyzed the miR-218 expression level and clinical significance in pancreatic cancer. One hundred and seven pairs of pancreatic cancer and adjacent normal tissues were analyzed by quantitative reverse-transcriptase polymerase chain reaction. The correlation between miR-218 expression and clinicopathological characters was determined by the two-sample Student t-test. The survival correlations were analyzed by the Kaplan-Meier method and Cox proportional hazards model. The relative expression of miR-218 in pancreatic cancer tissues (2.63 ± 1.59) was significantly lower than that in matched noncancerous pancreatic tissues (6.52 ± 2.50, P level of miR-218 expression was significantly correlated with the shorter overall survival time of pancreatic cancer patients (5-year overall survival rate: 7.5 vs 34.9%; log-rank test: P level of miR-218 expression was an independent predictor of poor prognosis in pancreatic cancer patients (Hazard ratio: 7.24; 95% confidence interval: 2.01-18.28; P = 0.007). Our findings suggested a significant downregulation in the expression of miR-218; this might have considerable potential value in the prognosis for pancreatic cancer. PMID:26662432

  20. 20 CFR 218.43 - When a surviving divorced spouse annuity ends.

    Science.gov (United States)

    2010-04-01

    ... surviving divorced spouse attains full retirement age (the disability annuitant then becomes entitled based... the month in which the surviving divorced spouse attains full retirement age (the annuitant then.... 218.43 Section 218.43 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE...

  1. A theoretical approach to the study of saturation phenomena of electrostatic collection efficiency of 218Po

    International Nuclear Information System (INIS)

    Radon monitors based on electrostatic collection have been widely used in different radon studies. Collection efficiency of this kind of instrument first depends on the cell geometry and electrostatic field intensity. In the process of new instrument development, some researchers found that electrostatic collection efficiency of 218Po was almost saturated when the voltage between the cylindrical vessel and the detector was higher than 1500 V. In this paper, we analyze the physical processes of the freshly positively charged 218Po formed from the α decay of 222Rn and the neutralization kinetics for positively charged 218Po cluster. The analytical expressions of the collection probability of any freshly positively charged 218Po cluster and the total collection efficiency in electrostatic collection cell are obtained. The ratio of the relative growth rate of the collection efficiency to the relative growth rate of the voltage is inversely proportional to the voltage. Such an approach is useful to understand the mechanism of the electrostatic collection of 218Po. - Highlights: • Expression for collection probability of positively charged 218Po has been obtained. • Expression for total collection efficiency of 218Po has been obtained. • The mechanism of electrostatic collection efficiency of 218Po has been explained

  2. 49 CFR 218.75 - Methods of protection for camp cars.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Methods of protection for camp cars. 218.75... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD OPERATING PRACTICES Protection of Occupied Camp Cars § 218.75 Methods of protection for camp cars. When camp cars requiring protection are on either main...

  3. 15 CFR 280.218 - Decision of the administrative law judge.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Decision of the administrative law judge. 280.218 Section 280.218 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade NATIONAL INSTITUTE OF STANDARDS AND TECHNOLOGY, DEPARTMENT OF COMMERCE ACCREDITATION...

  4. 14 CFR 417.218 - Hold-and-resume gate analysis.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Hold-and-resume gate analysis. 417.218..., DEPARTMENT OF TRANSPORTATION LICENSING LAUNCH SAFETY Flight Safety Analysis § 417.218 Hold-and-resume gate... analysis must construct a hold-and-resume gate for each populated or otherwise protected area. After...

  5. microRNA-218 Inhibits Oxygen-induced Retinal Neovascularization via Reducing the Expression of Roundabout 1

    Directory of Open Access Journals (Sweden)

    Shuang Han

    2016-01-01

    Conclusions: Our experiments showed that restoration of miR-218 inhibited retinal angiogenesis via targeting Robo1. MiR-218 contributed to the inhibition of retinal angiogenesis and miR-218 might be a new therapeutic target for preventing RNV.

  6. miR-218 Involvement in Cardiomyocyte Hypertrophy Is Likely through Targeting REST

    OpenAIRE

    Jing-Jing Liu; Cui-Mei Zhao; Zhi-Gang Li; Yu-Mei Wang; Wei Miao; Xiu-Juan Wu; Wen-Jing Wang; Chang Liu; Duo Wang; Kang Wang; Li Li; Lu-Ying Peng

    2016-01-01

    MicroRNAs (miRNAs) have been identified as key players in cardiomyocyte hypertrophy, which is associated with significant risks of heart failure. However, many microRNAs are still not recognized for their functions in pathophysiological processes. In this study, we evaluated effects of miR-218 in cardiomyocyte hypertrophy using both in vitro and in vivo models. We found that miR-218 was evidently downregulated in a transverse aortic constriction (TAC) mouse model. Overexpression of miR-218 is...

  7. Report on sampling and analysis of air at trenches 218-W-4C and218-W-5 {number_sign}31 of the low level burial grounds

    Energy Technology Data Exchange (ETDEWEB)

    Stauffer, M.

    1997-10-06

    This report presents analytical results of air samples collected from trenches at the Low Level Burial Grounds. The samples were collected with SUMMA canisters and were analyzed by gas chromatography-mass spectrometry using a modified EPA TO-14 procedure. The data suggest that the vent pipes of the 218-W-4C trenches had elevated concentrations of volatile organic compounds. The ambient air samples collected at the 218-W-5 {number_sign}31 facility, an open trench that does not contain any waste at this time, did not show any target compounds above the method detection limit.

  8. microRNA-218 inhibits prostate cancer cell growth and promotes apoptosis by repressing TPD52 expression

    International Nuclear Information System (INIS)

    Highlights: • miR-218 expression is downregulated in prostate cancer. • miR-218 inhibits prostate tumor cells proliferation partially through promoting apoptosis. • miR-218 targets TPD52 by binding to its 3′-UTR. • miR-218 suppresses prostate cancer cell growth through inhibiting TPD52 expression. - Abstract: The tumor protein D52 (TPD52) is an oncogene overexpressed in prostate cancer (PC) due to gene amplification. Although the oncogenic effect of TPD52 is well recognized, how its expression is regulated is still not clear. This study tried to explore the regulative role of miR-218, a tumor suppressing miRNA on TPD52 expression and prostate cancer cell proliferation. We found the expression of miR-218 was significantly lower in PC specimens. Based on gain and loss of function analysis, we found miR-218 significantly inhibit cancer cell proliferation by inducing apoptosis. These results strongly suggest that miR-218 plays a tumor suppressor role in PC cells. In addition, our data firstly demonstrated that miR-218 directly regulates oncogenic TPD52 in PC3 cells and the miR-218-TPD52 axis can regulate growth of this prostate cancer cell line. Knockdown of TPD52 resulted in significantly increased cancer cell apoptosis. Clearly understanding of oncogenic TPD52 pathways regulated by miR-218 might be helpful to reveal new therapeutic targets for PC

  9. MiR-218 inhibits invasion and metastasis of gastric cancer by targeting the Robo1 receptor.

    Directory of Open Access Journals (Sweden)

    Jun Tie

    2010-03-01

    Full Text Available MicroRNAs play key roles in tumor metastasis. Here, we describe the regulation and function of miR-218 in gastric cancer (GC metastasis. miR-218 expression is decreased along with the expression of one of its host genes, Slit3 in metastatic GC. However, Robo1, one of several Slit receptors, is negatively regulated by miR-218, thus establishing a negative feedback loop. Decreased miR-218 levels eliminate Robo1 repression, which activates the Slit-Robo1 pathway through the interaction between Robo1 and Slit2, thus triggering tumor metastasis. The restoration of miR-218 suppresses Robo1 expression and inhibits tumor cell invasion and metastasis in vitro and in vivo. Taken together, our results describe a Slit-miR-218-Robo1 regulatory circuit whose disruption may contribute to GC metastasis. Targeting miR-218 may provide a strategy for blocking tumor metastasis.

  10. 23 CFR 646.218 - Simplified procedure for accelerating grade crossing improvements.

    Science.gov (United States)

    2010-04-01

    ... ENGINEERING AND TRAFFIC OPERATIONS RAILROADS Railroad-Highway Projects § 646.218 Simplified procedure for... preliminary engineering costs may include those incurred in selecting crossings to be improved,...

  11. PET radiochemistry: synthesis of 2-[18 F]-fluorine-2-deoxy-D-glucose

    International Nuclear Information System (INIS)

    The present work describes the method for the synthesis of the 2-[18F]-fluorine-2-deoxy-D-glucose, the radiopharmaceutical of more use in nuclear medicine for the diagnosis of cancer at world level. (Author)

  12. A clinical positron emission tomography facility. 2-18FDG studies: Development and results

    International Nuclear Information System (INIS)

    Two different types of accelerators have been used for production of (18F)fluoride, and the isotope produced has been used for radiolabelling of 2-fluoro-2-deoxy-D-glucose (2-18FDG). A rotating PET scanner, based on two scintillation camera heads, has been developed and used for human 2-18FDG studies. The suitability of an energy window in the Compton region for imaging 511 keV photons in scintillation camera systems has been evaluated. A new simplified method for normalizing clinical 2-18FDG results has been developed and validated, using erythrocytes as a reference tissue, requiring only one blood sample in the middle of the PET scan to calculate the integrated 2-18FDG input function with an accuracy better than 8 percent. An investigation using 2-18FDG PET to monitor the effect of therapy in advanced head and neck cancer patients has been performed. We found that low initial metabolic rate of glucose (MRG) predicted a complete local response. The second PET examination gave no further information for this group. In the group of primary tumours and lymph node metastases representing a combination of high initial MRG and small decrease in MRG at he second PET examination, the outcome was unfavourable. An accurate normalization of 2-18FDG uptake was essential to evaluate the results of this study. 239 refs, 10 tabs

  13. Durable donor engraftment after radioimmunotherapy using α-emitter astatine-211-labeled anti-CD45 antibody for conditioning in allogeneic hematopoietic cell transplantation.

    Science.gov (United States)

    Chen, Yun; Kornblit, Brian; Hamlin, Donald K; Sale, George E; Santos, Erlinda B; Wilbur, D Scott; Storer, Barry E; Storb, Rainer; Sandmaier, Brenda M

    2012-02-01

    To reduce toxicity associated with external γ-beam radiation, we investigated radioimmunotherapy with an anti-CD45 mAb labeled with the α-emitter, astatine-211 ((211)At), as a conditioning regimen in dog leukocyte antigen-identical hematopoietic cell transplantation (HCT). Dose-finding studies in 6 dogs treated with 100 to 618 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) without HCT rescue demonstrated dose-dependent myelosuppression with subsequent autologous recovery, and transient liver toxicity in dogs treated with (211)At doses less than or equal to 405 μCi/kg. Higher doses of (211)At induced clinical liver failure. Subsequently, 8 dogs were conditioned with 155 to 625 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) before HCT with dog leukocyte antigen-identical bone marrow followed by a short course of cyclosporine and mycophenolate mofetil immunosuppression. Neutropenia (1-146 cells/μL), lymphopenia (0-270 cells/μL), and thrombocytopenia (1500-6560 platelets/μL) with prompt recovery was observed. Seven dogs had long-term donor mononuclear cell chimerism (19%-58%), whereas 1 dog treated with the lowest (211)At dose (155 μCi/kg) had low donor mononuclear cell chimerism (5%). At the end of follow-up (18-53 weeks), only transient liver toxicity and no renal toxicity had been observed. In conclusion, conditioning with (211)At-labeled anti-CD45 mAb is safe and efficacious and provides a platform for future clinical trials of nonmyeloablative transplantation with radioimmunotherapy-based conditioning. PMID:22134165

  14. A pri-miR-218 variant and risk of cervical carcinoma in Chinese women

    International Nuclear Information System (INIS)

    MicroRNA (miRNA)-related single nucleotide polymorphisms (SNPs) may compromise miRNA binding affinity and modify mRNA expression levels of the target genes, thus leading to cancer susceptibility. However, few studies have investigated roles of miRNA-related SNPs in the etiology of cervical carcinoma. In this case–control study of 1,584 cervical cancer cases and 1,394 cancer-free female controls, we investigated associations between two miR-218-related SNPs involved in the LAMB3-miR-218 pathway and the risk of cervical carcinoma in Eastern Chinese women. We found that the pri-miR-218 rs11134527 variant GG genotype was significantly associated with a decreased risk of cervical carcinoma compared with AA/AG genotypes (adjusted OR=0.77, 95% CI=0.63-0.95, P=0.015). However, this association was not observed for the miR-218 binding site SNP (rs2566) on LAMB3. Using the multifactor dimensionality reduction analysis, we observed some evidence of interactions of these two SNPs with other risk factors, especially age at primiparity and menopausal status, in the risk of cervical carcinoma. The pri-miR-218 rs11134527 SNP was significantly associated with the risk of cervical carcinoma in Eastern Chinese women. Larger, independent studies are warranted to validate our findings

  15. A pri-miR-218 variant and risk of cervical carcinoma in Chinese women

    Directory of Open Access Journals (Sweden)

    Shi Ting-Yan

    2013-01-01

    Full Text Available Abstract Background MicroRNA (miRNA-related single nucleotide polymorphisms (SNPs may compromise miRNA binding affinity and modify mRNA expression levels of the target genes, thus leading to cancer susceptibility. However, few studies have investigated roles of miRNA-related SNPs in the etiology of cervical carcinoma. Methods In this case–control study of 1,584 cervical cancer cases and 1,394 cancer-free female controls, we investigated associations between two miR-218-related SNPs involved in the LAMB3-miR-218 pathway and the risk of cervical carcinoma in Eastern Chinese women. Results We found that the pri-miR-218 rs11134527 variant GG genotype was significantly associated with a decreased risk of cervical carcinoma compared with AA/AG genotypes (adjusted OR=0.77, 95% CI=0.63-0.95, P=0.015. However, this association was not observed for the miR-218 binding site SNP (rs2566 on LAMB3. Using the multifactor dimensionality reduction analysis, we observed some evidence of interactions of these two SNPs with other risk factors, especially age at primiparity and menopausal status, in the risk of cervical carcinoma. Conclusions The pri-miR-218 rs11134527 SNP was significantly associated with the risk of cervical carcinoma in Eastern Chinese women. Larger, independent studies are warranted to validate our findings.

  16. MicroRNA-218 inhibits the proliferation of human choriocarcinoma JEG-3 cell line by targeting Fbxw8

    Energy Technology Data Exchange (ETDEWEB)

    Shi, Dazun; Tan, Zhihui; Lu, Rong; Yang, Wenqing; Zhang, Yi, E-mail: zhangyi5588@hotmail.com

    2014-08-08

    Highlights: • The miR-218 expression was decreased in choriocarcinoma cell lines. • The Fbxw8 protein expression was increased in choriocarcinoma cell lines. • We show that Fbxw8 is bona-fide target of miR-218 in JEG-3. • Ectopic miR-218 expression inhibits the proliferation of JEG-3 via Fbxw8. • Overexpression of miR-218 affected cyclin A and p27 expression via Fbxw8. - Abstract: MicroRNAs (miRNAs) are endogenous 19–25 nucleotide noncoding single-stranded RNAs that regulate gene expression by blocking the translation or decreasing the stability of mRNAs. In this study, we showed that miR-218 expression levels were decreased while Fbxw8 expression levels were increased in human choriocarcinoma cell lines, and identified Fbxw8 as a novel direct target of miR-218. Overexpression of miR-218 inhibited cell growth arrest at G2/M phase, suppressed the protein levels of cyclin A and up-regulated the expression levels of p27 through decreasing the levels of Fbxw8. On the other hand, forced expression of Fbxw8 partly rescued the effect of miR-218 in the cells, attenuated cell proliferation decrease the percentage of cells at G2/M phase, induced cyclin A protein expression and suppressed the protein level of p27 through up-regulating the levels of Fbxw8. Taken together, these findings will shed light the role to mechanism of miR-218 in regulating JEG-3 cells proliferation via miR-218/Fbxw8 axis, and miR-218 may serve as a novel potential therapeutic target in human choriocarcinoma in the future.

  17. 12 CFR 218.700 - Defined terms relating to the networking exception from the definition of “broker.”

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Defined terms relating to the networking exception from the definition of âbroker.â 218.700 Section 218.700 Banks and Banking FEDERAL RESERVE SYSTEM... the annual value of the Employment Cost Index For Wages and Salaries, Private Industry Workers (or...

  18. 17 CFR 274.218 - Form N-8F, application for deregistration of certain registered investment companies.

    Science.gov (United States)

    2010-04-01

    ...) (15 U.S.C. 80a-3(c)(7)) of the Act; or (d) Has become a business development company. Editorial Note... registered investment company; (b) Has distributed substantially all of its assets to its shareholders and... deregistration of certain registered investment companies. 274.218 Section 274.218 Commodity and...

  19. 12 CFR 218.775 - Exemption from the definition of “broker” for banks effecting certain excepted or exempted...

    Science.gov (United States)

    2010-01-01

    ... system has the same meaning as in 17 CFR 240.15c2-11. (3) Insurance company has the same meaning as in 15... banks effecting certain excepted or exempted transactions in investment company securities. 218.775 Section 218.775 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE...

  20. MicroRNA-218 promotes high glucose-induced apoptosis in podocytes by targeting heme oxygenase-1.

    Science.gov (United States)

    Yang, Haibo; Wang, Qingjun; Li, Sutong

    2016-03-18

    Emerging evidence has demonstrated that microRNAs (miRNAs) play a mediatory role in the pathogenesis of diabetic nephropathy. In this study, we found that miR-218 was upregulated in high glucose (HG) treated podocytes, which are essential components of the glomerular filtration barrier and a major prognostic determinant in diabetic nephropathy. Additionally, up-regulation of miR-218 was accompanied by an increased rate of podocyte death and down-regulation in the level of nephrin, a key marker of podocytes. However, inhibition of miR-218 exerted the opposite effect. In addition, the dual-luciferase reporter assay showed that miR-218 directly targeted the 3'-untranslated region of heme oxygenase-1 (HO-1), and further study confirmed an increase of HO-1 in HG-treated podocytes transfected with anti-miR-218. Knockdown of HO-1 blocked the anti-apoptotic effect of anti-miR-218. Furthermore, inhibition of miR-218 was associated with decreased expression of the known pro-apoptotic molecule p38-mitogen-activated protein kinase (p38-MAPK) activation. Following preconditioning with SB203580, an inhibitor of p38-MAPK, the stimulatory effect of HG on podocyte apoptosis was strikingly ameliorated. These findings suggested that miR-218 accelerated HG-induced podocyte apoptosis through directly down-regulating HO-1 and facilitating p38-MAPK activation. PMID:26876575

  1. Radiation and chemical stability of 2-deoxy-2-[18F]fluoro-D-glucose radiopharmaceutical

    International Nuclear Information System (INIS)

    Qualitative and quantitative analytical technique of low-molecular components of chemical and radiation-chemical decomposition of 2-deoxy-2-[18F]fluoro-D-glucose, 2-[18F]FDG radiopharmaceutical was developed for its extended QC by HPLC with mass-spectrometric electro-spray ionisation detector (ESI MS). The analysis constituted from the LC on silica gel NH2 bonded column combined with MS, UV-VIS, refraction index and radiometric detectors, and TLC on silica gel and high-performance TLC (HPTLC) on silica gel NH2 bonded as at the LC column. Condition of analysis, the composition of mobile phase at HPLC and the regime of ESI MS were optimised on the maximal intensity of the signals of analytes, which were predicted for commercial 2-[18F]FDG and its decomposition products. A modern LC/MS system was demonstrated to be suitable not only for identification of unknown analytes, but also for complex analysis of solutes except [18F]F-. This was advantageous for the 2-[18F]FDG autoradiolysis assessment about which no data were published. For comparative purposes, were used a classic TLC on silica gel with mobile phase acetonitrile: water at 95:5 v/v, and HPTLC on NH2 modified silica gel like the LC column. Mobile phase was identical as by LC/MS method (acetonitrile: 4 mM aqueous solution of ammonium formate 80:20 v/v). Retention times of reference samples: fluorodeoxyglucose, glucose, mannose, arabinose, deoxyglucose, gluconic and glucuronic acids at HPLC were established. Equal composition of the inlet sample and mobile phase was found important to avoid increased background of the MS detector and asymmetry of the chromatographic peaks. Reference substance detectability was investigated for various detectors. Characteristic ions were established for the analytes under consideration. Optimal performance of the ESI MS detector was discovered in negative ions mode or single ion monitoring (SIM) regime. The most intensive signal was observed for all analyte molecules association

  2. 20 CFR 218.26 - Work started after annuity beginning date.

    Science.gov (United States)

    2010-04-01

    ... RETIREMENT ACT ANNUITY BEGINNING AND ENDING DATES How Work and Special Payments Affect an Employee, Spouse, or Divorced Spouse Annuity Beginning Date § 218.26 Work started after annuity beginning date. (a... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Work started after annuity beginning...

  3. 17 CFR 249.218 - Form 18, for foreign governments and political subdivisions thereof.

    Science.gov (United States)

    2010-04-01

    ... Federal Register citations affecting Form 18, see the List of CFR Sections Affected, which appears in the... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form 18, for foreign... for Registration of Securities on National Securities Exchanges and Similar Matters § 249.218 Form...

  4. 20 CFR 408.218 - Do you meet the SSI eligibility requirements?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Do you meet the SSI eligibility requirements... CERTAIN WORLD WAR II VETERANS SVB Qualification and Entitlement Ssi Eligibility § 408.218 Do you meet the SSI eligibility requirements? For SVB purposes, you are eligible for SSI for a given month if all...

  5. 20 CFR 218.44 - When a remarried widow(er) annuity ends.

    Science.gov (United States)

    2010-04-01

    ... the month in which the remarried widow(er) attains full retirement age (the disability annuitant then... widow attains full retirement age (the annuitant then becomes entitled to an annuity based upon age). ....44 Section 218.44 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE...

  6. 20 CFR 218.13 - When a widow(er) annuity begins.

    Science.gov (United States)

    2010-04-01

    ... the month in which the claimant attains full retirement age; or (iii) The first day of the sixth month... 62 but under full retirement age. The earliest date permitted by law is the latest of— (A) The first... Section 218.13 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT...

  7. 20 CFR 218.36 - When an employee disability annuity ends.

    Science.gov (United States)

    2010-04-01

    ... month in which the employee attains full retirement age (the disability annuity is changed to an age... becomes entitled. When a disability annuity ends before an employee attains full retirement age, any....36 Section 218.36 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE...

  8. 30 CFR 218.101 - Royalty and rental remittance (naval petroleum reserves).

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Royalty and rental remittance (naval petroleum... INCENTIVES Oil and Gas, Onshore § 218.101 Royalty and rental remittance (naval petroleum reserves). Remittance covering payments of royalty or rental on naval petroleum reserves must be accomplished...

  9. miR-218 inhibits the invasive ability of glioma cells by direct downregulation of IKK-{beta}

    Energy Technology Data Exchange (ETDEWEB)

    Song, Libing, E-mail: lb.song1@gmail.com [State Key Laboratory of Oncology in Southern China, Department of Experimental Research, Sun Yat-sen University Cancer Center, Guangzhou, Guangdong 510060 (China); Huang, Quan; Chen, Kun [Department of Neurosurgery, The First Affiliated Hospital of Sun Yat-sen University, Guangzhou, Guangdong 510080 (China); Liu, Liping [Department of Microbiology, Zhongshan School of Medicine, Sun Yat-sen University, Guangzhou, Guangdong 510080 (China); Lin, Chuyong; Dai, Ting [Department of Biochemistry, Zhongshan School of Medicine, Sun Yat-sen University, Guangzhou, Guangdong 510080 (China); Yu, Chunping [State Key Laboratory of Oncology in Southern China, Department of Experimental Research, Sun Yat-sen University Cancer Center, Guangzhou, Guangdong 510060 (China); Wu, Zhiqiang [Department of Biochemistry, Zhongshan School of Medicine, Sun Yat-sen University, Guangzhou, Guangdong 510080 (China); Li, Jun, E-mail: junli99@gmail.com [Department of Biochemistry, Zhongshan School of Medicine, Sun Yat-sen University, Guangzhou, Guangdong 510080 (China)

    2010-11-05

    Research highlights: {yields} miR-218 is markedly downregulated in glioma cell lines and in primary glioma tissues. {yields} Upregulation of miR-218 dramatically reduces the invasive ability of glioma cells. {yields} Ectopic expression of miR-218 inactivates IKK-{beta}/NF-{kappa}B signaling pathway. {yields} miR-218 directly targets the 3'-untranslated region (3'-UTR) of IKK-{beta}. -- Abstract: Aberrant activation of nuclear factor-kappa B (NF-{kappa}B) pathway has been proven to play important roles in the development and progression of cancers. Activation of NF-{kappa}B via the classical pathway is modulated by I{kappa}Bs kinase (IKK-{beta}). However, the mechanism underlying the epigenetic regulation of IKK-{beta}/NF-{kappa}B pathway remains largely unknown. In this study, we found that the expression level of miR-218 was markedly downregulated in glioma cell lines and in human primary glioma tissues. Upregulation of miR-218 dramatically reduced the migratory speed and invasive ability of glioma cells. Furthermore, we showed that ectopically expressing miR-218 in glioma cells resulted in downregulation of matrix metalloproteinase-9 (MMP-9) and reduction in NF-{kappa}B transactivity at a transcriptional level, but inhibition of miR-218 enhanced the expression of MMP-9 and transcriptional activity of NF-{kappa}B. Moreover, we showed that miR-218 inactivated the NF-{kappa}B pathway through downregulating IKK-{beta} expression by directly targeting the 3'-untranslated region (3'-UTR) of IKK-{beta}. Taken together, our results suggest that miR-218 plays an important role in preventing the invasiveness of glioma cells, and our results present a novel mechanism of miRNA-mediated direct suppression of IKK-{beta}/NF-{kappa}B pathway in gliomas.

  10. Synthesis and purification of 2-deoxy-2-[18F]fluoro-D-glucose and 2-deoxy-2-[18F]fluoro-D-mannose: characterization of products by 1H- and 19F-NMR spectroscopy

    International Nuclear Information System (INIS)

    A procedure has been developed that allows the separation 2-deoxy-2-[18F]fluoro-D-glucose from 2-deoxy-2-[18F]fluoro-D-mannose employing selectively optimized ion-moderated partition chromatography. Both compounds can be obtained with a >98% chemical and radiochemical purity in about one half-life of 18F. Both the α- and β-anomers of both sugars were completely characterized by high-resolution 1H- and 19F-NMR spectroscopy. Various convenient preparation methods for 2-deoxy-2-[18F]fluoro-D-glucose were compared. (author)

  11. MiR-218 Inhibited Growth and Metabolism of Human Glioblastoma Cells by Directly Targeting E2F2.

    Science.gov (United States)

    Zhang, Yaxuan; Han, Dongfeng; Wei, Wenjin; Cao, Wenping; Zhang, Rui; Dong, Qingsheng; Zhang, Junxia; Wang, Yingyi; Liu, Ning

    2015-11-01

    In recent years, microRNA has become a hotspot in research on diseases, especially in the initiation and progression of different types of cancer. In this study, we found that miR-218 could inhibit growth and metabolism in gliomas by directly targeting E2F2. First, we obtained data from the Chinese Glioma Genome Atlas (CGGA) database to analyze miR-218 expression in different grades of gliomas. The effects of miR-218 on cell cycle progression and cell proliferation in U87 and U251 cell lines were investigated by flow cytometry, specifically CCK8 assay and tablet cloning, respectively. Glucose consumption and lactate production of glioma cell lines were measured by correlative test kits. Furthermore, we used Western blot analysis and luciferase reporter assay to identify the direct and functional target of miR-218. Data from the CGGA database and real-time quantitative reverse transcription-PCR demonstrated that miR-218 was obviously reduced in human glioblastoma tissues, as well as in the cell lines. When miR-218 level was elevated in vitro, cell cycle progression was arrested in the G1 phase, and cell proliferation was dramatically inhibited. Both glucose consumption and lactate production of glioma cells were significantly reduced. Western blot analysis and luciferase reporter assay revealed that E2F2 was a direct target of miR-218 in glioma cells. This investigation demonstrated that elevated E2F2 expression could partly weaken the effect of miR-218 in vitro. This study also showed that miR-218 may be a repressor in glioma by directly targeting E2F2, as well as a potential therapeutic target in gliomas. PMID:26012781

  12. Transient-diffusion measurements of radon. Fick's law confirmation and 218Po/214Po behavior determination

    International Nuclear Information System (INIS)

    Usually, radon diffusion coefficients in soils are measured based on the assumption that Fick's law holds true. But, unlike in a free volume, strictly speaking, there is no guarantee that Fick's law holds in soils. Transient-diffusion measurements of radon in soils are best employed in order to confirm Fick's law. Alpha-particles from 218Po/214Po and from 222Rn cannot be distinguished in the course of those measurements. Therefore, the relevant portions of the detector reading must be allocated to each of these nuclides. For that purpose, the behaviors of 218Po and 214Po in the detection volume were determined and their ratios of contribution to the detector reading were also determined by Monte Carlo calculations and a verification test. This information was used to confirm Fick's law for representative Japanese sand and loam samples through indicial transient-diffusion measurements and a theoretical interpretation of the measured data. (author)

  13. Synthesis of 2-18F-fluoroisonicotinic acid hydrazide and initial biological evaluation

    International Nuclear Information System (INIS)

    Isonicotinic acid hydrazide (isonizide) is one of the most effective agents in tuberculosis therapy. This agent rapidly permeates the bacterial cell membrane via passive diffusion. The central nervous system tuberculosis is being observed in patients who are intravenous drug abusers, with AIDS and AIDS-related complex. Therefore, radiopharmaceuticals for diagnosis of tuberculosis may become important. Very few attempts have been made to develop isonicotinic acid and derivatives for the same application. As part of an on-going research effort to develop radiotracers for fluorination of proteins and peptides via prosthetic groups approach, we have synthesized ethyl 2-[18F]-fluoroisonicotinate and 2-[18F]-fluoroisonicotinic acid hydrazide. The synthetic approach starts from treatment of ethyl-2-(trimethylammonium)-isonicotinate precursor using no-carrier-added radiofluoride produced by the 18O(p,n)18F nuclear reaction on 18O-enriched (95 %) water and Kryptofix 222 as nucleophilic catalyst in anhydrous acetonitrile at 1000C, gave ethyl 2-[18F]-fluoroisonicotinate in greater than 90% radiochemical yield (decay corrected) within two minutes reaction time. The ether extract of fluorinated ethylester evaporated and residue was re-dissolved in ethanol and treated with hydrazine for 15 minutes in boiling water to obtain 2-[18F]-fluoroisonicotinic acid hydrazide in excellent radiochemical yield. The overall radiochemical yield was greater that 70% with total synthesis time of approximately one hour. This synthetic approach hold considerable promise as a rapid and simple method for fluorination of radiopharmaceuticals of high radiochemical yield. Biological evaluation was performed in normal mice. The data obtained shown that the lungs appear to retain some activity that someone may presume that such radiotracer maybe useful in detection of tuberculosis

  14. An analysis of clinical characteristics,etiologies and prognosis of 218 patients with infective endocarditis

    Institute of Scientific and Technical Information of China (English)

    谢红梅

    2014-01-01

    Objective To describe the profile of patients with infective endocarditis(IE)and assess prognostic factors of IE.Methods Clinical and etiology data of 218 patients with IE were collected retrospectively from January 2011to January 2013.The distribution and antimicrobial susceptibilities of pathogens causing IE were evaluated.Prognostic factors associated with IE were determined by univariate and multivariate regression analysis.Results

  15. Progress of research in miR-218 and cervical cancer

    Institute of Scientific and Technical Information of China (English)

    Kangkang Zeng; Wei Zhang; Xiaoxia Hu

    2013-01-01

    MicroRNAs (miRNAs) are smal endogenous non-coding RNAs which can specifical y silence gene expression, and thereby alter cel and organism phenotype. Deregulation of miRNA expression has been discovered in a variety of tumors and it is now clear that they contribute to cancer development and progression. Previous studies have indicated that miRNAs are involved in developmental timing, cel proliferation, apoptosis, morphogenesis [1], antiviral defense [2], and tumorigenesis [3]. In cancer pathways, altered expression of tumor suppressive or oncogenic miRNAs can disrupt regulatory mechanisms normal. Altered miRNAs expression patterns have been observed in a variety of diseased tissues. Cervical cancer is the most common malignant tumor in female reproductive tract. Recently more and more study showed a large number of miRNAs were down-regulated or up-regulated in cervical cancer. Recent data revealed that miRNA-218 (miR-218) played important roles in tumor initiation and development. This review focuses on analysis of miR-218 and wil provide some insight into the progress of cervical cancer.

  16. Analysis of 218 cases of children's ADR reports%218例儿童药品不良反应报告分析

    Institute of Scientific and Technical Information of China (English)

    董传婷; 赵孝林; 郝丽娜

    2014-01-01

    目的:分析笔者所在医院儿童药品不良反应( ADR)的发生特点及影响因素,保障儿童用药安全。方法采用回顾性分析法,对218例儿童ADR报告按照报告类型、患儿年龄、性别、体质量,药品种类、给药途径,临床表现等进行统计分析。结果218例ADR报告中,患儿的平均年龄为(2.99±2.89)岁,平均体质量为(14.18±8.51) kg,男女比例为1.32:1,0~3岁患儿占58.26%;新的和严重的ADR占33.03%;引发ADR最多的是抗微生物药,占67.89%;最主要的给药方式是静脉滴注,占92.20%;ADR累及器官或系统中皮肤及其附件与全身性占80.76%。结论为使儿童ADR监测工作得到持续改进,医院必须有重点的继续加强培训,增强行政监管力度,加大奖惩力度,加强药品的质量控制,临床上继续减少静脉给药频率,加强用药监护,做好急救措施。%Objective To analyze the characters and influencing factors of children ADR monitoring in our hospital, and ensure the medical safety for children. Methods Retrospective study was used to analyze 218 cases of children ADR reports statistically in 2012,in accordance with the type of report and children′s age,gender,weight,as well as drug types, routes of administration,clinical manifestation etc. Results In the 218 cases of ADR reports,the children′s average age was(2. 99 ± 2. 89)years,the average weight was(14. 18 ± 8. 51)kg,male to female ratio was 1. 32:1,children of 0~3 years old accounted for 58. 26%;new and severe ADR accounted for 33. 03%;most of the ADR was caused by antimicrobi-al drugs,which accounted for 67. 89%;intravenous infusion,the main route of administration,accounted for 92. 20%;ADR involving the skin and its appendages as well as systemic accounted for 80. 76%. Conclusion In order to get continuous improvement in children ADR monitoring,the hospital must continue to focus on enhancing training,and strengthening ad

  17. High sensitivity ICLAS of H218O in the 12,580-13,550 cm-1 transparency window

    International Nuclear Information System (INIS)

    High-sensitivity Intracavity Laser Absorption Spectroscopy (ICLAS) is used to measure the high resolution absorption spectrum of H218O between 12,580 and 13,550 cm-1. This spectral region covers the 3v+δ polyad of very weak absorption. Four isotopologues of water (H218O, H216O, H217O, HD18O) are found to contribute to the observed spectrum. Spectrum analysis is performed with the aid of variational calculations and allowed for assigning 1126 lines belonging to H218O, while only 160 H218O lines are included in the HITRAN-2008 database. Altogether, 823 accurate energy levels of H218O are determined from transitions attributed to 26 upper vibrational states, 438 of them being reported for the first time. New information includes energy levels of four newly observed vibrational states of H218O: (2 4 0), (1 4 1), (0 4 2) and (2 3 1) at 13,167.718, 13,212.678, 13,403.71 and 15,073.975 cm-1, respectively. H218O transitions involving highly excited bending states like (1 6 0), (0 6 1), (0 7 1), (1 7 0), (0 9 0) and even (0 10 0) have been identified as a result of an intensity borrowing from stronger bands via high-order resonance interactions. Thirty-six new energy levels of H217O, present with a 2% relative concentration in our sample, could be determined. The rotational structure of the (0 2 3) state of HD18O at 13,245.497 cm-1 is also reported for the first time.

  18. Yeast Interacting Proteins Database: YML064C, YJL218W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ) 0 Synthetic lethality (0 or 1,YPD) 0 Co-induced by (YPD) - Co-repressed by (YPD) - Not affected by(YPD) - Interologs - Expression...ilar to bacterial galactoside O-acetyltransferases; induced by oleate in an OAF1/PIP2-dependent manner; promoter con...; induced by oleate in an OAF1/PIP2-dependent manner; promoter contains an oleate res...trols actomyosin and septin dynamics during cytokinesis Rows with this bait as bait (20) Rows with this bait as pre...y (0) YJL218W - Putative protein of unknown function, similar to bacterial galactoside O-acetyltransferases

  19. Mass flow rate correlation for two-phase flow of R218 through a capillary tube

    Czech Academy of Sciences Publication Activity Database

    Vinš, Václav; Vacek, V.

    2009-01-01

    Roč. 29, 14-15 (2009), s. 2816-2823. ISSN 1359-4311 Institutional research plan: CEZ:AV0Z20760514 Keywords : artificial neural network * capillary tube * mass flow rate correlation * R218 Subject RIV: BK - Fluid Dynamics Impact factor: 1.922, year: 2009 http://www.sciencedirect.com/science?_ob=PublicationURL&_cdi=5687&_pubType=J&_acct=C000034318&_version=1&_urlVersion=0&_userid=640952&md5=fc314a471a010545ee185394a6c8f5f7&jchunk=29#29

  20. Yeast Interacting Proteins Database: YGL044C, YDL218W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available starvation and aerobic conditions; expression also induced in cells treated with the mycotoxin patulin Rows ...duced by starvation and aerobic conditions; expression also induced in cells treated with the mycotoxin...imilarity (BRITE) - Alternative path with 1 intervening protein (YPD) 0 Alternative path with 2 intervening proteins (YPD) 0 IST hit 4 IST hit in the opposite bait/prey orientation - ... ...YGL044C RNA15 Cleavage and polyadenylation factor I (CF I) component involved in cl... of unknown function; YDL218W transcription is regulated by Azf1p and induced by

  1. Production process validation of 2-[18F]-fluoro-2-deoxy-D-glucose

    International Nuclear Information System (INIS)

    The main of validation of production process of 2-[18F]-fluoro-2-deoxi-D-glucose (FDG) was to check: A) equipment's and services implicated in the production process were correctly installed, well documented, and worked properly, and B) production of FDG was done in a repetitive way according to predefined parameters. The main document was the Validation Master Plan, and steps were: installation qualification, operation qualification, process qualification and validation report. After finalization of all tests established in qualification steps without deviations, we concluded that the production process was validated because is done in a repetitive way according predefined parameters (Au)

  2. Production process validation of 2-[18F]-fluoro-2-deoxy-D-glucose

    International Nuclear Information System (INIS)

    The aim of production process validation of 2-[18F]-fluoro-2-deoxi-D-glucose (FDG) was to check: A) equipments and services implicated in the production process were correctly installed, well documented, and worked properly, and B) production of FDG was done in a repetitive way according to predefined parameters. The main document was the Validation Master Plan, and steps were: installation qualification, operational qualification, performance qualification and validation final report. After finalization of all tests established in qualification steps without deviations, we concluded that the production process was validated because consistently produced FDG meeting its pre-determined specifications and quality characteristics (Au)

  3. Treatment of cultured glioma cells with the EGFR-TKI gefitinib (''Iressa'', ZD1839) increases the uptake of astatinated EGF despite the absence of gefitinib-mediated growth inhibition

    International Nuclear Information System (INIS)

    The EGFR-TKI (epidermal growth factor receptor tyrosine kinase inhibitor) gefitinib (''Iressa'', ZD1839), a reversible growth inhibitor of EGFR-expressing tumour cells, has been shown to enhance the antitumour effect of ionising radiation, and also to increase the uptake of radioiodinated EGF. Thus, combination of gefitinib treatment and radionuclide targeting is an interesting option for therapy of brain tumours that are difficult to treat with conventional methods. The aim of this study was to evaluate how pre-treatment with gefitinib affects binding of astatinated EGF (211At-EGF) to cultured glioma U343 cells, which express high levels of EGFR. The growth of U343 cells in the presence of gefitinib was investigated, and it was found that gefitinib does not significantly inhibit the growth of these cells. Nevertheless, the uptake of 211At-EGF in U343 cells was markedly increased (up to 3.5 times) in cells pre-treated with gefitinib (1 μM). This indicates that a combination of gefitinib treatment and radionuclide targeting to EGFR might be a useful therapeutic modality, even for patients who do not respond to treatment with gefitinib alone. (orig.)

  4. 2-deoxy-2-[18F]fluoro-D-mannose positron emission tomography imaging in atherosclerosis.

    Science.gov (United States)

    Tahara, Nobuhiro; Mukherjee, Jogeshwar; de Haas, Hans J; Petrov, Artiom D; Tawakol, Ahmed; Haider, Nezam; Tahara, Atsuko; Constantinescu, Cristian C; Zhou, Jun; Boersma, Hendrikus H; Imaizumi, Tsutomu; Nakano, Masataka; Finn, Aloke; Fayad, Zahi; Virmani, Renu; Fuster, Valentin; Bosca, Lisardo; Narula, Jagat

    2014-02-01

    Progressive inflammation in atherosclerotic plaques is associated with increasing risk of plaque rupture. Molecular imaging of activated macrophages with 2-deoxy-2-[(18)F]fluoro-D-glucose ([(18)F]FDG) has been proposed for identification of patients at higher risk for acute vascular events. Because mannose is an isomer of glucose that is taken up by macrophages through glucose transporters and because mannose receptors are expressed on a subset of the macrophage population in high-risk plaques, we applied (18)F-labeled mannose (2-deoxy-2-[(18)F]fluoro-D-mannose, [(18)F]FDM) for targeting of plaque inflammation. Here, we describe comparable uptake of [(18)F]FDM and [(18)F]FDG in atherosclerotic lesions in a rabbit model; [(18)F]FDM uptake was proportional to the plaque macrophage population. Our FDM competition studies in cultured cells with 2-deoxy-2-[(14)C]carbon-D-glucose ([(14)C]2DG) support at least 35% higher [(18)F]FDM uptake by macrophages in cell experiments. We also demonstrate that FDM restricts binding of anti-mannose receptor antibody to macrophages by approximately 35% and that mannose receptor targeting may provide an additional avenue for imaging of plaque inflammation. PMID:24412923

  5. IC-218合金的再结晶织构及其形成机制%RECRYSTALLIZATION TEXTURE OF IC-218 ALLOY

    Institute of Scientific and Technical Information of China (English)

    林一坚

    2004-01-01

    研究了IC-218合金冷轧60%后在1000℃退火中形成的织构,发现再结晶后晶粒取向分布漫散,这种情况早在再结晶形核阶段就已出现,并在随后的长时间退火中保持.相继出现几个弱的再结晶织构,它们都与冷轧织构之间存在与低∑重合点阵相近的位向关系.这些结果可与显微组织的观察很好地相互印证,表明导致再结晶织构这些特点的基本原因是一般大角晶界失去明显可动性而以位错运动为机制的界面迁移则相对活跃.将以上结果与单相Ni3Al的再结晶行为进行对比,发现两者极为相似.由此对76Ni-24Al-0.24B合金的晶界结构是否存在无序区的问题提供了新的信息.

  6. H_2^{16}O and H_2^{18}O Maser Emission from Gas-Dust Clouds

    CERN Document Server

    Nesterenok, Aleksandr; 10.1134/S1063773711070036

    2011-01-01

    The collisional pumping of H_2^{16}O and H_2^{18}O masers in hot dense gas-dust clouds has been simulated numerically. New data on the rate coefficients for collisional transitions from Faure et al. (2007) were used in the calculations. The possibility of detecting H_2^{18}O emission in 22.2-GHz H_2^{16}O maser sources is investigated. The medium is shown to become optically thick in the H_2^{16}O lines for which an inverted level population is observed at H_2O column densities of ~10^{19}-10^{20} cm^{-2}. A simultaneous observation of H_2^{18}O emission and H_2^{16}O maser emission in the same source will allow the physical conditions in the gas-dust cloud to be refined.

  7. A crucial role of Cys218 in configuring an unprecedented auto-inhibition form of MAP2K7.

    Science.gov (United States)

    Sogabe, Yuri; Hashimoto, Takuma; Matsumoto, Takashi; Kirii, Yasuyuki; Sawa, Masaaki; Kinoshita, Takayoshi

    2016-04-29

    Mitogen-activated protein kinase kinase 7 (MAP2K7) is an indispensable kinase of the c-Jun N-terminal kinase signal cascade and is rigorously regulated via phosphorylation. To investigate the regulatory mechanism of the inactive non-phosphorylated state of MAP2K7, the crystal structures of the wild-type and C218S mutant were solved. The wild-type apo-structure revealed an unprecedented auto-inhibition form that occluded the ATP site. This closed form was configured by the n-σ* interaction of Cys218, a non-conserved residue among the MAP2K family kinases, with Gly145 in the glycine-rich loop. The interaction was unaltered in the presence of an ATP analog, whereas the C218S mutation precluded the closed configuration. These structural insights are potentially valuable for drug discovery of highly selective MAP2K7 inhibitors. PMID:26987717

  8. Alternating parity bands in doubly odd 218Ac129 and octupole instability in the light actinide region

    International Nuclear Information System (INIS)

    High-spin states of doubly odd 218Ac129 have been investigated using in-beam α, γ and conversion electron spectroscopy techniques through the 209Bi(12(13)C,3(4)n) fusion-evaporation reactions. The level scheme of 218Ac shows three interconnected, alternating parity structures, each one linked by strong E1 transitions. Two of these bands are strikingly similar to the known scheme of the isotone 217Ra and this analogy is shown to persist for the pair 220Ac, 219Ra. The relation between the structure of 218Ac and its neighbors is thoroughly discussed showing that the first signals of octupole collectivity appear for N = 129. (orig.)

  9. Synthesis of 2-deoxi-2[18F]fluoro-D-glucose and its precursors for human diagnostics

    International Nuclear Information System (INIS)

    The planned Debrecen PET center requires an intensive radiopharmaceutical development program. In the frame of this project 2-[18F]FDG, an important radiopharmaceutical in the PET technique was synthesized. In order to prepare the precursor 1,3,4,6-tetra-O-acetyl-2-O-trifluoromethanesulfonyl-β-D-mannopyranose (TATM) the standard preparation protocols were modified for achieving a better yield. Stereochemically pure 2-[18F]FDG was synthesized using high purity TATM and 18F produced by the MGC-20 E cyclotron. Beside the elaboration of the synthesis a detailed description is also given of the methods used for quality control of both TATM and 2-[18F]FDG. In addition to the usual conformational and configurational characterization of precursor compounds measured NMR parameters were also used to explore the anomeric structure of the acetylated sugar derivates. (author) 24 refs.; 4 figs.; 4 tabs

  10. Malignant transformation of oral leukoplakia: a retrospective cohort study of 218 Chinese patients

    Directory of Open Access Journals (Sweden)

    Zhou Zeng-Tong

    2010-12-01

    Full Text Available Abstract Background Oral leukoplakia (OL is the best-known potentially malignant disorder. A new binary system to grade dysplasia was proposed by WHO, but the biological significance in predicting malignant transformation risk is unknown. The objective of this study is to estimate the rate of malignant transformation in a long-term follow-up cohort, explore the usefulness of the new binary system of grading dysplasia and identify significant risk factors of OL malignant transformation in China. Methods A total of 218 patients with clinical and histopathologic diagnosis of OL were retrospectively reviewed. They were selected among all archived files at the Department of Oral Mucosal Diseases, Ninth People's Hospital, Shanghai Jiao Tong University School of Medicine. The mean follow-up period was 5.3 years. Results Among 218 cases, 39 (17.9% OL patients developed oral cancer, with a mean duration of 5.2 years. Cox regression analysis revealed that dysplasia was an independent risk factor for OL malignant transformation, but age, gender, lesion site, diet habit, smoking and ethanol intake were not risk factors. High-risk dysplastic OL was associated with a 4.57-fold (95% confidence interval, 2.36-8.84; P Conclusions The new binary system's function in predicting OL malignant transformation risk was investigated in this survey. The utilization of high-risk dysplasia as a significant indicator for evaluating malignant transformation risk in patients with OL was suggested, which may be helpful to guide treatment selection in clinical practice.

  11. Malignant transformation of oral leukoplakia: a retrospective cohort study of 218 Chinese patients

    International Nuclear Information System (INIS)

    Oral leukoplakia (OL) is the best-known potentially malignant disorder. A new binary system to grade dysplasia was proposed by WHO, but the biological significance in predicting malignant transformation risk is unknown. The objective of this study is to estimate the rate of malignant transformation in a long-term follow-up cohort, explore the usefulness of the new binary system of grading dysplasia and identify significant risk factors of OL malignant transformation in China. A total of 218 patients with clinical and histopathologic diagnosis of OL were retrospectively reviewed. They were selected among all archived files at the Department of Oral Mucosal Diseases, Ninth People's Hospital, Shanghai Jiao Tong University School of Medicine. The mean follow-up period was 5.3 years. Among 218 cases, 39 (17.9%) OL patients developed oral cancer, with a mean duration of 5.2 years. Cox regression analysis revealed that dysplasia was an independent risk factor for OL malignant transformation, but age, gender, lesion site, diet habit, smoking and ethanol intake were not risk factors. High-risk dysplastic OL was associated with a 4.57-fold (95% confidence interval, 2.36-8.84; P < 0.001) increased risk of malignant transformation, compared with low-risk dysplasia. Consistent with this result, high-risk dysplastic OL had signicantly higher malignant incidence than low-risk dysplasia, particularly during the first 2-3 years of follow-up, by Kaplan-Meier analysis (Log-rank test, P < 0.001). The new binary system's function in predicting OL malignant transformation risk was investigated in this survey. The utilization of high-risk dysplasia as a significant indicator for evaluating malignant transformation risk in patients with OL was suggested, which may be helpful to guide treatment selection in clinical practice

  12. 5 CFR 792.218 - Does the law apply only to on-site Federal child care centers that are utilized by Federal families?

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Does the law apply only to on-site Federal child care centers that are utilized by Federal families? 792.218 Section 792.218 Administrative... law apply only to on-site Federal child care centers that are utilized by Federal families? The...

  13. Cooked oatmeal consumption is associated with better diet quality, better nutrient intakes, and reduced risk for central adiposity and obesity in Children 2-18 years

    Science.gov (United States)

    The objective of this study was to assess the association between oatmeal consumption and nutrient intake, diet quality, and weight/adiposity of children aged 2-18. A nationally representative sample of children aged 2-18 (N=14,690) participating in National Health and Nutrition Examination Survey 2...

  14. Aberrant expression of miR-218 and miR-204 in human mesial temporal lobe epilepsy and hippocampal sclerosis-Convergence on axonal guidance

    DEFF Research Database (Denmark)

    Kaalund, Sanne Simone; Venø, Morten T; Bak, Mads;

    2014-01-01

    . Moreover, miR-204 and miR-218 showed strong changes in expression during fetal development of the hippocampus in pigs, and we identified four target genes, involved in axonal guidance and synaptic plasticity, ROBO1, GRM1, SLC1A2, and GNAI2, as bona fide targets of miR-218. GRM1 was also shown to be a...

  15. 34 CFR 685.218 - Discharge of student loan indebtedness for survivors of victims of the September 11, 2001, attacks.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 3 2010-07-01 2010-07-01 false Discharge of student loan indebtedness for survivors of... WILLIAM D. FORD FEDERAL DIRECT LOAN PROGRAM Borrower Provisions § 685.218 Discharge of student loan... present at the World Trade Center in New York City, New York, at the Pentagon in Virginia, or at...

  16. 49 CFR Appendix B to Part 218 - Statement of Agency Enforcement Policy on Blue Signal Protection for Utility Employees

    Science.gov (United States)

    2010-10-01

    ... clarify FRA's enforcement policy. In the first four examples, the utility employee is properly attached to..., provided all the conditions specified in § 218.22 are met: Example 1: A utility employee assists a train crew by adding or reducing railroad cars to or from the train. The utility employee may perform...

  17. 77 FR 69503 - Comment Request for Information Collection on the ETA 218, Benefit Rights and Experience Report...

    Science.gov (United States)

    2012-11-19

    ... January 18, 2013. ADDRESSES: Submit written comments to Scott Gibbons, Office of Unemployment Insurance... determine eligibility for state unemployment compensation programs. The data in the ETA 218, Benefit Rights... submissions of responses. III. Current Actions Type of Review: Extension without changes. Title:...

  18. 49 CFR 218.101 - Leaving rolling and on-track maintenance-of-way equipment in the clear.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Leaving rolling and on-track maintenance-of-way... Handling Equipment, Switches, and Fixed Derails § 218.101 Leaving rolling and on-track maintenance-of-way... requirements of this section. (b) Rolling and on-track maintenance-of-way equipment shall not be left where...

  19. High frequency microphone measurements for transition detection on airfoils. Risø C2-18 appendix report

    DEFF Research Database (Denmark)

    Døssing, Mads

    pressure) and Tollmien-Schlichting frequencies. The tests were made at Reynolds and Mach numbers corresponding to the operating conditions of a typical horizontal axis wind turbine (HAWT). The Risø B1-18, Risø C2-18 and NACA0015 profiles were tested and the measured transition points are reported....

  20. 12 CFR 218.701 - Exemption from the definition of “broker” for certain institutional referrals.

    Science.gov (United States)

    2010-01-01

    ... in a merger, acquisition, tender offer or similar transaction; providing venture capital, equity... a contractual or other written arrangement of the type specified in section 3(a)(4)(B)(i) of the Act... type of compensation that would not be considered incentive compensation under § 218.700(b)(1) or...

  1. In vitro evaluation of nicotinic acetylcholine receptors with 2-[18F]F-A85380 in Parkinson's disease

    International Nuclear Information System (INIS)

    Nicotinic acetylcholine receptors (nAChR) are involved in many physiological functions and appear to be affected in neurodegenerative diseases like Alzheimer's disease and Parkinson's disease (PD). Here, we describe the in vitro evaluation of nAChRs in PD with 2-[18F]F-A85380, a ligand with high affinity to the β2 nAChR subunit. Autoradiography with 2-[18F]F-A85380 in untreated rat brain corresponded to the known distribution of α4β2 nAChRs with high uptake in the thalamus, moderate uptake in the striatum and cortex and low uptake in the cerebellum (47%, 43% and 19% of the thalamus, respectively). The localization of α4β2 nAChRs in the striatum was investigated in rodents with unilateral lesion of the substantia nigra. 2-[18F]F-A85380 binding was significantly reduced in the striatum ipsilateral to the lesion side (to 64% of the contralateral side), indicating that a fraction of α4β2 nAChRs is located on dopaminergic terminals, whereas another fraction resides on striatal interneurons or cortical afferents. Similarly, in human brain sections of PD patients, 2-[18F]F-A85380 uptake was significantly reduced not only in the caudate and putamen but also in the thalamus (approximately 30% of the binding of control brain in all three regions); within the striatum, nAChRs in the putamen were significantly more severely affected as in the caudate. The observed pattern of α4β2* nAChR loss demonstrates the potential of 2-[18F]F-A85380 for further investigations of this positron emission tomography ligand for in vivo studies of α4β2* nAChRs in PD

  2. Tumor suppressive microRNA-218 inhibits cancer cell migration and invasion through targeting laminin-332 in head and neck squamous cell carcinoma.

    Science.gov (United States)

    Kinoshita, Takashi; Hanazawa, Toyoyuki; Nohata, Nijiro; Kikkawa, Naoko; Enokida, Hideki; Yoshino, Hirofumi; Yamasaki, Takeshi; Hidaka, Hideo; Nakagawa, Masayuki; Okamoto, Yoshitaka; Seki, Naohiko

    2012-11-01

    Recent our microRNA (miRNA) expression signature revealed that expression of microRNA-218 (miR-218) was reduced in cancer tissues, suggesting a candidate of tumor suppressor in head and neck squamous cell carcinoma (HNSCC). The aim of this study was to investigate the functional significance of miR-218 and its mediated moleculer pathways in HNSCC. Restoration of miR-218 in cancer cells led to significant inhibition of cell migration and invasion activities in HNSCC cell lines (FaDu and SAS). Genome-wide gene expression analysis of miR-218 transfectants and in silico database analysis showed that focal adhesion pathway was a promising candidate of miR-218 target pathways. The laminins are an important and biologically active part of the basal lamina, the function of that are various such as influencing cell differentiation, migration and adhesion as well as proliferation and cell survival. Interestingly, all components of laminin-332 (LAMA3, LAMB3 and LAMC2) are listed on the candidate genes in focal adhesion pathway. Furthermore, we focused on LAMB3 which has a miR-218 target site and gene expression studies and luciferase reporter assays showed that LAMB3 was directly regulated by miR-218. Silencing study of LAMB3 demonstrated significant inhibition of cell migration and invasion. In clinical specimens with HNSCC, the expression levels of laminin-332 were significantly upregulated in cancer tissues compared to adjacent non-cancerous tissues. Our analysis data showed that tumor suppressive miR-218 contributes to cancer cell migration and invasion through regulating focal adhesion pathway, especially laminin-332. Tumor suppressive miRNA-mediated novel cancer pathways provide new insights into the potential mechanisms of HNSCC oncogenesis. PMID:23159910

  3. Binding properties of the cerebral α4β2 nicotinic acetylcholine receptor ligand 2-[18F]fluoro-A-85380 to plasma proteins

    International Nuclear Information System (INIS)

    Introduction: To determine the availability of nicotinic acetylcholine receptors in different human brain regions using the positron emission tomography (PET) radioligand 2-[18F]fluoro-A-85380 (2-[18F]FA) and invasive approaches for quantification, it is important to correct the arterial input function as well for plasma protein binding (PPB) of the radioligand as for radiolabeled metabolites accumulating in blood. This study deals with some aspects of PPB of 2-[18F]FA. Methods: Patients with different neurological disorders (n=72), such as Parkinson's disease, Alzheimer's disease and multiple sclerosis, and a group of healthy volunteers (n=15) subjected for PET imaging were analyzed for their PPB level of 2-[18F]FA using ultrafiltration. Protein gel electrophoresis of plasma samples was performed to identify the binding protein of 2-[18F]FA. The dependency of PPB on time and on free ligand concentration was analyzed to obtain the binding parameters B max and K d. Results: Albumin was identified to be the binding protein of 2-[18F]FA. PPB of 2-[18F]FA was low at 17±4% and did not show significant differences between the groups of patients. Corresponding to this, a narrow range of plasma albumin of 0.62±0.05 mM was observed. B max was determined as twice the albumin concentration, which indicates two binding sites for 2-[18F]FA on the protein. No time dependence of the PPB could be observed. By relating PPB to B max, an average K d value of 6.0±1.5 mM was obtained. Conclusion: This study shows the dependency of PPB of 2-[18F]FA on human albumin plasma concentration. An equation utilizing B max and K d to easily estimate PPB is presented

  4. Whole-body distribution and dosimetry of O-(2-[18F]fluoroethyl)-l-tyrosine

    International Nuclear Information System (INIS)

    The whole-body distribution of O-(2-[18F]fluoroethyl)-l-tyrosine (FET) was studied in seven patients with brain tumours by positron emission tomography (PET). Based on the IMEDOSE and MIRDOSE procedures, radiation absorbed doses were estimated from whole-body PET scans acquired approximately 70 and 200 min after i.v. injection of 400 MBq FET. After injection of FET, the peak of radioactivity in the blood was observed after 1.5 min, and a plateau of nearly constant radioactivity was reached at 20 min. The whole-body distribution of FET showed the highest activities in the urinary tract. All other organs exhibited only moderate FET uptake (SUV ≤1.6) which remained constant between early and late PET scans. No increased uptake was seen in the bone, the biliary tract or the pancreas. Twenty-two percent of the injected activity was excreted 5 h p.i. (approx. 5.3% ID/h). The highest absorbed dose was found for the urinary bladder wall. The effective dose according to ICRP 60 was 16.5 μSv/MBq for adults, which would lead to an effective dose of 6.1 mSv in a PET study using 370 MBq FET. (orig.)

  5. Measurement of the activity size distribution of the polonium-218 under laboratory conditions

    International Nuclear Information System (INIS)

    A number of investigators have reported the formation of the radiolytic ultrafine particles produced by the interaction of ionizing radiation with water vapor. Previous studies have suggested that a very high localized concentration of the OH radical produced by the radiolysis of water can react with trace gas like organic vapors and produce lower vapor pressure compounds that can then nucleate. In order to determine water vapor and trace gas dependence of the active, positive-charged, first radon daughter, an experiment was conducted using a radon chamber. The activity size distribution of the radon daughter in the range of 0.5 - 100 nm was measured using the stacked wire screens sampler. Measurements were taken for different relative humidity. The resultant activity size distributions were analyzed. The addition of water vapor to the radon carrier gases resulted in the formation of ultrafine particles by OH radicals formed radon radiolysis. It may be due to the neutralization of charged Po-218 ion with water vapor through the radiolysis

  6. Measurement of initial clustering on the radon decay product 218Po

    International Nuclear Information System (INIS)

    The formation of water clusters on 218Po ions is studied. The formation of the water clusters is discussed in the light of the classical theory of clustering, the clustering theory of Hawrynski and a kinetic model of clustering. The design of a specialized electric mobility spectrometer to measure the electric mobilities of the water clusters at various humidity levels is discussed. From the mobilities the radii of, and a number of water molecules in, the clusters are calculated using kinetic gas theory. The determinations were done for humidity levels between 0,16 and 96% relative humidity, and the results compared with the theoretical predictions. It was found that the classical theory underestimates the sizes of the clusters and the theory of Hawrynski overestimates the cluster sizes. It is concluded that the spectrometer is capable of high resolution measurement of the electric mobility of the small clusters. The underlying result of the clustering theories is that stable clusters with particular radii are formed at each humidity level. 91 refs., 70 figs., 11 tabs

  7. Assessment of wire and tube penetration theories using a 218PoOx cluster aerosol

    International Nuclear Information System (INIS)

    Diffusion samplers are commonly used for the measurement of aerosol size distributions (dpp: 0.5-3 nm, such as those associated with radon decay products. The methods have relied upon the Cheng-Yeh wire screen penetration theory [Cheng, Y.S. and Yeh, H.C. (1980) J. Aerosol Sci. ll, 313.] that has been verified for particle sizes dp>3.5-4 nm. The validity of the theory in the ultrafine cluster size range has been assumed. In this study, a well-defined 218PoOx cluster aerosol Davg=0.078±0.0003 cm2s-1 (dp ≅ 0.6 nm) was generated for an assessment of the wire screen penetration theory for two low mesh number wire screens. The results indicated good agreement with the theory, within the domain of its underlying assumptions. In addition, a theoretical expression developed by Ingham [Ingham, D.B. (1975) J. Aerosol Sci. 6, 125.] for uniform flow tube penetration was investigated using the cluster aerosol for its applicability in the estimation of diffusional losses in the entrance of a tube. (author)

  8. Familial Dysalbuminemic Hyperthyroxinemia in a Japanese Man Caused by a Point Albumin Gene Mutation (R218P)

    Science.gov (United States)

    Osaki, Yoshinori; Hayashi, Yoshitaka; Nakagawa, Yoshinori; Yoshida, Katsumi; Ozaki, Hiroshi; Fukazawa, Hiroshi

    2016-01-01

    Familial dysalbuminemic hyperthyroxinemia (FDH) is a familial autosomal dominant disease caused by mutation in the albumin gene that produces a condition of euthyroid hyperthyroxinemia. In patients with FDH, serum-free thyroxine (FT4) and free triiodothyronine (FT3) concentrations as measured by several commercial methods are often falsely increased with normal thyrotropin (TSH). Therefore, several diagnostic steps are needed to differentiate TSH-secreting tumor or generalized resistance to thyroid hormone from FDH. We herein report a case of a Japanese man born in Aomori prefecture, with FDH caused by a mutant albumin gene (R218P). We found that a large number of FDH patients reported in Japan to date might have been born in Aomori prefecture and have shown the R218P mutation. In conclusion, FDH needs to be considered among the differential diagnoses in Japanese patients born in Aomori prefecture and showing normal TSH levels and elevated FT4 levels. PMID:27081329

  9. Fourier transform measurements of H218O and HD18O in the spectral range 1000-2300 cm-1

    International Nuclear Information System (INIS)

    The spectra of water vapor enriched by 18O were recorded in the 1000-2300 cm-1 spectral range, which corresponds to the spectral region studied by IASI instrument (Infrared Atmospheric Sounding Spectrometer) instrument. The spectra were recorded by a step by step Fourier Transform Spectrometer (FTS) at room temperature with absorption path lengths up to 36 m. Positions, intensities and self broadening coefficients of about 1800 lines of H218O and 900 of HD18O were analyzed and all the transitions were assigned. This paper focuses on lines intensities and comparisons with data from literature are presented. An average difference of 10% with HITRAN2008 database H218O line intensities is found with a maximum discrepancy of about 25% for the ν1-ν2 band.

  10. LED-based Fourier transform spectroscopy of H218O in the 15,000-16,000 cm-1 range

    Science.gov (United States)

    Mikhailenko, S. N.; Serdyukov, V. I.; Sinitsa, L. N.

    2015-05-01

    The spectrum of Н218О has been recorded between 15,000 and 16,000 cm-1 by a Fourier transform spectrometer with spectral resolutions of 0.03 cm-1 and 0.05 cm-1 using high luminance LED light sources and a 60-cm multipath cell with a path length of 1920 and 3480 cm. A high signal-to-noise ratio (S/N=10,000) enabled us to register more than 1500 water vapor lines with intensities 1.0×10-27 to 2.2×10-24 cm/molecule at 296 K. 426 rotational-vibrational levels of the H218O molecule were assigned to eleven vibrational states: (014), (033), (052), (113), (132), (151), (212), (231), (311), (330) and (410). 72 Rotational-vibrational levels of the H217O molecule were assigned to six vibrational states: (014), (033), (113), (212), (311) and (410). An extended set of H218O transitions in the 15,000-16,000 cm-1 range was generated using the obtained energy level list and the results of a variational intensity calculation.

  11. Rapid Filament Supramolecular Chirality Reversal of HET-s (218-289) Prion Fibrils Driven by pH Elevation.

    Science.gov (United States)

    Shanmugasundaram, Maruda; Kurouski, Dmitry; Wan, William; Stubbs, Gerald; Dukor, Rina K; Nafie, Laurence A; Lednev, Igor K

    2015-07-01

    Amyloid fibril polymorphism is not well understood despite its potential importance for biological activity and associated toxicity. Controlling the polymorphism of mature fibrils including their morphology and supramolecular chirality by postfibrillation changes in the local environment is the subject of this study. Specifically, the effect of pH on the stability and dynamics of HET-s (218-289) prion fibrils has been determined through the use of vibrational circular dichroism (VCD), deep UV resonance Raman, and fluorescence spectroscopies. It was found that a change in solution pH causes deprotonation of Asp and Glu amino acid residues on the surface of HET-s (218-289) prion fibrils and triggers rapid transformation of one supramolecular chiral polymorph into another. This process involves changes in higher order arrangements like lateral filament and fibril association and their supramolecular chirality, while the fibril cross-β core remains intact. This work suggests a hypothetical mechanism for HET-s (218-289) prion fibril refolding and proposes that the interconversion between fibril polymorphs driven by the solution environment change is a general property of amyloid fibrils. PMID:26023710

  12. Line lists for H218O and H217O based on empirical line positions and ab initio intensities

    International Nuclear Information System (INIS)

    New line lists for isotopically substituted water are presented. Most line positions were calculated from experimentally determined energy levels, while all line intensities were computed using an ab initio dipole moment surface. Transitions for which experimental energy levels are unavailable use calculated line positions. These line lists cover the range 0.05-20 000 cm-1 and are significantly more complete and potentially more accurate than the line lists available via standard databases. All lines with intensities (scaled by isotopologue abundance) greater than 10-29 cm/molecule at 296 K are included, augmented by weaker lines originating from pure rotational transitions. The final line lists contain 39 918 lines for H218O and 27 546 for H217O and are presented in standard HITRAN format. The number of experimentally determined H218O and H217O line positions is, respectively, 32 970 (83% of the total) and 17 073 (62%) and in both cases the average estimated uncertainty is 2×10-4 cm-1. The number of ab initio line intensities with an estimated uncertainty of 1% is 16 621 (42%) for H218O and 13 159 (48%) for H217O.

  13. A simplified method for the measurement of nonmetabolized 2-[18F]F-A-85380 in blood plasma using solid-phase extraction

    International Nuclear Information System (INIS)

    Quantification of α4β2* nicotinic acetylcholine receptors using 2-[18F]fluoro-3-(2(S)-azetidinylmethoxy)pyridine (2-[18F]FA) and positron emission tomography (PET) imaging requires measurement of nonmetabolized radioligand in blood plasma, which was previously accomplished using high-performance liquid chromatography (HPLC). Here, we introduce a one-step solid-phase extraction (SPE) method for measuring the concentration of nonmetabolized 2-[18F]FA. This method allows many samples to be processed in a short period of time. SPE effectively separated 2-[18F]FA from radioactive metabolites typically observed in blood plasma after administration of radioligand in humans. Measurements of the 2-[18F]FA parent fraction in healthy human volunteers obtained using the SPE method were nearly identical to those obtained using HPLC (1.3±5% average underestimation of SPE), and reproducibility was good within and between runs (2% and 6% coefficient of variation, respectively). SPE recovery of 2-[18F]FA from blood plasma was not appreciably diminished (3±0.6%) by a larger volume of blood plasma loaded onto the cartridge, suggesting the possibility of increasing the plasma sample volume at later times in a PET study to improve measurement sensitivity. 2-[18F]FA was stable in blood stored on ice over 8 h and in saline at low concentrations (18F]FA in healthy human volunteers were estimated as 4.2±0.8 h and 220±70 L, respectively. These results suggest that SPE is the method of choice for the determination of the plasma 2-[18F]FA concentration when measurement of individual metabolites is not required

  14. MnBr2/18-crown-6 coordination complexes showing high room temperature luminescence and quantum yield.

    Science.gov (United States)

    Hausmann, David; Kuzmanoski, Ana; Feldmann, Claus

    2016-04-12

    The reaction of manganese(ii) bromide and the crown ether 18-crown-6 in the ionic liquid [(n-Bu)3MeN][N(Tf)2] under mild conditions (80-130 °C) resulted in the formation of three different coordination compounds: MnBr2(18-crown-6) (), Mn3Br6(18-crown-6)2 () and Mn3Br6(18-crown-6) (). In general, the local coordination and the crystal structure of all compounds are driven by the mismatch between the small radius of the Mn(2+) cation (83 pm) and the ring opening of 18-crown-6 as a chelating ligand (about 300 pm). This improper situation leads to different types of coordination and bonding. MnBr2(18-crown-6) represents a molecular compound with Mn(2+) coordinated by two bromine atoms and only five oxygen atoms of 18-crown-6. Mn3Br6(18-crown-6)2 falls into a [MnBr(18-crown-6)](+) cation - with Mn(2+) coordinated by six oxygen atoms and Br - and a [MnBr(18-crown-6)MnBr4](-) anion. In this anion, Mn(2+) is coordinated by five oxygen atoms of the crown ether as well as by two bromine atoms, one of them bridging to an isolated (MnBr4) tetrahedron. Mn3Br6(18-crown-6), finally, forms an infinite, non-charged [Mn2(18-crown-6)(MnBr6)] chain. Herein, 18-crown-6 is exocyclically coordinated by two Mn(2+) cations. All compounds show intense luminescence in the yellow to red spectral range and exhibit remarkable quantum yields of 70% (Mn3Br6(18-crown-6)) and 98% (Mn3Br6(18-crown-6)2). The excellent quantum yield of Mn3Br6(18-crown-6)2 and its differentiation from MnBr2(18-crown-6) and Mn3Br6(18-crown-6) can be directly correlated to the local coordination. PMID:26956783

  15. Imaging of central nAChReceptors with 2-[18F]F-A85380: optimized synthesis and in vitro evaluation in Alzheimer's disease

    International Nuclear Information System (INIS)

    In vivo labeling of the nicotinic acetylcholine receptors (nAChR) could be a useful tool for early diagnosis of neurodegenerative disorders. 2-[18F]F-A85380 (2-[18F]Fluoro-3-[2(S)-2-azetidinylmethoxy]pyridine), a ligand with high affinity to the β2 subunit of the nAChRs, has been shown to label neurons in the nAChR-rich thalamus, cortex and striatum in baboons. We report an optimized synthesis resulting in an uncorrected yield of 58% in 45 min (precursor 2), enabling efficient production intended for clinical use. Incubation of normal rat brain sections with 2-[18F]F-A85380 with subsequent autoradiographic analyses showed the expected distribution in nAChR areas. In human brain sections of Alzheimer's disease (AD) a decrease of 2-[18F]F-A85380 uptake to 36% of the control group was measured in the thalamus and also in the occipital cortex. These findings suggest that 2-[18F]F-A85380 is a promising PET-ligand in the diagnosis of AD

  16. Spatially extended absorption around the z=2.63 radio galaxy MRC 2025-218: outflow or infall?

    CERN Document Server

    Humphrey, A; Sánchez, S F; Alighieri, S di Serego; De Breuck, C; Binette, L; Tadhunter, C; Vernet, J; Fosbury, R; Stasielak, J

    2008-01-01

    We present an investigation into the absorber in front of the z=2.63 radio galaxy MRC 2025-218, using integral field spectroscopy obtained at the Very Large Telescope, and long slit spectroscopy obtained at the Keck II telescope. The properties of MRC 2025-218 are particularly conducive to study the nature of the absorbing gas, i.e., this galaxy shows bright and spatially extended Ly-alpha emission, along with bright continuum emission from the active nucleus. Ly-alpha absorption is detected across ~40x30 kpc^2, has a covering factor of ~1, and shows remarkably little variation in its properties across its entire spatial extent. This absorber is kinematically detached from the extended emission line region (EELR). Its properties suggest that the absorber is outside of the EELR. We derive lower limits to the HI, HII and H column densities for this absorber of 3x10^16, 7x10^17 and 2x10^18 cm^-2, respectively. Moreover, the relatively bright emission from the active nucleus has allowed us to measure a number of ...

  17. The First Circumstellar Disk Imaged in Silhouette with Adaptive Optics: MagAO Imaging of Orion 218-354

    CERN Document Server

    Follette, Katherine B; Males, Jared R; Kopon, Derek; Wu, Ya-Lin; Morzinski, Katie M; Hinz, Philip; Rodigas, Timothy J; Puglisi, Alfio; Esposito, Simone; Riccardi, Armando; Pinna, Enrico; Xompero, Marco; Briguglio, Runa

    2013-01-01

    We present high resolution adaptive optics (AO) corrected images of the silhouette disk Orion 218-354 taken with Magellan AO (MagAO) and its visible light camera, VisAO, in simultaneous differential imaging (SDI) mode at H-alpha. This is the first image of a circumstellar disk seen in silhouette with adaptive optics and is among the first visible light adaptive optics results in the literature. We derive the disk extent, geometry, intensity and extinction profiles and find, in contrast with previous work, that the disk is likely optically-thin at H-alpha. Our data provide an estimate of the column density in primitive, ISM-like grains as a function of radius in the disk. We estimate that only ~10% of the total sub-mm derived disk mass lies in primitive, unprocessed grains. We use our data, Monte Carlo radiative transfer modeling and previous results from the literature to make the first self-consistent multiwavelength model of Orion 218-354. We find that we are able to reproduce the 1-1000micron SED with a ~2...

  18. Synthesis of 2-[18F]fluoro-2-deoxy-L-glucose and positron emission tomography studies in monkeys

    International Nuclear Information System (INIS)

    2-[18F]Fluoro-2-deoxy-L-glucose was synthesized from its trifluoromethanesulfonyl precursor. The precursor was prepared by selective acetylation and triflation of L-mannose. L-Mannose was first treated with acetic anhydride in the presence of a catalytic amount of perchloric acid and then reacted with phosphorus tribromide followed by aqueous sodium acetate to produce pure 1,3,4,6-tetra-O-acetyl-a-L-mannopyranose in 32% yield. This compound was treated with trifluoromethanesulfonic anhydride and pyridine in methylene chloride to form 1,3,4,6-tetra-O-acetyl-2-O-trifluoromethanesulfonyl-a-L-mannopyranose in 77% yield. Nucleophilic substitution of the triflate with 18F- in the presence of Kryptofix 2.2.2. followed by acid hydrolysis produced 2-[18F]fluoro-2-deoxy-L-glucose with a radiochemical yield of 20-30% (EOS) within 90 min. Biodistribution studies in rats and PET imaging in Rhesus monkeys demonstrated that this sugar analog distributes in the extracellular space of most organs but is excluded from the CNS. (author)

  19. Radiation and chemical stability of 2-deoxy-2-[18F]fluoro-D-glucose radiopharmaceutical. Author-review of thesis

    International Nuclear Information System (INIS)

    A qualitative and quantitative analytical technique of low-molecular components of chemical and radiation-chemical decomposition of 2-deoxy-2-[18F]fluoro-D-glucose, 2-[18F]FDG radiopharmaceutical was developed for its extended quality control by HPLC with mass-spectrometric electro-spray ionisation detector (ESI MS). The analysis constituted from the liquid chromatography on silica gel NH2 bonded column combined with mass-spectrometric, UV-VIS, refraction index and radiometric detectors. A modern LC/MS system (Agilent 1100) was demonstrated to be suitable not only for identification of unknown analytes, but also for complex analysis of solutes except [18F]F-. This was advantageous for the 2-[18F]FDG autoradiolysis assessment about which no data were published. For comparative purposes, were used a classic thin layer chromatography (TLC) on silica gel with mobile phase acetonitril: water at 95:5 v/v, and HPTLC on NH2 modified silica gel like the LC column. Mobile phase was identical as by LC/MS method (acetonitril: 4 mM aqueous solution of ammonium formate 80:20 v/v). Retention times of reference samples: fluorodeoxyglucose, glucose, mannose, arabinose, deoxyglucose, gluconic and glucuronic acids at HPLC were established. Optimal performance of the ESI MS detector was discovered in negative ions mode or single ion monitoring (SIM) regime. The most intensive signal was observed for all analyte molecules association with formate anion HCOO- and also for negative ions of deprotonised molecules. All acids appeared in the form of their lactones. FDG and Glc exhibited tendency for formation of a mixed associate charged by HCOO- anion. On the amine bond silica gel HPTLC column, FDG is poorly separated from fluoride, which even in presence of Kryptofix 2.2.2 remains on the start like on the silica gel layer. At LC-MS Kryptofix provides a very well measurable signals of associates with NH4+ a H+ ions in positive mode of ESI MS. Concentration of (19F)FDG carrier in 2-[18F

  20. 节能BCD-248/H、BCD-218/H电冰箱的研究开发%Research and development the super energy- saving fridge BCD-218/H and BCD-248/H

    Institute of Scientific and Technical Information of China (English)

    赵先美

    2002-01-01

    运用项目管理方法及ERA电冰箱分析设计软件来科学决策BCD-248/H、BCD-218/H超级节能冰箱的开发设计方案,对采用压缩机、发泡层厚度、门封结构、门一体发泡、电子温控及数显、采用二位三通电磁阀及制冷系统最优化设计等进行了详细的经济技术分析,根据成本与性能综合最优化原则确定了上述两种冰箱的开发设计方案,据此开发出的样机总体能效水平处于国内领先水平.

  1. Astatination of closo-dodecaborate(2-) anion

    Czech Academy of Sciences Publication Activity Database

    Orlova, A.; Lebeda, Ondřej; Tolmachev, V.; Lundquist, H.; Carlsson, J.; Sjöberg, S.

    Cambridge : The Royal Society of Chemistry , 2000 - (Davidson, M.; Hughes, A.; Marder, T.; Wade , K.), s. 144-147 [Conference "Contemporary Boron Chemistry ". Durham (GB), 11.07.1999-15.07.1999] Institutional research plan: CEZ:AV0Z1048901 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  2. Estimating the Nucleotide Diversity in Ceratodon purpureus (Ditrichaceae from 218 Conserved Exon-Primed, Intron-Spanning Nuclear Loci

    Directory of Open Access Journals (Sweden)

    Stuart F. McDaniel

    2013-04-01

    Full Text Available Premise of the study: We developed and tested primers for 218 nuclear loci for studying population genetics, phylogeography, and genome evolution in bryophytes. Methods and Results: We aligned expressed sequence tags (ESTs from Ceratodon purpureus to the Physcomitrella patens genome sequence, and designed primers that are homologous to conserved exons but span introns in the P. patens genome. We tested these primers on four isolates from New York, USA; Otavalo, Ecuador; and two laboratory isolates from Austria (WT4 and GG1. The median genome-wide nucleotide diversity was 0.008 substitutions/site, but the range was large (0–0.14, illustrating the among-locus heterogeneity in the species. Conclusions: These loci provide a valuable resource for finely resolved, genome-wide population genetic and species-level phylogenetic analyses of C. purpureus and its relatives.

  3. Erratum; A Three-Position Spectral Line Survey of Sagittarius B2 between 218 and 263 GHz. II. Data Analysis

    Science.gov (United States)

    Nummelin, A.; Bergman, P.; Hjalmarson, Å.; Friberg, P.; Irvine, W. M.; Millar, T. J.; Ohishi, M.; Saito, S.

    2001-01-01

    In the paper ``A Three-Position Spectral Line Survey of Sagittarius B2 between 218 and 263 GHz. II. Data Analysis'' by A. Nummelin, P. Bergman, Å. Hjalmarson, P. Friberg, W. M. Irvine, T. J. Millar, M. Ohishi, and S. Saito (ApJS, 128, 213 [2000]), the affiliations for M. Ohishi and S. Saito were set incorrectly. The correct affiliation for M. Ohishi is National Astronomical Observatory of Japan, 2-21-1, Osawa, Mitaka, Tokyo 181-8588, Japan; ohishi@nao.ac.jp. The correct affiliation for S. Saito is Research Center for Development of Far-Infrared Region, Fukui University, 3-9-1 Bunkyo, Fukui 901-8507, Japan; saito@maxwell.apphy.fukui-u.ac.jp. The Press sincerely regrets this error.

  4. Environmental assessment for Trench 33 widening in 218-W-5 Low-Level Burial Ground, Hanford Site, Richland, Washington

    International Nuclear Information System (INIS)

    This environmental assessment (EA) has been prepared to assess potential environmental impacts associated with the US Department of Energy''s proposed action: to widen and operated the unused Trench 33 in the 218-W-5 Low-Level Burial Ground. Information contained herein will be used by the US Department of Energy, Richland Operations Office Manager, to determine if the Proposed Action is a major federal action significantly affecting the quality of the human environment. If the Proposed Action is determined to be major and significant, an environmental impact statement will be prepared. If the Proposed Action is determined not to be major and significant, a Finding of No significant Impact will be issued and the action may proceed

  5. 75 FR 32773 - Auction of 218-219 MHz Service and Phase II 220 MHz Service Licenses Scheduled for December 7...

    Science.gov (United States)

    2010-06-09

    ... and impede the deployment of service to the public, and an additional default payment of more than... COMMISSION Auction of 218-219 MHz Service and Phase II 220 MHz Service Licenses Scheduled for December 7... overnight U.S. Postal Service mail. All filings must be addressed to the Commission's Secretary, Attn:...

  6. Prediction of outcome in head-and-neck cancer patients using the standardized uptake value of 2-[18F]fluoro-2-deoxy-D-glucose

    OpenAIRE

    Allal, Abdelkarim Said; Slosman, Daniel O.; Kebdani, Tayeb; Allaoua, Mohamed Ghoulem; Lehmann, Willy; Dulguerov, Pavel

    2004-01-01

    Tumor uptake of 2-[(18)F] fluoro-2-deoxy-D-glucose (FDG) may relate to outcome in cancer patients. Pretreatment FDG uptake was evaluated as a predictor of local control (LC) and disease-free survival (DFS) in patients with head-and-neck cancer managed primarily either by radiotherapy (RT) or surgery.

  7. MiR-495 and miR-218 regulate the expression of the Onecut transcription factors HNF-6 and OC-2

    Energy Technology Data Exchange (ETDEWEB)

    Simion, Alexandru; Laudadio, Ilaria; Prevot, Pierre-Paul; Raynaud, Peggy; Lemaigre, Frederic P. [Universite catholique de Louvain, de Duve Institute, 75 Avenue Hippocrate 7529, B-1200 Brussels (Belgium); Jacquemin, Patrick, E-mail: patrick.jacquemin@uclouvain.be [Universite catholique de Louvain, de Duve Institute, 75 Avenue Hippocrate 7529, B-1200 Brussels (Belgium)

    2010-01-01

    MicroRNAs are small, non-coding RNAs that posttranscriptionally regulate gene expression mainly by binding to the 3'UTR of their target mRNAs. Recent data revealed that microRNAs have an important role in pancreas and liver development and physiology. Using cloning and microarray profiling approaches, we show that a unique repertoire of microRNAs is expressed at the onset of liver and pancreas organogenesis, and in pancreas and liver at key stages of cell fate determination. Among the microRNAs that are expressed at these stages, miR-495 and miR-218 were predicted to, respectively, target the Onecut (OC) transcription factors Hepatocyte Nuclear Factor-6 (HNF-6/OC-1) and OC-2, two important regulators of liver and pancreas development. MiR-495 and miR-218 are dynamically expressed in developing liver and pancreas, and by transient transfection, we show that they target HNF-6 and OC-2 3'UTRs. Moreover, when overexpressed in cultured cells, miR-495 and miR-218 decrease the endogenous levels of HNF-6 and OC-2 mRNA. These results indicate that the expression of regulators of liver and pancreas development is modulated by microRNAs. They also suggest a developmental role for miR-495 and miR-218.

  8. MiR-495 and miR-218 regulate the expression of the Onecut transcription factors HNF-6 and OC-2

    International Nuclear Information System (INIS)

    MicroRNAs are small, non-coding RNAs that posttranscriptionally regulate gene expression mainly by binding to the 3'UTR of their target mRNAs. Recent data revealed that microRNAs have an important role in pancreas and liver development and physiology. Using cloning and microarray profiling approaches, we show that a unique repertoire of microRNAs is expressed at the onset of liver and pancreas organogenesis, and in pancreas and liver at key stages of cell fate determination. Among the microRNAs that are expressed at these stages, miR-495 and miR-218 were predicted to, respectively, target the Onecut (OC) transcription factors Hepatocyte Nuclear Factor-6 (HNF-6/OC-1) and OC-2, two important regulators of liver and pancreas development. MiR-495 and miR-218 are dynamically expressed in developing liver and pancreas, and by transient transfection, we show that they target HNF-6 and OC-2 3'UTRs. Moreover, when overexpressed in cultured cells, miR-495 and miR-218 decrease the endogenous levels of HNF-6 and OC-2 mRNA. These results indicate that the expression of regulators of liver and pancreas development is modulated by microRNAs. They also suggest a developmental role for miR-495 and miR-218.

  9. 31 CFR 585.218 - Trade in United Nations Protected Areas of Croatia and those areas of the Republic of Bosnia and...

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Trade in United Nations Protected... HERZEGOVINA SANCTIONS REGULATIONS Prohibitions § 585.218 Trade in United Nations Protected Areas of Croatia... importation from, exportation to, or transshipment of goods through the United Nations Protected Areas in...

  10. Dynamic 2-[18F]fluoro-2-deoxy-D-glucose positron emission tomography of liver tumours without blood sampling

    DEFF Research Database (Denmark)

    Keiding, S; Munk, O L; Schiøtt, K M;

    2000-01-01

    Positron emission tomography (PET) using 2-[18F]fluoro-2-deoxy-D-glucose (FDG) is a useful diagnostic tool for the detection of tumours. Using dynamic FDG PET, net metabolic clearance of FDG, K, can be calculated by Gjedde-Patlak analysis of the time course of the radioactivity concentrations in...

  11. [18F]norchlorofluorohomoepibatidine. Synthesis, radiosynthesis, evaluation in vitro and comparison with 2-[18F]fluoro-A-85380 in mice

    International Nuclear Information System (INIS)

    In this abstract we describe synthesis, radiosynthesis and biological evalution of both stereoisomers of NCFHEB (norchlorofluorohomoepibatidine) and compare the biodistribution data with 2-[18F]fluoro-A-85380, a tracer currently used for imaging nicotinic receptors with PET. (orig.)

  12. Downregulation of miR-185 and upregulation of miR-218 expression may be potential diagnostic and prognostic biomarkers of human chondrosarcoma.

    Science.gov (United States)

    Goudarzi, Peyman Karimi; Taheriazam, Afshin; Asghari, Saeid; Jamshidi, Mohammad; Shakeri, Mohammadreza; Yahaghi, Emad; Mirghasemi, Alireza

    2016-05-01

    Increasing evidence has confirmed that dysregulation of microRNAs (miRNAs) can contribute to the progression and metastasis of human tumors. Chondrosarcoma is the most common primary malignant bone tumor in adults and has no effective systemic treatment, and patients with this disease have poor survival. Thus, it is important to find new diagnostic markers and improve treatment options. In the current study, we are interested to examine the role of miR-185 and miR-218 expression in patients with chondrosarcoma using real-time PCR. Moreover, the association of the two miRNAs with clinicopathological features and prognosis was evaluated. Survival and Cox proportional hazards analyses were performed to find the association of miR-185 expression and miR-218 levels with prognosis in the patients. Our results indicated that the miR-185 expression was significantly downexpressed in clinical chondrosarcoma bone tissues compared with adjacent normal tissues (P = 0.001). MiR-218 expression level was increased in clinical chondrosarcoma bone tissue than those adjacent normal tissues (P = 0.001). Decreased expression of miR-185 showed remarkable correlation with advanced tumor stage (P = 0.019), tumor grade (P < 0.001), and distant metastasis (P = 0.001). Moreover, high expression of miR-218 was strongly correlated with advanced tumor stage (P = 0.014), tumor grade (P < 0.001), and distant metastasis (P = 0.002). Kaplan-Meier survival analysis revealed that the low miR-185 expression group and the high miR-218 expression group had remarkably shorter overall survival (log-rank test P = 0.007, P = 0.004). The multivariate Cox proportional hazards model indicated that decreased expression of miR-185 and increased expression of miR-218 (P = 0.017, P = 0.012), advanced tumor stage (P = 0.006, P = 0.012), tumor grade (P = 0.032, P = 0.016), and distant metastasis (P = 0.004, P = 0.015) were independently related

  13. A Tape Method for Fast Characterization and Identification of Active Pharmaceutical Ingredients in the 2-18 THz Spectral Range

    Science.gov (United States)

    Kissi, Eric Ofosu; Bawuah, Prince; Silfsten, Pertti; Peiponen, Kai-Erik

    2015-03-01

    In order to find counterfeit drugs quickly and reliably, we have developed `tape method' a transmission spectroscopic terahertz (THz) measurement technique and compared it with a standard attenuated total reflection (ATR) THz spectroscopic measurement. We used well-known training samples, which include commercial paracetamol and aspirin tablets to check the validity of these two measurement techniques. In this study, the spectral features of some active pharmaceutical ingredients (APIs), such as aspirin and paracetamol are characterized for identification purpose. This work covers a wide THz spectral range namely, 2-18 THz. This proposed simple but novel technique, the tape method, was used for characterizing API and identifying their presence in their dosage forms. By comparing the spectra of the APIs to their dosage forms (powder samples), all distinct fingerprints present in the APIs are also present in their respective dosage forms. The positions of the spectral features obtained with the ATR techniques were akin to that obtained from the tape method. The ATR and the tape method therefore, complement each other. The presence of distinct fingerprints in this spectral range has highlighted the possibility of developing fast THz sensors for the screening of pharmaceuticals. It is worth noting that, the ATR method is applicable to flat faced tablets whereas the tape method is suitable for powders in general (e.g. curved surface tablets that require milling before measurement). Finally, we have demonstrated that ATR techniques can be used to screen counterfeit antimalarial tablets.

  14. Novel application of 2-[18F]fluoro-2-deoxy-D-glucose to study plant defenses

    International Nuclear Information System (INIS)

    Introduction: Since its first use in humans in 1976, 2-[18F]fluoro-2-deoxy-D-glucose (18FDG) continues to serve as a tracer to measure tissue glucose metabolism in medical imaging. Here we demonstrate a novel use for this tracer to study glycoside biosynthesis in plants as a measure of plant response to defense induction. Methods: Coupling autoradiography with radio high-performance liquid chromatography analysis of tissue extracts, we examined the combined effects of leaf wounding and treatment using the potent plant defense hormone, methyl jasmonate (MeJA), to measure tracer distribution and tracer use in secondary defense chemistry in Arabidopsis thaliana. We hypothesized that competing sinks like roots and reproductive tissues, as well as vascular architecture, would impact the induction of phenolic defenses of the plant that make use of glucose in glycoside formation by altering distribution and metabolic utilization of 18FDG. Results: Our studies showed that leaf orthostichy defined the major route of 18FDG transport in both vegetative and reproductive plants when a single petiole was cut as the entry point for tracer introduction. However, when nonorthostichous leaves were damaged and treated with MeJA, 18FDG was transported in its intact form to these leaves 3 h later, where it was incorporated into phenolic glycosides. Conclusions: Our work demonstrates a new use for 18FDG in plant science with insights into carbohydrate allocation that contradict conclusions of previous studies showing transport of resources away from damaged sites.

  15. Biodegradation and surfactant-mediated biodegradation of diesel fuel by 218 microbial consortia are not correlated to cell surface hydrophobicity

    Energy Technology Data Exchange (ETDEWEB)

    Owsianiak, Mikolaj; Szulc, Alicja; Chrzanowski, Lukasz; Bogacki, Mariusz [Poznan Univ. of Technology (Poland). Inst. of Chemical Technology and Engineering; Cyplik, Pawel; Olejnik-Schmidt, Agniezka K. [Poznan Univ. of Life Sciences (Poland). Dept. of Biotechnology and Food Microbiology; Heipieper, Hermann J. [Helmholtz Centre for Environmental Research - UFZ, Leipzig (Germany). Dept. of Environmental Biotechnology

    2009-09-15

    In this study, we elucidated the role of cell surface hydrophobicity (microbial adhesion to hydrocarbons method, MATH) and the effect of anionic rhamnolipids and nonionic Triton X-100 surfactants on biodegradation of diesel fuel employing 218 microbial consortia isolated from petroleum-contaminated soils. Applied enrichment procedure with floating diesel fuel as a sole carbon source in liquid cultures resulted in consortia of varying biodegradation potential and diametrically different cell surface properties, suggesting that cell surface hydrophobicity is a conserved parameter. Surprisingly, no correlations between cell surface hydrophobicity and biodegradation of diesel fuel were found. Nevertheless, both surfactants altered cell surface hydrophobicity of the consortia in similar manner: increased for the hydrophilic and decreased for the hydrophobic cultures. In addition to this, the surfactants exhibited similar influence on diesel fuel biodegradation: Increase was observed for initially slow-degrading cultures and the opposite for fast degraders. This indicates that in the surfactant-mediated biodegradation, effectiveness of surfactants depends on the specification of microorganisms and not on the type of surfactant. In contrary to what was previously reported for pure strains, cell surface hydrophobicity, as determined by MATH, is not a good descriptor of biodegrading potential for mixed cultures. (orig.)

  16. Elastic scattering for 16O + 12C at 140 MeV and 218 MeV

    International Nuclear Information System (INIS)

    In this work, angular distribution of cross sections have been measured for 12C(16O,16O)12C at two energies. The measurements were carried out in 0.50 intervals between 50-19.50C (lab.) at 140 MeV, 4.50-14.50 at 218 MeV. An optical model analysis of these strong structure angular distributions was done. Good fits of the data were obtained using the optical model search code GENOA with a full Woods-Saxon potential form. This yielded parameters subject to considerable ambiguities as it is known to occur for strongly absorbed particles. These ambiguities were explored in detail and it was found that both the real and the imaginary parts present some characteristics that have been found before for the real potential (as Igo relation for continous ambiguities and the fact that potentials with different diffusivities tend to have the same value at the strong absorption radii). It was found, among other results, that the real volume integral, the mean square radius, as well as the total reaction cross section (σsub(r)) cannot be determined unambiguously. A strong correlation was found between σsub(r) and the imaginary diffusivity. A systematic study of how the variation of the potential parameters affects the angular distribution is presented and some features of the diffraction structure of the angular distribution are discussed. (author)

  17. 2-deoxy-2-(18F)fluoro-D-glucose positron emission tomography/computed tomography imaging in paediatric oncology

    Institute of Scientific and Technical Information of China (English)

    John; Freebody; Eva; A; Wegner; Monica; A; Rossleigh

    2014-01-01

    Positron emission tomography(PET) is a minimally in-vasive technique which has been well validated for the diagnosis, staging, monitoring of response to therapy, and disease surveillance of adult oncology patients. Tra-ditionally the value of PET and PET/computed tomogra-phy(CT) hybrid imaging has been less clearly defined for paediatric oncology. However recent evidence has emerged regarding the diagnostic utility of these mo-dalities, and they are becoming increasingly important tools in the evaluation and monitoring of children with known or suspected malignant disease. Important indi-cations for 2-deoxy-2-(18F)fluoro-D-glucose(FDG) PET in paediatric oncology include lymphoma, brain tumours, sarcoma, neuroblastoma, Langerhans cell histiocytosis, urogenital tumours and neurofibromatosis type Ⅰ. This article aims to review current evidence for the use of FDG PET and PET/CT in these indications. Attention will also be given to technical and logistical issues, the description of common imaging pitfalls, and dosimetric concerns as they relate to paediatric oncology.

  18. Synthesis and evaluation of N-(2-[18F]fluoro-4-nitrobenzoyl)glucosamine. A preliminary report

    International Nuclear Information System (INIS)

    D-glucosamine at concentration of certain range could kill tumor cells without influencing normal cells. There are also some reports on the antitumor activity of d-glucosamine and its derivatives in murine models. It was therefore postulated that d-glucosamine might have the potential to invade tumor cells. We designed and radiosynthesized a glucosamine derivative, N-(2-[18F]fluoro-4-nitrobenzoyl)glucosamine ([18F]FNBG([18F]7)). Evaluations in vitro and in vivo were performed on tumor bearing mice. Excitingly, the radiochemical purity of [18F]FNBG([18F]7) was 99%, and besides the best radiochemical yield was up to 35%. The best T/Bl (Tumor/Blood) and T/M (Tumor/Muscle) ratios of [18F]FNBG([18F]7) were 4.40 and 4.84. Although [18F]FNBG([18F]7) deserved further studies, the results revealed it might become a potential PET imaging agent for detecting tumors. (author)

  19. Adduct of 2-[18F]FDG and 2-nitroimidazole as a putative radiotracer for the detection of hypoxia with PET: synthesis, in vitro- and in vivo-characterization

    International Nuclear Information System (INIS)

    A new sugar-coupled 2-nitroimidazole derivative ([18F]1) has been prepared in good radiochemical yields starting from peracetylated 2-[18F]FDG obtained from an automated 2-[18F]FDG production module. The corresponding glucose derivative 2 has proved to be able to inhibit 2-[18F]FDG uptake into tumor cells in a concentration dependent way. However, [18F]1 failed to show a retention in hypoxic tumor tissue thus excluding itself from further investigations

  20. Quantification of Kryptofix 2.2.2 in 2-[18F]FDG and other radiopharmaceuticals by LC/MS/MS

    International Nuclear Information System (INIS)

    A high-performance liquid chromatography-tandem mass spectrometric method (LC/MS/MS) was developed and validated for the quantitative analysis of Kryptofix (K-222) in the radiopharmaceuticals of 2-deoxy-2-[18F] fluoro-D-glucose (2-[18F]FDG) and 3-(3-((3-fluoropropyl)thio)-1,2,5-thiadiazol-4-yl)-1,2,5,6-tetrahydro -1-methylpyridine (FPTZTP). With an internal standard, the limit of quantitation for K-222 was 1.0 ng/ml. This is so far the most sensitive method for the quantification of K-222. Excellent linearity (RSQ=0.9997) was obtained over the range of 1.0-100 ng/ml. Good precision and accuracy were also observed. The method is amenable to the validation of radiosynthetic methods

  1. Collision-induced dissociation of Co+n (n=2--18) with Xe: Bond energies of cationic and neutral cobalt clusters, dissociation pathways, and structures

    International Nuclear Information System (INIS)

    The kinetic energy dependence of collision-induced dissociation (CID) of Co+n (n=2--18) with xenon is studied by using a guided ion beam mass spectrometer. Examination of the general dissociation behavior over a broad collision energy range shows that cobalt cluster cations dissociate exclusively by loss of single atoms (cluster ''evaporation''), with no evidence found for elimination of molecular cluster fragments. Bond dissociation energies for cobalt cluster cations, Co+n (n=2--18), are determined from measurements of the CID thresholds. Bond energies for neutral cobalt clusters, Con (n=4--18), are derived by combining these cationic bond energies with ionization energies for Con from the literature. The dependence of binding energy on cluster size is similar to that observed for iron clusters, and inspires some speculation regarding cluster ion structures

  2. Fiber Diffraction of the Prion-Forming Domain HET-s(218-289) Shows Dehydration-Induced Deformation of a Complex Amyloid Structure

    Energy Technology Data Exchange (ETDEWEB)

    Wan, William; Stubbs, Gerald [Vanderbilt

    2014-05-01

    Amyloids are filamentous protein aggregates that can be formed by many different proteins and are associated with both disease and biological functions. The pathogenicities or biological functions of amyloids are determined by their particular molecular structures, making accurate structural models a requirement for understanding their biological effects. One potential factor that can affect amyloid structures is hydration. Previous studies of simple stacked β-sheet amyloids have suggested that dehydration does not impact structure, but other studies indicated dehydration-related structural changes of a putative water-filled nanotube. Our results show that dehydration significantly affects the molecular structure of the fungal prion-forming domain HET-s(218–289), which forms a β-solenoid with no internal solvent-accessible regions. The dehydration-related structural deformation of HET-s(218–289) indicates that water can play a significant role in complex amyloid structures, even when no obvious water-accessible cavities are present.

  3. Diurnal variations of 218Po, 214Pb, and 214Po and their effect on atmospheric electrical conductivity in the lower atmosphere at Mysore

    International Nuclear Information System (INIS)

    The short-lived radon daughters (218Po, 214Pb, 214Bi and 214Po) are natural tracers in the troposphere in particular near the ground surface. They are electrically charged particles and are chemically reactive. As soon as they are formed they get attached to the aerosol particles of the atmosphere. Their behaviour is similar to that of aerosols with respect to their growth, transport, removal processes in the atmosphere. The electrical conductivity of the atmosphere is mainly due to the presence of highly mobile (small) ions. Hence the electrical conductivity of air at near the surface of the earth mainly due to 222Rn, 218Po, 214Pb, 214Bi and 214Po concentrations, and depends on aerosol concentrations and meteorological parameters. The individual radon progeny concentrations (218Po, 214Pb, and 214Po) are measured using Air Flow meter. The concentration of radon in the atmospheric air is measured using Low Level Radon Detection System. The total energy released due to both radon and its progeny is computed in energy units (eV cm-3s-1) and is converted into ion-pair production rate (No. cm-3 s-1), 32 eV being the energy producing one-ion pair. The atmospheric electrical conductivity (both positive and negative) is measured using a Gerdien's apparatus with two identical tubes. The average values of 218Po, 214Pb, and 214Po are respectively 13.70, 1.45 and 1.92 Bq m-3 respectively. The average value of positive and negative electrical conductivity are 5.08 x 10-14U-1 m-1 and 4.67 x 10-14 U-1 m-1. The concentrations of radon, its progeny, and positive and negative conductivity show a similar kind of diurnal variations with maximum in the early morning hours and a minimum during day time. The activity is higher in winter than in summer and rainy season. (author)

  4. Schwangerschaftsabbruch als sprachliches Problem : eine linguistische Textanalyse ausgewählter Gesetzentwürfe zur Reform des § 218 StGB

    OpenAIRE

    Beckmann, Pia

    2004-01-01

    Die Arbeit stellt eine linguistische Textanalyse von Gesetzentwürfen zur Reform des § 218 StGB aus dem Jahr 1991 dar. Mitspieler (Aktanten) in den jeweiligen Handlungsframes der Gesetzentwürfe sind die Frau als Entscheidungsträgerin für die Handlung "Schwangerschaftsabbruch", der Arzt, der den Schwangerschaftsabbruch vornimmt, und der Embryo, der abgetrieben wird. Unter Rückgriff auf die Prototypensemantik werden die Handlung und die Aktanten in dem jeweiligen Textzusammenhang der einzelnen G...

  5. Two-way shape memory effect and mechanical properties of Pulse Discharge Sintered Ni2.18Mn0.82Ga

    OpenAIRE

    Takagi, T; Khovailo, V.; Nagatomo, T.; Matsumoto, M.; Ohtsuka, M; T. Abe; Miki, H

    2003-01-01

    Mechanical and shape memory properties of a polycrystalline Ni2.18Mn0.82Ga alloy prepared by a PDS (Pulse Discharge Sintering) method were investigated. It was found that the material demonstrates the two-way shape memory effect after a loading - unloading cycle performed in the martensitic state, i. e. essentially without special training. The samples exhibiting the two-way shape memory effect show a significant enhancement in the magnitude of magnetic-field-induced strain.

  6. Heterogeneous Seeding of a Prion Structure by a Generic Amyloid Form of the Fungal Prion-forming Domain HET-s(218-289)

    Energy Technology Data Exchange (ETDEWEB)

    Wan, William; Bian, Wen; McDonald, Michele; Kijac, Aleksandra; Wemmer, David E.; Stubbs, Gerald [UCB; (Vanderbilt); (LBNL)

    2013-11-13

    The fungal prion-forming domain HET-s(218–289) forms infectious amyloid fibrils at physiological pH that were shown by solid-state NMR to be assemblies of a two-rung β-solenoid structure. Under acidic conditions, HET-s(218–289) has been shown to form amyloid fibrils that have very low infectivity in vivo, but structural information about these fibrils has been very limited. We show by x-ray fiber diffraction that the HET-s(218–289) fibrils formed under acidic conditions have a stacked β-sheet architecture commonly found in short amyloidogenic peptides and denatured protein aggregates. At physiological pH, stacked β-sheet fibrils nucleate the formation of the infectious β-solenoid prions in a process of heterogeneous seeding, but do so with kinetic profiles distinct from those of spontaneous or homogeneous (seeded with infectious β-solenoid fibrils) fibrillization. Several serial passages of stacked β-sheet-seeded solutions lead to fibrillization kinetics similar to homogeneously seeded solutions. Our results directly show that structural mutation can occur between substantially different amyloid architectures, lending credence to the suggestion that the processes of strain adaptation and crossing species barriers are facilitated by structural mutation.

  7. IUPAC critical evaluation of the rotational-vibrational spectra of water vapor. Part I-Energy levels and transition wavenumbers for H217O and H218O

    International Nuclear Information System (INIS)

    This is the first part of a series of articles reporting critically evaluated rotational-vibrational line positions, transition intensities, pressure dependence and energy levels, with associated critically reviewed assignments and uncertainties, for all the main isotopologues of water. The present article contains energy levels and data for line positions of the singly substituted isotopologues H217O and H218O. The procedure and code MARVEL, standing for measured active rotational-vibrational energy levels, is used extensively in all stages of determining the validated levels and lines and their self-consistent uncertainties. The spectral regions covered for both isotopologues H217O and H218O are 0-17125cm-1. The energy levels are checked against ones determined from accurate variational calculations. The number of critically evaluated and recommended levels and lines are, respectively, 2687 and 8614 for H217O, and 4839 and 29 364 for H218O. The extensive lists of MARVEL lines and levels obtained are deposited in the Supplementary Material, as well as in a distributed information system applied to water, W-DIS, where they can easily be retrieved. A distinguishing feature of the present evaluation of water spectroscopic data is the systematic use of all available experimental data and validation by first-principles theoretical calculations.

  8. Dual-time-point O-(2-[18F]fluoroethyl)-L-tyrosine PET for grading of cerebral gliomas

    International Nuclear Information System (INIS)

    We aimed to evaluate the diagnostic potential of dual-time-point imaging with positron emission tomography (PET) using O-(2-[18F]fluoroethyl)-L-tyrosine (18F-FET) for non-invasive grading of cerebral gliomas compared with a dynamic approach. Thirty-six patients with histologically confirmed cerebral gliomas (21 primary, 15 recurrent; 24 high-grade, 12 low-grade) underwent dynamic PET from 0 to 50 min post-injection (p.i.) of 18F-FET, and additionally from 70 to 90 min p.i. Mean tumour-to-brain ratios (TBRmean) of 18F-FET uptake were determined in early (20-40 min p.i.) and late (70-90 min p.i.) examinations. Time-activity curves (TAC) of the tumours from 0 to 50 min after injection were assigned to different patterns. The diagnostic accuracy of changes of 18F-FET uptake between early and late examinations for tumour grading was compared to that of curve pattern analysis from 0 to 50 min p.i. of 18F-FET. The diagnostic accuracy of changes of the TBRmean of 18F-FET PET uptake between early and late examinations for the identification of HGG was 81 % (sensitivity 83 %; specificity 75 %; cutoff - 8 %; p < 0.001), and 83 % for curve pattern analysis (sensitivity 88 %; specificity 75 %; p < 0.001). Dual-time-point imaging of 18F-FET uptake in gliomas achieves diagnostic accuracy for tumour grading that is similar to the more time-consuming dynamic data acquisition protocol. (orig.)

  9. Radiation dosimetry estimation of N-(2-[18F]fluoropropionyl)- L-glutamate based on the mice distribution data

    International Nuclear Information System (INIS)

    N-(2-[18F]fluoropropionyl)-L-glutamate([18F]FPGLU) was a recently developed potential amino acid tracer for tumor imaging with positron emission tomography–computer tomography (PET–CT). The absorbed and effective radiation doses resulting from the intravenous administration of [18F]FPGLU were estimated using biodistribution data from normal mice. The methodology recommended by Medical Internal Radiation Dose Committee (MIRD) was used to estimate the doses. The highest uptake of [18F]FPGLU was found in the kidneys, followed by the liver and lung. The kidneys were the organ received the highest absorbed dose, 58.4 μGy/MBq, the brain received the lowest dose, 5.5 μGy/MBq, and other organs received doses in the range of 8.3–11.9 μGy/MBq. The effective dose was 17.0 μSv/MBq. The data show that a 370 MBq (10 mCi) injection of [18F]FPGLU would lead to an estimated effective dose of 6.3 mSv, which is within the accepted range of routine nuclear medicine investigations. - Highlights: • The absorbed and effective radiation dosimetry of [18F]FPGLU was estimated using the biodistribution data from normal mice. • A 370 MBq (10 mCi) injection of [18F] FPGLU would lead to an estimated effective dose of 6.3 mSv, which is within the accepted range of routine nuclear medicine investigations. • [18F]FPGLU is a safe amino acid PET tracer for imaging and can be used in further clinical study

  10. Response of the unattached 218Po activity size distribution in H2O-SO2-N2 atmospheres

    International Nuclear Information System (INIS)

    The response of the unattached 218Po activity size distribution to variations in H2O and SO2 concentration was investigated in a high-purity N2 atmosphere. Lognormal size distributions were reconstructed from screen diffusion battery data using a random search and optimization procedure. For relative humidities of 1% to 90%, SO2 concentrations of 0-6 ppm, and residence times of 38 s, median diameters of the unattached mode ranged from 0.50 (± 0.04) to 0.80 (± 0.06) nm, corresponding to diffusion coefficients of 0.1-0.05 cm2 s-1. Increases in water vapor concentration resulted in an enhanced rate of ion neutralization and suppression of ion cluster formation. Decreases in cluster diameter with increasing humidity were therefore observed. Addition of SO2 at constant relative humidity resulted in an initial increase in diameter, with a subsequent decrease. Geometric standard deviations averaged 1.05 (± 0.01) to 1.06 (± 0.01) in all cases, with the unattached fraction comprising 83% to 88% of the total distribution. Results suggest that increases in water vapor concentration enhance neutralization in the immediate vicinity of the recoil path through water radiolysis. Conversion of OH to H2OSO4 on addition of SO2 provides a binary condensable phase capable of clustering around the ion at low relative humidities, increasing particle size. High H2O and SO2 concentrations enhance neutralization through electron scavenging and subsequent ion collision near the end of the recoil path, decreasing the number of available cluster sites and suppressing cluster formation. This reduction is more significant than the increasing size of the stable ion cluster, with increasing H2O and H2SO4 concentrations as predicted by Raes, resulting in decreases in both median diameter and distribution spread

  11. The propagation of a soil H218O labeling through the atmosphere-plant-soil system under drought using H218O and C18OO as two independent proxies

    Science.gov (United States)

    Barthel, Matthias; Sturm, Patrick; Hammerle, Albin; Siegwolf, Rolf; Gentsch, Lydia; Buchmann, Nina; Knohl, Alexander

    2013-04-01

    Above- and belowground processes in plants are tightly coupled via carbon and water flows through the atmosphere-plant-soil system. While recent studies elucidated the influence of drought on the carbon flow through plant and soil using 13C, much less is known about the propagation of 18O. Therefore, this study aimed to examine the timing and intensity of 18O enrichment in soil and shoot CO2 and H2O vapor fluxes of European beech saplings (Fagus sylvatica L.) after applying 18O-labeled water to the soil. A custom-made chamber system, separating shoot from soil compartments, allowed independent measurements of shoot and soil related processes in a controlled climate chamber environment. Gas-exchange of oxygen stable isotopes in CO2 and H2O-vapor served as the main tool for investigation and was monitored in real-time using laser spectroscopy. This is the first study measuring concurrently and continuously the enrichment of 18O in CO2 and H2O in shoot- and soil gas-exchange after applying 18O-labeled water to the soil. Photosynthesis (A) and stomatal conductance (gs) of drought-stressed plants showed an immediate coinciding small increase to the H218O irrigation event after only ~30 min. This rapid information transfer, however, was not accompanied by the arrival of 18O labeled water molecules within the shoot. The actual label induced 18O enrichment in transpired water and CO2 occurred not until ~4h after labeling. Further, the timing of the enrichment of 18O in the transpirational flux was similar in both treatments, thus pointing to similar transport rates. However, drought reduced the 18O exchange rate between H2O and CO2at the shoot level, likely caused by a smaller leaf CO2retroflux. Moreover, 18O exchange between H2O and CO2 occurred also in the soil. However, the there was no difference observed between the treatments.

  12. Uptake of O-(2-[18F]fluoroethyl)-L-tyrosine in reactive astrocytosis in the vicinity of cerebral gliomas

    International Nuclear Information System (INIS)

    PET using O-(2-[18F]fluoroethyl)-L-tyrosine (18F-FET) allows improved imaging of tumor extent of cerebral gliomas in comparison to MRI. In experimental brain infarction and hematoma, an unspecific accumulation of 18F-FET has been detected in the area of reactive astrogliosis which is a common cellular reaction in the vicinity of cerebral gliomas. The aim of this study was to investigate possible 18F-FET uptake in the area of reactive gliosis in the vicinity of untreated and irradiated rat gliomas. Methods: F98-glioma cells were implanted into the caudate nucleus of 33 Fisher CDF rats. Sixteen animals remained untreated and in 17 animals the tumor was irradiated by Gamma Knife 5–8 days after implantation (2/50 Gy, 3/75 Gy, 6/100 Gy, 6/150 Gy). After 8–17 days of tumor growth the animals were sacrificed following injection of 18F-FET. Brains were removed, cut in coronal sections and autoradiograms of 18F-FET distribution were produced and compared with histology (toluidine blue) and reactive astrogliosis (GFAP staining). 18F-FET uptake in the tumors and in areas of reactive astrocytosis was evaluated by lesion to brain ratios (L/B). Results: Large F98-gliomas were present in all animals showing increased 18F-FET-uptake which was similar in irradiated and non-irradiated tumors (L/B: 3.9 ± 0.8 vs. 4.0 ± 1.3). A pronounced reactive astrogliosis was noted in the vicinity of all tumors that showed significantly lower 18F-FET-uptake than the tumors (L/B: 1.5 ± 0.4 vs. 3.9 ± 1.1). The area of 18F-FET-uptake in the tumor was congruent with histological tumor extent in 31/33 animals. In 2 rats irradiated with 150 Gy, however, high 18F-FET uptake was noted in the area of astrogliosis which led to an overestimation of the tumor size. Conclusions: Reactive astrogliosis in the vicinity of gliomas generally leads to only a slight 18F-FET-enrichment that appears not to affect the correct definition of tumor extent for treatment planning

  13. Evaluation of lymphocyte levels in a random sample of 218 elderly individuals from São Paulo city

    Directory of Open Access Journals (Sweden)

    Daniela Teixeira

    2011-10-01

    Full Text Available BACKGROUND: Age-associated changes in the immune system cause decreased protection after vaccination and increased rates of infections and tumor development. METHODS: Lymphocyte percentages were compared by gender and age to establish differences between subtypes. Three mL blood samples were obtained from 218 randomly selected individuals (60-101 years old who live in São Paulo city. Blood was lysed with Tris phosphate buffer and stained for 30 minutes with monoclonal antibodies (CD3PerCP, CD4FITC, CD8Pe, CD19Pe for analysis by flow cytometry. Statistical analysis was by ANOVA. RESULTS: The percentage of CD4+ T cells (p-value = 0.005 and the CD4/CD8 ratio (p-value = 0.010 were lower in men, whereas the percentage of CD8+ T cells was lower (p-value = 0.002 in women; the percentage of B cells (CD19+ was similar between groups. Individuals grouped by gender and age range and compared showed a drop in CD4+ cells in 75 to 79-year-old men (female: 46.1% ± 8.1% and male: 38.8% ± 10.5%; p-value = 0.023. Also, the 80 to 84-year-old group of men had a higher percentage of CD8+ (female: 20.8% ± 8.2%, and male: 27.2% ± 8.2%; p-value = 0.032. Low percentages of B cells were detected in men in the 75 to 79-year-old (p-value = 0.003, 85 to 89-year-old (p-value = 0.020 and older than 90 year old (p-value = 0.002 age ranges. CONCLUSION: Elderly men present with more changes in lymphocyte subsets compared to elderly women. These findings could demonstrate impairment in the immune response since the lower CD4+ in men would provide less help to B cells (also lower in men in terms of antibody production. In addition, the increase in CD8+ cells in this group could represent chronic inflammation observed during the aging process.

  14. Diagnosis of pseudoprogression in patients with glioblastoma using O-(2-[18F]fluoroethyl)-l-tyrosine PET

    International Nuclear Information System (INIS)

    The follow-up of glioblastoma patients after radiochemotherapy with conventional MRI can be difficult since reactive alterations to the blood-brain barrier with contrast enhancement may mimic tumour progression (i.e. pseudoprogression, PsP). The aim of this study was to assess the clinical value of O-(2-18F-fluoroethyl)-l-tyrosine (18F-FET) PET in the differentiation of PsP and early tumour progression (EP) after radiochemotherapy of glioblastoma. A group of 22 glioblastoma patients with new contrast-enhancing lesions or lesions showing increased enhancement (>25 %) on standard MRI within the first 12 weeks after completion of radiochemotherapy with concomitant temozolomide (median 7 weeks) were additionally examined using amino acid PET with 18F-FET. Maximum and mean tumour-to-brain ratios (TBRmax, TBRmean) were determined. 18F-FET uptake kinetic parameters (i.e. patterns of time-activity curves, TAC) were also evaluated. Classification as PsP or EP was based on the clinical course (no treatment change at least for 6 months), follow-up MR imaging and/or histopathological findings. Imaging results were also related to overall survival (OS). PsP was confirmed in 11 of the 22 patients. In patients with PsP, 18F-FET uptake was significantly lower than in patients with EP (TBRmax 1.9 ± 0.4 vs. 2.8 ± 0.5, TBRmean 1.8 ± 0.2 vs. 2.3 ± 0.3; both P < 0.001) and presence of MGMT promoter methylation was significantly more frequent (P = 0.05). Furthermore, a TAC type II or III was more frequently present in patients with EP (P = 0.04). Receiver operating characteristic analysis showed that the optimal 18F-FET TBRmax cut-off value for identifying PsP was 2.3 (sensitivity 100 %, specificity 91 %, accuracy 96 %, AUC 0.94 ± 0.06; P < 0.001). Univariate survival analysis showed that a TBRmax <2.3 predicted a significantly longer OS (median OS 23 vs. 12 months; P = 0.046). 18F-FET PET may facilitate the diagnosis of PsP following radiochemotherapy of glioblastoma. (orig.)

  15. The usefulness of dynamic O-(2-18F-fluoroethyl)-L-tyrosine PET in the clinical evaluation of brain tumors in children and adolescents

    DEFF Research Database (Denmark)

    Dunkl, Veronika; Cleff, Corvin; Stoffels, Gabriele; Judov, Natalie; Sarikaya-Seiwert, Sevgi; Law, Ian; Bøgeskov, Lars; Nysom, Karsten; Andersen, Sofie B; Steiger, Hans-Jakob; Fink, Gereon R; Reifenberger, Guido; Shah, Nadim J; Coenen, Heinz H; Langen, Karl-Josef; Galldiks, Norbert

    2015-01-01

    UNLABELLED: Experience regarding O-(2-(18)F-fluoroethyl)-L-tyrosine ((18)F-FET) PET in children and adolescents with brain tumors is limited. METHODS: Sixty-nine (18)F-FET PET scans of 48 children and adolescents (median age, 13 y; range, 1-18 y) were analyzed retrospectively. Twenty-six scans to...... by receiver-operating-characteristic curve analyses using histology or clinical course as a reference. RESULTS: In patients with newly diagnosed cerebral lesions, the highest accuracy (77%) to detect neoplastic tissue (19/26 patients) was obtained when the maximum TBR was 1.7 or greater (area under...

  16. Continuous monitoring α-activity on aerosol filters by the pseudo-coincidence-technique. Explicitly taking into account the short lived Po-218 activity

    International Nuclear Information System (INIS)

    Pseudo-coincidence-technique is applied to continuous monitoring of α-activity on aerosolfilters by proportional counters. Filter activity can markedly increase or decrease by changing air conditions especially by the amount of short lived Po-218 activity. Conditions of constant proportions of activity concentrations for the short lived species for operating this technique are seldom fulfilled. The dynamic behavior of artificial (long lived) and natural (short lived) activity is mathematically modelled and the measured moving count rates are analyzed under this model by a multivariate regression analysis for activity concentrations of artificial resp. short lived activity. Results are compared to standard recommendations of DIN ISO 11929.

  17. Estimation of the release and migration of lead through soils and groundwater at the Hanford Site 218-E-12B Burial Ground. Volume 2, Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Rhoads, K.; Bjornstad, B.N.; Lewis, R.E.; Teel, S.S.; Cantrell, K.J.; Serne, R.J.; Smoot, J.L.; Kincaid, C.T.; Wurstner, S.K.

    1992-10-01

    This report describes the technical basis for a groundwater transport analysis that was conducted to evaluate migration of potentially hazardous materials from the Hanford Site 218-E-12B burial ground. The analysis characterized the geologic, chemical, and hydrologic properties of the disposal site, and used that information to perform a screening analysis for transport of materials from the burial ground to downgradient groundwater locations and to the Columbia River. Subsequent sections of the appendix describe the geologic setting, geochemistry, and hydrology of the disposal site and their relationship to the transport analysis.

  18. Estimation of the release and migration of lead through soils and groundwater at the Hanford Site 218-E-12B Burial Ground

    Energy Technology Data Exchange (ETDEWEB)

    Rhoads, K.; Bjornstad, B.N.; Lewis, R.E.; Teel, S.S.; Cantrell, K.J.; Serne, R.J.; Smoot, J.L.; Kincaid, C.T.; Wurstner, S.K.

    1992-10-01

    This report describes the technical basis for a groundwater transport analysis that was conducted to evaluate migration of potentially hazardous materials from the Hanford Site 218-E-12B burial ground. The analysis characterized the geologic, chemical, and hydrologic properties of the disposal site, and used that information to perform a screening analysis for transport of materials from the burial ground to downgradient groundwater locations and to the Columbia River. Subsequent sections of the appendix describe the geologic setting, geochemistry, and hydrology of the disposal site and their relationship to the transport analysis.

  19. Positron emission tomography with 2-deoxy-2-[18F]fluoro-d -glucose in patients with thyroid diseases : FDG PET in thyroid diseases

    OpenAIRE

    2011-01-01

    The aim of this thesis was to contribute to the field of positron emission tomography (PET) with 2-deoxy-2-[18F]fluoro-D-glucose (FDG) in benign and malignant diseases of the thyroid gland. The primary method used was review of retrospectively or prospectively enrolled patients referred for FDG PET at the Mayo Clinic, Rochester, MN, USA. PET findings were compared with the results of all other imaging, laboratory results and clinical information, as well as, extensive recording of follow-up i...

  20. A program for calculating load coefficient matrices utilizing the force summation method, L218 (LOADS). Volume 2: Supplemental system design and maintenance document

    Science.gov (United States)

    Anderson, L. R.; Miller, R. D.

    1979-01-01

    The LOADS computer program L218 which calculates dynamic load coefficient matrices utilizing the force summation method is described. The load equations are derived for a flight vehicle in straight and level flight and excited by gusts and/or control motions. In addition, sensor equations are calculated for use with an active control system. The load coefficient matrices are calculated for the following types of loads: (1) translational and rotational accelerations, velocities, and displacements; (2) panel aerodynamic forces; (3) net panel forces; and (4) shears, bending moments, and torsions.

  1. The use of C-18 SEP PAK cartridges to simplify routine production of 2-deoxy-2-[18F]fluoro-D-glucose

    International Nuclear Information System (INIS)

    The synthesis of 2-deoxy-2[18F]fluoro-D-glucose has been simplified by the use of C-18 SEP PAK cartridges. The fluorinated sugar produced from the reaction of acetyl hypofluorite and tri-acetyl glucal (TAG) was extracted from the neutralized reaction mixture with C-18 SEP PAK cartridges. The product was washed off the cartridge with diethyl ether and hydrolyzed by HCl. After hydrolysis the product was purified by passage through ion retardation resin, alumina and another C-18 cartridge. The radiochemical purity was 98% and the radiochemical yield was 28%, decay corrected to EOB, with a total synthesis time of 50 min from EOB. (author)

  2. Interactions of Neuropathogenic Escherichia coli K1 (RS218) and Its Derivatives Lacking Genomic Islands with Phagocytic Acanthamoeba castellanii and Nonphagocytic Brain Endothelial Cells

    Science.gov (United States)

    Yousuf, Farzana Abubakar; Yousuf, Zuhair; Iqbal, Junaid; Siddiqui, Ruqaiyyah; Khan, Hafsa; Khan, Naveed Ahmed

    2014-01-01

    Here we determined the role of various genomic islands in E. coli K1 interactions with phagocytic A. castellanii and nonphagocytic brain microvascular endothelial cells. The findings revealed that the genomic islands deletion mutants of RS218 related to toxins (peptide toxin, α-hemolysin), adhesins (P fimbriae, F17-like fimbriae, nonfimbrial adhesins, Hek, and hemagglutinin), protein secretion system (T1SS for hemolysin), invasins (IbeA, CNF1), metabolism (D-serine catabolism, dihydroxyacetone, glycerol, and glyoxylate metabolism) showed reduced interactions with both A. castellanii and brain microvascular endothelial cells. Interestingly, the deletion of RS218-derived genomic island 21 containing adhesins (P fimbriae, F17-like fimbriae, nonfimbrial adhesins, Hek, and hemagglutinin), protein secretion system (T1SS for hemolysin), invasins (CNF1), metabolism (D-serine catabolism) abolished E. coli K1-mediated HBMEC cytotoxicity in a CNF1-independent manner. Therefore, the characterization of these genomic islands should reveal mechanisms of evolutionary gain for E. coli K1 pathogenicity. PMID:24818136

  3. Interactions of Neuropathogenic Escherichia coli K1 (RS218 and Its Derivatives Lacking Genomic Islands with Phagocytic Acanthamoeba castellanii and Nonphagocytic Brain Endothelial Cells

    Directory of Open Access Journals (Sweden)

    Farzana Abubakar Yousuf

    2014-01-01

    Full Text Available Here we determined the role of various genomic islands in E. coli K1 interactions with phagocytic A. castellanii and nonphagocytic brain microvascular endothelial cells. The findings revealed that the genomic islands deletion mutants of RS218 related to toxins (peptide toxin, α-hemolysin, adhesins (P fimbriae, F17-like fimbriae, nonfimbrial adhesins, Hek, and hemagglutinin, protein secretion system (T1SS for hemolysin, invasins (IbeA, CNF1, metabolism (D-serine catabolism, dihydroxyacetone, glycerol, and glyoxylate metabolism showed reduced interactions with both A. castellanii and brain microvascular endothelial cells. Interestingly, the deletion of RS218-derived genomic island 21 containing adhesins (P fimbriae, F17-like fimbriae, nonfimbrial adhesins, Hek, and hemagglutinin, protein secretion system (T1SS for hemolysin, invasins (CNF1, metabolism (D-serine catabolism abolished E. coli K1-mediated HBMEC cytotoxicity in a CNF1-independent manner. Therefore, the characterization of these genomic islands should reveal mechanisms of evolutionary gain for E. coli K1 pathogenicity.

  4. Stability study of 2-[18F]Fluoro-2-Deoxy-D-Glucose (18FDG) stored at room temperature by physicochemical and microbiological assays

    International Nuclear Information System (INIS)

    The most widely used radiopharmaceutical in the expanding medical imaging technology of Positron Emission Tomography (PET) is 2-[18F]fluoro-2-deoxy-D-glucose (18FDG). The increasing demand for 18FDG requires reliable production in large amounts. The synthesis of 18FDG is based on a nucleophilic substitution of the triflate-leaving group from the precursor, mannose triflate, in the presence of Crypt and 2.2.2, as a phase-transfer agent. After labeling, the removal of the acetyl protecting groups from resulting 2-[18F]fluoro-1,3,4,6-tetra-Oacetyl- D-glucose is performed by alkaline hydrolysis, followed by purification and final filtration (0.22 μm). It was reported that 18FDG decomposes in vitro, resulting in the degradation of the radiochemical purity with time. The aim of this study was to evaluate physicochemical and microbiological stability of 18FDG, stored at room temperature (15-30 deg C), at different time intervals. It was investigated how the quality of this radiopharmaceutical varies with time under the influence of environmental factors. 18FDG pH, radionuclidic identity and purity, radiochemical identity and purity, chemical purity, residual solvents, bacterial endotoxins and sterility were evaluated according to the United States Pharmacopeia 31th edition analytical methods and acceptance criteria. The results suggest that 18FDG has physicochemical and microbiological stability up to 10 hours after the end of synthesis, under experimental conditions. (author)

  5. MicroRNAs MiR-218, MiR-125b, and Let-7g predict prognosis in patients with oral cavity squamous cell carcinoma.

    Directory of Open Access Journals (Sweden)

    Shih-Chi Peng

    Full Text Available MicroRNAs (miRNAs have a major impact on regulatory networks in human carcinogenesis. In this study, we sought to investigate the prognostic significance of miRNAs in patients with oral cavity squamous cell carcinoma (OSCC. In a discovery phase, RNA was extracted from 58 OSCC tumor samples and paired normal tissues. MiRNAs expression was evaluated with TaqMan Array Card and TaqMan MicroRNA assays. The prognostic significance of the miRNA signature identified in the discovery phase was validated by qRT-PCR in a replication set consisting of 141 formalin-fixed, paraffin-embedded (FFPE samples. We identified a miRNA regulatory network centered on the three hub genes (SP1, MYC, and TP53 that predicted distinct clinical endpoints. Three miRNAs (miR-218, miR-125b, and let-7g and their downstream response genes had a concordant prognostic significance on disease-free survival and disease-specific survival rates. In addition, patients with a reduced expression of miR-218, miR-125b, and let-7g have a higher risk of poor outcomes in presence of specific risk factors (p-stage III-IV, pT3-4, or pN+. Our findings indicate that specific miRNAs have prognostic significance in OSCC patients and may improve prognostic stratification over traditional risk factors.

  6. An Ammonia Spectral Map of the L1495-B218 Filaments in the Taurus Molecular Cloud : I. Physical Properties of Filaments and Dense cores

    CERN Document Server

    Seo, Young Min; Goldsmith, Paul; Ward-Thompson, Derek; Kirk, Jason M; Schmalzl, Markus; Lee, Jeong-Eun; Friesen, Rachel; Langston, Glen; Masters, Joe; Garwood, Robert W

    2015-01-01

    We present deep NH$_3$ observations of the L1495-B218 filaments in the Taurus molecular cloud covering over a 3 degree angular range using the K-band focal plane array on the 100m Green Bank Telescope. The L1495-B218 filaments form an interconnected, nearby, large complex extending over 8 pc. We observed NH$_3$ (1,1) and (2,2) with a spectral resolution of 0.038 km/s and a spatial resolution of 31$"$. Most of the ammonia peaks coincide with intensity peaks in dust continuum maps at 350 $\\mu$m and 500 $\\mu$m. We deduced physical properties by fitting a model to the observed spectra. We find gas kinetic temperatures of 8 $-$ 15 K, velocity dispersions of 0.05 $-$ 0.25 km/s, and NH$_3$ column densities of 5$\\times$10$^{12}$ $-$ 1$\\times$10$^{14}$ cm$^{-2}$. The CSAR algorithm, which is a hybrid of seeded-watershed and binary dendrogram algorithms, identifies a total of 55 NH$_3$ structures including 39 leaves and 16 branches. The masses of the NH$_3$ sources range from 0.05 M$_\\odot$ to 9.5 M$_\\odot$. The masses...

  7. Herschel/HIFI search for H2-17O and H2-18O in IRC+10216: constraints on models for the origin of water vapor

    CERN Document Server

    Neufeld, David A; Agúndez, Marcelino; González-Alfonso, Eduardo; Decin, Leen; Daniel, Fabien; Cernicharo, José; Melnick, Gary J; Schmidt, Miroslaw; Szczerba, Ryszard

    2013-01-01

    We report the results of a sensitive search for the minor isotopologues of water, H2-17O and H2-18O, toward the carbon-rich AGB star IRC+10216 (a.k.a. CW Leonis) using the HIFI instrument on the Herschel Space Observatory. This search was motivated by the fact that any detection of isotopic enhancement in the H2-17O and H2-18O abundances would have strongly implicated CO photodissociation as the source of the atomic oxygen needed to produce water in a carbon-rich circumstellar envelope. Our observations place an upper limit of 1/470 on the H2-17O/H2-16O abundance ratio. Given the isotopic 17O/16O ratio of 1/840 inferred previously for the photosphere of IRC+10216, this result places an upper limit of a factor 1.8 on the extent of any isotope-selective enhancement of H2-17O in the circumstellar material, and provides an important constraint on any model that invokes CO photodissociation as the source of O for H2O production. In the context of the clumpy photodissociation model proposed previously for the origi...

  8. THE FIRST CIRCUMSTELLAR DISK IMAGED IN SILHOUETTE AT VISIBLE WAVELENGTHS WITH ADAPTIVE OPTICS: MagAO IMAGING OF ORION 218-354

    International Nuclear Information System (INIS)

    We present high-resolution adaptive optics (AO) corrected images of the silhouette disk Orion 218-354 taken with Magellan AO (MagAO) and its visible light camera, VisAO, in simultaneous differential imaging mode at Hα. This is the first image of a circumstellar disk seen in silhouette with AO and is among the first visible light AO results in the literature. We derive the disk extent, geometry, intensity, and extinction profiles and find, in contrast with previous work, that the disk is likely optically thin at Hα. Our data provide an estimate of the column density in primitive, ISM-like grains as a function of radius in the disk. We estimate that only ∼10% of the total submillimeter derived disk mass lies in primitive, unprocessed grains. We use our data, Monte Carlo radiative transfer modeling, and previous results from the literature to make the first self-consistent multiwavelength model of Orion 218-354. We find that we are able to reproduce the 1-1000 μm spectral energy distribution with a ∼2-540 AU disk of the size, geometry, small versus large grain proportion, and radial mass profile indicated by our data. This inner radius is a factor of ∼15 larger than the sublimation radius of the disk, suggesting that it is likely cleared in the very interior

  9. THE FIRST CIRCUMSTELLAR DISK IMAGED IN SILHOUETTE AT VISIBLE WAVELENGTHS WITH ADAPTIVE OPTICS: MagAO IMAGING OF ORION 218-354

    Energy Technology Data Exchange (ETDEWEB)

    Follette, Katherine B.; Close, Laird M.; Males, Jared R.; Wu, Ya-Lin; Morzinski, Katie M.; Hinz, Philip; Rodigas, Timothy J. [Steward Observatory, The University of Arizona, 933 N Cherry Avenue, Tucson, AZ 85721 (United States); Kopon, Derek [Max Planck Institute for Astronomy, Königstuhl 17, D-69117 Heidelberg (Germany); Puglisi, Alfio; Esposito, Simone; Riccardi, Armando; Pinna, Enrico; Xompero, Marco; Briguglio, Runa [INAF - Osservatorio Astrofisico di Arcetri, Largo E. Fermi 5, I-50125 Firenze (Italy)

    2013-09-20

    We present high-resolution adaptive optics (AO) corrected images of the silhouette disk Orion 218-354 taken with Magellan AO (MagAO) and its visible light camera, VisAO, in simultaneous differential imaging mode at Hα. This is the first image of a circumstellar disk seen in silhouette with AO and is among the first visible light AO results in the literature. We derive the disk extent, geometry, intensity, and extinction profiles and find, in contrast with previous work, that the disk is likely optically thin at Hα. Our data provide an estimate of the column density in primitive, ISM-like grains as a function of radius in the disk. We estimate that only ∼10% of the total submillimeter derived disk mass lies in primitive, unprocessed grains. We use our data, Monte Carlo radiative transfer modeling, and previous results from the literature to make the first self-consistent multiwavelength model of Orion 218-354. We find that we are able to reproduce the 1-1000 μm spectral energy distribution with a ∼2-540 AU disk of the size, geometry, small versus large grain proportion, and radial mass profile indicated by our data. This inner radius is a factor of ∼15 larger than the sublimation radius of the disk, suggesting that it is likely cleared in the very interior.

  10. Measurement of the α4β2* nicotinic acetylcholine receptor ligand 2-[18F]Fluoro-A-85380 and its metabolites in human blood during PET investigation: a methodological study

    International Nuclear Information System (INIS)

    2-[18F]fluoro-A-85380 (2-[18F]FA) is a new radioligand for noninvasive imaging of α4β2* nicotinic acetylcholine receptors (nAChRs) by positron emission tomography (PET) in human brain. In most cases, quantification of 2-[18F]FA receptor binding involves measurement of free nonmetabolized radioligand concentration in blood. This requires an efficient and reliable method to separate radioactive metabolites from the parent compound. In the present study, three analytical methods, thin layer chromatography (TLC), high-performance liquid chromatography (HPLC) and solid phase extraction (SPE) have been tested. Reversed-phase TLC of deproteinized aqueous samples of plasma provides good estimates of 2-[18F]FA and its metabolites. However, because of the decreased radioactivity in plasma samples, this method can be used in humans over the first 2 h after radioligand injection only. Reliable quantification of the parent radioligand and its main metabolites was obtained using reversed-phase HPLC, followed by counting of eluted fractions in a well gamma counter. Three main and five minor metabolites of 2-[18F]FA were detected in human blood using this method. On average, the unchanged 2-[18F]FA fraction in plasma of healthy volunteers measured at 14, 60, 120, 240 and 420 min after radioligand injection was 87.3±2.2%, 74.4±3%, 68.8±5%, 62.3±8% and 61.0±8%, respectively. In patients with neurodegenerative disorders, the values corresponding to the three last time points were significantly lower. The fraction of nonmetabolized 2-[18F]FA in plasma determined using SPE did not differ significantly from that obtained by HPLC (+gamma counting) (n=73, r=.95). Since SPE is less time-consuming than HPLC and provides comparable results, we conclude that SPE appears to be the most suitable method for measurement of 2-[18F]FA parent fraction during PET investigations

  11. Diurnal variations of 218Po, 214Pb, and 214Po and their effect on atmospheric electrical conductivity in the lower atmosphere at Mysore city, Karnataka State, India

    International Nuclear Information System (INIS)

    The short-lived radon daughters (218Po, 214Pb, 214Bi and 214Po) are natural tracers in the troposphere, in particular near the ground surface. They are electrically charged particles and are chemically reactive. As soon as they are formed they get attached to the aerosol particles of the atmosphere. The behavior of radon daughters is similar to that of aerosols with respect to their growth, transport and removal processes in the atmosphere. The electrical conductivity of the atmosphere is mainly due to the presence of highly mobile ions. Galactic cosmic rays are the main source of ionization in the planetary boundary layer; however, near the surface of the earth, ions are produced mainly by decays of natural radioactive gases emanating from the soil surface and by radiations emitted directly from the surface. Hence the electrical conductivity of air near the surface of the earth is mainly due to radiations emitted by 222Rn, 218Po, 214Pb, 214Bi and 214Po, and depends on aerosol concentrations and meteorological parameters. In the present work the diurnal and seasonal variations of radon and its progeny concentrations are studied using Low Level Radon Detection System and Airflow Meter respectively. Atmospheric electrical conductivity of both positive and negative polarities is measured using a Gerdien Condenser. All the measurements were carried out simultaneously at one location in Mysore city (12°N, 76°E), India. The diurnal variation of atmospheric electrical conductivity was found to be similar to that of ion pair production rate estimated from radon and its progeny concentrations with a maximum in the early morning hours and minimum during day time. The annual average concentrations of 222Rn, 218Po, 214Pb, and 214Po at the study location were found to be 21.46, 10.88, 1.78 and 1.80 Bq m−3 respectively. The annual average values of positive and negative atmospheric electrical conductivity were found to be 18.1 and 16.6 f S m−1 respectively. The radon and

  12. Diurnal variations of (218)Po, (214)Pb, and (214)Po and their effect on atmospheric electrical conductivity in the lower atmosphere at Mysore city, Karnataka State, India.

    Science.gov (United States)

    Pruthvi Rani, K S; Paramesh, L; Chandrashekara, M S

    2014-12-01

    The short-lived radon daughters ((218)Po, (214)Pb, (214)Bi and (214)Po) are natural tracers in the troposphere, in particular near the ground surface. They are electrically charged particles and are chemically reactive. As soon as they are formed they get attached to the aerosol particles of the atmosphere. The behavior of radon daughters is similar to that of aerosols with respect to their growth, transport and removal processes in the atmosphere. The electrical conductivity of the atmosphere is mainly due to the presence of highly mobile ions. Galactic cosmic rays are the main source of ionization in the planetary boundary layer; however, near the surface of the earth, ions are produced mainly by decays of natural radioactive gases emanating from the soil surface and by radiations emitted directly from the surface. Hence the electrical conductivity of air near the surface of the earth is mainly due to radiations emitted by (222)Rn, (218)Po, (214)Pb, (214)Bi and (214)Po, and depends on aerosol concentrations and meteorological parameters. In the present work the diurnal and seasonal variations of radon and its progeny concentrations are studied using Low Level Radon Detection System and Airflow Meter respectively. Atmospheric electrical conductivity of both positive and negative polarities is measured using a Gerdien Condenser. All the measurements were carried out simultaneously at one location in Mysore city (12°N, 76°E), India. The diurnal variation of atmospheric electrical conductivity was found to be similar to that of ion pair production rate estimated from radon and its progeny concentrations with a maximum in the early morning hours and minimum during day time. The annual average concentrations of (222)Rn, (218)Po, (214)Pb, and (214)Po at the study location were found to be 21.46, 10.88, 1.78 and 1.80 Bq m(-3) respectively. The annual average values of positive and negative atmospheric electrical conductivity were found to be 18.1 and 16.6 f S m(-1

  13. Measurement of glucose and 2-deoxy-2-[18F]fluoro-D-glucose transport and phosphorylation rates in myocardium using dual-tracer kinetic experiments

    International Nuclear Information System (INIS)

    To examine the use of 2-deoxy-2-[18F]fluoro-D-glucose (2-FDG) as a glucose analog for measuring glucose utilization rate in myocardium, dual-tracer kinetic experiments with 2-FDG and 2-[3H]glucose were performed in the perfused, isolated rabbit interventricular septum to measure simultaneously the transport and phosphorylation rates of glucose and 2-FDG. Results of the present study indicated that, in the septum, (i) the transport rate constants of 2-FDG and glucose were similar in magnitude, (ii) the phosphorylation rate constant for 2-FDG was about 60% of that of glucose, (iii) hypoxia caused an increase in phosphorylation rates of glucose and 2-FDG without affecting transport. 9 refs.; 1 figure; 3 tabs

  14. All-solid-state dual end pumped YVO4:Nd/LBO blue laser with 21.8 W output power at 457 nm

    Science.gov (United States)

    Ling, Zhao; Yi, Yao; Yang, Zhao; Quan, Zheng

    2014-03-01

    It is reported the efficient compact deep-blue laser at 457 nm generation by intracavity frequency doubling of a continuous wave (CW) laser operation of a diode-pumped YVO4:Nd laser on the 4 F 3/2 → 4 I 9/2 transition at 914 nm. An LBO crystal, cut for critical type I phase matching at room temperature is used for second harmonic generation (SHG) of the laser. With dual end pump configurations at total incident pump power of 60 W, as high as 21.8 W of CW output power at 457 nm is achieved with 20-mm-long LBO. The optical-to-optical conversion efficiency is up to 36.3%, and the power stability in 8 h is better than 2.36%.

  15. Estimation of the release and migration of lead through soils and groundwater at the Hanford Site 218-E-12B Burial Ground. Volume 1, Final report

    Energy Technology Data Exchange (ETDEWEB)

    Rhoads, K.; Bjornstad, B.N.; Lewis, R.E.; Teel, S.S.; Cantrell, K.J.; Serne, R.J.; Smoot, J.L.; Kincaid, C.T.; Wurstner, S.K.

    1992-10-01

    This study was performed to evaluate the potential for transport of lead from the Hanford Site 218-E-12B Burial Ground to the surrounding surface- and groundwater. Burial of metal components containing nickel alloy steel and lead at this location may eventually result in release of lead to the subsurface environment, including groundwater aquifers that may be used for domestic and agricultural purposes in the future and, ultimately, to the Columbia River. The rate at which lead is transported to downgradient locations depends on a complex set of factors, such as climate, soil and groundwater chemistry, and the geologic and hydrologic configuration of the subsurface region between the burial ground and a potential receptor location. The groundwater transport analysis was conducted using a one-dimensional screening model with a relatively conservative matrix of parameters obtained from the hydrogeologic and geochemical studies.

  16. Estimation of the release and migration of lead through soils and groundwater at the Hanford Site 218-E-12B Burial Ground

    Energy Technology Data Exchange (ETDEWEB)

    Rhoads, K.; Bjornstad, B.N.; Lewis, R.E.; Teel, S.S.; Cantrell, K.J.; Serne, R.J.; Smoot, J.L.; Kincaid, C.T.; Wurstner, S.K.

    1992-10-01

    This study was performed to evaluate the potential for transport of lead from the Hanford Site 218-E-12B Burial Ground to the surrounding surface- and groundwater. Burial of metal components containing nickel alloy steel and lead at this location may eventually result in release of lead to the subsurface environment, including groundwater aquifers that may be used for domestic and agricultural purposes in the future and, ultimately, to the Columbia River. The rate at which lead is transported to downgradient locations depends on a complex set of factors, such as climate, soil and groundwater chemistry, and the geologic and hydrologic configuration of the subsurface region between the burial ground and a potential receptor location. The groundwater transport analysis was conducted using a one-dimensional screening model with a relatively conservative matrix of parameters obtained from the hydrogeologic and geochemical studies.

  17. 2-[18F]fluoro-2-deoxyglucose positron-emission tomography in staging, response evaluation, and treatment planning of lymphomas

    DEFF Research Database (Denmark)

    Specht, Lena

    2007-01-01

    2-[18F]fluoro-2-deoxyglucose positron-emission tomography (FDG-PET) is used increasingly in the clinical management of lymphomas. With regard to staging, FDG-PET is more sensitive and specific than conventional staging methods in FDG avid lymphomas (ie, Hodgkin lymphoma and most aggressive non-Hodgkin...... lymphomas). Despite methodological problems, in particular the lack of a valid reference test, FDG-PET is approved and generally used for this purpose. With regard to response evaluation, FDG-PET at the end of treatment seems to aid considerably in differentiating between residual masses with or without...... residual lymphoma. Hence, new revised response criteria have been proposed, incorporating the result of FDG-PET at the end of treatment. An early interim FDG-PET scan after 1 to 3 cycles of chemotherapy is a very strong predictor of outcome, and trials are now in progress testing treatment modifications on...

  18. The Atacama Cosmology Telescope: A Measurement of the Cosmic Microwave Background Power Spectrum at 148 AND 218 GHz from the 2008 Southern Survey

    Science.gov (United States)

    Das, Sudeep; Marriage, Tobias A.; Ade, Peter A. R.; Aguirre, Paula; Amiri, Mandana; Appel, John W.; Barrientos, L. Felipe; Battistelli, Elia A.; Bond, J. Richard; Brown, Ben; Burger, Bryce; Chervenak, Jay; Devlin, Mark J.; Dicker, Simon R.; Doriese, W. Bertrand; Dunkley, Joanna; Duenner, Rolando; Essinger-Hileman, Thomas; Fisher, Ryan P.; Fowler, Joseph W.; Hajian, Amir; Halpern, Mark; Hasselfield, Matthew; Hernandez-Monteagudo, Carlos; Wollack, Ed

    2010-01-01

    We present measurements of the cosmic microwave background (CMB) power spectrum made by the Atacama Cosmology Telescope at 148 GHz and 218 GHz, as well as the cross-frequency spectrum between the two channels. Our results dearly show the second through the seventh acoustic peaks in the CMB power spectrum. The measurements of these higher-order peaks provide an additional test of the ACDM cosmological model. At l > 3000, we detect power in excess of the primary anisotropy spectrum of the CMB. At lower multipoles 500 < l < 3000, we find evidence for gravitational lensing of the CMB in the power spectrum at the 2.8(sigma) level. We also detect a low level of Galactic dust in our maps, which demonstrates that we can recover known faint, diffuse signals.

  19. THE ATACAMA COSMOLOGY TELESCOPE: A MEASUREMENT OF THE COSMIC MICROWAVE BACKGROUND POWER SPECTRUM AT 148 AND 218 GHz FROM THE 2008 SOUTHERN SURVEY

    International Nuclear Information System (INIS)

    We present measurements of the cosmic microwave background (CMB) power spectrum made by the Atacama Cosmology Telescope at 148 GHz and 218 GHz, as well as the cross-frequency spectrum between the two channels. Our results clearly show the second through the seventh acoustic peaks in the CMB power spectrum. The measurements of these higher-order peaks provide an additional test of the ΛCDM cosmological model. At l>3000, we detect power in excess of the primary anisotropy spectrum of the CMB. At lower multipoles 500 < l < 3000, we find evidence for gravitational lensing of the CMB in the power spectrum at the 2.8σ level. We also detect a low level of Galactic dust in our maps, which demonstrates that we can recover known faint, diffuse signals.

  20. Guided ion beam studies of the reactions of Nin+ (n=2-18) with O2: Nickel cluster oxide and dioxide bond energies

    International Nuclear Information System (INIS)

    The kinetic energy dependences of the reactions of Nin+ (n=2-18) with O2 are studied in a guided ion beam tandem mass spectrometer. A variety of NimO2+, NimO+, and Nim+ product ions, where m≤n, are observed, with the dioxide cluster ions dominating the products for all larger reactant cluster ions. Reaction efficiencies are near unity for all but the smallest clusters. The energy dependences of the product cross sections are analyzed in several different ways to determine thermochemistry for both the first and second oxygen atom binding to nickel cluster ions. These values show little dependence on cluster size for clusters larger than three atoms. The trends in this thermochemistry are discussed and compared to bulk phase oxidation values

  1. Estimation of the release and migration of nickel through soils and groundwater at the Hanford Site 218-E-12B Burial Ground

    International Nuclear Information System (INIS)

    An assessment was performed to evaluate release and transport of nickel from large metal components containing nickel-bearing alloys at the Hanford Site 218-E-12B Burial Ground. The potential for nickel within the components to enter groundwater under the burial site was investigated by examining available data on the site's geology, geochemistry, and geohydrology to develop a conceptual model for release and transport of nickel from the components. In addition, laboratory studies were performed to provide information needed for the model, but which was not available from existing databases. Estimates of future concentrations of nickel radioisotopes (59Ni and 63Ni) and total elemental nickel in the unconfined aquifer and in the Columbia River were developed based on this information

  2. HERSCHEL/HIFI SEARCH FOR H217O AND H218O IN IRC+10216: CONSTRAINTS ON MODELS FOR THE ORIGIN OF WATER VAPOR

    International Nuclear Information System (INIS)

    We report the results of a sensitive search for the minor isotopologues of water, H217O and H218O, toward the carbon-rich asymptotic giant branch star IRC+10216 (a.k.a. CW Leonis) using the HIFI instrument on the Herschel Space Observatory. This search was motivated by the fact that any detection of isotopic enhancement in the H217O and H218O abundances would have strongly implicated CO photodissociation as the source of the atomic oxygen needed to produce water in a carbon-rich circumstellar envelope. Our observations place an upper limit of 1/470 on the H217O/H216O abundance ratio. Given the isotopic 17O/16O ratio of 1/840 inferred previously for the photosphere of IRC+10216, this result places an upper limit of a factor 1.8 on the extent of any isotope-selective enhancement of H217O in the circumstellar material, and provides an important constraint on any model that invokes CO photodissociation as the source of O for H2O production. In the context of the clumpy photodissociation model proposed previously for the origin of water in IRC+10216, our limit implies that 12C16O (not 13C16O or SiO) must be the dominant source of 16O for H2O production, and that the effects of self-shielding can only have reduced the 12C16O photodissociation rate by at most a factor ∼2.

  3. Nucleophilic radiosynthesis of 2-[18F]fluoro-2-deoxy-D-galactose from Talose triflate and biodistribution in a porcine model

    International Nuclear Information System (INIS)

    Introduction: The galactose analogue 2-[18F]fluoro-2-deoxy-D-galactose (FDGal) is a promising positron emission tomography (PET) tracer for studies of regional differences in liver metabolic function and for clinical evaluation of patients with liver cirrhosis and patients undergoing treatment of liver diseases. However, there is an unmet need for routine production of FDGal from readily available starting material. In this study, we present the preparation of FDGal with high radiochemical purity and in amounts sufficient for clinical investigations from commercially available Talose triflate (1,3,4,6-tetra-O-acetyl-2-O-trifluoromethanesulfonyl-β-D-talopyranose). In addition, the biodistribution of FDGal in the pig is presented. Methods: FDGal was prepared by nucleophilic fluorination of Talose triflate followed by basic hydrolysis. The entire synthesis was performed using the GE TRACERlab MX 2-[18F]fluoro-2-deoxy-D-glucose (FDG) synthesizer and existing methods for quality control of FDG were applied. Biodistribution of FDGal was studied by successive whole-body PET recordings of two anaesthetized 37-kg pigs. Results: Up to 3.7 GBq sterile, pyrogen-free and no-carrier-added FDGal was produced with a radiochemical yield of 3.8±1.2% and a radiochemical purity of 98±1% (42 productions; yield is decay corrected). The adopted quality control methods for FDG were directly applicable for FDGal. Biodistribution studies in the pig revealed the liver and the urinary bladder as critical organs in terms of radiation dose. Conclusion: Commercially available Talose triflate is a suitable starting material for routine productions of FDGal. The presented radiosynthesis and quality control methods allow for the production of pure, no-carrier-added FDGal in sufficient amounts for clinical PET-investigations of the liver.

  4. Herschel/HIFI Search for H_2^{17}O and H_2^{18}O in IRC+10216: Constraints on Models for the Origin of Water Vapor

    Science.gov (United States)

    Neufeld, David A.; Tolls, Volker; Agúndez, Marcelino; González-Alfonso, Eduardo; Decin, Leen; Daniel, Fabien; Cernicharo, José; Melnick, Gary J.; Schmidt, Miroslaw; Szczerba, Ryszard

    2013-04-01

    We report the results of a sensitive search for the minor isotopologues of water, H_2^{17}O and H_2^{18}O, toward the carbon-rich asymptotic giant branch star IRC+10216 (a.k.a. CW Leonis) using the HIFI instrument on the Herschel Space Observatory. This search was motivated by the fact that any detection of isotopic enhancement in the H_2^{17}O and H_2^{18}O abundances would have strongly implicated CO photodissociation as the source of the atomic oxygen needed to produce water in a carbon-rich circumstellar envelope. Our observations place an upper limit of 1/470 on the H_2^{17}O/H_2^{16}O abundance ratio. Given the isotopic 17O/16O ratio of 1/840 inferred previously for the photosphere of IRC+10216, this result places an upper limit of a factor 1.8 on the extent of any isotope-selective enhancement of H_2^{17}O in the circumstellar material, and provides an important constraint on any model that invokes CO photodissociation as the source of O for H2O production. In the context of the clumpy photodissociation model proposed previously for the origin of water in IRC+10216, our limit implies that 12C16O (not 13C16O or SiO) must be the dominant source of 16O for H2O production, and that the effects of self-shielding can only have reduced the 12C16O photodissociation rate by at most a factor ~2. Herschel is an ESA space observatory with science instruments provided by European-led Principal Investigator consortia and with important participation from NASA.

  5. EFSA Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids (CEF); Scientific Opinion on Flavouring Group Evaluation 218, Revision 1 (FGE.218Rev1): alpha,beta-Unsaturated aldehydes and precursors from subgroup 4.2 of FGE.19: Furfural derivatives

    DEFF Research Database (Denmark)

    Larsen, John Christian; Nørby, Karin Kristiane; Beltoft, Vibe Meister;

    and aliphatic saturated carboxylic acids [FL-no: 13.057, 13.062, 13.067, 13.068 and 13.128]. In the previous version of this Opinion, FGE.218, the Panel had expressed the following view. The five furfuryl esters are anticipated to be hydrolysed to furfuryl alcohol (and carboxylic acids). Furfuryl...... that 5-methylfurfural [FL-no: 13.001] can be oxidised to the primary alcohol 5-hydroxymethylfurfural [FL-no: 13.139]. 5-Hydroxymethylfurfural has been evaluated by EFSA in FGE.13 dealing with furfuryl and furan derivatives. In the latter Opinion, it was concluded that since 5-hydroxymethylfurfural may...

  6. Continuous monitoring α-activity on aerosol filters by the pseudo-coincidence-technique. Explicitly taking into account the short lived Po-218 activity; Kontinuierliche Ueberwachung der α-Aktivitaet eines Aerosolfilters mit der Pseudokoinzidenzmesstechnik. Explizite Beruecksichtigung der kurzlebigen Po-218 Aktivitaetsbeitraaege

    Energy Technology Data Exchange (ETDEWEB)

    Kraut, W.; Schwarz, W. [Duale Hochschule Baden-Wuerttemberg (DHBW), Karlsruhe (Germany). Studiengang Sicherheitswesen; Kraut, B. [Berthold Technologies GmbH und Co.KG, Bad Wildbad (Germany)

    2015-07-01

    Pseudo-coincidence-technique is applied to continuous monitoring of α-activity on aerosolfilters by proportional counters. Filter activity can markedly increase or decrease by changing air conditions especially by the amount of short lived Po-218 activity. Conditions of constant proportions of activity concentrations for the short lived species for operating this technique are seldom fulfilled. The dynamic behavior of artificial (long lived) and natural (short lived) activity is mathematically modelled and the measured moving count rates are analyzed under this model by a multivariate regression analysis for activity concentrations of artificial resp. short lived activity. Results are compared to standard recommendations of DIN ISO 11929.

  7. Standardized uptake value of 2-[(18)F] fluoro-2-deoxy-D-glucose in predicting outcome in head and neck carcinomas treated by radiotherapy with or without chemotherapy

    OpenAIRE

    Allal, Abdelkarim Said; Dulguerov, Pavel; Allaoua, Mohamed Ghoulem; Haenggeli, Charles-André; El-Ghazi, El Abbes; Lehmann, Willy; Slosman, Daniel O.

    2002-01-01

    In patients with head and neck cancer enrolled onto a prospective study of positron emission tomography (PET), pretreatment 2-[(18)F] fluoro-2- deoxy-D-glucose (FDG) uptake was evaluated as a predictor of local control and disease-free survival (DFS) after treatment by radiotherapy (RT) with or without chemotherapy.

  8. Cortical synaptic transmission in CaV2.1 knockin mice with the S218L missense mutation which causes a severe familial hemiplegic migraine syndrome in humans.

    Directory of Open Access Journals (Sweden)

    Dania eVecchia

    2015-02-01

    Full Text Available Familial hemiplegic migraine type 1 (FHM1 is caused by gain-of-function mutations in CaV2.1 (P/Q-type Ca2+ channels. Knockin (KI mice carrying the FHM1 R192Q missense mutation show enhanced cortical excitatory synaptic transmission at pyramidal cell synapses but unaltered cortical inhibitory neurotransmission at fast-spiking interneuron synapses. Enhanced cortical glutamate release was shown to cause the facilitation of cortical spreading depression (CSD in R192Q KI mice. It, however, remains unknown how other FHM1 mutations affect cortical synaptic transmission. Here, we studied neurotransmission in cortical neurons in microculture from KI mice carrying the S218L mutation, which causes a severe FHM syndrome in humans and an allele-dosage dependent facilitation of experimental CSD in KI mice, which is larger than that caused by the R192Q mutation. We show gain-of-function of excitatory neurotransmission, due to increased action-potential evoked Ca2+ influx and increased probability of glutamate release at pyramidal cell synapses, but unaltered inhibitory neurotransmission at multipolar interneuron synapses in S218L KI mice. In contrast with the larger gain-of-function of neuronal CaV2.1 current in homozygous than heterozygous S218L KI mice, the gain-of-function of evoked glutamate release, the paired-pulse ratio and the Ca2+ dependence of the EPSC were all similar in homozygous and heterozygous S218L KI mice, suggesting compensatory changes in the homozygous mice. Furthermore, we reveal a unique feature of S218L KI cortical synapses which is the presence of a fraction of mutant CaV2.1 channels being open at resting potential. Our data suggest that, while the gain-of-function of evoked glutamate release may explain the facilitation of CSD in heterozygous S218L KI mice, the further facilitation of CSD in homozygous S218L KI mice is due to other CaV2.1-dependent mechanisms, that likely include Ca2+ influx at voltages sub-threshold for action

  9. Low-Level Burial Grounds dangerous waste permit application: Request for exemption from lined trench requirements and from land disposal restrictions for residual liquid at 218-E-12B Burial Ground Trench 94

    International Nuclear Information System (INIS)

    This document has been prepared and is being submitted to the respective agencies to satisfy three objectives of the US Department of Energy (DOE) Richland Field Office (DOE-RL) concerning Trench 94 of the 218-E-12B Burial Ground. The 218-E-12B Burial Ground is located in the 200 East Area of the Hanford Facility. Figure 1-1 shows the general location of the Hanford Site. The 218-E-12B Burial Ground is one of eight burial grounds included in the Low-Level Burial Grounds (LLBG), a treatment, storage and/or disposal (TSD) unit. Decommissioned, defueled naval submarine reactor compartments (SRCs) contain radioactivity caused by exposure of structural components to neutrons during normal operation of the submarines. After all the alternatives were evaluated in the US Department of the Navy 1984 environmental impact statement (EIS) (USN 1984), land burial of the SRCs was selected as the preferred disposal option. The SRCs currently are sent to Trench 94 of the 218-E-12B Burial Ground. In addition to radioactivity, the SRCs disposed in. The DOE-RL's three objectives in preparing and submitting this document are as follows. Request from Ecology an exemption from dangerous waste landfill liner and leachate collection and removal system (hereinafter referred to as liner/leachate system) requirements for Trench 94 of the 218-E-12B Burial Ground. Petition Ecology to exempt residual liquid in the SRCs from land disposal restrictions. Obtain EPA Region 10 review and comment on the request to Ecology for exemption from liner/leachate system requirements

  10. Titan's surface at 2.18-cm wavelength imaged by the Cassini RADAR radiometer: Results and interpretations through the first ten years of observation

    Science.gov (United States)

    Janssen, M. A.; Le Gall, A.; Lopes, R. M.; Lorenz, R. D.; Malaska, M. J.; Hayes, A. G.; Neish, C. D.; Solomonidou, A.; Mitchell, K. L.; Radebaugh, J.; Keihm, S. J.; Choukroun, M.; Leyrat, C.; Encrenaz, P. J.; Mastrogiuseppe, M.

    2016-05-01

    A comprehensive calibration and mapping of the thermal microwave emission from Titan's surface is reported based on radiometric data obtained at 2.18-cm wavelength by the passive radiometer included in the Cassini RADAR instrument. Compared to previous work, the present results incorporate the much larger data set obtained in the approximately ten years following Saturn Orbit Insertion. Brightness temperature data including polarization were accumulated by segments in Titan passes from Ta (October 2004) through T98 (February 2014). The observational segments were analyzed to produce a mosaic of effective dielectric constant based on the measurement of thermal polarization covering 76% of the surface, and brightness temperature at normal incidence covering Titan's entire surface. As part of the mosaicking process we also solved for the seasonal variation of physical temperature with latitude, which we found to be smaller by a factor of 0.87 ± 0.05 in relative amplitude compared to that reported in the thermal infrared by Cassini's Composite Infrared Spectrometer (CIRS). We used the equatorial temperature obtained by the Huygens probe and the seasonal dependence with latitude from CIRS to convert the brightness mosaic to absolute emissivity, from which we could infer global thermophysical properties of the surface in combination with the dielectric mosaic. We see strong evidence for subsurface (volume) scattering as a dominant cause of the radar reflectivity in bright regions, and elsewhere a surface composition consistent with the slow deposition and processing of organic compounds from the atmosphere. The presence of water ice in the near subsurface is strongly indicated by the high degree of volume scattering observed in radar-bright regions (e.g., Hummocky/mountainous terrains) constituting ∼10% of Titan's surface. A thermal analysis allowed us to infer a mean 2.18-cm emission depth in the range 40-100 cm for the dominant radar-dark terrains (the remainder of

  11. The L1495-B218 filaments in Taurus seen in NH3 & CCS and Dynamical Stability of Filaments and Dense Cores

    Science.gov (United States)

    Seo, Youngmin

    2016-01-01

    We present deep NH3 map of L1495-B218 filaments and the dense cores embedded within the filaments in Taurus. The L1495-B218 filaments form an interconnected, nearby, large complex extending 8 pc. We observed the filaments in NH3 (1,1) & (2,2) and CCS 21-10 with spectral resolution of 0.038 km/s and spatial resolution of 31". The CSAR algorithm, which is a hybrid of seeded-watershed and binary dendrogram algorithm, identifies 39 leaves and 16 branches in NH3 (1,1). Applying a virial analysis for the 39 NH3 leaves, we find only 9 out of 39 leaves are gravitationally bound, and 12 out of 30 gravitationally unbound leaves are pressure-confined. Our analysis suggests that a dense core may form as a pressure-confined structure, evolve to a gravitationally bound core, and then undergo collapse to form a protostar (Seo et al. 2015).We also present more realistic dynamic stability conditions for dense cores with converging motions and under the influence of radiation pressure. The critical Bonnor-Ebert sphere and the isothermal cylinder have been widely used to test stability of dense cores and filaments; however, these assume a quiescent environment while actual star forming regions are turbulent and illuminated by radiation. In a new analysis of stability conditions we account for converging motions which have been modeled toward starless cores (Seo et al. 2011) and the effect of radiation fields into account. We find that the critical size of a dense core having a homologous converging motion with its peak speed being the sound speed is roughly half of the critical size of the Bonnor-Ebert sphere (Seo et al. 2013). We also find that the critical mass/line density of a dense core/filament irradiated by radiation are considerably smaller than that of the Bonnor-Ebert sphere/isothermal cylinder when the radiation pressure is stronger than the central gas pressure of dense core/isothermal cylinder. For inner Galactic regions and regions near OB associations, the critical

  12. The Ks-band Tully–Fisher Relation – A Determination of the Hubble Parameter from 218 ScI Galaxies and 16 Galaxy Clusters

    Indian Academy of Sciences (India)

    David G. Russell

    2009-06-01

    The value of Hubble parameter (H0) is determined using the morphologically type dependent Ks-band Tully–Fisher Relation (K-TFR). The slope and zero point are determined using 36 calibrator galaxies with ScI morphology. Calibration distances are adopted from direct Cepheid distances, and group or companion distances derived with the Surface Brightness Fluctuation Method or Type Ia Supernova. It is found that a small morphological type effect is present in the K-TFR such that ScI galaxies are more luminous at a given rotational velocity than Sa/Sb galaxies and Sbc/Sc galaxies of later luminosity classes. Distances are determined to 16 galaxy clusters and 218 ScI galaxies with minimum distances of 40.0 Mpc. From the 16 galaxy clusters a weighted mean Hubble parameter of H0 = 84.2 ± 6 km s-1 Mpc-1 is found. From the 218 ScI galaxies a Hubble parameter of H0 = 83.4 ± 8 km s-1 Mpc-1 is found. When the zero point of K-TFR is corrected to account for recent results that find a Large Magellanic Cloud distance modulus of 18.39 × 0.05, a Hubble parameter of 88.0 ± 6 km s-1 Mpc-1 is found. Effects from Malmquist bias are shown to be negligible in this sample as galaxies are restricted to a minimum rotational velocity of 150 km s-1. It is also shown that the results of this study are negligibly affected by the adopted slope for the K-TFR, inclination binning, and distance binning. A comparison with the results of the Hubble Key Project (Freedman et al. 2001) is made. Discrepancies between the K-TFR distances and the HKP I-TFR distances are discussed. Implications for -CDM cosmology are considered with H0 = 84 km s-1 Mpc-1. It is concluded that it is very difficult to reconcile the value of H0 found in this study with ages of the oldest globular clusters and matter density of the universe derived from galaxy clusters in the context of -CDM cosmology.

  13. Early Treatment Response Monitoring Using 2-Deoxy-2-[18F]fluoro-D-glucose Positron Emission Tomography Imaging during Fractionated Radiotherapy of Head Neck Cancer Xenografts

    Directory of Open Access Journals (Sweden)

    Jiayi Huang

    2014-01-01

    Full Text Available Background. To determine the optimal timing and analytic method of 2-deoxy-2-[18F]fluoro-D-glucose positron emission tomography (PET imaging during fractionated radiotherapy (RT to predict tumor control. Methods. Ten head neck squamous cell carcinoma xenografts derived from the UT-14-SCC cell line were irradiated with 50 Gy at 2 Gy per day over 5 weeks. Dynamic PET scans were acquired over 70 minutes at baseline (week 0 and weekly for seven weeks. PET data were analyzed using standard uptake value (SUV, retention index (RI, sensitivity factor (SF, and kinetic index (Ki. Results. Four xenografts had local failure (LF and 6 had local control. Eighty scans from week 0 to week 7 were analyzed. RI and SF after 10 Gy appeared to be the optimal predictors for LF. In contrast, SUV and Ki during RT were not significant predictors for LF. Conclusion. RI and SF of PET obtained after the first week of fractionated RT were the optimal methods and timing to predict tumor control.

  14. Chelator-Accelerated One-Pot ‘Click’ Labeling of Small Molecule Tracers with 2-[18F]Fluoroethyl Azide

    Directory of Open Access Journals (Sweden)

    Erik Årstad

    2013-05-01

    Full Text Available 2-[18F]Fluoroethyl azide ([18F]FEA can readily be obtained by nucleophilic substitution of 2-azidoethyl-4-toluenesulfonate with [18F]fluoride (half-life 110 min, and has become widely used as a reagent for ‘click’ labeling of PET tracers. However, distillation of [18F]FEA is typically required, which is time-consuming and unpractical for routine applications. In addition, copper(I-catalyzed cycloaddition of [18F]FEA with non-activated alkynes, and with substrates containing labile functional groups, can be challenging. Herein, we report a highly efficient and practical ligand-accelerated one-pot/two-step method for ‘click’ labeling of small molecule tracers with [18F]FEA. The method exploits the ability of the copper(I ligand bathophenanthrolinedisulfonate to accelerate the rate of the cycloaddition reaction. As a result, alkynes can be added directly to the crude reaction mixture containing [18F]FEA, and as cyclisation occurs almost immediately at room temperature, the reaction is tolerant to labile functional groups. The method was demonstrated by reacting [18F]FEA with a series of alkyne-functionalized 6-halopurines to give the corresponding triazoles in 55–76% analytical radiochemical yield.

  15. Functional analysis of three amino acid residues of purR re-pressor, Trp147, Gln-218 and Gln-292 in Salmonella typhi-murium

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The amber mutation sites of 6 purR(am) mutants were determined bycloning and DNA sequencing. The results showed that the mutations were distributed at three different sites in PurR coding region, G721(→A), C933(→T) and C1155(→T), which respectively turn Trp-147,Gln-218 and Gln-292 of PurR into TAG terminal codon. To determine the effect of the three amino acid residues on regulatory function of PurR protein 5 different kinds of tRNA suppressor genes, Su3, Su4, Su6, Su7 and Su9 were used for creating the PurR protein variants with single amino acid substitution. The results indicated that Cys, Glu, Gly, His and Arg which substituted Trp-147 respectively all could not recover the regulation function of PurR. It confirmed that Trp-147 is a critical amino acid for the PurR function. Gln-292 substituted respectively by the same amino acids also could not recover the PurR function, demonstrating that Gln-292 is also an important amino acid residue in PurR.

  16. Preliminary Thermal Modeling of Hi-Storm 100S-218 Version B Storage Modules at Hope Creek Nuclear Power Station ISFSI

    Energy Technology Data Exchange (ETDEWEB)

    Cuta, Judith M.; Adkins, Harold E.

    2013-08-30

    This report fulfills the M3 milestone M3FT-13PN0810022, “Report on Inspection 1”, under Work Package FT-13PN081002. Thermal analysis is being undertaken at Pacific Northwest National Laboratory (PNNL) in support of inspections of selected storage modules at various locations around the United States, as part of the Used Fuel Disposition Campaign of the U.S. Department of Energy, Office of Nuclear Energy (DOE-NE) Fuel Cycle Research and Development. This report documents pre-inspection predictions of temperatures for four modules at the Hope Creek Nuclear Generating Station ISFSI that have been identified as candidates for inspection in late summer or early fall/winter of 2013. These are HI-STORM 100S-218 Version B modules storing BWR 8x8 fuel in MPC-68 canisters. The temperature predictions reported in this document were obtained with detailed COBRA-SFS models of these four storage systems, with the following boundary conditions and assumptions.

  17. A novel radiochemical approach to 1-(2'-deoxy-2'-[(18) F]fluoro-β-d-arabinofuranosyl)cytosine ((18) F-FAC).

    Science.gov (United States)

    Meyer, Jan-Philip; Probst, Katrin C; Trist, Iuni M L; McGuigan, Christopher; Westwell, Andrew D

    2014-09-01

    (18) F-FAC (1-(2'-deoxy-2'-[(18) F]fluoro-β-D-arabinofuranosyl)-cytosine) is an important 2'-fluoro-nucleoside-based positron emission tomography (PET) tracer that has been used for in vivo prediction of response to the widely used cancer chemotherapy drug gemcitabine. Previously reported synthetic routes to (18) F-FAC have relied on early introduction of the (18) F radiolabel prior to attachment to protected cytosine base. Considering the (18) F radiochemical half-life (110 min) and the technical challenges of multi-step syntheses on PET radiochemistry modular systems, late-stage radiofluorination is preferred for reproducible and reliable radiosynthesis with in vivo applications. Herein, we report the first late-stage radiosynthesis of (18) F-FAC. Cytidine derivatives with leaving groups at the 2'-position are particularly prone to undergo anhydro side-product formation upon heating because of their electron density at the 2-carbonyl pyrimidone oxygen. Our rationally developed fluorination precursor showed an improved reactivity-to-stability ratio at elevated temperatures. (18) F-FAC was obtained in radiochemical yields of 4.3-5.5% (n = 8, decay-corrected from end of bombardment), with purities ≥98% and specific activities ≥63 GBq/µmol. The synthesis time was 168 min. PMID:25257474

  18. Validity of positron emission tomography (PET) using 2-deoxy-2-[18F]fluoro-D-glucose (FDG) in patients with renal cell carcinoma (preliminari report)

    International Nuclear Information System (INIS)

    Positron emission tomography (PET) using 2-deoxy-2-[18F]fluoro-D-glucose (FDG) was carried out in 6 patients with renal tumors (5 renal cell carcinomas including one patient in whom the primary renal lesion was nephrectomized and 1 angiomyolipoma) and FDG accumulation was evaluated in the tumor lesion as a ''hot spot''. In dynamic images after 16 min. FDG accumulated in the tumor portion in 3 out of 4 patients with renal cell carcinoma. However, there was no accumulation in one renal cell carcinoma in which marked necrosis was histologically found. FDG accumulation was not evident in the tumorous lesion of angiomyolipoma. FDG accumulation was also noticed in the metastatic lesion of renal cell carcinoma in the liver or retroperitoneal lymph node. A gradual increase of FDG activity in the lesion of renal cell carcinoma was clearly demonstrated in the time-radioactivity curve, while activities rapidly decreased in renal cortex and pelvis, and liver. In the healthy portion of the kidney, FDG is filtered from the glomerulus and is not reabsorbed from the tubulus and is excreted in the collecting system. On the contrary, FDG, catalyzed by hexokinase, is phospholylated to FDG-6-phosphate which accumulates in the tumor tissue. PET using FDG can provide a new insight for understanding biological activity of renal cell carcinoma from the point of glucose metabolism in tumor tissue. (author)

  19. Crossed cerebellar diaschisis. A positron emission tomography study with L-[methyl-11C]methionine and 2-deoxy-2-[18F]fluoro-D-glucose

    International Nuclear Information System (INIS)

    Crossed cerebellar diaschisis (CCD) is defined as a depression of blood flow and oxidative metabolism of glucose in the cerebellum contralateral to a supratentorial brain lesion, as detected with positron emission tomography (PET) and single photon emission computed tomography. We examined whether L-[methyl-11C]methionine (MET) uptake is affected in CCD. In 12 patients with a unilateral supratentorial brain tumor, we evaluated the uptake of 2-deoxy-2-[18F]fluoro-D-glucose (FDG) and MET in the cerebellar hemispheres by means of PET. Asymmetry index (AI) was defined as a difference in the average count between the ipsilateral and contralateral cerebellar hemispheres divided by the average count in both cerebellar hemispheres. Patients with AI of FDG PET more than 0.1 and those with AI equal to 0.1 or less than 0.1 were classified as CCD-positive and CCD-negative, respectively. Six patients were CCD-positive and others were CCD-negative in the FDG PET study. Between CCD-positive and CCD-negative patients, mean AI of MET was not significantly different (0.017±0.023 and 0.014±0.039, respectively). Different from glucose metabolism, cerebellar MET uptake was not affected in CCD. The present study may indicate that cerebellar MET uptake is independent of suppression of cerebellar neuronal activity. (author)

  20. Synthesis of O-(2-[18F]fluoroethyl)-L-tyrosine and its biological evaluation in B16 melanoma-bearing mice as PET tracer for tumor imaging

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    O-(2-[18F]fluoroethyl) -L-tyrosine([18F]FET) ,a fluorine-18 labeled analogue of tyrosine,has been syn-thesized and biologically evaluated in tumor-bearing mice. The whole synthesis procedure is com-pleted within 50 min. The radiochemical yield is about 40%(no decay corrected) and radiochemical purity more than 97% after simplified solid phase extraction. [18F]FET shows rapid,high uptake and long retention in the tumor as well as low uptake in the brain. The ratios of tumor-to-muscle(T/M) and tumor-to-blood(T/B) of [18F]FET are similar to those of [18F]FDG,but the ratios of tumor-to-brain(T/Br) are 2-3 times higher than that of [18F]FDG. Autoradiography of [18F]FET demonstrates a remarkable accumulation in melanoma with high contrast. It appears to be a probable competitive candidate for melanoma imaging with PET.

  1. Synthesis of O-(2-[18F]fluoroethyl)-L-tyrosine and its biological evaluation in B16 melanoma-bearing mice as PET tracer for tumor imaging

    Institute of Scientific and Technical Information of China (English)

    WANG MingWei; YIN DuanZhi; LI ShiQiang; WANG YongXian

    2007-01-01

    O-(2-[18F]fluoroethyl)-L-tyrosine ([18F]FET), a fluorine-18 labeled analogue of tyrosine, has been synthesized and biologically evaluated in tumor-bearing mice. The whole synthesis procedure is completed within 50 min. The radiochemical yield is about 40% (no decay corrected) and radiochemical purity more than 97% after simplified solid phase extraction. [18F]FET shows rapid, high uptake and long retention in the tumor as well as low uptake in the brain. The ratios of tumor-to-muscle (T/M) and tumor-to-blood (T/B) of [18F]FET are similar to those of [18F]FDG, but the ratios of tumor-to-brain (T/Br)are 2-3 times higher than that of [18F]FDG. Autoradiography of [18F]FET demonstrates a remarkable accumulation in melanoma with high contrast. It appears to be a probable competitive candidate for melanoma imaging with PET.

  2. Line position and line intensity analyses of the high-resolution spectrum of H218O up to the First Triad and J = 17

    Science.gov (United States)

    Coudert, L. H.; Chelin, P.

    2016-08-01

    Line position and line intensity analyses of the high-resolution spectrum of the H218O isotopic species of the water molecule are performed with the Bending-Rotation approach up to J = 17 and the First Triad of interacting states, (0 2 0), (1 0 0), and (0 0 1). The line position analysis involves microwave and terahertz transitions, ground state combination differences, far infrared and infrared lines, and experimental energy levels which were reproduced with a 1.2 unitless standard deviation. The data set considered in the line intensity analysis consists of 3707 infrared transitions recorded using absorption spectroscopy at room temperature which were fitted with a 1.4 unitless standard deviation. The results of both analyses are compared with previous investigations and are used to build a line position and line intensity database to update the HITRAN and GEISA databases. A comparison with the HITRAN 2012 database reveals that the new database yields intensity values closer to the experimental ones.

  3. Assessment of diffuse Lewy body disease by 2-[18F]fluoro-2-deoxy-D-glucose positron emission tomography (FDG PET)

    International Nuclear Information System (INIS)

    Lewy body disease is, after Alzheimer's disease, the second most common cause of senile degenerative dementia with progressive cognitive deterioration, fluctuation of cognitive and motoric functions and psychotic symptoms. It is characterized histologically by the occurrence of Lewy bodies in allocortical, neocortical and subcortical structures. The aim of this study was to measure the cortical glucose metabolism using FDG PET (2-[18F]fluoro-2-deoxy-D-glucose position emission tomography) compared to normal subjects. Five patients (5 m, mean age 75 y) with clinically suspected diffuse Lewy body disease (DLB) were studied with FDG PET. PET studies of the head were performed with a Siemens ECAT-ART PET-scanner with attenuation correction using 137-Cs point sources. We found the same distribution pattern of diffuse glucose hypometabolism in the entire cortical region with relative sparing of the primary sensory-motor cortex in all the patients. The few cases reported in the literature so far describe findings similar to ours. The pattern of diffuse glucose hypometabolism in the entire cortex including the occipital region seems to be a typical feature of DLB that is distinctive from dementia of Alzheimer's disease

  4. Preparation of a fine powder of 2-deoxy-2-[18F]fluoro-D-glucose suitable for inhalation to diagnose lung diseases by means of PET

    International Nuclear Information System (INIS)

    Fine 2-deoxy-2[18F]fluoro-D-glucose (18FDG) powder was obtained by adding diethyl ether into a methyl alcohol solution of 18FDG and other sugar as seed. When micronized particles of sodium N-acetyl-neuraminate (Neu5Ac-Na) were used as seed crystals, particles containing 18FDG were obtained and 80% of them were smaller than 10μm in size. More than 60% of these crystals were 4-6μm in size. In a preclinical study of forced inhalation in a dog, the 18FDG fine powder was mainly distributed in the trachea. The radioactivity in the trachea then increased once and a gradual decrease followed. The radioactivity was transferred into the blood and radioactivity incorporation into the heart was observed. After a normal volunteer inhaled 18FDG dry powder aerosol, the radioactivity was found in the respiratory tract and the peripheral area of the lung by means of PET. Absorption and in vivo dynamics of the 18FDG were also analysed. (author)

  5. miR-7 and miR-218 epigenetically control tumor suppressor genes RASSF1A and Claudin-6 by targeting HoxB3 in breast cancer

    International Nuclear Information System (INIS)

    Highlights: ► Both miR-7 and miR-218 down-regulates HoxB3 expression by targeting the 3′-UTR of HoxB3 mRNA. ► A reverse correlation between the levels of endogenous miR-7, miR218 and HoxB3 expression. ► Epigenetic changes involve in the reactivation of HoxB3. ► Both miRNAs inhibits the cell cycle and clone formation of breast cancer cells. -- Abstract: Many microRNAs have been implicated as key regulators of cellular growth and differentiation and have been found to dysregulate proliferation in human tumors, including breast cancer. Cancer-linked microRNAs also alter the epigenetic landscape by way of DNA methylation and post-translational modifications of histones. Aberrations in Hox gene expression are important for oncogene or tumor suppressor during abnormal development and malignancy. Although recent studies suggest that HoxB3 is critical in breast cancer, the putative role(s) of microRNAs impinging on HoxB3 is not yet fully understood. In this study, we found that the expression levels of miR-7 and miR-218 were strongly and reversely associated with HoxB3 expression. Stable overexpression of miR-7 and miR-218 was accompanied by reactivation of tumor suppressor genes including RASSF1A and Claudin-6 by means of epigenetic switches in DNA methylation and histone modification, giving rise to inhibition of the cell cycle and clone formation of breast cancer cells. The current study provides a novel link between overexpression of collinear Hox genes and multiple microRNAs in human breast malignancy.

  6. Documentation associated with the shipping of Hot-Cell Waste from WESF 225-B to the 200W (218-W-3AE) burial grounds under shipment number RSR-37338

    International Nuclear Information System (INIS)

    The purpose of this report is to compile the records generated during the Packaging and Shipping of WESF Hot-Cell Waste from the 225-B Facility to 200W (218-W-3AE) burial grounds. A total of six 55-gallon drums were packaged and shipped using the Chem-Nuc Cask in accordance with WHC-SD-TP-SARP-025, Rev.0 ''Safety Analysis Report for Packaging (Onsite) for Type B Material in the CNS-14-215H Cask''

  7. IUPAC critical evaluation of the rotational–vibrational spectra of water vapor. Part IV. Energy levels and transition wavenumbers for D216O, D217O, and D218O

    International Nuclear Information System (INIS)

    This paper is the fourth of a series of papers reporting critically evaluated rotational–vibrational line positions, transition intensities, pressure dependences, and energy levels, with associated critically reviewed assignments and uncertainties, for all the main isotopologues of water. This paper presents energy level and transition data for the following doubly and triply substituted isotopologues of water: D216O, D217O, and D218O. The MARVEL (Measured Active Rotational–Vibrational Energy Levels) procedure is used to determine the levels, the lines, and their self-consistent uncertainties for the spectral regions 0–14 016, 0–7969, and 0–9108 cm−1 for D216O, D217O, and D218O, respectively. For D216O, D217O, and D218O, 53 534, 600, and 12 167 lines are considered, respectively, from spectra recorded in absorption at room temperature and in emission at elevated temperatures. The number of validated energy levels is 12 269, 338, and 3351 for D216O, D217O, and D218O, respectively. The energy levels have been checked against the ones determined, with an average accuracy of about 0.03 cm−1, from variational rovibrational computations employing exact kinetic energy operators and an accurate potential energy surface. Furthermore, the rovibrational labels of the energy levels have been validated by an analysis of the computed wavefunctions using the rigid-rotor decomposition (RRD) scheme. The extensive list of MARVEL lines and levels obtained is deposited in the Supplementary Material of this paper, in a distributed information system applied to water, W@DIS, and on the official MARVEL website, where they can easily be retrieved. - Highlights: • All published transitions are collected and analyzed. • A set of validated rovibrational transitions are presented. • Experimental energy levels for all three D2O isotopologues are determined. • Synthetic spectra are presented using these validated energy levels

  8. Process for producing astatine-211 for radiopharmaceutical use

    International Nuclear Information System (INIS)

    A one-step chemical manipulation is described in combination with a distillation and collection process for producing At-211 comprising; a. providing a target of irradiated Bismuth coated to a predetermined thickness of a backing member, b. providing a vapor-producing still operably connected with a condenser that has a water cooled condensate collector formed of a dry silica gel mesh maintained at a temperature above the freezing point of water, and providing an effluent gas filter that is operably connected to receive effluent gas from the condenser, c. heating the target in the still at a temperature in the range of about 6300-6800C for a time period in the range of 50 to 80 minutes, to evole At-211 vapor from the target, c. providing a dry carrier gas having an oxygen concentration that is sufficient to form Bi/sub 2/O/sub 3/ thereby to essentially preclude vaporization of Bi metal, passing the carrier gas through the still to carry the At-211 vapor to the condenser, and to carry effluent from the condenser to the effluent gas filter, e. eluting At-211 from the condensate collector of the condenser with a controlled volume of eluent containing predetermined solvents that are compatible with a given desired radiopharmaceutical procedure, and f. collecting the At-211 in the controlled volume of eluent for use in the given radiopharmaceutical procedure

  9. Sick-leave track record and other potential predictors of a disability pension. A population based study of 8,218 men and women followed for 16 years

    Directory of Open Access Journals (Sweden)

    Rosengren Annika

    2009-04-01

    Full Text Available Abstract Background A number of previous studies have investigated various predictors for being granted a disability pension. The aim of this study was to test the efficacy of sick-leave track record as a predictor of being granted a disability pension in a large dataset based on subjects sampled from the general population and followed for a long time. Methods Data from five ongoing population-based Swedish studies was used, supplemented with data on all compensated sick leave periods, disability pensions granted, and vital status, obtained from official registers. The data set included 8,218 men and women followed for 16 years, generated 109,369 person years of observation and 97,160 sickness spells. Various measures of days of sick leave during follow up were used as independent variables and disability pension grant was used as outcome. Results There was a strong relationship between individual sickness spell duration and annual cumulative days of sick leave on the one hand and being granted a disability pension on the other, among both men and women, after adjustment for the effects of marital status, education, household size, smoking habits, geographical area and calendar time period, a proxy for position in the business cycle. The interval between sickness spells showed a corresponding inverse relationship. Of all the variables studied, the number of days of sick leave per year was the most powerful predictor of a disability pension. For both men and women 245 annual sick leave days were needed to reach a 50% probability of transition to disability. The independent variables, taken together, explained 96% of the variation in disability pension grantings. Conclusion The sick-leave track record was the most important predictor of the probability of being granted a disability pension in this study, even when the influences of other variables affecting the outcome were taken into account.

  10. 2-[18F]-fluoro-2-desoxy-D-glucose positron emission tomography initial staging impacts on survival in Hodgkin lymphoma

    Institute of Scientific and Technical Information of China (English)

    Juliano; J; Cerci; Camila; C; G; Linardi; Luís; F; Pracchia; José; Soares; Junior; Evelinda; Trindade; Dominique; Delbeke; Rodrigo; J; Cerci; Robert; Carr; José; C; Meneghetti; Valeria; Buccheri

    2013-01-01

    AIM:To assess the prognostic value and risk classification improvement of metabolic staging(MS)with Initial2-[18F]-fluoro-2-desoxy-D-glucose positron emission tomography(FDG-PET)in initial staging of Hodgkin’s Lymphoma(HL)patients to predict 5 years overall survival(5y-OS)and event free survival(EFS).METHODS:A total of 275 patients were included in this retrospective study,155 patients were staged with conventional anatomical staging(AS),and 120 also submitted to MS(FDG-PET).Prognostic analysis compared 5y-OS and 5y-EFS of patients staged with AS and MS.Risk-adjusted models incorporated clinical risk factors,computed tomography and FDG-PET staging.RESULTS:During the follow up of 267 evaluated patients,220(122 AS and 98 MS)achieved complete remission after first-line therapy(median follow-up:70±29 mo),treatment failure occurred in 79 patients and 34 died.The 5y-EFS for early vs advanced disease in AS patients was 79.3%and 66.7%,and 85.6%and53.6%in MS patients,respectively(P<0.01).The5y-OS for early and advanced disease with AS was91.3%and 81.5%,and 97.5%and 80.7%for patients staged with MS,respectively.Cox proportional hazards analysis demonstrated that FDG-PET added signifcant prognostic information and improved risk prediction(P=0.02).CONCLUSION:Initial staging FDG-PET could be used as an accurate and independent predictor of OS and EFS in HL,with impact in 5y-EFS and OS.

  11. Efficient automated one-step synthesis of 2-[18F]fluoroethylcholine for clinical imaging: optimized reaction conditions and improved quality controls of different synthetic approaches

    International Nuclear Information System (INIS)

    [18F]-labelled choline analogues, such as 2-[18F]fluoroethylcholine (18FECH), have suggested to be a new class of choline derivatives highly useful for the imaging of prostate and brain tumours. In fact, tumour cells with enhanced proliferation rate usually exhibit an improved choline uptake due to the increased membrane phospholipids biosynthesis. The aim of this study was the development of a high yielding synthesis of 18FECH. The possibility of shortening the synthesis time by reacting all the reagents in a convenient and rapid one-step reaction was specially considered. Methods: 18FECH was synthesized by reacting [18F]fluoride with 1,2-bis(tosyloxy)ethane and N,N-dimethylaminoethanol. The synthesis was carried out using both a one- and a two-step reaction in order to compare the two procedures. The effects on the radiochemical yield and purity by using different [18F]fluoride phase transfer catalysts, reagents amounts and purification methods were assessed. Quality controls on the final products were performed by means of radio-thin-layer chromatography, gas chromatography and high-performance liquid chromatography equipped with conductimetric, ultraviolet and radiometric detectors. Results: In the optimized experimental conditions, 18FECH was synthesized with a radiochemical yield of 43±3% and 48±1% (not corrected for decay) when the two-step or the one-step approach were used, respectively. The radiochemical purity was higher than 99% regardless of the different synthetic pathways or purification methods adopted. The main chemical impurity was due to N,N-dimethylmorpholinium. The identity of this impurity in 18FECH preparations was not previously reported. Conclusion: An improved two-step and an innovative one-step reaction for synthesizing 18FECH in a high yield were reported. The adaptation of a multistep synthesis to a single step process, opens further possibilities for simpler and more reliable automations.

  12. Positron Emission Tomography with 2-Deoxy-2-[18F] Fluoro-DGlucose in the Detection of Malignancy in Intraductal Papillary Mucinous Neoplasms of the Pancreas

    Directory of Open Access Journals (Sweden)

    Brian KP Goh

    2007-05-01

    Full Text Available A 79-year-old Indian male was admitted with upper abdominal discomfort of 1-year duration which was associated with loss of weight and appetite. Clinical examination of the abdomen did not reveal any palpable masses. Laboratory investigations including a complete blood count, liver function tests and serum amylase were unremarkable. Standard serum tumor markers were within normal limits: carbohydrate antigen (CA 19-9, 13.4 U/mL (reference range: 3-45 U/mL; carcinoembryonic antigen (CEA, 1.4 μg/L (reference range: 0.5-3.5 μg/L and alphafetoprotein, 1.3 μg/L (reference range: 1-10 μg/L. A contrast-enhanced computed tomographic (CT scan demonstrated a cystically dilated and tortuous pancreatic duct measuring 1.9 cm, suggestive of an intraductal papillary mucinous neoplasm (IPMN. The common bile duct was dilated up to the level of the ampulla and a 3.2x2.0 cm heterogeneous soft tissue mass was observed in the head of the pancreas which extended into the duodenum, suggestive of a malignant lesion (Images 1 and 2. Fusion positron emission tomography/computed tomography (PET/CT was subsequently performed with 12.7 mCi of 2-deoxy-2-[18F] fluoro-D-glucose (18F-FDG administered intravenously. A whole body PET/CT scan was performed 60 minutes later with CT data used for attenuation correction and anatomical correlation. This confirmed a metabolically active focus within the pancreatic head mass with a standard uptake value (SUVmax of 3.5 compatible with carcinoma (Image 3.

  13. N-(N-benzylpiperidin-4-yl)-2-[18F]fluorobenzamide: A potential ligand for PET imaging of σ receptors

    International Nuclear Information System (INIS)

    Four nitro- and fluorobenzamides (1-4) have been synthesized in good yields from nitro- and fluoro-substituted benzoyl chloride with 4-amino-1-benzylpiperidine. In vitro studies showed that these compounds have high affinities to σ receptors. N-(N-Benzylpiperidin-4-yl)-2-fluorobenzamide (3), in particular, bound to σ receptors with high affinity (Ki = 3.4 nM, guinea pig brain membranes) and high selectivity (σ-2/σ-1 = 120). It was, therefore, labeled with 18F and evaluated as a σ receptor radioligand. N-(N-Benzylpiperidin-4-yl)-2-[18F]fluorobenzamide (3a) was synthesized in one step by nucleophilic substitution of the 2-nitro precursor (1) with [18F]fluoride in DMSO at 140 deg. C for 20 min followed by purification with HPLC in 4-10% yield (decay corrected). The synthesis time was 90 min and the specific activity was 0.4-1.0 Ci/μmol. Tissue distribution in mice revealed that the uptakes of 3a in the brain, heart, liver, lungs, spleen, kidneys and small intestine were high, and the radioactivity in these organs remained constant from 60 to 120 min post-injection. The radioactivity in the bone did not significantly increase, suggesting in vivo defluorination may not be the major route of metabolism of 3a in mice. Blocking studies with haloperidol in rats indicated that the uptake of compound 3a in the rat brain was selective to haloperidol-sensitive σ sites. These results suggest that compound 3a is a potent σ receptor radioligand and may be a potential ligand for PET imaging of σ receptors in humans

  14. Pharmacokinetics and metabolism of 2-[18F]fluoro-2-deoxy-d-glucose (FDG) in mammary tumors of antiestrogen-treated rats

    International Nuclear Information System (INIS)

    Attempts are being made to evaluate 2-[18F]fluoro-2-deoxy-d-glucose (FDG) as a noninvasive marker of therapy response in malignant tumors. We studied rats with 7,12-dimethylbenzanthracene (DMBA)-induced mammary carcinomas by measuring the differential absorption ratio (DAR) and the metabolites of FDG in tumor homogenates. Half the rats were treated with the antiestrogen toremifene for 14 days and half were untreated. The histology of the tumors was studied by morphometry. The animals were killed 15, 45 or 240 min after injection. Regardless of whether the rats received toremifene or not, the fractional change in tumor volume correlated better with the DAR at 15 min [r = 0.284 (untreated) and r = 0.721 (treated)] and at 240 min [r 0.932 (untreated)], than at 45 min [r = -0.137 (untreated) and r = 0.265 (treated)]. Inverse relations were found for the fraction of unmetabolized FDG and change in tumor volume [r = 0.070 (45 min) and r = -0.872 (240 min) for untreated tumors and r = -0.963 (15 min) and r = -0.715 (45 min) for treated tumors]. The DAR and the fraction of unmetabolized FDG correlated also [r = -0.420 (15 min), r = -0.647 (45 min) and r = -0.976 (240 min) for untreated tumors, and r = -0.963 (15 min) and r = -0.213 (45 min) for treated tumors]. No significant therapy-induced morphometrical changes were observed. These findings imply that the FDG-derived uptake of radioactivity (= DAR) does relate to the tumor's speed of growth shortly after injection and also after some time, but there is a time period in between (a 'twilight zone') when this correlation is poor. These findings may have implications for FDG-PET studies in cancer patients: the optimal imaging time may have to be reconsidered

  15. Reproducibility of O-(2-18F-fluoroethyl)-L-tyrosine uptake kinetics in brain tumors and influence of corticoid therapy: an experimental study in rat gliomas

    International Nuclear Information System (INIS)

    Positron emission tomography (PET) using O-(2-18F-fluoroethyl)-L-tyrosine (18F-FET) is a well-established method for the diagnostics of brain tumors. This study investigates reproducibility of 18F-FET uptake kinetics in rat gliomas and the influence of the frequently used dexamethasone (Dex) therapy. F98 glioma or 9L gliosarcoma cells were implanted into the striatum of 31 Fischer rats. After 10-11 days of tumor growth, the animals underwent dynamic PET after injection of 18F-FET (baseline). Thereafter, animals were divided into a control group and a group receiving Dex injections, and all animals were reinvestigated 2 days later. Tumor-to-brain ratios (TBR) of 18F-FET uptake (18-61 min p.i.) and the slope of the time-activity-curves (TAC) (18-61 min p.i.) were evaluated using a Volume-of-Interest (VOI) analysis. Data were analyzed by two-way repeated measures ANOVA and reproducibility by the intraclass correlation coefficient (ICC). The slope of the tumor TACs showed high reproducibility with an ICC of 0.93. A systematic increase of the TBR in the repeated scans was noted (3.7 ± 2.8 %; p < 0.01), and appeared to be related to tumor growth as indicated by a significant correlation of TBR and tumor volume (r = 0.77; p < 0.0001). After correction for tumor growth TBR showed high longitudinal stability with an ICC of 0.84. Dex treatment induced a significant decrease of the TBR (-8.2 ± 6.1 %; p < 0.03), but did not influence the slope of the tumor TAC. TBR of 18F-FET uptake and tracer kinetics in brain tumors showed high longitudinal stability. Dex therapy may induce a minor decrease of the TBR; this needs further investigation. (orig.)

  16. Physical activity attenuates the influence of FTO variants on obesity risk: a meta-analysis of 218,166 adults and 19,268 children.

    Directory of Open Access Journals (Sweden)

    Tuomas O Kilpeläinen

    2011-11-01

    Full Text Available The FTO gene harbors the strongest known susceptibility locus for obesity. While many individual studies have suggested that physical activity (PA may attenuate the effect of FTO on obesity risk, other studies have not been able to confirm this interaction. To confirm or refute unambiguously whether PA attenuates the association of FTO with obesity risk, we meta-analyzed data from 45 studies of adults (n = 218,166 and nine studies of children and adolescents (n = 19,268.All studies identified to have data on the FTO rs9939609 variant (or any proxy [r(2>0.8] and PA were invited to participate, regardless of ethnicity or age of the participants. PA was standardized by categorizing it into a dichotomous variable (physically inactive versus active in each study. Overall, 25% of adults and 13% of children were categorized as inactive. Interaction analyses were performed within each study by including the FTO×PA interaction term in an additive model, adjusting for age and sex. Subsequently, random effects meta-analysis was used to pool the interaction terms. In adults, the minor (A- allele of rs9939609 increased the odds of obesity by 1.23-fold/allele (95% CI 1.20-1.26, but PA attenuated this effect (p(interaction  = 0.001. More specifically, the minor allele of rs9939609 increased the odds of obesity less in the physically active group (odds ratio  = 1.22/allele, 95% CI 1.19-1.25 than in the inactive group (odds ratio  = 1.30/allele, 95% CI 1.24-1.36. No such interaction was found in children and adolescents.The association of the FTO risk allele with the odds of obesity is attenuated by 27% in physically active adults, highlighting the importance of PA in particular in those genetically predisposed to obesity.

  17. Glacial-interglacial changes in H218O, HDO and deuterium excess - results from the fully coupled ECHAM5/MPI-OM Earth system model

    Science.gov (United States)

    Werner, M.; Haese, B.; Xu, X.; Zhang, X.; Butzin, M.; Lohmann, G.

    2016-02-01

    In this study we present the first results of a new isotope-enabled general circulation model set-up. The model consists of the fully coupled ECHAM5/MPI-OM atmosphere-ocean model, enhanced by the JSBACH interactive land surface scheme and an explicit hydrological discharge scheme to close the global water budget. Stable water isotopes H218O and HDO have been incorporated into all relevant model components. Results of two equilibrium simulations under pre-industrial and Last Glacial Maximum conditions are analysed and compared to observational data and paleoclimate records for evaluating the model's performance in simulating spatial and temporal variations in the isotopic composition of the Earth's water cycle. For the pre-industrial climate, many aspects of the simulation results of meteoric waters are in good to very good agreement with both observations and earlier atmosphere-only simulations. The model is capable of adequately simulating the large spread in the isotopic composition of precipitation between low and high latitudes. A comparison to available ocean data also shows a good model-data agreement; however, a strong bias of overly depleted ocean surface waters is detected for the Arctic region. Simulation results under Last Glacial Maximum boundary conditions also fit to the wealth of available isotope records from polar ice cores, speleothems, as well as marine calcite data. Data-model evaluation of the isotopic composition in precipitation reveals a good match of the model results and indicates that the temporal glacial-interglacial isotope-temperature relation was substantially lower than the present spatial gradient for most mid- to high-latitudinal regions. As compared to older atmosphere-only simulations, a remarkable improvement is achieved for the modelling of the deuterium excess signal in Antarctic ice cores. Our simulation results indicate that cool sub-tropical and mid-latitudinal sea surface temperatures are key for this progress. A recently

  18. Glacial–interglacial changes of H218O, HDO and deuterium excess – results from the fully coupled Earth System Model ECHAM5/MPI-OM

    Directory of Open Access Journals (Sweden)

    M. Werner

    2015-10-01

    Full Text Available In this study we present first results of a new isotope-enabled general circulation model setup. The model consists of a fully coupled atmosphere–ocean model ECHAM5/MPI-OM, enhanced by the interactive land surface scheme JSBACH and an explicit hydrological discharge scheme to close the global water budget. Stable water isotopes H218O and HDO have been incorporated into all relevant model components. Results of two equilibrium simulations under pre-industrial and last glacial maximum conditions are analysed and compared to observational data and paleoclimate records for evaluating the model's performance of simulating spatial and temporal variations in the isotopic composition of the Earth's water cycle. For the pre-industrial climate, many aspects of the simulation results of meteoric waters are in good to very good agreement with both observations and earlier atmosphere-only simulations. The model is capable of adequately simulating the large spread in the isotopic composition of precipitation between low and high latitudes. A comparison to available ocean data also shows a good model-data agreement, however a strong bias of too depleted ocean surface waters is detected for the Arctic region. Simulation results under last glacial maximum boundary conditions also fit to the wealth of available isotope records from polar ice cores, speleothems, as well as marine calcite data. Data-model evaluation of the isotopic composition in precipitation reveals a good match of the model results and indicates that the temporal glacial–interglacial isotope–temperature relation was substantially lower than the present spatial gradient for most mid- to high-latitudinal regions. As compared to older atmosphere-only simulations, a remarkable improvement is achieved for the modelling of the deuterium excess signal in Antarctic ice cores. Our simulation results indicate that cool sub-tropical and mid-latitudinal sea surface temperatures are key for this

  19. Positron emission tomography agent 2-deoxy-2-[18F]fluoro-D-glucose has a therapeutic potential in breast cancer

    International Nuclear Information System (INIS)

    Novel approaches are needed for breast cancer patients in whom standard therapy is not effective. 2-Deoxy-2-[18F]fluoro-D-glucose (18F-FDG) was evaluated as a potential radiomolecular therapy agent in breast cancer animal models and, retrospectively, in patients with metastatic breast cancer. Polyoma middle T antigen (PyMT) and mouse mammary tumor virus-NeuT transgenic mice with tumors 0.5–1 cm in diameter were imaged with 18F-FDG, and tumor to liver ratios (TLRs) were calculated. The radiotoxicity of 18F-FDG administration was determined in healthy mice. PyMT mice with small (0.15–0.17 cm) and large (more than 1 cm) tumors were treated with 2–4 mCi of 18F-FDG, and control C3H/B6 mice with 3 mCi of 18F-FDG. At 10 days after treatment the tumors and control mammary glands were analyzed for the presence of apoptotic and necrotic cells. Five patients with breast cancer and metastatic disease were evaluated and standardized uptake values (SUVs) in tumors, maximum tolerated dose, and the doses to the tumor were calculated. Doses up to 5 mCi proved to be non-radiotoxic to normal organs. The 18F-FDG uptake in mouse tumors showed an average TLR of 1.6. The treatment of mice resulted in apoptotic cell death in the small tumors. Cell death through the necrotic pathway was seen in large tumors, and was accompanied by tumor fragmentation and infiltration with leukocytes. Normal mammary tissues were not damaged. A human 18F-FDG dose delivering 200 rad to the red marrow (less than 5% damage) was calculated to be 4.76 Ci for a 70 kg woman, and the dose to the tumors was calculated to be 220, 1100 and 2200 rad for SUVs of 1, 5 and 10, respectively. We have shown that positrons delivered by 18F-FDG to mammary tumors have a tumoricidal effect on cancer cells. The study of breast cancer patients suggests that the tumor and normal organ dosimetry of 18F-FDG makes it suitable for therapy of this malignancy

  20. Positron emission tomography with 2-[18F]-Fluoro-2-Deoxy-D-Glucose for initial staging of hodgkin lymphoma: a single center experience in Brazil

    Directory of Open Access Journals (Sweden)

    Juliano Julio Cerci

    2009-06-01

    Full Text Available BACKGROUND: 2-[18F]-Fluoro-2-Deoxy-D-Glucose (FDG-PET is a well established functional imaging modality for the initial staging of Hodgkin lymphoma (HL in patients from Western Europe and North America. The reliability of FDG-PET in populations of different ethnic groups is unclear, as all investigations published to date have come from developed countries. PURPOSE: The aim of the present study was to investigate the effectiveness of FDG-PET in the initial staging of HL patients in a Brazilian population. METHODS: Eighty-two patients with newly diagnosed HL were prospectively included in the study. All patients were staged with both conventional clinical staging (CCS methods, including computed tomography (CT and whole-body FDG-PET methods. A standard of reference for the nodal regions and the extranodal organs was determined using all available information, including the CCS methods, FDG-PET, the diagnostic histology and the follow-up examinations. The results of the CCS were then compared to the FDG-PET results. RESULTS: The sensitivity of FDG-PET was higher for nodal staging than that of CT (87.8% vs. 61.6%, respectively. FDG-PET was also more sensitive than CT in regard to evaluating the extranodal organs for lymphomatous involvement (96.2% vs. 40.0%, respectively. FDG-PET detected all 16 patients who were characterized by a positive bone marrow biopsy and identified an additional 4 patients with bone marrow disease. The incorporation of FDG-PET coupled with CCS in the staging procedure upstaged 20% (17/82 of the patients and downstaged 11% (9/82 of the patients. As a result of these changes in staging, 15% (13/82 of the patients would have received a different therapeutic regimen. CONCLUSIONS: The FDG-PET method is superior to CT for the detection of nodal and extra-nodal HL. The observation that the FDG-PET method upstaged the disease was the most common result (20% of patients brought about by the addition of PET to the staging algorithm

  1. Comparing 2-[18F]fluoro-2-deoxy-D-glucose and [68Ga]gallium-citrate translocation in Arabidopsis thaliana

    International Nuclear Information System (INIS)

    2-[18F]fluoro-2-deoxy-D-glucose (18FDG) is a glucose surrogate commonly used in clinical or animal imaging but rarely in plant imaging to trace glucose metabolism. Recently, 18FDG has been employed in plant imaging for studying photoassimilate translocation and glycoside biosynthesis. There is growing evidence that 18FDG could be used as a tracer in plant imaging studies to trace sugar dynamics. However, to confirm this hypothesis, it was necessary to show that the observed 18FDG distribution in an intact plant is an outcome of the chemical nature of the introduced radiotracer and not of the plant vascular architecture or radiotracer introduction method. Methods: In the present work, we fed 18FDG and [68Ga]gallium-citrate (68Ga-citrate) solution through mature Arabidopsis thaliana leaf and monitored subsequent radioactivity distribution using positron autoradiography. The possible route of radioactivity translocation was elucidated through stem-girdling experiments. We also employed a bi-functional positron emission tomography/computed tomography (PET/CT) modality to capture 18FDG radiotracer dynamics in one of the plants in order to assess applicability of PET/CT for 4-D imaging in an intact plant. Results: Autoradiography results showed that [18F] radioactivity accumulated mostly in roots and young growing parts such as the shoot apex, which are known to act as sinks for photoassimilate. [18F] radioactivity translocation, in this case, occurred mainly via phloem. PET/CT results corroborated with autoradiography. [68Ga] radioactivity, on the other hand, was mainly translocated to neighboring leaves and its translocation occurred via both xylem and phloem. Conclusion: The radioactivity distribution pattern and translocation route observed after 18FDG feeding is markedly different from that of 68Ga-citrate. [18F] radioactivity distribution pattern in an intact plant is found similar to the typical distribution pattern of photoassimilates. Despite its limitations in

  2. Environmental Assessment and Finding of No Significant Impact: Widening Trench 36 of the 218-E-12B Low-Level Burial Ground, Hanford Site, Richland, Washington

    Energy Technology Data Exchange (ETDEWEB)

    N/A

    1999-02-11

    This environmental assessment was prepared to assess potential environmental impacts associated with the proposed action to widen and operate unused Trench 36 in the 218-E-12B Low-Level Burial Ground for disposal of low-level waste. Information contained herein will be used by the Manager, U.S. Department of Energy, Richland Operations Office, to determine if the Proposed Action is a major federal action significantly affecting the quality of the human environment. If the Proposed Action is determined to be major and significant, an environmental impact statement will be prepared. If the Proposed Action is determined not to be major and significant, a Finding of No Significant Impact will be issued and the action may proceed. Criteria used to evaluate significance can be found in Title 40, Code of Federal Regulations 1508.27. This environmental assessment was prepared in compliance with the ''National Environmental Policy Act of1969'', as amended, the Council on Environmental Quality Regulations for Implementing the Procedural Provisions of ''National Environmental Policy Act'' (Title 40, Code of Federal Regulations 1500-1508), and the U.S. Department of Energy Implementing Procedures for ''National Environmental Polio Act'' (Title 10, Code of Federal Regulations 1021). The following is a description of each section of this environmental assessment. (1) Purpose and Need for Action. This section provides a brief statement concerning the problem or opportunity the U.S, Department of Energy is addressing with the Proposed Action. Background information is provided. (2) Description of the Proposed Action. This section provides a description of the Proposed Action with sufficient detail to identify potential environmental impacts. (3) Alternatives to the Proposed Action. This section describes reasonable,alternative actions to the Proposed Action, which addresses the Purpose and Need. A No Action Alternative

  3. New radiosynthesis of 2-deoxy-2-[18F]fluoroacetamido-D-glucopyranose and its evaluation as a bacterial infections imaging agent

    International Nuclear Information System (INIS)

    Introduction: The diagnosis of infection and the ability to distinguish bacterial infection from nonbacterial inflammation by positron emission tomography (PET) have gained interest in recent years, but still few specific radiopharmaceuticals are available for use. In this study, we developed a new radiosynthesis method of 2-deoxy-2-[18F]fluoroacetamido-D-glucopyranose ([18F]FAG) by applying microwave irradiation and demonstrated that [18F]FAG could be a potential radiopharmaceutical to distinguish bacterial infection from nonbacterial inflammation. Methods: 1,3,4,6-Tetra-O-acetyl-2-deoxy-2-bromoacetamido-D-glucopyranose was used as precursor, and labeling was performed under microwave irradiation conditions followed by alkaline hydrolysis and high-performance liquid chromatography (HPLC) purification. In vitro uptake of [18F]FAG by Escherichia coli was performed. Tissue biodistribution of [18F]FAG was performed in mice. Moreover, PET imaging acquisition of E. coli infection and nonbacterial inflammation models was performed in rats. Tissue radiotracer-accumulated sites were analyzed by hematoxylin and eosin staining and anti-E.coli immunostaining. Results: The radiosynthesis of [18F]FAG was achieved with microwave irradiation, and the radiochemical yield was 9.7%±2.8% end of bombardment (EOB); the radiochemical purity was more than 98%, and the total synthesis time was 62 min. Compared with control group, in vitro uptake of [18F]FAG by E. coli was significantly decrease in inhibition group (P18F]FAG from the animal body. [18F]FAG clearly visualized the infection areas but not nonbacterial inflammation areas in PET studies. Quantitative analysis revealed that the uptake of [18F]FAG into infection areas was significantly higher than that of [18F]FAG into inflammation areas (P18F]FAG. Conclusions: Using 1,3,4,6-tetra-O-acetyl-2-deoxy-2-bromoacetamido-D-glucopyranose as a precursor, the new radiosynthesis method of [18F]FAG was achieved in fewer steps and with a

  4. Investigating the impact of light and water status on the exchange of COS, 13CO2, CO18O and H218O from bryophytes

    Science.gov (United States)

    Gimeno, Teresa; Royles, Jessica; Ogee, Jerome; Jones, Samuel; Burlett, Regis; West, Jason; Sauze, Joana; Wohl, Steven; Genty, Bernard; Griffiths, Howard; Wingate, Lisa

    2016-04-01

    Terrestrial surfaces are often covered by photoautotrophic communities that play a significant role in the biological fixation of C and N at the global scale. Bryophytes (mosses, liverworts and hornworts) are key members in these communities and are especially adapted to thrive in hostile environments, by growing slowly and surviving repeated dehydration events. Consequently, bryophyte communities can be extremely long-lived (>1500yrs) and can serve as valuable records of historic climate change. In particular the carbon and oxygen isotope compositions of mosses can be used as powerful proxies describing how growing season changes in atmospheric CO2 and rainfall have changed in the distant past over the land surface. Interpreting the climate signals of bryophyte biomass requires a robust understanding of how changes in photosynthetic activity and moisture status regulate the growth and isotopic composition of bryophyte biomass. Thus theoretical models predicting how changes in isotopic enrichment and CO2 discrimination respond to dehydration and rehydration are used to tease apart climatic and isotopic source signals. Testing these models with high resolution datasets obtained from new generation laser spectrometers can provide more information on how these plants that lack stomata cope with water loss. In addition novel tracers such as carbonyl sulfide (COS) can also be measured at high resolution and precision (CO2, CO18O and H218O fluxes by a bryophyte species (Marchantia sp.) in the light and during the dark, through complete desiccation cycles. Our measurements consistently reveal a strong enrichment dynamic in the oxygen isotope composition of transpired water over the dessication cycle that caused an increase in the oxygen isotope discrimination of CO2. These data followed closely values predicted by our process-based model. We also observed a consistent pattern in the fluxes of CO2 and COS during the desiccation cycle. Initially when the bryophyte was wet

  5. A Fully Automated Radiosynthesis of [18F]Fluoroethyl-Diprenorphine on a Single Module by Use of SPE Cartridges for Preparation of High Quality 2-[18F]Fluoroethyl Tosylate

    Directory of Open Access Journals (Sweden)

    Gjermund Henriksen

    2013-06-01

    Full Text Available We have developed a new method for automated production of 2-[18F]fluoroethyl tosylate ([18F]FETos that enables 18F-alkylation to provide PET tracers with high chemical purity. The method is based on the removal of excess ethylene glycol bistosylate precursor by precipitation and subsequent filtration and purification of the filtrate by means of solid phase extraction cartridges (SPE. The method is integrated to a single synthesis module and thereby provides the advantage over previous methods of not requiring HPLC purification, as demonstrated by the full radiosynthesis of the potent opioid receptor PET tracer [18F]fluoroethyldiprenorphine.

  6. An efficient, one-pot synthesis of 2-deoxy-2-[18F]fluoro-acetamido-D-glucopyranose (N-[18F]fluoroacetyl-D-glucosamine), potential diagnostic imaging agent

    International Nuclear Information System (INIS)

    A rapid, one-pot synthesis of 2-deoxy-2-[18F]fluoroacetamido-D-glucopyranose (N-[18F]fluoroacetyl-D-glucosamine) starting from [18F]fluoride and ethyl bromoacetate is described. The synthesis was accomplished by a combination of halogen exchange, alkaline hydrolysis, and condensation. [18F]Fluoride was produced by the 18O (p, n) 18F nuclear reaction using the cyclotron. The total synthesis time, the radiochemical yield, and purity are ca. 90 min, ca. 9.1%, and >98%, respectively. This sugar showed diagnostic tumor-imaging activity. (author)

  7. Early interim 2-[18F]fluoro-2-deoxy-D-glucose positron emission tomography is prognostically superior to international prognostic score in advanced-stage Hodgkin's lymphoma: a report from a joint Italian-Danish study

    DEFF Research Database (Denmark)

    Loft, Annika; Gallamini, Andrea; Hutchings, Martin; Rigacci, Luigi; Specht, Lena; Merli, Francesco; Hansen, Mads; Patti, Caterina; Jakobsen, Annika Loft; Di Raimondo, Francesco; D'Amore, Francesco; Biggi, Alberto; Vitolo, Umberto; Stelitano, Caterina; Sancetta, Rosario; Trentin, Livio; Luminari, Stefano; Iannitto, Emilio; Viviani, Simonetta; Pierri, Ivana; Levis, Alessandro

    2007-01-01

    PURPOSE: Starting from November 2001, 260 newly diagnosed patients with Hodgkin's lymphoma (HL) were consecutively enrolled in parallel Italian and Danish prospective trials to evaluate the prognostic role of an early interim 2-[(18)F]fluoro-2-deoxy-D-glucose positron emission tomography (FDG...... adverse prognostic factors. All but 11 patients were treated with standard ABVD therapy followed by consolidation radiotherapy in case of bulky presentation or residual tumor mass. Conventional radiologic staging was performed at baseline. FDG-PET scan was performed at baseline and after two courses of...

  8. Synthesis and comparison of 4-[18F]F-ADAM, 2-[18F]F-ADAM, N-Desmethyl-4-[18F]F-ADAM and [18F]F-AFM as serotonin transporter imaging agents

    International Nuclear Information System (INIS)

    4-[18F]F-ADAM (1a), 2-[18F]F-ADAM (2a), N-Desmethyl-4-[18F]F-ADAM (3a) and [18F]F-AFM (4a ) were synthesized in 1.7, 3.9, 2.9 and 0.6% yield (EOS), respectively, in a synthesis time of ∼120 min from EOB. PET studies in rats showed that the maximum specific uptake ratios of 1a, 2a, 3a and 4a in midbrain were 3.86, 0.73, 0.35 and 2.23, respectively. Thus, in terms of radiochemical yield, specific binding and in vivo stability, 4-[18F]F-ADAM may be the most appropriate SERT imaging agent for human studies. - Highlights: ► Four 18F-labeled radioligands were synthesized and evaluated as SERT imaging agents. ► 4-[18F]F-ADAM and [18F]F-AFM had high specific uptake in SERT-rich brain regions. ► 2-[18F]F-ADAM and N-Desmethyl-4-[18F]F-ADAM had low specific uptake in brain. ► 4-[18F]F-ADAM may be the most appropriate SERT imaging agent for human studies.

  9. Refsiréttur : um 2. mgr. 218. gr. almennra hegningarlaga nr. 19/1940 : þegar ekki hlýst bani af atlögu

    OpenAIRE

    Aldís Ýr Ólafsdóttir 1983

    2009-01-01

    Með lögum um breytingar á almennum hegningarlögum nr. 20/1981 var annarri málsgrein bætt við 218. gr. almennra hegningarlaga nr. 19/1940. Var þetta gert þar sem of ólík brot voru heimfærð undir ákvæðið sem tók til allt frá minniháttar líkamsmeiðingum, t.d. beinbrot, og allt til stórfelldra líkamsmeiðinga þar með talið þegar bani hlaust af líkamsárás. Ritgerð þessi fjallar um líkamsárásir sem valda stórfelldu líkams- eða heilsutjóni sbr. 2. mgr. 218. gr. þegar ekki hlýst bani af. Farið verður ...

  10. Manndráp og meiriháttar líkamsmeiðingar - Mörk 211. gr. og 2. mgr. 218. gr. hgl. þegar bani hlýst af atlögu

    OpenAIRE

    Sonja Hjördís Berndsen 1986

    2011-01-01

    Efni ritgerðar þessarar eru skilin milli ákvæðis 211. gr. um manndráp af ásetningi og ákvæðis 2. mgr. 218. gr. almennra hegningarlaga nr. 19/1940 um meiriháttar líkamsárás, þegar bani hlýst af atlögu. Verknaður sem leiðir til dauða er felldur undir 211. gr. hgl. nái ásetningur geranda bæði til frumverknaðar og þess dauðdaga sem fylgir verknaðinum. Verði afleiðingarnar sem í dauðdaganum felast eingöngu raktar til gáleysis geranda, er háttsemi felld undir 2. mgr. 218. gr. hgl. Við athugun á...

  11. Request for interim approval to operate Trench 94 of the 218-E-12B Burial Ground as a chemical waste landfill for disposal of polychlorinated biphenyl waste in submarine reactor compartments. Revision 2

    Energy Technology Data Exchange (ETDEWEB)

    Cummins, G.D.

    1994-06-01

    This request is submitted to seek interim approval to operate a Toxic Substances Control Act (TSCA) of 1976 chemical waste landfill for the disposal of polychlorinated biphenyl (PCB) waste. Operation of a chemical waste landfill for disposal of PCB waste is subject to the TSCA regulations of 40 CFR 761. Interim approval is requested for a period not to exceed 5 years from the date of approval. This request covers only the disposal of small 10 quantities of solid PCB waste contained in decommissioned, defueled submarine reactor compartments (SRC). In addition, the request applies only to disposal 12 of this waste in Trench 94 of the 218-E-12B Burial Ground (Trench 94) in the 13 200 East Area of the US Department of Energy`s (DOE) Hanford Facility. Disposal of this waste will be conducted in accordance with the Compliance 15 Agreement (Appendix H) between the DOE Richland Operations Office (DOE-RL) and 16 the US Environmental Protection Agency (EPA), Region 10. During the 5-year interim approval period, the DOE-RL will submit an application seeking final 18 approval for operation of Trench 94 as a chemical waste landfill, including 19 any necessary waivers, and also will seek a final dangerous waste permit from 20 the Washington State Department of Ecology (Ecology) for disposal of lead 21 shielding contained in the SRCS.

  12. The effect of continuous work on discretionary energy expenditure in male adult construction workers in northern Mexico as studies by the 2H218O method and indirect calorimetry

    International Nuclear Information System (INIS)

    Energy balance, in relation to energy needs in populations of developing countries is an important issue in terms of nutritional status, health and food policy implications. The objective of this study was to measure the variations in discretionary energy expenditure (DEE) in male adult construction workers of different body mass index (BMI), when challenged to heavy work. Twelve adult volunteers engaged in construction work, 18-30 years, BMI range 16.7 to 28.9 were selected from different low income urban sectors in northern Mexico. These individuals were subjected to a specific work load equivalent to a physical activity index (PAI) ≥ 2.1 x BMR, within a time frame of 6 hours a day, eight out of ten days. The rest of the time including one full weekend was to their discretion. Energy expenditure was measured using the 2H218O technique. BMR and the thermic effect of food were evaluated by ventilated hood indirect calorimetry. The energy cost of fixed activities was measured by the Oxylog. A daily activity diary was kept throughout the ten days of the protocol. This study shows no evidence that individuals of different energy status in a range of BMI from 16.7 to 28.9 modify the discretionary component of their total daily expenditure to cope with the equivalent of a heavy work load (PAI ≥ 2.1) 11 refs, 1 fig., 3 tabs

  13. Quality of 2-deoxy-2-[18F]fluoro-d-glucose injection prepared by isotopic exchange of fluorine using anion exchange or liquid phase exchange catalysed with amino polyether

    International Nuclear Information System (INIS)

    Production of 2-deoxy-2-[18F]fluoro-D-glucose ([18F]FDG) for Czech and Slovak PET Centres started on our upgraded U-120 cyclotron and in our radiopharmaceutical laboratory as early as June 1997, first for validation purposes and subsequently for clinical trials. The product was registered by the Czech State Institute for Drug Control in June 1999, and then distribution of the [18F]FDG injection preparation to hospitals was launched. The older automatic equipment (MicroLab I) manufactured by General Electric Medical Systems (GEMS) was based on a technology involving nucleophilic substitution of the precursor (1,3,4,6-tetra-O-acetyl-2-O-trifluoromethanesulfonyl-β-D-mannopyranose) dissolved in acetonitrile with [18F]fluoride absorbed on a solid anion exchanger modified with 4-(4-methylpiperidino) pyridine. This technology was used by us until March 2001, when it was superseded by a more advanced technology, MicroLab II. The nucleophilic substitution in the new technology is catalysed with amino polyether (Kryptofix) in a liquid phase. Benefits of MicroLab II include a significantly higher yield and better radiochemical purity of the product

  14. Development of N-[3-(2',4'-dichlorophenoxy)-2-18F-fluoropropyl]-N-methylpropargylamine (18F-fluoroclorgyline) as a potential PET radiotracer for monoamine oxidase-A

    International Nuclear Information System (INIS)

    We have synthesized N-[3-(2',4'-dichlorophenoxy)-2-18F-fluoropropyl]-N-methylpropargylamine (18F-fluoroclorgyline) as a potential positron emission tomography (PET) radiotracer for monoamine oxidase A (MAO-A). The radiosynthesis was carried out by a 18F-fluoride-for-mesylate substitution reaction in approximately 20% radiochemical yield in specific activities of 1-2 Ci/μmol. Selectivity for MAO-A was demonstrated by the high affinity of clorgyline ( IC50=39 nM) and lower affinity of (R)-deprenyl ( IC50≥100 μM) for the inhibition of 18F-fluoroclorgyline binding in vitro in rat brain membranes. The uptake of 18F-fluoroclorgyline in the rat brains was high (>1.0% injected dose/g). The binding of 18F-fluoroclorgyline in the rat brain correlated with the distribution of MAO-A and was inhibited by preadministration of MAO-A inhibitors, clorgyline, and Ro 41-1049, whereas (R)-deprenyl, a MAO-B blocker, had no inhibitory effect. These results suggest that 18F-fluoroclorgyline is a potential PET radiotracer for MAO-A

  15. Request for interim approval to operate Trench 94 of the 218-E-12B Burial Ground as a chemical waste landfill for disposal of polychlorinated biphenyl waste in submarine reactor compartments

    International Nuclear Information System (INIS)

    This request is submitted to seek interim approval to operate a Toxic Substances Control Act (TSCA) of 1976 chemical waste landfill for the disposal of polychlorinated biphenyl (PCB) waste. Operation of a chemical waste landfill for disposal of PCB waste is subject to the TSCA regulations of 40 CFR 761. Interim approval is requested for a period not to exceed 5 years from the date of approval. This request covers only the disposal of small 10 quantities of solid PCB waste contained in decommissioned, defueled submarine reactor compartments (SRC). In addition, the request applies only to disposal 12 of this waste in Trench 94 of the 218-E-12B Burial Ground (Trench 94) in the 13 200 East Area of the US Department of Energy's (DOE) Hanford Facility. Disposal of this waste will be conducted in accordance with the Compliance 15 Agreement (Appendix H) between the DOE Richland Operations Office (DOE-RL) and 16 the US Environmental Protection Agency (EPA), Region 10. During the 5-year interim approval period, the DOE-RL will submit an application seeking final 18 approval for operation of Trench 94 as a chemical waste landfill, including 19 any necessary waivers, and also will seek a final dangerous waste permit from 20 the Washington State Department of Ecology (Ecology) for disposal of lead 21 shielding contained in the SRCS

  16. Quality of 2-deoxy-2-[18 F]fluoro-D-glucose injection prepared by isotopic exchange of fluorine using anion exchange or liquid phase exchange catalysed with aminopolyether

    International Nuclear Information System (INIS)

    Regular production of 2-deoxy-2-[18F]fluoro-D-glucose ([18F]FDG) for Czech and Slovak PET Centers started at our upgraded U-120 cyclotrone and radiopharmaceutical laboratory already in June 1997 when [18F]FDG started being produced for validation and then for clinical trials in the Czech Republic. After registering the product by the Czech State Institute for Drug Control in June 1999, distribution of [18F]FDG,injection, to hospitals was commenced. The older automatic equipment (MicroLab I) of General Electric Medical Systems (GEMS) used technology with nucleophilic substitution of precursor (1,3,4,6-tetra-O-acetyl-2-O-trifluormethansulfonyl-β-D-mannopyranose) dissolved in acetonitrile with [18F]fluoride absorbed on a solid anion exchanger modified with 4-(4-methylpiperidino) pyridine. We used this technology until March 2001, when it was substituted with more advanced technology, MicroLab II. Nucleophilic substitution in the new technology is catalysed with aminopolyether (Kryptofix) in a liquid phase. Benefits of the MicroLab II technology consist of significantly higher yield of synthesis and better radiochemical purity of the product. Those parameters for intermediate period in March 2001 when both technologies were used is presented, so the conditions for production were comparable. The MicroLab II technology brings much higher yield of synthesis while radiochemical purity of the product also increases to over 99%

  17. Synthesis of 2'-deoxy-2'-[18F]-fluoro-5-iodo-1-β-D-arabinofuranosyluracil ([18F]-FIAU) and micro-PET imaging of suicide gene expression in tumor-bearing nude mice

    International Nuclear Information System (INIS)

    Herpes simplex virus type-1 thymidine kinase (HSV1-tk) is being used as a suicide gene for gene therapy of cancer. An in vivo method to assess the HSV1-tk enzyme activity after gene transfer is desirable to monitor gene expression as an indicator of gene delivery. Imaging of the HSV1-tk reporter gene along with various reporter probes is of current interest. We originally developed [18F]-FHPG and [18F]-FHBG for PET imaging of HSV1-tk gene expression and demonstrated that [18F]-FHBG is more useful than [18F]-FHPG for this purpose. [124I]-FIAU has been shown to be a potential PET imaging agent for HSV1-tk gene expression, and is superior to [18F]-FHPG and [18F]-FHBG. We also demonstrated that radiolabeled FMAU can be used as a marker for HSV-tk gene expression, and is superior to [18F]-FHPG and [18F]-FHBG. Earlier we reported a synthesis for 2'-deoxy-2'-[18F]fluoro-5-methyl-1-β-D-arabinofuranosyluracil ([18F]-FMAU) and some other 5-substituted nucleosides. We have synthesized now [18F]-FIAU, used the tracer for micro-PET imaging of suicide gene expression in tumor-bearing nude mice, and compared the results with earlier studies using [14C]-FMAU. (orig.)

  18. Synthesis of O-[2-[18F]fluoro-3-(2-nitro-1H-imidazole-1-yl)propyl]tyrosine ([18F]FNT]) as a new class of tracer for imaging hypoxia

    International Nuclear Information System (INIS)

    For detection of hypoxic tumor tissue, all radiotracers synthesized until now, are based on the concept that cellular uptake is being controlled by diffusion. As a new approach, we chose the concept to have the tracer hypothetically transported into the cells by well known carrier systems like the amino acid transporters. For this purpose, radiosynthesis of O-[2-[18F]fluoro-3-(2-nitro-1H-imidazole-1yl)propyl]tyrosine ([18F]FNT]) was carried out from methyl 2-(benzyloxycarbonyl)-3-(4-3-(2-nitro-1H-imidazol-1-yl) -2-(tosyloxy)propoxy) phenyl)propanoate via no-carrier-added nucleophilic aliphatic substitution. After labelling, 81 ± 0.9% of labelled intermediate i.e. methyl 2-(benzyloxycarbonyl)-3-(4-(2-[18F]fluoro-3- (2-nitro-1H-imidazole-1-yl)propoxy) phenyl)propanoate was obtained at 140 deg C. At the end of radiosynthesis, [18F]FNT was obtained in an overall radiochemical yield of 40 ± 0.9% (not decay corrected) within 90 min in a radiochemical purity of >98% in a formulation ready for application in the clinical studies for PET imaging of hypoxia. (author)

  19. Preparation and radiosynthesis of [18F]FE rate at CFN (2-[18F]fluoroethyl 4-[N-(1-oxopropyl)-N-phenylamino]-1- (2-phenylethyl)-4-piperidinecarboxylate): a potential μ-opioid receptor imaging agent

    International Nuclear Information System (INIS)

    PET imaging of the μ-opioid receptor (OR) is still restricted to [11C]carfentanil ([11C]CFN) but its use is limited due to its short half-life and high agonistic potency. Recently, the radiosynthesis of [18F]fluoroalkyl esters of CFN was proposed, unfortunately yielding products not suitable for human PET due to their low specific activities. Therefore, our rationale was to develop a reliable radiosynthesis of a [18F]fluoroethylated CFN derivative overcoming these drawbacks. The [18F]fluoroethyl ester of carfentanil, [18F]FE rate at CFN (2-[18F]fluoroethyl 4-[N-(1-oxopropyl)-N-phenylamino]-1- (2-phenylethyl)-4-piperidinecarboxylate), and its corresponding inactive standard compound were prepared. Purification of [18F]FE rate at CFN was achieved via a simple solid phase extraction method. [18F]FE rate at CFN was prepared with excellent purity (> 98%) and sufficient yields. Specific activity surpassed the level required for safe administration. We therefore conclude that our simplified synthesis of [18F]FE rate at CFN, for the first time, overcomes the shortcomings of [11C]CFN and the previously suggested alternatives, namely, (1) longer half-life; (2) easy production and (3) adequate specific activity, should make a wider application possible. Hence, [18F]FE rate at CFN may become a valuable PET tracer for the imaging of the μ-OR in human brain and heart. (orig.)

  20. Lipidomics and H218O labeling techniques reveal increased remodeling of DHA-containing membrane phospholipids associated with abnormal locomotor responses in α-tocopherol deficient zebrafish (danio rerio) embryos

    Science.gov (United States)

    McDougall, Melissa Q.; Choi, Jaewoo; Stevens, Jan F.; Truong, Lisa; Tanguay, Robert L.; Traber, Maret G.

    2016-01-01

    We hypothesized that vitamin E (α-tocopherol) is required by the developing embryonic brain to prevent depletion of highly polyunsaturated fatty acids, especially docosahexaenoic acid (DHA, 22:6), the loss of which we predicted would underlie abnormal morphological and behavioral outcomes. Therefore, we fed adult 5D zebrafish (Danio rerio) defined diets without (E−) or with added α-tocopherol (E+, 500 mg RRR-α-tocopheryl acetate/kg diet) for a minimum of 80 days, and then spawned them to obtain E− and E+ embryos. The E− compared with E+ embryos were 82% less responsive (p<0.01) to a light/dark stimulus at 96 h post-fertilization (hpf), demonstrating impaired locomotor behavior, even in the absence of gross morphological defects. Evaluation of phospholipid (PL) and lysophospholipid (lyso-PL) composition using untargeted lipidomics in E− compared with E+ embryos at 24, 48, 72, and 120 hpf showed that four PLs and three lyso-PLs containing docosahexaenoic acid (DHA), including lysophosphatidylcholine (LPC 22:6, required for transport of DHA into the brain, p<0.001), were at lower concentrations in E− at all time-points. Additionally, H218O labeling experiments revealed enhanced turnover of LPC 22:6 (p<0.001) and three other DHA-containing PLs in the E− compared with the E+ embryos, suggesting that increased membrane remodeling is a result of PL depletion. Together, these data indicate that α-tocopherol deficiency in the zebrafish embryo causes the specific depletion and increased turnover of DHA-containing PL and lyso-PLs, which may compromise DHA delivery to the brain and thereby contribute to the functional impairments observed in E− embryos. PMID:26774753

  1. Lipidomics and H218O labeling techniques reveal increased remodeling of DHA-containing membrane phospholipids associated with abnormal locomotor responses in α-tocopherol deficient zebrafish (danio rerio embryos

    Directory of Open Access Journals (Sweden)

    Melissa Q. McDougall

    2016-08-01

    Full Text Available We hypothesized that vitamin E (α-tocopherol is required by the developing embryonic brain to prevent depletion of highly polyunsaturated fatty acids, especially docosahexaenoic acid (DHA, 22:6, the loss of which we predicted would underlie abnormal morphological and behavioral outcomes. Therefore, we fed adult 5D zebrafish (Danio rerio defined diets without (E− or with added α-tocopherol (E+, 500 mg RRR-α-tocopheryl acetate/kg diet for a minimum of 80 days, and then spawned them to obtain E− and E+ embryos. The E− compared with E+ embryos were 82% less responsive (p<0.01 to a light/dark stimulus at 96 h post-fertilization (hpf, demonstrating impaired locomotor behavior, even in the absence of gross morphological defects. Evaluation of phospholipid (PL and lysophospholipid (lyso-PL composition using untargeted lipidomics in E− compared with E+ embryos at 24, 48, 72, and 120 hpf showed that four PLs and three lyso-PLs containing docosahexaenoic acid (DHA, including lysophosphatidylcholine (LPC 22:6, required for transport of DHA into the brain, p<0.001, were at lower concentrations in E− at all time-points. Additionally, H218O labeling experiments revealed enhanced turnover of LPC 22:6 (p<0.001 and three other DHA-containing PLs in the E− compared with the E+ embryos, suggesting that increased membrane remodeling is a result of PL depletion. Together, these data indicate that α-tocopherol deficiency in the zebrafish embryo causes the specific depletion and increased turnover of DHA-containing PL and lyso-PLs, which may compromise DHA delivery to the brain and thereby contribute to the functional impairments observed in E− embryos.

  2. Lipidomics and H2(18)O labeling techniques reveal increased remodeling of DHA-containing membrane phospholipids associated with abnormal locomotor responses in α-tocopherol deficient zebrafish (danio rerio) embryos.

    Science.gov (United States)

    McDougall, Melissa Q; Choi, Jaewoo; Stevens, Jan F; Truong, Lisa; Tanguay, Robert L; Traber, Maret G

    2016-08-01

    We hypothesized that vitamin E (α-tocopherol) is required by the developing embryonic brain to prevent depletion of highly polyunsaturated fatty acids, especially docosahexaenoic acid (DHA, 22:6), the loss of which we predicted would underlie abnormal morphological and behavioral outcomes. Therefore, we fed adult 5D zebrafish (Danio rerio) defined diets without (E-) or with added α-tocopherol (E+, 500mg RRR-α-tocopheryl acetate/kg diet) for a minimum of 80 days, and then spawned them to obtain E- and E+ embryos. The E- compared with E+ embryos were 82% less responsive (p<0.01) to a light/dark stimulus at 96h post-fertilization (hpf), demonstrating impaired locomotor behavior, even in the absence of gross morphological defects. Evaluation of phospholipid (PL) and lysophospholipid (lyso-PL) composition using untargeted lipidomics in E- compared with E+ embryos at 24, 48, 72, and 120hpf showed that four PLs and three lyso-PLs containing docosahexaenoic acid (DHA), including lysophosphatidylcholine (LPC 22:6, required for transport of DHA into the brain, p<0.001), were at lower concentrations in E- at all time-points. Additionally, H2(18)O labeling experiments revealed enhanced turnover of LPC 22:6 (p<0.001) and three other DHA-containing PLs in the E- compared with the E+ embryos, suggesting that increased membrane remodeling is a result of PL depletion. Together, these data indicate that α-tocopherol deficiency in the zebrafish embryo causes the specific depletion and increased turnover of DHA-containing PL and lyso-PLs, which may compromise DHA delivery to the brain and thereby contribute to the functional impairments observed in E- embryos. PMID:26774753

  3. 10 CFR 218.3 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... established pursuant to the Agreement on an International Energy Program signed at Paris, France, on November 18, 1974, including (a) the Annex entitled “Emergency Reserves”, (b) any amendment to such Agreement that includes another nation as a Party to such Agreement, and (c) any technical or clerical...

  4. BDML Metadata: 218 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available NC-SA 0.150 2a3c851a-29f8-43da-a783-3c09668238da 0.105 x 0.105 x 0.5 (micrometer), 40 (second) http://ssbd.qbic.riken.jp/data.../source/Ce_KK_P002/RNAi_T20G5.2_040909_01/ http://ssbd.qbic.riken.jp/data.../bdml/Ce_KK_P002/RNAi_T20G5.2_040909_01.bdml0.15.xml http://ssbd.qbic.riken.jp/data/pdpml/Ce_KK_P00...2.pdpml0.05.xml http://ssbd.qbic.riken.jp/search/2a3c851a-29f8-43da-a783-3c09668238da/ http://ssbd.qbic.riken.jp/omero/webclient/?show=dataset-159 ...

  5. 49 CFR 218.5 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... by an employee positioned on or alongside a caboose, locomotive, or passenger car; or (ii) marker... sufficiently lighted so as to make the blue signal clearly distinguishable. Camp car means any on-track vehicle... does not include wreck trains. Car shop repair track area means one or more tracks within an area...

  6. 32 CFR 218.1 - Policies.

    Science.gov (United States)

    2010-07-01

    ... alpha radiation (internally) for personnel whose activities indicate the possibility of inhalation or... THE DETERMINATION AND REPORTING OF NUCLEAR RADIATION DOSE FOR DOD PARTICIPANTS IN THE ATMOSPHERIC... radiation environment to which the veteran was exposed and shall include inhaled, ingested and neutron...

  7. 50 CFR 218.4 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ...) helicopter crews shall complete Marine Species Awareness Training (MSAT). (B) Navy lookouts shall undertake...) Mid-Atlantic, Offshore of the Eastern United States: (A) All Navy vessels are required to use extreme... Atlantic, Offshore of the Eastern United States—for the purposes of the measures below (paragraphs...

  8. 50 CFR 218.13 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ...) helicopter crews shall complete Marine Species Awareness Training (MSAT). (B) Navy lookouts shall undertake...) Mid-Atlantic, Offshore of the Eastern United States: (A) All Navy vessels are required to use extreme... whale, consistent with vessel safety. (ii) Southeast Atlantic, Offshore of the Eastern United...

  9. 50 CFR 218.104 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ... with deployed sonobuoys shall use only the passive capability of sonobuoys when marine mammals are... be used with the employment of IEER/AEER sonobuoys: (i) Crews shall conduct visual reconnaissance of... Navy shall ensure all payloads are accounted for. Explosive source sonobuoys (AN/SSQ-110A) that...

  10. 50 CFR 218.23 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ... daylight and periods of good visibility, to the extent practicable and consistent with mission, training... look a little to one side and out of the corners of their eyes, paying attention to the things on...

  11. 29 CFR 1910.218 - Forging machines.

    Science.gov (United States)

    2010-07-01

    ... maintenance is being performed on the press, the following shall be accomplished: (i) The hydraulic pumps and... provided at the back of every press, so arranged as to stop flying scale. (b) Hammers, general—(1) Keys... presses. When dies are being changed or maintenance is being performed on the press, the following...

  12. 31 CFR 31.218 - Enforcement.

    Science.gov (United States)

    2010-07-01

    ... disqualification of the retained entity from future financial agency agreements. (4) Imposition of any other remedy... significant consideration to a retained entity's prompt disclosure of any violation of these rules. ... is of the utmost importance. In the event a retained entity or any individual or entity...

  13. 50 CFR 218.183 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ... employing a scanning methodology in accordance with the Lookout Training Handbook (NAVEDTRA 12968-D). (v... testing requirement and general marine mammal mitigation measures. (iii) Test Directors shall make use of... operating level if any detected animals are within 500 yards (457 m) of the sonar source. Vessels...

  14. 48 CFR 218.201 - Contingency operation.

    Science.gov (United States)

    2010-10-01

    ... hours of business related courses do not apply to DoD employees or members of the armed forces who are..., DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES EMERGENCY ACQUISITIONS Emergency...

  15. 36 CFR 2.18 - Snowmobiles.

    Science.gov (United States)

    2010-07-01

    ... of total snowmobile noise that exceeds 78 decibels measured on the A-weighted scale measured at 50... decibels on the A-weighted scale at 50 feet. Snowmobiles manufactured prior to July 1, 1973 shall not register more than 86 decibels on the A-weighted scale at 50 feet. All decibel measurements shall be...

  16. Comparative Oncology: Evaluation of 2-Deoxy-2-[18F]fluoro-D-glucose (FDG Positron Emission Tomography/Computed Tomography (PET/CT for the Staging of Dogs with Malignant Tumors.

    Directory of Open Access Journals (Sweden)

    Stefanie M F Seiler

    Full Text Available 2-Deoxy-2-[18F]fluoro-D-glucose PET/CT is a well-established imaging method for staging, restaging and therapy-control in human medicine. In veterinary medicine, this imaging method could prove to be an attractive and innovative alternative to conventional imaging in order to improve staging and restaging. The aim of this study was both to evaluate the effectiveness of this image-guided method in canine patients with spontaneously occurring cancer as well as to illustrate the dog as a well-suited animal model for comparative oncology.Ten dogs with various malignant tumors were included in the study and underwent a whole body FDG PET/CT. One patient has a second PET-CT 5 months after the first study. Patients were diagnosed with histiocytic sarcoma (n = 1, malignant lymphoma (n = 2, mammary carcinoma (n = 4, sertoli cell tumor (n = 1, gastrointestinal stromal tumor (GIST (n = 1 and lung tumor (n = 1. PET/CT data were analyzed with the help of a 5-point scale in consideration of the patients' medical histories.In seven of the ten dogs, the treatment protocol and prognosis were significantly changed due to the results of FDG PET/CT. In the patients with lymphoma (n = 2 tumor extent could be defined on PET/CT because of increased FDG uptake in multiple lymph nodes. This led to the recommendation for a therapeutic polychemotherapy as a treatment. In one of the dogs with mammary carcinoma (n = 4 and in the patient with the lung tumor (n = 1, surgery was cancelled due to the discovery of multiple metastasis. Consequently no treatment was recommended.FDG PET/CT offers additional information in canine patients with malignant disease with a potential improvement of staging and restaging. The encouraging data of this clinical study highlights the possibility to further improve innovative diagnostic and staging methods with regard to comparative oncology. In the future, performing PET/CT not only for staging but also in therapy control could offer a

  17. Evaluation of 2-deoxy-2-[18F]fluoro-D-glucose positron emission tomography in gastric carcinoma. Relation to histological subtypes, depth of tumor invasion, and glucose transporter-1 expression

    International Nuclear Information System (INIS)

    Variable uptake of 2-deoxy-2-[18F]fluoro-D-glucose (FDG) has been noticed in positron emission tomography (PET) studies of gastric carcinoma patients, with low uptake occurring especially in some particular histological subtypes and early carcinomas. But this phenomenon has not been adequately explained. The aim of the present study is to clarify FDG uptake in gastric carcinomas especially focusing on histological subtypes, the depth of tumor invasion, and glucose transporter-1 (GLUT-1) expression which is considered to be one of the major factors for higher FDG uptake in human malignant tumors. FDG-PET was performed on 35 preoperative patients with gastric carcinoma. Forty macroscopically distinguishable lesions on a surgical specimen were histologically classified into two subtypes: Cohesive type (papillary adenocarcinoma, tubular adenocarcinoma, and solid type poorly differentiated adenocarcinoma) or Non-cohesive type (signet-ring cell carcinoma and non-solid type poorly differentiated carcinoma). GLUT-1 expression was immunohistochemically determined. Histological parameters (GLUT-1 expression, histological subtypes, the depth of invasion, lymphatic permeation, venous invasion and tumor size) were evaluated, and factors for FDG uptake (detectability and the degree) and GLUT-1 overexpression were determined by multiple regression analysis. Nineteen of 40 gastric carcinomas showed detectable FDG uptake (48%), multiple regression analysis revealed that both the depth of invasion and histological subtypes are independent factors that influence the detectable FDG uptake in gastric carcinoma (R2=0.66). GLUT-1 expression was seen from an early cancer stage and the cohesive type was an independent factor influencing the overexpression of GLUT-1 (R2=0.66). GLUT-1 expression was the most influential factor for the degree of FDG uptake in gastric carcinoma (R2=0.68). This study provided important information on the clinical application of FDG-PET in gastric carcinoma that

  18. Molecular clouds and star formation toward the Galactic plane within 216.25° ≤ l ≤ 218.75° and -0.75° ≤ b ≤ 1.25°

    Science.gov (United States)

    Gong, Y.; Mao, R. Q.; Fang, M.; Zhang, S. B.; Su, Y.; Yang, J.; Jiang, Z. B.; Xu, Y.; Wang, M.; Wang, Y.; Lu, D. R.; Sun, J. X.

    2016-04-01

    Context. Molecular clouds trace the spiral arms of the Milky Way and all its star forming regions. Large-scale mapping of molecular clouds will provide an approach to understand the processes that govern star formation and molecular cloud evolution. Aims: As a part of the Milky Way Imaging Scroll Painting (MWISP) survey, the aim is to study the physical properties of molecular clouds and their associated star formation toward the Galactic plane within 216.25° ≤ l ≤ 218.75° and -0.75° ≤ b ≤ 1.25°, which covers the molecular cloud complex S287. Methods: Using the 3 × 3 Superconducting Spectroscopic Array Receiver (SSAR) at the PMO-13.7m telescope, we performed a simultaneous 12CO (1-0), 13CO (1-0), C18O (1-0) mapping toward molecular clouds in a region encompassing 3.75 square degrees. We also make use of archival data to study star formation within the molecular clouds. Results: We reveal three molecular clouds, the 15 km s-1 cloud, the 27 km s-1 cloud, and the 50 km s-1 cloud, in the surveyed region. The 50 km s-1 cloud is resolved with an angular resolution of ~1' for the first time. Investigating their morphology and velocity structures, we find that the 27 km s-1 cloud is likely affected by feedback from the stellar association Mon OB3 and the 50 km s-1 cloud is characterized by three large expanding molecular shells. The surveyed region is mapped in C18O (1-0) for the first time. We discover seven C18O clumps that are likely to form massive stars, and 15 dust clumps based on the Bolocam Galactic Plane Survey (BGPS) archive data. Using infrared color-color diagrams, we find 56 Class I and 107 Class II young stellar object (YSO) candidates toward a slightly larger region of 5.0 square degrees. Based on the distribution of YSO candidates, an overdensity is found around the HII region S287 and the intersection of two shells; this is probably indicative of triggering. The star formation efficiency (SFE) and rate (SFR) of the 27 km s-1 cloud are

  19. Evaluation of a Wet Chemistry Method for Isolation of Cyclotron Produced [211At]Astatine

    Directory of Open Access Journals (Sweden)

    Shigeki Watanabe

    2013-09-01

    Full Text Available A “wet chemistry” approach for isolation of 211At from an irradiated bismuth target is described. The approach involves five steps: (1 dissolution of bismuth target in conc. HNO3; (2 removal of the HNO3 by distillation; (3 dissolution of residue in 8 M HCl; (4 extraction of 211At from 8 M HCl into DIPE; and (5 extraction of 211At from DIPE into NaOH. Results from 55 “optimized” 211At isolation runs gave recovery yields of approximately 78% after decay and attenuation corrections. An attenuation-corrected average of 26 ± 3 mCi in the target provided isolated (actual yields of 16 ± 3 mCi of 211At. A sixth step, used for purification of 211At from trace metals, was evaluated in seven runs. In those runs, isolated 211At was distilled under reductive conditions to provide an average 71 ± 8% recovery. RadioHPLC analyses of the isolated 211At solutions, both initial and after distillation, were obtained to examine the 211At species present. The primary species of 211At present was astatide, but astatate and unidentified species were also observed. Studies to determine the effect of bismuth attenuation on 211At were conducted to estimate an attenuation factor (~1.33 for adjustment of 211At readings in the bismuth target.

  20. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  1. Astatination of nanoparticles containing silver as possible carriers of 211At

    Czech Academy of Sciences Publication Activity Database

    Lebeda, Ondřej; Kučka, Jan; Hrubý, Martin; Koňák, Čestmír; Kozempel, Ján

    2006-01-01

    Roč. 64, - (2006), s. 201-206. ISSN 0969-8043 R&D Projects: GA AV ČR KJB4048302; GA AV ČR KJB4050408 Institutional research plan: CEZ:AV0Z1048901 Keywords : nanoparticles * 211AT * Atalpha particle therapy Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.924, year: 2006

  2. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  3. Case 218: Birt-Hogg-Dubé syndrome.

    Science.gov (United States)

    Zamora, Carlos A; Rowe, Steven P; Horton, Karen M

    2015-06-01

    History A 53-year-old man presented to the emergency department with subacute poorly localized abdominal pain that was increasing in intensity. He had a history of spontaneous pneumothoraces and skin lesion biopsy. Clinical examination revealed numerous small dome-shaped flesh-colored papules on the head and neck, as well as multiple palpable soft pliable nontender subcutaneous tumors scattered over the chest, abdomen, and extremities. Laboratory test results were unremarkable. The patient underwent contrast material-enhanced multidetector computed tomography (CT) of the chest, abdomen, and pelvis after intravenous administration of 120 mL of iohexol (Omnipaque 350; GE Healthcare, Princeton, NJ) infused at a rate of 3 mL/sec. PMID:25997135

  4. Dicty_cDB: VSF218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available significant alignments: (bits) Value N BD092935 |BD092935.1 Methods and compositions for synthesis of long c...hain polyunsaturated fatty acids in plants. 936 0.0 1 BD082645 |BD082645.1 Methods and composition...s for synthesis of long chain polyunsaturated fatty acids. 936 0.0 1 BD082630 |BD082630.1 Methods and composition

  5. Dicty_cDB: SSC218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 94.1 SD21708.5prime SD Drosophila melanogaster Schneider L2 cell culture pOT2 Drosophila melanogaster cDNA c...neider L2 cell culture pOT2 Drosophila melanogaster cDNA clone SD01870 5prime, mRNA...lone SD21708 5, mRNA sequence. 32 1.9 3 AI531016 |AI531016.1 SD01870.5prime SD Drosophila melanogaster Sch

  6. Dicty_cDB: AFO218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available a and immune antigen for suppressing growth of plasmodium. 58 4e-19 6 BD183625 |B...D183625.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium. 58 4e-19

  7. Dicty_cDB: VHH218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cqrktnyqlvvlhtnf*silsipqvtlisvxk*llpsvllmvl*slsiaskvfay kpklyyvkpslnvsnqshsstksivsyxnsn*tlkklislsvellnpsmsll...00 mNt: 0.00 m3a: 0.00 m3b: 0.00 m_ : 1.00 64.0 %: cytoplasmic 32.0 %: nuclear 4.0 %: cytoskeletal >> predic...ardia theta nucleomorph chro... 164 3e-39 EU624167_1( EU624167 |pid:none) Gas...ts: (bits) Value D21259_1( D21259 |pid:none) Entamoeba histolytica gene for elongat... 166 6e-40 ( Q06193 ) RecName: Full...39 EU624179_1( EU624179 |pid:none) Lomentaria orcadensis elongation f... 164 2e-39 AF083031_87( AF083031 |pid:none) Guill

  8. 32 CFR 218.3 - Dose reconstruction methodology.

    Science.gov (United States)

    2010-07-01

    ... radiation sources and their varied interaction properties with air and soil, it is necessary to obtain...) MISCELLANEOUS GUIDANCE FOR THE DETERMINATION AND REPORTING OF NUCLEAR RADIATION DOSE FOR DOD PARTICIPANTS IN THE... specific methodology consists of the characterization of the radiation environments to which...

  9. Dicty_cDB: AFK218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *titr*dvtrsslllsryssssfrcklstnpsqlsirrkgwc*klpt*wfhg cqw*ww*rsklstklfrwsratsricst...554266.1 Glossina morsitans morsitans (Tseatse fly) EST from adult infected midgut library, clone Tse14d06_q...1c. 74 3e-09 1 BX564920 |BX564920.1 Glossina morsitans morsitans (Tseatse fly) ES...T from adult infected midgut library, clone Tse74e09_q1c. 74 3e-09 1 BX554380 |BX554380.1 Glossina morsitans morsitans (Tseats...61 1e-68 ( P26901 ) RecName: Full=Vegetative catalase; EC=1.11.1.6... 259 7e-68 ( O93662 ) RecName: Full=Cat

  10. Dicty_cDB: AFF218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -51 J00621_1( J00621 |pid:none) Mus musculus renin mRNA, complete cds. 127 2e-51 AY102037_1( AY102037 |pid:none) Mus musculus transge...AACAATATATGTGNCATTGTTTTTTTTT sequence update 2001. 6. 2 Translated Amino Acid sequence fkltkilahrfqqrffy*SIP...YVLEVTEFGKTECLSGFMGIELNMGNFWILGDVFISAYYTVFDFGNKQVGFATAI QG*iflinlylxieiklnnrtiyvxlfff Translated Amino Acid sequence (All Fra...29 9e-60 AY361913_1( AY361913 |pid:none) Botryotinia fuckeliana aspartic pr... 140 1e-55 J02941_1( J02941 |pid:none) Rat reni...xivff Frame B: i*inkdfgaqistkifllinst*fnkgeneityfnfifsyycfsssfns

  11. 50 CFR 218.102 - Permissible methods of taking.

    Science.gov (United States)

    2010-10-01

    ... (Megaptera novaeangliae)—4,025 (an average of 805 annually); (B) Fin whale (Balaenoptera physalus)—910 (an average of 182 annually); (C) Blue whale (Balaenoptera musculus)—650 (an average of 130 annually); (D) Sei whale (Balaenoptera borealis)—1,625 (an average of 325 annually); (E) Minke whale...

  12. Dicty_cDB: CFG218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NLNSKKIIELNTVIFFVFLYLSFIL*kk--- Frame B: ntinnqitqihii*iqkk**n*iq*fflyfyiyhsyfkkk--- Frame C: iq*tik*hkyi*fkfkknnrikysnffcifisi...ihtlkk--- Homology vs CSM-cDNA Score E Sequences producing significa.... 4 Homology vs DNA Score E Sequences producing significant alignments: (bits) Va...0.044 5 AZ678477 |AZ678477.1 ENTMS22TF Entamoeba histolytica Sheared DNA Entamoeba histolytica genomic, genomic..., DNA sequence. 44 0.44 1 AC144971 |AC144971.1 Silurana tropicalis clone ISB-372E6, WORKING DRAFT SEQUENCE,

  13. Dicty_cDB: SHC218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gy vs DNA Score E Sequences producing significant alignments: (bits) Value N BX548045 |BX548045.6 Zebrafish ...ly*fsnery*fktskcfnn*k s*nfts*iprnw*nf Homology vs CSM-cDNA Score E Sequences producing significant alignment...m clone DKEYP-123A1. 46 0.93 1 dna update 2005.12.31 Homology vs Protein Score E Sequences producing significa...liyyflfvikkkkxq****ffknkxikk*xqikk*f nnnnfsfikktxk*kk*nnk*xlkkk--- ---lvmsvisirmvsfsspierks*slqqvvkifhqp*lkv... 12.0 %: mitochondrial 4.0 %: cytoskeletal 4.0 %: vacuolar 4.0 %: vesicles of secretory system >> predic

  14. Dicty_cDB: SSI218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rvl*lve*niwvlrvthkvsmvkreqlvvflleqakqsllafm miksnqdqlhlllks*vit*eimvikili...nfkn*kk*****nlnvttkink* kkkt*ivnp*ksikkkkkkk Frame C: ---flfssntiyihtnkik*agnnmsmnn*lvqdflkeqf*vqmmvvfglnhqvlillnq kvmv*llyskiqlryll... i... 108 9e-23 (Q5FX67) RecName: Full=Profilin; AltName: Full=Pollen allergen C....SQGAILGANDGGVWAKSSGINITKP EGDGIAALFKNPAEVFAKGALIGGVKYMGIKGDPQSIYGKKGATGCVLVRTGQAIIVGIY DDKVQPGSAALIVEKLGDYLRDNGY*dinill...SSGINITKP EGDGIAALFKNPAEVFAKGALIGGVKYMGIKGDPQSIYGKKGATGCVLVRTGQAIIVGIY DDKVQPGSAALIVEKLGDYLRDNGY*dinillkpirf

  15. 50 CFR 218.181 - Permissible methods of taking.

    Science.gov (United States)

    2010-10-01

    ... (Stenella frontalis)—2,355 (an average of 471 annually); (v) Pantropical spotted dolphin (S. attenuata)—115...) Atlantic spotted dolphin (Stenella frontalis)—10 (an average of 2 annually); (iii) Pantropical spotted dolphin (S. attenuata)—5 (an average of 1 annually); (ix) Spinner dolphin (S. longirostris)—5 (an...

  16. 30 CFR 218.152 - Fishermen's Contingency Fund.

    Science.gov (United States)

    2010-07-01

    ... MANAGEMENT COLLECTION OF MONIES AND PROVISION FOR GEOTHERMAL CREDITS AND INCENTIVES Oil, Gas and Sulfur..., any holder of a lease issued or maintained under the Outer Continental Shelf Lands Act and any...

  17. 50 CFR 218.105 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... trying to categorize in any way, the observed behavior of the animals (such as animal closing to bow ride... without trying to categorize in any way, the observed behavior of the animals (such as animal closing to... animal(s), the condition of the animal(s) (including carcass condition if the animal is dead),...

  18. Testing program PIN using experimental results from Report CENPD--218

    International Nuclear Information System (INIS)

    The applicability is tested of program PIN (derived from program GAPCON-THERMAL-2) in the thermomechanical modelling of light water reactor fuel elements. Four variants of fuel elements designated A through to D were calculated using the PIN. Variant B consists of two fuel elements with a different irradiation history. The elements were irradiated in different reactors. The experimental data (temperature in the middle of the fuel, the amount of fission products, axial and radial can deformations, fuel-can gap) are shown in tables and graphs. (H.S.)

  19. 50 CFR 218.24 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ...; (B) Species (if not possible, indicate whale, dolphin or pinniped); (C) Number of individuals; (D... Comprehensive Monitoring Program (ICMP) Plan in 2009. This planning and adaptive management tool shall...

  20. 50 CFR 218.5 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ..., indicate whale, dolphin or pinniped); (C) Number of individuals; (D) Whether calves were observed; (E... planning and adaptive management tool shall include: (1) A method for prioritizing monitoring projects...

  1. 50 CFR 218.14 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ..., indicate whale, dolphin or pinniped); (C) Number of individuals; (D) Whether calves were observed; (E... planning and adaptive management tool shall include: (1) A method for prioritizing monitoring projects...

  2. Dicty_cDB: CFJ218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available _04H08_TEXF1 Psoroptes ovis mixed Psoroptes ovis cDNA clone Po_ad_04H08 5' similar to O46030 CYSTEINE PROT...EINASE. Sitophilus zeamais (maize weevil), mRNA sequence. 50 2e-06 3 dna update 200

  3. Body mass index cut-offs for overweight and obesity in Chinese children and adolescents aged 2-18 years%中国2~18岁儿童青少年超重和肥胖筛查体重指数界值点的研究

    Institute of Scientific and Technical Information of China (English)

    李辉; 宗心南; 季成叶; 米杰

    2010-01-01

    Objective To study the body cut-offs of mass index (BMI) for the purpose of screening overweight and obesity for Chinese children and adolescents aged 2-18 years. Methods Based on the BMI growth reference values for Chinese children aged 0-18, using the common methods to establish the BMI cut-offs for screening overweight and obesity. These methods were having the same empirical percentile or Z scores and the BMI value at 18 years consistent with adults.Three sets of BMI cut-offs, including (BMI24, BMI28) , (P85, P95) and (Z1, Z2) , were initially identified. Differences were compared on different cut-off points and prevalence rates of overweight and obesity with different BMI reference, different values and "prevalence" of overweight and obesity based on "2004 Beijing Child and Adolescent Metabolic Syndrome Study ". Cut-offs standards which recommended by the Chinese Working Group on Obesity for Children (WGOC) and by the International Obesity Task Force (IOTF) were also used. Finally the appropriate cut-offs were defined. Results Three sets of BMI cut-offs for screening overweight and obesity for Chinese children and adolescents aged 2-18 years were obtained according to the above mentioned methods for selection. The prevalence rates of overweight and obesity defined by those cut-offs appeared not to be significantly different. Compared with the WGOC, the BMI cut-off points for screening overweight and obesity for both boys and girls from our study were very close to the WGOC', but cut-off points for screening overweight for girls aged 8.5-15.5 y was 0.3-1.0 kg/m2 lower than the WGOC'. Going through the database on screening of "2004 Beijing Children's Metabolic Syndrome Survey ", the prevalence of overweight for girls was about 3.4% higher than using the cut-offs of WGOC. Conclusion Results from this study suggested that the BMI cut-offs passed through the cut-off point of BMI24 and BMI28 at 18 years was appropriate for screening overweight and obesity in

  4. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  5. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE,CERN

    OpenAIRE

    Rothe, Sebastian

    2012-01-01

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spec...

  6. Inactivation of human osteosarcoma cells in vitro by {sup 211}At-TP-3 monoclonal antibody: Comparison with astatine-211 and external-beam X rays

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, R.H. [Univ. of Oslo (Norway)]|[Institute for Cancer Research, Oslo (Norway); Bruland, O.S. [Institute for Cancer Research, Oslo (Norway); Hoff, P.; Alstad, J. [Univ. of Oslo (Norway); Lindmo, T. [Institute for Cancer Research, Oslo (Norway); Rofstad, E.K. [Norwegian Institute of Technology, Trondheim (Norway)

    1994-08-01

    The potential usefulness of {alpha}-particle radioimmunotherapy in the treatment of osteosarcoma was studied in vitro by using the monoclonal antibody TP-3 and cells of three human osteosarcoma cell lines (OHS, SAOS and KPDX) differing in antigen expression. Cell survival curves were established after treatment with (a) {sup 211}At-TP-3 of different specific activities, (b) {sup 211}At-labeled bovine serum albumin (BSA), (c) free {sup 211}At and (d) external-beam X rays. The three osteosarcoma cell lines showed similar survival curves, whether treated with external-beam X rays, {sup 211}At-BSA or free {sup 211}At. The D{sub o}`s were lower for free {sup 211}At than for {sup 211}At-BSA. The survival curves for {sup 211}At-TP-3 treatment, on the other hand, differed significantly among the cell lines, suggesting that sensitivity to {sup 211}At-TP-3 treatment was governed by cellular properties other than sensitivity to external-beam X rays. The cellular property most important for sensitivity to {sup 211}At-TP-3 treatment was the antigen expression. Cell inactivation after {sup 211}At-TP-3 treatment increased substantially with increasing specific activity of the {sup 211}At-TP-3. At high specific activities, the cytotoxic effect of {sup 211}At-TP-3 was significantly higher than that of {sup 211}At-BSA. In conclusion, {sup 211}At-TP-3 has the potential to give clinically favorable therapeutic ratios in the treatment of osteosarcoma. 39 refs., 5 figs., 2 tabs.

  7. Heterogeneous seeding of HET-s(218–289) and the mutability of prion structures

    Energy Technology Data Exchange (ETDEWEB)

    Wan, William; Stubbs, Gerald

    2014-02-18

    One fundamental property of prions is the formation of strains—prions that have distinct biological effects, despite a common amino acid sequence. The strain phenomenon is thought to be caused by the formation of different molecular structures, each encoding for a particular biological activity. While the precise mechanism of the formation of strains is unknown, they tend to arise following environmental changes, such as passage between different species. One possible mechanism discussed here is heterogeneous seeding; the formation of a prion nucleated by a different molecular structure. While heterogeneous seeding is not the only mechanism of prion mutation, it is consistent with some observations on species adaptation and drug resistance. Heterogeneous seeding provides a useful framework to understand how prions can adapt to new environmental conditions and change biological phenotypes.

  8. 24 CFR 884.218 - Reexamination of family income and composition.

    Science.gov (United States)

    2010-04-01

    ... requirements of 24 CFR part 5 concerning verification of the immigration status of any new family member. (b... 19, 1995 when there is a new family member, the owner shall follow the requirements of 24 CFR part 5... title and determine whether the family's unit size is still appropriate. The owner must adjust...

  9. Calibration of ground-based Lidar instrument WLS7-218

    DEFF Research Database (Denmark)

    Yordanova, Ginka; Gómez Arranz, Paula

    This report presents the result of the lidar calibration performed for the given WLS7 Windcube at DTU’s test site for large wind turbines at Høvsøre, Denmark. Calibration is here understood as the establishment of a relation between the reference wind speed measurements with measurement...... uncertainties provided by measurement standard and corresponding lidar wind speed indications with associated measurement uncertainties. The lidar calibration concerns the 10 minute mean wind speed measurements. The comparison of the lidar measurements of the wind direction with that from wind vanes...... measurements are given for information only....

  10. AB218. The size of seminal vesicles on ultrasound is related with premature ejaculation

    Science.gov (United States)

    Yao, Bin

    2016-01-01

    Objective Myriad biological factors have been proposed to explain premature ejaculation (PE). However, data correlating PE with seminal vesicles (SV) are sparse. The study aimed to evaluate the relationship between the size of SV on ultrasound and PE and to explore the potential mechanism of the relationship. Methods A cross-sectional study was conducted that included 44 PE outpatients and another 44 male volunteers without PE. Self-estimated intravaginal ejaculatory latency time (IELT), the Premature Ejaculation Diagnostic Tool (PEDT), the International Index of Erectile Function-15 (IIEF) and the National Institutes of Health Chronic Prostatitis Symptom Index (NIH-CPSI) were used for assessment of symptoms. The size of SV and other ultrasound figures were compared between PE group and control group. Tandem mass tag (TMT) method followed by mass spectrometry analysis was used to compare the relative expression levels of seminal plasma proteins between PE group and control group. Results Compared to the control group, the PE group had significantly higher mean anterior-posterior diameter (APD) of SV. The optimal mean APD of SV cutoff level as identified by the maximal Youden index was 9.25 mm for PE. In the PE group, PEDT was also higher with mean APD of SV >9.25 mm compared with mean APD of SV <9.25 mm. PEDT was significantly correlated with mean APD of SV, even after adjusting for age, IIEF-15 erectile function score and NIH-CPSI pain domain and voiding domain score. Compared to the matched six control subjects, 102 proteins were at least 1.5-fold up- or down-regulated in seminal plasma of six PE patients. Among them, GGT1, LAMC1 and APP were significantly higher in the PE group. Conclusions Our results indicated that men with larger mean APD of SV might have a higher PEDT score. Transrectal ultrasound of SV should be considered in the clinical evaluation of patients with PE. The changes of SV might be associated with the higher expressed GGT1, LAMC1 and APP, which might further result in PE.

  11. http://www.se.org.pk/File-Download.aspx?publishedid=218

    Directory of Open Access Journals (Sweden)

    Syed Saqlain Hussain, Muhammad Jamil, Muhammad Sadiq and Shahzada Munawar Mehdi

    2012-05-01

    Full Text Available It is an established fact that temporary waterlogging occurs at first irrigation to wheat crop in rice-wheat cropping system. This is also true in saline sodic soils. Wheat crop becomes pale yellow just after first irrigation resulting in severe reduction in growth and yield. This study was planned to address this problem by various management strategies like irrigation at 25 days after sowing (DAS without fertilizer, irrigation at 25 DAS + 120-110-70 NPK kg ha-1, irrigation at 25 DAS + 120-110-70 NPK kg ha-1 + 25 kg sulphuric acid per hectare, irrigation at 25 DAS+ 120-110-70 NPK kg ha-1 +12 kg sulphuric acid per hectare and irrigation at 40 DAS +120-110-70 NPK kg ha-1. A saline sodic field {pHs =8.92, ECe =5.70 (dS m-1 and SAR=23.71 (mmol L-11/2} was selected. Maximum grain yield (3.01 t ha-1, number of tillers (437 m-2, 1000-grain weight (35.43 g and number of grains spike-1 (40 were produced with the application of 120-110-70 NPK kg ha-1 + 25 kg ha -1 sulphuric acid at first irrigation applied 25 days after sowing in saline sodic soil.

  12. 38 CFR 1.218 - Security and law enforcement at VA facilities.

    Science.gov (United States)

    2010-07-01

    ... not reside in quarters on the property, is prohibited. Acts of prostitution or solicitation for acts of prostitution on VA property is prohibited. For the purposes of this paragraph, an act of prostitution is defined as the performance or the offer or agreement to perform any sexual act for money...

  13. 50 CFR 218.10 - Specified activity and specified geographical area and effective dates.

    Science.gov (United States)

    2010-10-01

    ... training events indicated in paragraph (c)(1)(ii) of this section: (i) Underwater Explosives: (A) AGM-114 (Hellfire missile); (B) AGM-65 E/F (Maverick missile); (C) Mine Neutralization (20 lb NEW charges); (D)...

  14. 50 CFR 218.1 - Specified activity, specified geographical area and effective dates.

    Science.gov (United States)

    2010-10-01

    ... events indicated in paragraph (c)(1)(ii) of this section: (i) Underwater Explosives: (A) AGM-114 (Hellfire missile) (B) AGM-65 E/F (Maverick missile) (C) MK-83/GBU-32 (1,000 lb High Explosive bomb) (D) Airgorne Mine Neutralization system (AMNS) (E) 20 lb NEW charges (F) AGM-88 (HARM) (G) 5″ Naval Gunfire...

  15. Olivia BENHAMOU, Avorter aujourd’hui, Paris, Mille et une nuits, 2004, 218 p.

    OpenAIRE

    KNIBIEHLER, Yvonne

    2005-01-01

    Le trentième anniversaire de la loi Veil a suscité de nombreux ouvrages dont celui-ci. L’auteure, une journaliste née en 1973, un an avant cette loi, s’est engagée dans une investigation méthodique d’excellente qualité afin d’en mesurer les effets. Elle a découvert avec stupeur que pour bien des femmes l’avortement reste encore un calvaire. Le livre, composé et écrit avec talent, exprime son émotion et sa révolte, et se lit d’un trait. Les chapitres présentent, en alternance, un témoignage d’...

  16. Geohydrology of the 218-W-5 Burial Ground, 200-West Area, Hanford Site

    Energy Technology Data Exchange (ETDEWEB)

    Bjornstad, B.N.

    1990-05-01

    Construction a disposal facility for solid, mixed low-level radioactive and hazardous wastes at the Hanford Site in southeastern Washington State (Figure 1) is planned. A site-specific performance assessment for each new disposal facility to ensure that wastes will be isolated from the environment is required. To demonstrate the adequacy of the facility for isolating the wastes, computer codes are used to simulate the physical processes that could cause the waste to migrate to underground water supplies or to the land's surface. The purpose of this report is provide a compilation and interpretation of geologic and hydrologic data available use in the performance assessment modeling. A variety of data are needed to model flow and transport from a solid-waste burial trench. These data include soil water content, soil moisture potential, saturated and unsaturated hydraulic conductivity, and phase mineralogy of the soils and sediments within the vadose zone. The hydrologic data that are critical for quantifying the water storage and transport properties for unsaturated soils require a characterization of the heterogeneities of various soil layers and the moisture characteristic curves for these layers. Hydraulic properties and mineralogic data for the saturated sediments are also important for modelling the flow and transport of wastes in the unconfined aquifer. This report begins with a discussion of the procedures and methods used to gather data both in the field and in the laboratory. This is followed by a summary of the geology, including the stratigraphic framework, lithofacies, and mineralogic/geochemical characteristics of the suprabasalt sediments. The hydrology of the region of the site is discussed next. In this discussion, the characteristics of the uppermost aquifer(s), unsaturated zone, and the various hydrogeologic units are presented. 54 refs., 39 figs., 11 tabs.

  17. Histological evidence of testicular dysgenesis in contralateral biopsies from 218 patients with testicular germ cell cancer

    DEFF Research Database (Denmark)

    Hoei-Hansen, Christina E; Holm, Mette; Rajpert-De Meyts, Ewa;

    2003-01-01

    This study was prompted by a hypothesis that testicular germ cell cancer may be aetiologically linked to other male reproductive abnormalities as a part of the so-called 'testicular dysgenesis syndrome' (TDS). To corroborate the hypothesis of a common association of germ cell cancer with testicular...... presenting with testicular germ cell neoplasms of the adolescent and young type. The findings therefore support the hypothesis that this cancer is part of a testicular dysgenesis syndrome. The presence of contralateral carcinoma in situ was higher in the present study than previously reported....... dysgenesis, microscopic dysgenetic features were quantified in contralateral testicular biopsies in patients with a testicular germ cell tumour. Two hundred and eighty consecutive contralateral testicular biopsies from Danish patients with testicular cancer diagnosed in 1998-2001 were evaluated...

  18. 50 CFR 218.100 - Specified activity and specified geographical area.

    Science.gov (United States)

    2010-10-01

    ... Command Activated Sonobuoy System (DICASS) sonobuoys)-up to 8270 sonobuoys over the course of 5 years (an average of 1654 sonobuoys per year); (iv) AN/AQS-22 (helicopter dipping sonar)—up to 2,960 dips over...

  19. 49 CFR Appendix D to Part 218 - Requirements and Considerations for Implementing Technology Aided Point Protection

    Science.gov (United States)

    2010-10-01

    ... driver behavior (e.g., driving erratically) of any approaching motor vehicles. 6. Either the camera... or yard access crossings equipped with approved supplemental safety devices (see 49 CFR part 222,...

  20. 30 CFR 218.104 - Exemption of States from certain interest and penalties.

    Science.gov (United States)

    2010-07-01

    ... MINERALS REVENUE MANAGEMENT COLLECTION OF MONIES AND PROVISION FOR GEOTHERMAL CREDITS AND INCENTIVES Oil... Interior for failure to comply with the Emergency Petroleum Allocation Act of 1973, as amended, or any... Act of 1973, as amended. Each State's share shall be assessed against monies owed to the State....

  1. VLA observations of the radio galaxy Hydra A (3C 218)

    Energy Technology Data Exchange (ETDEWEB)

    Taylor, G.B.; Perley, R.A.; Inoue, M.; Kato, T.; Tabara, H. (California Univ., Los Angeles (USA) National Radio Astronomy Observatory, Socorro, NM (USA) Nobeyama Radio Observatory, Minamimaki (Japan) Utsunomiya Univ. (Japan))

    1990-09-01

    An extensive series of observations of the radio galaxy Hydra A using the VLA is reported. The radio emission consists of two components: (1) a pair of well-collimated, curved jets with S-symmetry, each of which makes a turn through about 40 deg between the core and the lobe, and (2) diffuse radio lobes, also rotation-symmetric, although straighter, which extend north out to 5 arcmin (420 kpc) and south out to 3 arcmin (250 kpc). Rotation measures (RMs) ranging from -1000 to +3300 rad/sq m are found in the northern lobe with gradients in the RM of up to 1000 rad/sq m/arcsec. In the southern lobe the RM gradients are probably in excess of + or - 3750 rad/sq m, the maximum value that can be unambiguously determined here. 48 refs.

  2. VLA observations of the radio galaxy Hydra A (3C 218)

    International Nuclear Information System (INIS)

    An extensive series of observations of the radio galaxy Hydra A using the VLA is reported. The radio emission consists of two components: (1) a pair of well-collimated, curved jets with S-symmetry, each of which makes a turn through about 40 deg between the core and the lobe, and (2) diffuse radio lobes, also rotation-symmetric, although straighter, which extend north out to 5 arcmin (420 kpc) and south out to 3 arcmin (250 kpc). Rotation measures (RMs) ranging from -1000 to +3300 rad/sq m are found in the northern lobe with gradients in the RM of up to 1000 rad/sq m/arcsec. In the southern lobe the RM gradients are probably in excess of + or - 3750 rad/sq m, the maximum value that can be unambiguously determined here. 48 refs

  3. 12 CFR 218.741 - Exemption for banks effecting transactions in money market funds.

    Science.gov (United States)

    2010-01-01

    ... (15 U.S.C. 78c(a)(4)) to the extent that it effects transactions on behalf of a customer in securities issued by a money market fund, provided that: (1) The bank either (i) Provides the customer, directly or..., the other bank described in paragraph (a)(1)(B) of this section provides the customer, not later...

  4. Using Interactive Videodiscs in Open University Courses. I.E.T. Papers on Broadcasting No. 218.

    Science.gov (United States)

    Fuller, Robert G., Ed.

    This nine-paper collection from a June 1983 Open University (OU) campus workshop in Milton Keynes, England, describes an interactive video project developed for an OU undergraduate course, T252, Introduction to Engineering Materials, and discusses varied aspects of interactive videodisc program development. The following papers are included:…

  5. Yeast Interacting Proteins Database: YGR218W, YMR124W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ry, cytoplasm, bud, and bud neck; interacts with Crm1p in two-hybrid assay; YMR12...bud, and bud neck; interacts with Crm1p in two-hybrid assay; YMR124W is not an essential gene Rows with this

  6. Histological evidence of testicular dysgenesis in contralateral biopsies from 218 patients with testicular germ cell cancer

    DEFF Research Database (Denmark)

    Hoei-Hansen, Christina E; Holm, Mette; Rajpert-De Meyts, Ewa; Skakkebæk, Niels Erik

    2003-01-01

    This study was prompted by a hypothesis that testicular germ cell cancer may be aetiologically linked to other male reproductive abnormalities as a part of the so-called 'testicular dysgenesis syndrome' (TDS). To corroborate the hypothesis of a common association of germ cell cancer with testicular...... dysgenesis, microscopic dysgenetic features were quantified in contralateral testicular biopsies in patients with a testicular germ cell tumour. Two hundred and eighty consecutive contralateral testicular biopsies from Danish patients with testicular cancer diagnosed in 1998-2001 were evaluated...... presenting with testicular germ cell neoplasms of the adolescent and young type. The findings therefore support the hypothesis that this cancer is part of a testicular dysgenesis syndrome. The presence of contralateral carcinoma in situ was higher in the present study than previously reported....

  7. Structure of Even-Even 218-230 Ra Isotopes within the Interacting Boson Approximation Model

    Directory of Open Access Journals (Sweden)

    Diab S. M.

    2008-01-01

    Full Text Available A good description of the excited positive and negative parity states of radium nuclei (Z=88, N=130-142 is achieved using the interacting boson approximation model (IBA-1. The potential energy surfaces, energy levels, parity shift, electromagnetic transition rates B(E1, B(E2 and electric monopole strength X(E0/E2 are calculated for each nucleus. The analysis of the eigenvalues of the model Hamiltonian reveals the presence of an interaction between the positive and negative parity bands. Due to this interaction the $Delta I = 1$ staggering effect, between the energies of the ground state band and the negative parity state band, is produced including beat patterns.

  8. Adjustable valves in normal-pressure hydrocephalus: a retrospective study of 218 patients

    DEFF Research Database (Denmark)

    Zemack, G.; Rommer, Bertil Roland

    2008-01-01

    OBJECTIVE: We sought to assess the value of adjusting shunt valve opening pressure, complications, and outcomes with the use of an adjustable shunt valve in the treatment of patients with normal-pressure hydrocephalus (NPH). METHODS: In a single-center retrospective study, 231 adjustable valves (...

  9. 2-18 GHz broadband MMIC SPDT switches based on GMIC and heterolithic circuits

    OpenAIRE

    Howell, Charles M.; Regan, John J.

    1990-01-01

    Monolithic integrated circuit switches can be fabricated using either GaAs FETs or with PIN diodes as the active elements. Each offers advantages and disadvantages to the circuit design. It has been shown that because of their higher switching Q1,4 that PIN diodes should exhibit lower loss and higher isolation in the same circuit than a switch made with a FET as the switching element. Conversely, FET based switches offer an advantage of less control power and better DC to RF isolation of the ...

  10. Absolute total cross sections for the scattering of 2--18-eV electrons by cesium atoms

    International Nuclear Information System (INIS)

    Absolute total cross sections for the scattering of electrons by cesium atoms between 2 and 18 eV have been measured using the atomic-recoil technique in the scattering-out mode. Our results are somewhat lower than those of Visconti, Slevin, and Rubin [Phys. Rev. A 3, 1310 (1971)] above 2 eV

  11. Absolute total cross sections for the scattering of 2--18-eV electrons by cesium atoms

    Energy Technology Data Exchange (ETDEWEB)

    Jaduszliwer, B.; Chan, Y.C. (Electronics Technology Center, The Aerospace Corporation, P. O. Box 92957, Los Angeles, California 90009 (United States))

    1992-01-01

    Absolute total cross sections for the scattering of electrons by cesium atoms between 2 and 18 eV have been measured using the atomic-recoil technique in the scattering-out mode. Our results are somewhat lower than those of Visconti, Slevin, and Rubin (Phys. Rev. A 3, 1310 (1971)) above 2 eV.

  12. 46 CFR 67.218 - Optional filing of instruments in portable document format as attachments to electronic mail.

    Science.gov (United States)

    2010-10-01

    ... recording under § 67.200 may be submitted in portable document format (.pdf) as an attachment to electronic... submitted for filing in .pdf format pertains to a vessel that is not a currently documented vessel, a... with the National Vessel Documentation Center or must be submitted in .pdf format with the...

  13. The study of neutralization of Po-218 ions by small ion recombination in O2, Ar and N2

    International Nuclear Information System (INIS)

    Three mechanisms of neutralization of Po+, electron transfer, electron scavenging and small ion recombination, have been suggested. Considerable work has been conducted on the first two mechanisms. However, little information about the small ion recombination is available. In the present research, this mechanism was studied by examining the neutralization rates in different radon concentrations in N2, Ar, and O2 with the aid of a continuous monitoring of radon and progency experimental system. The results showed that the neutralization rates in the three gases are around 2 to 4 sec/sup /minus/1/. A linear relationship between the neutralization rate and the square root of radon concentration was obtained. It was also found that the neutralization rates are higher in the gas with lower ionization potential. The charged fraction of polonium in all cases was measured to be 0.88. Further, the existence of the neutralization rate plateau at high radon concentrations was strongly suggested. 24 refs

  14. 75 FR 56533 - Wireless Telecommunications Bureau Postpones Auction of 218-219 MHz Service and Phase II 220 MHz...

    Science.gov (United States)

    2010-09-16

    ... document announces the postponement of Auction 89. FOR FURTHER INFORMATION CONTACT: Wireless.... SUPPLEMENTARY INFORMATION: This is a summary of the Auction 89 Postponement Public Notice, which was released on August 26, 2010. The complete text of the Auction 89 Postponement Public Notice and related...

  15. Bis{2-[1-(8-hydroxy-2-quinolylmethyl)-1H-benzimidazol-2-yl]quinolin-8-ol} toluene solvate

    OpenAIRE

    Qing-Ming Wang; Qi Ma; Hui-Li Chen

    2010-01-01

    Crystals of the title compound, 2C26H18N4O2·C7H8, were obtained from the reaction of 8-hydroxyquinoline with 1,2-phenylenediamine in methanol and recrystallized from toluene. The compound contains three essentially planar ring systems: the benzimidazole ring (r.m.s. deviation = 0.039 Å) and two 8-hydroxyquinoline rings (r.m.s. deviations of 0.0056 Å in both rings). The benzimidazole ring and one 8-hydroxyquinoline ring are almost co-planar, formi...

  16. Bis{2-[1-(8-hydroxy-2-quinolylmethyl-1H-benzimidazol-2-yl]quinolin-8-ol} toluene solvate

    Directory of Open Access Journals (Sweden)

    Qing-Ming Wang

    2010-03-01

    Full Text Available Crystals of the title compound, 2C26H18N4O2·C7H8, were obtained from the reaction of 8-hydroxyquinoline with 1,2-phenylenediamine in methanol and recrystallized from toluene. The compound contains three essentially planar ring systems: the benzimidazole ring (r.m.s. deviation = 0.039 Å and two 8-hydroxyquinoline rings (r.m.s. deviations of 0.0056 Å in both rings. The benzimidazole ring and one 8-hydroxyquinoline ring are almost co-planar, forming a dihdral angle of 3.1 (2°. The other 8-hydroxyquinoline ring is almost perpendicular to the benzimidazole plane with a dihedral angle of 86.2 (2°. Intramolecular O—H...N contacts are present. The crystal structure is stabilized by intermolecular O—H...N interactions. The complete toluene molecule is generated by crystallographic inversion symmetry; therefore its methyl group is disordered over two sites of equal occupancy.

  17. Compliance matrix for the Mixed Waste Disposal Facilities, Trenches 31 and 34, burial ground 218-W-5. Revision 1

    International Nuclear Information System (INIS)

    The purpose of the Trench 31 and 34 Mixed Waste Disposal Facility Compliance Matrix is to provide objective evidence of implementation of all regulatory and procedural--institutional requirements for the disposal facilities. This matrix provides a listing of the individual regulatory and procedural--institutional requirements that were addressed. Subject matter experts reviewed pertinent documents that had direct or indirect impact on the facility. Those found to be applicable were so noted and listed in Appendix A. Subject matter experts then extracted individual requirements from the documents deemed applicable and listed them in the matrix tables. The results of this effort are documented in Appendix B. The implementing compliance documentation for WHC-CM manuals is not included in Appendix B because these are, by definition, implementing documents

  18. CTEPP STANDARD OPERATING PROCEDURE FOR COLLECTION OF DISLODGEABLE RESIDUES -- PUF ROLLER SAMPLES FOR PERSISTENT ORGANIC POLLUTANTS (SOP-2.18)

    Science.gov (United States)

    This SOP describes the method to collect transferable residues from indoor floor surfaces. The sampling procedures described are applicable to bare floors or covered floor surfaces, e.g., carpeting and vinyl flooring. The samples will be collected only in the day care centers o...

  19. A THREE-POSITION SPECTRAL LINE SURVEY OF SAGITTARIUS B2 BETWEEN 218 AND 263 GHz. II. DATA ANALYSIS

    OpenAIRE

    Nummelin, A.; Bergman, ; P.; Hjalmarson, Å.; Friberg, P.; IRVINE, W.M; Millar, T. J.; OhiShi, M; Saito, S.

    2000-01-01

    We present an analysis of the data from our Swedish-ESO Submillimetre Telescope molecular line survey in the 1.3 mm band of the N, M, and NW positions in the Sgr B2 molecular cloud. The line emissions from 42 molecular species, and some of their isotopomers, were analyzed assuming a single temperature and a homogeneous source. In cases where a source size much smaller than the antenna beam (23″) could be estimated, optical depth effects were also accounted for. In this way rotation temperatur...

  20. 12 CFR 218.760 - Exemption from definition of “broker” for banks accepting orders to effect transactions in...

    Science.gov (United States)

    2010-01-01

    ... a plan under 17 CFR 270.12b-1, from the bank, the executing broker or dealer, or any other person... transactions in securities for the account only as an accommodation to the customer; (2) Employee compensation...) of this section; and (ii) Responding to customer inquiries regarding the bank's safekeeping...

  1. The Structure of Even-Even 218-230 Ra Isotopes within the Interacting Boson Approximation Model

    Directory of Open Access Journals (Sweden)

    Diab S. M.

    2008-01-01

    Full Text Available A good description of the excited positive and negative parity states of radium nuclei ( Z = 88, N = 130–142 is achieved using the interacting boson approximation model (IBA-1. The potential energy surfaces, energy levels, parity shift, electromagnetic tran- sition rates B ( E 1 , B ( E 2 and electric monopole strength X ( E 0 / E 2 are calculated for each nucleus. The analysis of the eigenvalues of the model Hamiltonian reveals the presence of an interaction between the positive and negative parity bands. Due to this interaction the I = 1 staggering e ect, between the energies of the ground state band and the negative parity state band, is produced including beat patterns.

  2. 12 CFR 218.721 - Defined terms relating to the trust and fiduciary activities exception from the definition of...

    Science.gov (United States)

    2010-01-01

    ... investment performance or for reviewing compliance with applicable investment guidelines or restrictions...; (D) Based on the financial performance of the assets in an account; or (E) For the types of services... statements showing their purchases, sales, and positions in the investment company; (4) Processing...

  3. Rapid preparation of pyrogen-free 2H2(18)O for human-nutrition studies

    International Nuclear Information System (INIS)

    We describe a compact ultrafiltration system for the removal of pyrogens and bacteria from water labeled with the stable isotopes of deuterium and oxygen-18. The ultrafiltration system is constructed from readily available commercial components and can achieve complete removal of pyrogens and bacteria from 1L contaminated water within 30 min. By use of our procedure, loss of the isotopically labeled water by retention in the filtration system was minimal. The purified water is suitable for both oral and intravenous administration to healthy human subjects participating in nutrition studies

  4. Compliance matrix for the mixed waste disposal facilities, trenches 31 and 34, burial ground 218-W-5. Revision 2

    International Nuclear Information System (INIS)

    This document provides a listing of applicable regulatory requirements to the Mixed Waste Disposal trenches. After the listing of regulations to be followed is a listing of documents that show how the regulations are being implemented and followed for the Mixed Waste trenches

  5. Compliance matrix for the mixed waste disposal facilities, Trenches 31 ampersand 34, burial ground 218-W-5

    International Nuclear Information System (INIS)

    The purpose of the Trench 31 ampersand 34 Mixed Waste Disposal Facility Compliance Matrix is to provide objective evidence of implementation of all regulatory and procedural-institutional requirements for the disposal facilities. This matrix provides a listing of the individual regulatory and procedural-institutional requirements that were addressed. Subject matter experts reviewed pertinent documents that had direct or indirect impact on the facility. Those found to be applicable were so noted and listed in Appendix A. Subject matter experts then extracted individual requirements from the documents deemed applicable and listed them in the matrix tables. The results of this effort are documented in Appendix B

  6. 美国调香师对若干食用香料的评价(218

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    来源——芬美意(Firmenich);FEMA#2857,CAS#103—45—7;天然等同物;天然来源——苹果、啤酒、白肋烟草、可可、葡萄、李、草莓、茶叶、全麦面包、威士忌和红葡萄酒;香气特征——@1.0%:甜的,玫瑰花香,带有粉香的蜂蜜样香气,类似苹果、葡萄和桃子的果香韵,并带有可可和威士忌样香调;

  7. Shelf-Life of ɛ-Lysyl-3-(Trimethylstannyl)Benzamide Immunoconjugates, Precursors for 211At Labeling of Antibodies

    OpenAIRE

    Aneheim, Emma; Halleröd, Jenny; Albertsson, Per; Jensen, Holger; Holgersson, Stellan; Lindegren, Sture

    2015-01-01

    Astatine-211 is possibly the most promising radionuclide for targeted α-particle therapy when it comes to the treatment of occult disseminated cancer. Preclinical research has proven effective, and patient studies have been initiated based on these results. However, a lack of production capacity and the complex radiochemistry of 211At are major obstacles for research and prospective clinical applications. In the present study, astatination of immunoconjugates, already prepared well in advance...

  8. Use of fluorine-18 free of carrier for the synthesis of 2-[18 F]-fluoro-2-deoxy-d-glucose by nucleophilic substitution

    International Nuclear Information System (INIS)

    Preliminary studies on the synthesis of 2 - [18 F]-fluoro-2-deoxy-d-glucose (2 - [18 F]-FDG) were carried out by means of the nucleophilic method proposed by K. Hamacher and the 18 F obtained in the Nuclear Reactor TRIGA Mark III of the Nuclear Center of Mexico. For the control of radiochemical quality it was used the chromatography technique in paper and silica gel with 4 solvent systems. The identification of the marked species with 18 F was carried out by means of comparison of its Rf with the Rf of the obtained not radioactive species, using the same synthesis method. (Author)

  9. Oxidation of methionine 216 in sheep and elk prion protein is highly dependent upon the amino acid at position 218 but is not important for prion propagation

    Science.gov (United States)

    We developed a sensitive mass spectrometry-based method of quantitating the prions present in elk and sheep. Calibration curves relating the area ratios of the selected analyte peptides and their homologous stable isotope labeled internal standards were prepared. This method was compared to the ELIS...

  10. 30 CFR 218.306 - May I receive a credit against production royalties for in-kind deliveries of electricity I...

    Science.gov (United States)

    2010-07-01

    ... royalties for in-kind deliveries of electricity I provide under contract to a State or county government... electricity I provide under contract to a State or county government? (a) You may receive a credit against royalties for in-kind deliveries of electricity you provide under contract to a State or county...

  11. Preliminary Thermal Modeling of HI-Storm 100S-218 Version B Storage Modules at Hope Creek Cuclear Power Station ISFSI

    Energy Technology Data Exchange (ETDEWEB)

    Cuta, Judith M.; Adkins, Harold E.

    2013-08-30

    As part of the Used Fuel Disposition Campaign of the U. S. Department of Energy, Office of Nuclear Energy (DOE-NE) Fuel Cycle Research and Development, a consortium of national laboratories and industry is performing visual inspections and temperature measurements of selected storage modules at various locations around the United States. This report documents thermal analyses in in support of the inspections at the Hope Creek Nuclear Generating Station ISFSI. This site utilizes the HI-STORM100 vertical storage system developed by Holtec International. This is a vertical storage module design, and the thermal models are being developed using COBRA-SFS (Michener, et al., 1987), a code developed by PNNL for thermal-hydraulic analyses of multi assembly spent fuel storage and transportation systems. This report describes the COBRA-SFS model in detail, and presents pre-inspection predictions of component temperatures and temperature distributions. The final report will include evaluation of inspection results, and if required, additional post-test calculations, with appropriate discussion of results.

  12. Load unload system optimization on H218O irradiation target used for 18F- production at the cyclotron cyclone 30 from IPEN-CNEN/SP

    International Nuclear Information System (INIS)

    The demand growing in Brazil by the radiopharmaceutical [18F]FDG in positron emission tomography (PET-CT) and the 109,7 minutes half life claim special attention to the productive chain of this radiopharmaceutical. Since the [18O]water irradiation until the tomograph patient scanning, in sequential procedures that may spent about six hours, all the productive chain stages must be as reliable as possible, because any stage failed will be perceived in productive chain extremity. The position indication absence from Load and Unload 18F- Target System valve in Cyclotron Accelerators Center resulted in 18F- production loss, Irradiation Room contamination and the increase workers' dose responsible by operation and maintenance of irradiation systems. This study tested the behaviour of three types of position sensors (micro switch, reed switch and inductive sensor), into Irradiation Room 1.2 environment of the Cyclotron Accelerators Center, where there are high gamma radiation and neutrons rates because the routine 18F- and 1'23I production, through this test was possible to discover the fitter position sensor to run on 18F- Target, and after rewriting the programmable logic controller software was possible avoid this type of fail at 18F- production time in Cyclotron Accelerators Center, and to grow up the reliability on [18F]FDG productive chain. (author)

  13. Load and unload system optimization on H218 O irradiation target used for 18F- production at the cyclotron cyclone 30 from IPEN-CNEN/SP, Brazil

    International Nuclear Information System (INIS)

    The demand growing in Brazil by the radiopharmaceutical [18F] FDG in positron emission tomography (PET-CT) and the 109,7 minutes half life claim special attention to the productive chain of this radiopharmaceutical. Since the [18O]water irradiation until the tomograph patient scanning, in sequential procedures that may spent about six hours, all the productive chain stages must be as reliable as possible, because any stage failed will be perceived in productive chain extremity. The position indication absence from Load and Unload 18F- Target System valve in Cyclotron Accelerators Center resulted in 18F- production loss, Irradiation Room contamination and the increase workers dose responsible by operation and maintenance of irradiation systems. This study tested the behaviour of three types of position sensors (micro switch, reed switch and inductive sensor), into Irradiation Room 1.2 environment of the Cyclotron Accelerators Center, where there are high gamma radiation and neutrons rates because the routine 18F- and 123I production, through this test was possible to discover the fitter position sensor to run on 18F- Target, and after rewriting the programmable logic controller software was possible avoid this type of fail at 18F- production time in Cyclotron Accelerators Center, and to grow up the reliability on [18F]FDG productive chain. (author)

  14. Escherichia coli K1 RS218 Interacts with Human Brain Microvascular Endothelial Cells via Type 1 Fimbria Bacteria in the Fimbriated State

    Science.gov (United States)

    Teng, Ching-Hao; Cai, Mian; Shin, Sooan; Xie, Yi; Kim, Kee-Jun; Khan, Naveed Ahmed; Di Cello, Francescopaolo; Kim, Kwang Sik

    2005-01-01

    Escherichia coli K1 is a major gram-negative organism causing neonatal meningitis. E. coli K1 binding to and invasion of human brain microvascular endothelial cells (HBMEC) are a prerequisite for E. coli penetration into the central nervous system in vivo. In the present study, we showed using DNA microarray analysis that E. coli K1 associated with HBMEC expressed significantly higher levels of the fim genes compared to nonassociated bacteria. We also showed that E. coli K1 binding to and invasion of HBMEC were significantly decreased with its fimH deletion mutant and type 1 fimbria locked-off mutant, while they were significantly increased with its type 1 fimbria locked-on mutant. E. coli K1 strains associated with HBMEC were predominantly type 1 fimbria phase-on (i.e., fimbriated) bacteria. Taken together, we showed for the first time that type 1 fimbriae play an important role in E. coli K1 binding to and invasion of HBMEC and that type 1 fimbria phase-on E. coli is the major population interacting with HBMEC. PMID:15845498

  15. 12 CFR 218.740 - Defined terms relating to the sweep accounts exception from the definition of “broker.”

    Science.gov (United States)

    2010-01-01

    ... securities for sales or sales promotion expenses, for personal service, or for the maintenance of shareholder... investment company's securities for sales or sales promotion expenses, for personal service, or for the... has the same meaning as in 17 CFR 270.6c-10. (b) Money market fund means an open-end...

  16. The synthesis of 18F-labelled amino acid O-(2-[18F]fluoroethyl)-L-tyrosine (FET) in NPI

    Czech Academy of Sciences Publication Activity Database

    Švecová, Helena; Procházka, Libor; Fedorova, S.; Kropáček, Martin; Melichar, František

    2007-01-01

    Roč. 2, č. 331 (2007), s. 34-34. ISSN 1619-7070 R&D Projects: GA MPO 2A-1TP1/055 Institutional research plan: CEZ:AV0Z10480505 Keywords : [18F]FET * PET * tumor imaging Subject RIV: FR - Pharmacology ; Medidal Chemistry

  17. Methyl p-hydroxybenzoate (E-218) a preservative for drugs and food is an activator of the ryanodine receptor Ca2+ release channel

    OpenAIRE

    Cavagna, Dario; Zorzato, Francesco; Babini, Elena; Prestipino, Gianfranco; Treves, Susan

    2000-01-01

    Haloperidol is a drug used in the management of several psychotic disorders and its use has been linked to Neuroleptic Malignant Syndrome. In the present study we have investigated the effect of a commercial preparation of haloperidol, Serenase, on skeletal muscle sarcoplasmic reticulum.Addition of Serenase to isolated terminal cisternae caused a rapid release of calcium. We tested whether the active Ca2+-releasing substance was haloperidol or another compound present in the preparation.Our r...

  18. An Association Study of the A218C Polymorphism of the Tryptophan Hydroxylase 1 Gene with Eating Disorders in a Korean Population: A Pilot Study

    OpenAIRE

    Kim, Youl-Ri; Woo, Jong-Min; Heo, Si Young; Kim, Jeong Hyun; Lim, Soo-Jin; Yu, Bum-Hee

    2009-01-01

    Objective We examined the association between the tryptophan hydroxylase 1 (TPH1) gene and eating disorders focusing on obsessionality. Methods The sample included 62 women with a lifetime diagnosis of anorexia nervosa (AN) as well as 50 women with a lifetime diagnosis of bulimia nervosa (BN) recruited from specialist clinics for eating disorders and 131 healthy women in Korea. Blood samples were collected from all participants for the TPH1 genotyping. The patients were ad ministered the Kore...

  19. Monte Carlo Simulation of Vapor-Liquid Equilibria for Perfluoropropane (R-218) and 2,3,3,3-Tetrafluoropropene (R-1234yf)

    Science.gov (United States)

    Paulechka, E.; Kazakov, A.; Frenkel, M.

    2010-03-01

    Thermophysical properties of two refrigerants (perfluoropropane and 2,3,3,3-tetrafluoropropene) were computed using Monte Carlo methods with the OPLS-AA (Optimized Potentials for Liquid Simulations-All Atoms) forcefield. Original OPLS-AA parameters were extended to include an F atom attached to a double bond in 2,3,3,3-tetrafluoropropene and modified to produce the correct stationary geometry for this compound. The results of the simulations for critical parameters, saturated densities, saturated pressures, liquid densities, and vaporization enthalpies are in good agreement with available experimental data and equation of state models. Systematic deviations between the experimental data and the predicted values were observed for liquid densities and saturated pressures, suggesting that further refinement of forcefield parameters that can lead to better accuracy may be possible.

  20. Herschel/PACS spectroscopy of NGC 4418 and Arp 220: H2O, H2^{18}O, OH, ^{18}OH, O^0, HCN and NH3

    CERN Document Server

    González-Alfonso, E; Graciá-Carpio, J; Sturm, E; Hailey-Dunsheath, S; Lutz, D; Poglitsch, A; Contursi, A; Feuchtgruber, H; Veilleux, S; Spoon, H W W; Verma, A; Christopher, N; Davies, R; Sternberg, A; Genzel, R; Tacconi, L

    2011-01-01

    Herschel/PACS spectroscopy of the (ultra)luminous infrared galaxies NGC 4418 and Arp 220 reveals high excitation in H2O, OH, HCN, and NH3. In NGC 4418, absorption lines were detected with E_lower>800 K (H2O), 600 K (OH), 1075 K (HCN), and 600 K (NH3), while in Arp 220 the excitation is somewhat lower. While clear outflow signatures are seen in Arp 220 as has been seen in previous studies, in NGC 4418 the lines tracing its outer regions are redshifted relative to the nucleus, suggesting an inflow with Mdot~100 K) nuclear continuum components, together with a more extended and colder component that is much more prominent and massive in Arp 220. A chemical dichotomy is found in both sources: on the one hand, the nuclear regions have high H2O abundances, ~0.5x10^{-5}, and high HCN/H2O and HCN/NH3 column density ratios of 0.2-0.7 and 6-9, respectively, indicating a chemistry typical of evolved hot cores where grain mantle evaporation has occurred. On the other hand, the high OH abundance, with OH/H2O ratios of ~0....

  1. miR-218 inhibits the migration and invasion of glioma U87 cells through the Slit2-Robo1 pathway

    OpenAIRE

    Gu, Jian-jun; GAO, GUANG-ZHONG; Zhang, Shi-ming

    2015-01-01

    Malignant gliomas are the most common primary brain tumors in adults and are associated with the highest mortality rate. Glioma invasion is one of the most notable causes of the poor prognosis of this cancer. Preventing the invasive behavior of malignant glioma cells by altering effector molecules can significantly improve the prognosis of a patient. microRNAs (miRNAs) are small noncoding RNAs, ~22 nucleotides in length, that are able to function as oncogenes or tumor suppressors in human can...

  2. Shelf-life of ɛ-lysyl-3-(trimethylstannyl)benzamide immunoconjugates, precursors for 211At labeling of antibodies

    DEFF Research Database (Denmark)

    Aneheim, Emma; Halleröd, Jenny; Albertsson, Per;

    2015-01-01

    Astatine-211 is possibly the most promising radionuclide for targeted α-particle therapy when it comes to the treatment of occult disseminated cancer. Preclinical research has proven effective, and patient studies have been initiated based on these results. However, a lack of production capacity ...

  3. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  4. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    International Nuclear Information System (INIS)

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons

  5. Separation of 211At from irradiated bismuth target and labelling of a model protein

    International Nuclear Information System (INIS)

    Astatine-211 is a promising radionuclide for therapeutic use in nuclear medicine. An efficient method (70%) for radiochemical separation from the irradiated Bi-target has been described. The level of Bi contamination in the purified 2'11At-solution was estimated. Finally labelling of a model protein has been tried. (author). 14 refs

  6. Comparison of the doubly labeled water (2H2(18)O) method with indirect calorimetry and a nutrient-balance study for simultaneous determination of energy expenditure, water intake, and metabolizable energy intake in preterm infants

    International Nuclear Information System (INIS)

    The doubly labeled water method was compared with indirect calorimetry and a nutrient-balance study for simultaneous determination of rates of CO2 production, energy expenditure, and water intake over 5 days in four preterm infants. Additionally, metabolizable energy (ME) intake estimated using the isotope procedure (as energy expenditure plus an estimate for energy deposition based on weight gain), was compared to ME intake measured in the balance study. Compared to values obtained by traditional methods, calculated CO2 production, energy expenditure, and water intake differed by -1.4 +/- 4.8% (SD), +0.3 +/- 2.6%, and +5.7 +/- 1.4%, respectively; the difference in water intake was significant (p less than 0.05). Calculated ME intakes were 5.3 +/- 19.3% less than measured intakes, but the difference was not significant. These findings indicate that the doubly labeled water method can provide accurate information on rates of CO2 production, energy expenditure, and water intake in preterm infants, but individual estimates of ME intake may be subject to substantial error

  7. Multibeam collection for KN218: Multibeam data collected aboard Knorr from 2014-05-01 to 2014-05-12, departing from Woods Hole, MA and returning to Woods Hole, MA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  8. SiSPAT-Isotope, a coupled heat, water and stable isotope (HDO and H 218O) transport model for bare soil. Part II. Evaluation and sensitivity tests using two laboratory data sets

    Science.gov (United States)

    Braud, I.; Bariac, T.; Vauclin, M.; Boujamlaoui, Z.; Gaudet, J. P.; Biron, Ph.; Richard, P.

    2005-07-01

    Stable water isotopes are tracers of water movement within the soil-vegetation-atmosphere system. They have the potential for a better understanding of water vapour transport within soils, evaporation and transpiration processes. To better understand those potentialities and possible lack of knowledge, a coupled heat-water and stable isotope transport model, called SiSPAT-Isotope was developed for bare soil. We presented the theoretical basis of the model in the first part of the paper, including a first validation of the likelihood of model results and a comparison with existing analytical solutions. In this companion paper, we go a step further by comparing the model results with two data sets collected on laboratory columns. In both cases, five soil columns were saturated and let drying during 173 and 253 days, respectively. At selected dates, one of the column was cut into slices and analysed to determine the volumetric water content, the deuterium and oxygen 18 concentrations profiles. The first data set was acquired on disturbed soil columns. The second one was collected on non-disturbed soil columns and it included a complete monitoring of atmospheric variables. It was not the case for the first one and a sensitivity analysis of model results to the air humidity was performed, showing its large influence on surface isotope concentrations. For both data sets, we also conducted a sensitivity analysis to the formulation of the kinetic fractionation factor, conditioning the resistance to isotope transport between the soil surface and the atmosphere, and to the value of soil tortuosity. The results showed that the model was able to reproduce the behaviour of the observed concentration profiles. A fair agreement between measured and calculated values was obtained for all profiles for the disturbed soil. Near surface concentrations were in general overestimated for the undisturbed soil, raising the question of possible influence of immobile water on concentrations values. We showed that soil tortuosity was mostly influential on the depth of the peak isotope concentration, which opens perspectives for its retrieval from the measurement of isotope concentration profiles. When only molecular diffusion was considered, the model was not able to reproduce the liquid slopes of the deuterium/oxygen 18 relationships at the beginning of the drying process. Results were more in agreement with the data when molecular diffusion combined with turbulent transfer were considered. Further laboratory and field experiments are, however, still required to derive a formulation of the kinetic fractionation factor adapted to drying soils and non-saturated conditions.

  9. Niskin Bottle Data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 Miles North of Oahu, Hawaii for Cruises HOT218-227 during 2010 (NODC Accession 0087596)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  10. Molecular clouds and star formation toward the Galactic plane within 216.25$^{\\rm o}\\le$ l $\\le$218.75$^{\\rm o}$ and $-$0.75$^{\\rm o} \\le$ b $\\le$1.25$^{\\rm o}$

    CERN Document Server

    Gong, Y; Fang, M; Zhang, S B; Su, Y; Yang, J; Jiang, Z B; Xu, Y; Wang, M; Wang, Y; Lu, D R; Sun, J X

    2016-01-01

    As a part of the Milky Way Imaging Scroll Painting (MWISP) survey, we performed a simultaneous 12CO(1-0), 13CO(1-0), C18O(1-0) mapping toward molecular clouds in a region encompassing 3.75 square degrees. We reveal three molecular clouds, the 15 km/s cloud, the 27 km/s cloud, and the 50 km/s cloud, in the surveyed region. The 50 km/s cloud is resolved with an angular resolution of around 1' for the first time. Investigating their morphology and velocity structures, we find that the 27 km/s cloud is likely affected by feedback from the stellar association Mon OB3 and the 50 km/s cloud is characterised by three large expanding molecular shells. The region is mapped in C18O (1-0) for the first time. We discover seven C18O clumps, which are likely to form massive stars, and 15 dust clumps based on the BGPS archival data. Using infrared color-color diagrams, we find 56 Class I and 107 Class II young stellar object (YSO) candidates. According to the distribution of YSO candidates, an overdensity is found around the...

  11. Subtask 2.18 - Advancing CO2 Capture Technology: Partnership for CO2 Capture (PCO2C) Phase III

    Energy Technology Data Exchange (ETDEWEB)

    Kay, John; Azenkeng, Alexander; Fiala, Nathan; Jensen, Melanie; Laumb, Jason; Leroux, Kerryanne; McCollor, Donald; Stanislowski, Joshua; Tolbert, Scott; Curran, Tyler

    2016-03-31

    Industries and utilities continue to investigate ways to decrease their carbon footprint. Carbon capture and storage (CCS) can enable existing power generation facilities to meet the current national CO2 reduction goals. The Partnership for CO2 Capture Phase III focused on several important research areas in an effort to find ways to decrease the cost of capture across both precombustion and postcombustion platforms. Two flue gas pretreatment technologies for postcombustion capture, an SO2 reduction scrubbing technology from Cansolv Technologies Inc. and the Tri-Mer filtration technology that combines particulate, NOx, and SO2 control, were evaluated on the Energy & Environmental Research Center’s (EERC’s) pilot-scale test system. Pretreating the flue gas should enable more efficient, and therefore less expensive, CO2 capture. Both technologies were found to be effective in pretreating flue gas prior to CO2 capture. Two new postcombustion capture solvents were tested, one from the Korea Carbon Capture and Sequestration R&D Center (KCRC) and one from CO2 Solutions Incorporated. Both of these solvents showed the ability to capture CO2 while requiring less regeneration energy, which would reduce the cost of capture. Hydrogen separation membranes from Commonwealth Scientific and Industrial Research Organisation were evaluated through precombustion testing. They are composed of vanadium alloy, which is less expensive than the palladium alloys that are typically used. Their performance was comparable to that of other membranes that have been tested at the EERC. Aspen Plus® software was used to model the KCRC and CO2 Solutions solvents and found that they would result in significantly improved overall plant performance. The modeling effort also showed that the parasitic steam load at partial capture of 45% is less than half that of 90% overall capture, indicating savings that could be accrued if 90% capture is not required. Modeling of three regional power plants using the Carnegie Mellon Integrated Environmental Control Model showed that, among other things, the use of a bypass during partial capture may minimize the size of the capture tower(s) and result in a slight reduction in the revenue required to operate the capture facility. The results reinforced that a one-size-fits-all approach cannot be taken to adding capture to a power plant. Laboratory testing indicated that Fourier transform infrared spectroscopy could be used to continuously sample stack emissions at CO2 capture facilities to detect and quantify any residual amine or its degradation products, particularly nitrosamines. The information gathered during Phase III is important for utility stakeholders as they determine how to reduce their CO2 emissions in a carbon-constrained world. This subtask was funded through the EERC–U.S. Department of Energy (DOE) Joint Program on Research and Development for Fossil Energy-Related Resources Cooperative Agreement No. DE-FC26-08NT43291. Nonfederal funding was provided by the North Dakota Industrial Commission, PPL Montana, Nebraska Public Power District, Tri-Mer Corporation, Montana–Dakota Utilities Co., Basin Electric Power Cooperative, KCRC/Korean Institute of Energy Research, Cansolv Technologies, and CO2 Solutions, Inc.

  12. CTD Data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 Miles North of Oahu, Hawaii for Cruises HOT218-227 during 2010) (NCEI Accession 0087584)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  13. Influence of 2-(18F) fluoro-2-deoxy-D-glucose positron emission tomography/computed tomography on recurrent ovarian cancer diagnosis and on selection of patients for secondary cytoreductive surgery

    DEFF Research Database (Denmark)

    Risum, Signe; Høgdall, Claus; Markova, Elena;

    2009-01-01

    The objective of this prospective study was to compare the sensitivities and the specificities of combined 2-(F) fluoro-2-deoxy-D-glucose positron emission tomography/computed tomography (PET/CT), abdominal/transvaginal ultrasound (US), and CT for diagnosing recurrent ovarian cancer (OC) and to...... 27 (69%) of 39 patients with solitary tumors on US and in 8 (42%) of 19 patients with solitary tumors on CT. We conclude that the diagnostic value of PET/CT for detecting recurrent OC was higher than those of US and CT and that PET/CT more accurately identified patients with solitary recurrence...

  14. Biodistribution of phenylboric acid derivative entrapped lipiodol and 4-borono-2-18F-fluoro-L-phenylalanine-fructose in GP7TB liver tumor bearing rats for BNCT

    International Nuclear Information System (INIS)

    A new phenylboric acid derivative entrapped lipiodol (PBAD-lipiodol) was developed as a boron carrier for the boron neutron capture therapy (BNCT) of hepatoma in Taiwan. The biodistribution of both PBAD-lipiodol and BPA-fructose was assayed in GP7TB hepatoma-bearing rat model. The highest uptake of PBAD-lipiodol was found at 2 h post injection. The application of BNCT for the hepatoma treatment in tumor-bearing rats is suggested to be 2-4 h post PBAD-lipiodol injection.

  15. Information Literacy Programs and Research: Reflections on "Information Literacy Programs and Research: An International Review" by Christine Bruce. 2000. "The Australian Library Journal" 49 no. 3: 209-218.

    Science.gov (United States)

    Bruce, Christine

    2011-01-01

    Although in the late 1990s there was much discussion as to whether the idea of information literacy was necessary or had longevity, global interest in the phenomenon has increased rather than diminished. Information literacy standards have been developed and become widely accepted in educational systems. Research centres for information literacy…

  16. Lipidomics and H218O labeling techniques reveal increased remodeling of DHA-containing membrane phospholipids associated with abnormal locomotor responses in α-tocopherol deficient zebrafish (danio rerio) embryos

    OpenAIRE

    McDougall, Melissa Q.; Jaewoo Choi; Stevens, Jan F.; Lisa Truong; Tanguay, Robert L.; Traber, Maret G.

    2016-01-01

    We hypothesized that vitamin E (α-tocopherol) is required by the developing embryonic brain to prevent depletion of highly polyunsaturated fatty acids, especially docosahexaenoic acid (DHA, 22:6), the loss of which we predicted would underlie abnormal morphological and behavioral outcomes. Therefore, we fed adult 5D zebrafish (Danio rerio) defined diets without (E−) or with added α-tocopherol (E+, 500 mg RRR-α-tocopheryl acetate/kg diet) for a minimum of 80 days, and then spawned them to obta...

  17. Multiple bone metastases detected on 2-[18F]-fluoro-2-deoxy-d-glucose positron emission tomography in a breast cancer patient: Case report and literature review

    Directory of Open Access Journals (Sweden)

    Zeki Dostbil

    2012-09-01

    Full Text Available Bone scintigraphy has been widely used to assess skeletal metastasis in patients with breast cancer. 18F-FDGPET/CT is another imaging modality that has gained previously wide use to determine metastasis based on increased glucose metabolism in malignant cells. Generally, these two modalities give similar results in evaluation of bone metastasis of breast cancer. In this breast cancer case, 99mTc-MDP bone scintigraphy showed normal findings in regards to skeletal metastasis while 18FFDG-PET/CT, contrast-enhanced CT and MRI revealed multiple metastatic focuses. J Clin Exp Invest 2012; 3 (3: 426-429Key words: 18F-fluorodeoxyglucose, bone metastasis, bone scintigraphy, positron emission tomography

  18. Low Temperature Densities from (218 to 364) K and up to 50 MPa in Pressure and Surface Tension for Trihexyl(tetradecyl)phosphonium Bis(trifluoromethylsulfonyl)imide and Dicyanamide and 1-Hexyl-3-methylimidazolium Hexafluorophosphate

    Czech Academy of Sciences Publication Activity Database

    Klomfar, Jaroslav; Součková, Monika; Pátek, Jaroslav

    2014-01-01

    Roč. 59, July (2014), s. 2263-2274. ISSN 0021-9568 R&D Projects: GA ČR GA13-00145S; GA ČR GA101/09/0010 Institutional support: RVO:61388998 Keywords : trihexyl(tetradecyl)phosphonium cation * 1-hexyl-3-methylimidazolium hexafluorophosphate * bis(trifluoromethylsulfonyl)imide anion * dicyanamide anion * experimental pvT data * surface tension * internal pressure Subject RIV: BJ - Thermodynamics Impact factor: 2.037, year: 2014

  19. Cooked oatmeal consumption is associated with better diet quality, better nutrient intakes, and reduced risk for central adiposity and obesity in children 2-18 years: NHANES 2001-2010

    OpenAIRE

    O'Neil, Carol E.; Victor L. Fulgoni III; Nicklas, Theresa A.; DiRienzo, Maureen A.

    2015-01-01

    Background: None of the studies of whole grains that have looked either at diet or weight/adiposity measures have focused exclusively on oatmeal.Objective: The objective of this study was to assess the association between oatmeal consumption and nutrient intake, diet quality, and weight/adiposity of children aged 2–18.Design: A nationally representative sample of children aged 2–18 (N=14,690) participating in National Health and Nutrition Examination Survey 2001–2010 was used. Intake was dete...

  20. Differentiation of tumour and inflammation: characterisation of [methyl-3H]methionine (MET) and O-(2-[18F]fluoroethyl)-L-tyrosine (FET) uptake in human tumour and inflammatory cells

    International Nuclear Information System (INIS)

    Previous studies suggest that radiolabelled amino acids could be superior to FDG in differentiating tumour and inflammation. Therefore the aim of this study was to investigate the uptake of FET and MET in human tumour and inflammatory cells and to investigate their uptake kinetics. For uptake studies, cells were incubated with 370 kBq FET or 3.7 kBq MET for 15 min. Kinetic studies were performed at variable concentrations of FET and MET. Competitive inhibition studies were done with BCH, MeAIB and L-serine. All inflammatory cells incorporated more MET than the tumour cells. The uptake of FET, in contrast, was significantly lower in all inflammatory cells than in the tumour cells. In tumour cells the uptake of MET was about five times the uptake of FET. The competitive inhibitors reduced uptake of both tracers to 20-40% in tumour cells and to 70% in inflammatory cells. Kinetic studies showed that MET and FET transport was saturable in all cells except macrophages and followed a Michaelis-Menten kinetic. Highest capacity (Vmax) and affinity (Km) for the uptake of MET was observed in granulocytes. Capacity and affinity for FET uptake were highest in the DHL-4 cells. In contrast to MET, FET accumulated to a significantly greater extent in tumour cells than in inflammatory cells. The marked differences between tumour and inflammatory cells concerning FET and MET uptake suggest that FET and MET are substrates of different subtypes of the L system. (orig.)

  1. 77 FR 26356 - Petition for Waiver of Compliance

    Science.gov (United States)

    2012-05-03

    ... requested, exempting onboard I-ETMS equipment from the requirements of Sections 218.51, 218.53, 218.55, 218..., turning on, and turning off the onboard equipment. NS also needs the flexibility to permanently disable or... onboard, non-I-ETMS-equipped locomotives operating in I-ETMS territory shall not be construed as an...

  2. Hurdles for a Broader Use of 211At and for the Synthesis of 211At-Labelled Radiopharmaceuticals at High Activities for Clinical Use

    International Nuclear Information System (INIS)

    One of the key impediments to the use of 211At is the very well known deleterious effect of high radiation fields caused by its alpha particles on the synthesis of 211At-labelled radiopharmaceuticals. This is problematic because radiolysis-mediated effects can produce diminishing efficiency of electrophilic astatination reactions due to increasing deposition of radiation dose with increasing activities and with the passage of the time. Astatine-211 has chemical properties that permit complex labelling strategies and a longer half-life than 213Bi that makes it more suitable when the targeting molecule does not gain immediate access to the tumour cells. The first clinical evaluation was published in 2001 [2] in patients with brain tumour. Although this study circumvents many of the challenges to entering clinical studies with 211At and many obstacles had to be surmounted before clinical studies could be initiated, several problems were encountered in maintaining efficient labelling with escalating radiation dose of α-particle even with fresh 211At elution [3]. Astatine-211 also has an additional hurdle to overcome before to its clinical application in labelled radiopharmaceuticals related with its production and distribution. Among the potential group of promising α- emitter it is the only one produced by cyclotrons, but due to the scarcity of cyclotrons equipped with 25−30 MeV α-particle beams, it will of necessity be utilized in distant locations from the site of production. It presents a major chemical challenge because the diminishing efficiency of electrophilic astatination reactions with the passage of the time is well known, a problem likely related to the radiolysis produced by the high LET (linear energy transfer) meaning that large amounts of energy are deposited in a highly localized manner. This problem has been most comprehensively investigated to understand and evaluate the role of the radiolysis effects of astatine alpha particles in the synthesis

  3. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  4. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita

    2011-01-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  5. Radiopharmaceutical Chemistry of Targeted Radiopharmaceutics. Synthesis of 211At-Labeled Radiopharmaceuticals at High Activities for Clinical Use

    International Nuclear Information System (INIS)

    Targeted α-particle radiotherapy is an appealing approach to cancer treatment because of the potential for delivering curative doses of radiation to tumor with minimal damage to normal tissue due to a range equivalent to only a few cell diameters. Compared with β-emitters they have significant advantages from a radiobiological perspective. The LET of 211At α-particles is more than 400 times higher than the β-particles emitted by 90Y, in addition the distance between ionizing events is almost the same as that between the two strands of DNA, yielding a high probability of creating non-repairable DNA damage. It gives the ability to kill cancer cells not compromised by hypoxia, dose rate effects or cell cycle position, enhancing their attractiveness for targeted radiotherapy. However, translation of the concept to the clinic has been slow, many obstacles had to be surmounted before clinical studies could be initiated, the first clinical evaluation of a 211At- labeled mAb was made in 2001. This study circumvents many of the challenges to entering clinical studies with 211At. But several problems were encountered in maintaining efficient labeling with escalating radiation dose of alpha-particle likely related to radiolysis. The impact of the radiolysis produced by the α-particle over the labeling chemistry is much higher in comparison with typical β-emitters due to a deposition of energy in the solvent in a highly localized manner two orders of magnitude per unit volume higher than 90Y or 131I. Due to these difficulties a comprehensive basic science study about the radiolytic effects of astatine alpha-particles over the synthesis of 211At-labeled radiopharmaceuticals was carried out. Its main goal was overcoming the problem of the synthesis of 211At-labeled radiopharmaceuticals at the high activities necessaries for therapy and also to extend the shelf life of astatine elutions. Briefly this study held several steps, the first one was to study the role of solvent

  6. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    International Nuclear Information System (INIS)

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on 211At and 124I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[211At]astato-2'-deoxyuridine (AUdR) and N-succinimidyl-4-[211At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [124I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[124I]iodo-2'-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for radioiodination of macromolecules

  7. 211At production and recovery: first results of a new start

    International Nuclear Information System (INIS)

    Full text: 211At is the only alpha-emitting isotope which can be introduced into organic molecular structures by covalent chemical binding and possesses superior decay characteristics for therapeutic applications when compared with other alpha emitters. However, its production requires a minimum of 27,5 MeV alpha-particles, which are relatively rarely available. In view of the revival of alpha-therapy approaches a production of 211At has been set up at the MHH cyclotron (MC-35). The first aim of this project was to establish a target- and work-up-system for the reliable production of several ten MBq-quantities of 211At for animal- and cell-research. An aluminum-target-system holds a 1.3 cm diameter Bi-disc of 0.25 mm thickness. The disk is pressed onto a the aluminum backing with 2 tons/cm2. The front is covered with a 125 μm Al foil, cooled by a He jet which is separated from the vacuum by a 250 μm Ti foil. Starting with 27.5 MeV alpha-particles the resulting target-energy is 25 MeV. This relatively low energy is chosen to avoid any contamination with 210At and 210Po in the first experimental period. A beam current of 10 μA for 15 min (9 mCoulomb) yields 16.4 MBq 211At theoretically. Astatine is recovered from the target by a dry distillation technique, using various gases as a transport support-medium. The small all-quartz distillation-apparatus is heated up to 900 oC. Astatine is recovered in a small cool able vessel containing various trapping media. Distillation and trapping can be monitored with small radioactivity monitors. The whole system fits in a cubical 0.5 m glove box. Continuous monitoring of the distillation process allowed to optimize the heating rate, the transport support-medium and its flow-rate. Various trapping solutions were tested for their efficiency. Different beam dispersion in the target seems to influence the release and distillation of astatine from the molten bismuth-target. Two different release patterns were observed. The first

  8. 12 CFR 250.221 - Issuance and sale of short-term debt obligations by bank holding companies.

    Science.gov (United States)

    2010-01-01

    ... Bulletin 485, 12 CFR 218.104, 12 CFR 218.105 and 12 CFR 218.101.) (e) In reaching this conclusion, the... (17 CFR 231.4412). The reasons for such exemption, taken together with the abuses that gave rise to... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Issuance and sale of short-term...

  9. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC218 (Link to dictyBase) - - - Contig-U12091-1 VFC218P (Link... to Original site) VFC218F 487 VFC218Z 391 VFC218P 878 - - Show VFC218 Library VF (Link to library) Clone ID VFC218 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12091-1 Original site URL http://dict... J03515 |J03515.1 Slime mold (D.discoideum) severin mRNA, complete cds. 856 0.0 3 U66525 |U66525.1 Dictyoste...mic 24.0 %: mitochondrial 20.0 %: nuclear 4.0 %: peroxisomal >> prediction for VF

  10. Inclusive measurement of (p,πsup(-)xn) double charge exchange reactions on bismuth from threshold to 800 MeV

    International Nuclear Information System (INIS)

    The energy dependence of the total angle-integrated cross section for the production of astatine isotopes from (p,πsup(-)xn) double charge exchange reactions on bismuth (sup(209)Bi) was measured from 120 to 800 MeV using activation and radiochemical techniques. Chemical yields were estimated by direct radioassaying of sup(211)At activity in thin (approximately 1 mg/cmsup(2)), irradiated bismuth targets. Calculations of the contributions of secondary (2-step) reactions to these measured astatine yields were performed, based partially upon the observed sup(211)At activity although even at the highest energies, the contribution to products lighter than sup(207)At was negligible. These data for products with as many as 7 neutrons removed from the doubly coherent product (sup(210)At) display nearby gaussian shapes for the mass distributions of the astatine residues with the maximum occurring for about sup(204)At. The most probable momentum transfer deduced from these distributions for the initial πsup(-) production step was 335 MeV/c. The observed excitation functions display a behaviour similar to that observed for the yield of sup(210)Po from a (p,πsup(O)) reaction on sup(209)Bi, but radically different from that observed for inclusive πsup(-) reactions on a heavy nucleus. These data are discussed in terms of recent theoretical approaches to negative pion production from bismuth. In addition, a simple, schematic model is developed to treat the rapidly decreasing percentage of the total inclusive πsup(-) emission which is observed for this double charge exchange reaction. This model reflects the capacity of a nucleus to a source of internal energetic protons

  11. Experimental performance of ozone-safe alternative refrigerants: Experimental performance comparisons of R32, R125, R143a, R218, R134a, R152a, R124, R142b, RC318 and R143 in a refrigeration circuit

    Science.gov (United States)

    Sand, James R.; Vineyard, Edward A.; Nowak, Richard J.

    1990-02-01

    Several compounds proposed as near term or longer range substitutes for the regulated chlorofluorocarbon (CFC) refrigerants were tested in a breadboard vapor-compression circuit, and their performance was evaluated relative to more commonly used refrigerants. The limited physical property information available in the literature for these alternative compounds was used to fit an equation of state so coefficients of performance (COPs) and capacities calculated from refrigerant property subroutines could be compared to those obtained experimentally. Comparisons of measured and modeled performance are given for 11 alternatives and for R22, R12, and R114. Estimates of compressor efficiency with each refrigerant are provided. Several of the alternatives exhibited better performance than the more widely used refrigerants at some or all of the conditions tested. Ozone-safe, alternative refrigerants that performed better than CFC counterparts at selected conditions are R152a, R143a, R134a, R134, and R142b.

  12. Reseña de Tratados de paz en las pampas: los ranqueles y su devenir político, 1850-1880, de Graciana Pérez Zavala. Ciudad Autónoma de Buenos Aires: Aspha, 2014. 218 p. ISBN 978-987-45321-6-9

    OpenAIRE

    Calderón Archina, Aldana

    2015-01-01

    ¿Por qué los ranqueles se fueron desmembrando como grupo político territorial y quedaron sometidos a las autoridades argentinas? ¿De qué manera? ¿Por qué en la década de 1870 el Estado argentino logró direccionar los movimientos políticos de los ranqueles? ¿Por qué la “paz” incidió en el desmembramiento de la nación ranquel? Tratado de Paz en las Pampas invita a sumergirse en los avatares políticos, sociales y económicos que envolvieron a los ranqueles durante la segunda mitad del siglo XIX....

  13. A tomografia por emissão de pósitrons com 2-[18F]-fluoro-2-desoxi-D-glicose é custo-efetiva em pacientes com câncer de pulmão não pequenas células no Brasil

    Directory of Open Access Journals (Sweden)

    Juliano Julio Cerci

    2012-08-01

    Full Text Available OBJETIVO: Comparar a acurácia e a custo-efetividade do estadiamento metabólico (EM com o FDG-PET em relação ao estadiamento convencional (EC no estadiamento inicial de pacientes com câncer de pulmão não pequenas células (CPNPC. MATERIAIS E MÉTODOS: Noventa e cinco pacientes com diagnóstico inicial de CPNPC foram estadiados antes do início do tratamento. Os resultados do EC e EM foram comparados quanto a definição do tratamento e incidência de toracotomia fútil em cada estratégia. RESULTADOS: O EM com FDG-PET classificou 48,4% dos pacientes como estádio mais avançado e 5,3% como menos avançado. O resultado do EM modificaria o tratamento em 41% dos pacientes. A toracotomia foi considerada fútil em 47% dos pacientes com EC e em 19% dos casos com EM. O custo das toracotomias fúteis em oito pacientes no EM foi de R$ 79.720, enquanto em 31 pacientes no EC seria de R$ 308.915. Apenas esta economia seria mais que suficiente para cobrir os custos de todos os exames de FDG-PET nos 95 pacientes (R$ 126.350 ou de FDG-PET/CT (R$ 193.515. CONCLUSÃO: O EM com FDG-PET tem maior acurácia que o EC em pacientes com CPNPC. A FDG-PET e FDG-PET/CT são custo-efetivas e sua utilização se justifica economicamente na saúde pública no Brasil.

  14. 13b,13c-Di-2-pyridyl-5,7,12,13b,13c,14-hexahydro-6H,13H-5a,6a,12a,13a-tetraazabenz[5,6]azuleno[2,1,8-ija]benz[f]azulene-6,13-dione methanol hemisolvate

    Directory of Open Access Journals (Sweden)

    Lin Li

    2008-01-01

    Full Text Available The title compound, C30H24N6O2·0.5CH3OH, a glycoluril derivative with two pyridine substituents on the convex face of the glycoluril system, is an important intermediate for the synthesis of more complex glycoluril derivatives. The compound crystallizes with two independent molecules in the asymmetric unit, one of which exhibits disorder of one benzene ring over two orientations with refined site occupancy factors 0.65 (4:0.35 (4. The crystal structure contains several short C—H...O contacts, and the methanol molecule forms an O—H...O hydrogen bond to one of the glycoluril molecules.

  15. Valor pronóstico del análisis semicuantitativo del grado de fijación de la 2.[.[18f]fluoro-2-deoxi-d-glucosa mediante tomografía por emisión de positrones en pacientes pediátricos con linfoma

    OpenAIRE

    Borrego Dorado, Isabel

    2016-01-01

    El linfoma es una neoplasia relativamente frecuente en niños y adolescentes jóvenes constituyendo del 10% al 15% de todas las neoplasias que aparecen durante la edad pediátrica1, 2. Su pronóstico ha mejorado gracias al desarrollo de nuevos tratamientos en las 2 últimas décadas3, presentando un amplio rango de supervivencia global a los 5 años, que varía desde el 75% en los linfoma no hodgkin (LNH) hasta el 90% en la en¬fermedad de Hodgkin (EH)4-6. Por otra parte, la duración e intensidad del ...

  16. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    OpenAIRE

    BAYRAM, Ali

    1998-01-01

    In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 1...

  17. Human radiation studies: Remembering the early years: Oral history of Dr. Patricia Wallace Durbin, Ph.D., conducted November 11, 1994

    International Nuclear Information System (INIS)

    This report is a transcript of an interview of Dr. Patricia Wallace Durbin by representatives of the US DOE Office of Human Radiation Research. Dr. Durbin was selected for this interview because of her knowledge of the human plutonium injections and her recollections of key figures, especially Joseph Hamilton. After a brief biographical sketch Dr. Durbin discusses her loss of research funding from DOE, her recollections concerning research into strontium metabolism as part of Project Sunshine, her recollections relating to the rationale for studies of human metabolism of radionuclides, her remembrances of Dr. Hamilton's Astatine and Plutonium research, and her experiences in gathering archival records concerning these researches

  18. Radiosynthesis of [18F]fluorophenyl-L-amino acids by isotopic exchange on carbonyl-activated precursors

    OpenAIRE

    Castillo Meleán, J.

    2011-01-01

    ABSTRACT Aromatic [18F]fluoroamino acids have earlier been developed as promising probes for diagnostics using PET. However, a wider use of these radiofluorinated compounds has been limited due to radiosynthetic constraints. The work here presents an amenable three-step radiosynthesis pathway for the preparation of 2-[18F]fluoro-L-phenylalanine (2-[18F]Fphe), 2-[18F]fluoro-L-tyrosine (2-[18F]Ftyr), 6-[18F]fuoro-L-m-tyrosine (6-[18F]Fmtyr) and 6-[18F]fluoro-L-DOPA (6-[18F]FDOPA). For this, ...

  19. Dicty_cDB: Contig-U12668-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s / Plus Query: 13 aaaaagggacttgngagtntgntgatttngatccnaaaccnnnnnnnngnaaaantgntg 72 |||||||||||||||||||||||||...|||||||||||||||| || |||||||||||| Sbjct: 13 aaaaagggacttgngagtntgntgatttngatccnaaaccnttnntttgnaaaantgntg 72 Q...aaaggntntgnntnctggaaancnagncaaggngnttcaa 192 Query: 193 nggccccntnaaangccnatcccctt 218 |||||||||||||||||||||...||||| Sbjct: 193 nggccccntnaaangccnatcccctt 218 >Contig-U11508-1 (Contig-U11508-1Q) /CSM_Contig/Contig-U1150...us Query: 13 aaaaagggacttgngagtntgntgatttngatccnaaaccnnnnnnnngnaaaantgntg 72 ||||

  20. EST Table: BP182855 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP182855 NRPG1123 10/09/28 100 %/218 aa gb|ADB25316.1| guanine nucleotide-binding protein G(o) s ... 8 88 %/218 aa C26C6.2#CE05311#WBGene00001648#locus:goa -1#guanine nucleotide-binding protein#status:Confir ...

  1. 76 FR 72502 - Removal From the List of Specially Designated Nationals and Blocked Persons of Certain Entities...

    Science.gov (United States)

    2011-11-23

    ..., Cantonments, Kumasi, Ghana; Plot F32 and 33, 5th Circular Road, East Cantonments, P.O. Box AN7281, Accra..., Finance and Trade Centre, 5th Floor, Block C, Shahrah-E-Faisal, Karachi 74400, Pakistan; Telephone No...) 214443061; Fax No. (218) 213337922; Fax No. (218) 213330068 38. SAVINGS AND REAL ESTATE INVESTMENT BANK...

  2. 77 FR 35921 - Defense Federal Acquisition Regulation Supplement: Item Unique Identifier Update (DFARS Case 2011...

    Science.gov (United States)

    2012-06-15

    ... valuation is a system of marking, valuing, and tracking items delivered to DoD that enhances logistics... ACQUISITIONS 10. Section 218.201(2) is revised to read as follows: 218.201 Contingency operation. * * * * * (2... identification if the items, as determined by the head of the agency, are to be used to support a...

  3. Tourism and the coastal zone

    Digital Repository Service at National Institute of Oceanography (India)

    Mascarenhas, A.

    stream_size 1 stream_content_type text/plain stream_name Fish_Curry_Rice_2002_218.pdf.txt stream_source_info Fish_Curry_Rice_2002_218.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  4. Gclust Server: 201683 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 201683 OSA_@218 Cluster Sequences - 164 no annotation 1 1.00e-80 14.29 0.0 0.0 0.0 0.0 0.0 Show 2016...83 Cluster ID 201683 Sequence ID OSA_@218 Link to cluster sequences Cluster Sequences Link

  5. Actiniarian Sea anemone fauna of India

    Digital Repository Service at National Institute of Oceanography (India)

    Parulekar, A.H.

    stream_size 11 stream_content_type text/plain stream_name Mar_Biofouling_Power_Plants_1990_218.pdf.txt stream_source_info Mar_Biofouling_Power_Plants_1990_218.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset...

  6. 77 FR 19109 - Bacillus Pumilus Strain GHA 180; Exemption From the Requirement of a Tolerance

    Science.gov (United States)

    2012-03-30

    ...: Fundamentals and Frontiers. American Society for Microbiology, Washington, DC 5. World Health Organization...- 5805. II. Background and Statutory Findings In the Federal Register of September 30, 2010 (75 FR 60452... Technical Grade of the Active Ingredient (TGAI) (2.18 mg/L) for 4 hours (LC 50 >2.18 mg/L, EPA...

  7. Do We Need New Antibiotics?

    Czech Academy of Sciences Publication Activity Database

    Spížek, Jaroslav; Novotná, Jitka; Janata, Jiří

    Seoul : COEX Convention and Exhibition Center , 2009. s. 218-218. [Annual World Congress of Industrial Biotechnology 2009 /2./. 05.04.2009-07.04.2009, Seoul] R&D Projects: GA AV ČR IAA500200810 Institutional research plan: CEZ:AV0Z50200510 Keywords : antibiotics Subject RIV: EE - Microbiology, Virology

  8. 26 CFR 31.6413(c)-1 - Special refunds.

    Science.gov (United States)

    2010-04-01

    ... from the employee's remuneration by reason of such agreement has been paid to the district director... such remuneration for services covered by an agreement made pursuant to section 218 of the Social... from an employee's remuneration as a result of an agreement made pursuant to section 218 of the...

  9. AcEST: BP920280 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000135_B10 465 Adiantum capillus-veneris mRNA. clone: YMU001_000135_B10. BP920280 - Show ... aps = 3/68 (4%) Frame = +3 Query: 48 MIFTCTVCQTRSAKTMS RETYEKGVVTARCGGCKNLHLIADRLGWFGE---PGSVEDFLN 218 +I+ ... aps = 3/68 (4%) Frame = +3 Query: 48 MIFTCTVCQTRSAKTMS RETYEKGVVTARCGGCKNLHLIADRLGWFGE---PGSVEDFLN 218 +++ ...

  10. 29 CFR 502.19 - Civil money penalty assessment.

    Science.gov (United States)

    2010-07-01

    ... that is required by sec. 218 of the INA, 20 CFR 655, subpart B, or these regulations constituting a... worker's employment that are required by sec. 218 of the INA, 20 CFR 655, subpart B, or these regulations... 29 Labor 3 2010-07-01 2010-07-01 false Civil money penalty assessment. 502.19 Section 502.19...

  11. Low Response Rate and Other Factors Render Academic Health Science Library System Study Ungeneralizable. A Review of: Folb, B. L., Wessel, C. B., & Czechowski, L. J. (2011. Clinical and academic use of electronic and print books: The Health Sciences Library System e-book study at the University of Pittsburgh. Journal of the Medical Library Association, 99(3, 218-228. doi:10.3163/1536-5050.99.3.009

    Directory of Open Access Journals (Sweden)

    Maria Melssen

    2012-06-01

    Full Text Available Objective – To determine the factors, barriersand facilitators, preference, and intended useof e-book compared to print book usage by allpatrons in a health science library system,which serves a university with health sciencedegree programs and a hospital system.Design – Two online surveys.Setting – University of Pittsburgh HealthSciences Library System, which includes theUniversity of Pittsburgh’s six schools of healthsciences (medicine, dental medicine, nursing,pharmacy, public health, and rehabilitationand the University of Pittsburgh MedicalCenter hospitals and programs.Subjects – All health sciences library systemusrers, including faculty, researchers, clinicians,residents, fellows, employees, and students.Methods – Two versions of the survey weredeployed in 2009 using Opinio. There were 46questions for the University of PittsburghMedical Center (UPMC survey and 47questions for the University of Pittsburgh (Pittsurvey. The surveys were pilot tested byHealth Sciences Library System (HSLSlibrarians and graduate students in a surveymethods class. The survey was edited based onthe feedback provided and receivedinstitutional review board approval as anexempt study.A total of 5,292 email addresses wererandomly selected by SPSS from a pool of 9,472 UPMC and Pitt patrons registered with a HSLS remote access password; 2,684 patrons from UPMC and 2,608 patrons from Pitt were selected. HSLS librarians were excluded from the survey. Participants were emailed a link to the survey in March of 2009. Three email reminders were sent at five day intervals. Data was collected for 22 days and exported from Opinio to SPSS statistics software. Survey results were analyzed using basic descriptive statistics and cross-tabulations.Main Results – Of the 5,292 emails sent, 979 surveys were submitted and 871 were completed fully. The 108 partially completed the surveys were analyzed using pair wise deletion. All HSLS user groups were represented and all rated their confidence in computer skills high. The mean age of respondents was 39.9 with the majority of respondents being female.Of the 871 completed surveys, over half (55.4% of the respondents reported using HSLS e-books: 66.7% men and 54.9% women. HSLS e-books were used for in-depth reading by 53.4% of men and 36.8% of women. At UPMC, 70% of attending physicians, interns, residents, fellows, and Pitt postdoctoral/fellows use HSLS e-books. The primary use of the e-books was for clinical care, by 75.3% of attending physicians; 86% of interns, residents, and fellows; and 38.9% of nurses. HSLS e-books are also used by 61.8% of respiratory care and physical therapists, 28.6% of administrators, and 56.8% of researchers.At Pitt, 73% of postdoctoral students or fellows and 64.7% of faculty used HSLS e-books. The primary use of the e-books was to support research. 76.5% of postdoctoral students and fellows and 54.1% of faculty used e-books for this purpose. Only 21.3% of faculty assigned e-books for class readings. Though 14% of undergraduate and 33.5% of medical students responded that they had been assigned readings from e-books, 51% of undergraduates and 62.1% of graduate and medical students used an e-book to complete an assignment.Over half (65.5% of respondents saw information about HSLS e-books on the HSLS website and 55.4% of respondents used an HSLS e-book. When using an e-book, 56.6% look up brief, factual information while 41.9% use e-books for in-depth study.Uses of HSLS e-book search tools were rated: the federated full text search tool was used by 67.2% of respondents and 74.3% of those who use this tool rated it as moderately to extremely useful. Google books and the library catalog were also rated moderately to extremely useful by respondents. The catalog received the lowest rating of the HSLS e-book search tools.More respondents (95.4% use the library’s website than come to the physical library (63.8%; however, 66.9% say they use both the website and physical library. Of the 63.8% of respondents who came to one of the HSLS libraries, 67.2% borrowed or used a HSLS print book. When using a book at the library, 23.4% only use print, 14.8% only use e-books, 44.7% use both, and 17.1% use neither. Fewer respondents (46.4% agreed or completely agreed they could locate an e-book compared to those who agreed or completely agreed they could locate a print book (66.7%.Nearly half (45.3% agreed that both HSLS e-books and print books were accessible where they needed to use them; however, only 27.9% agreed or completely agreed that they had time to go to the library and use a print book when they needed it. The closer a respondent worked to the library the more likely they used the physical library. Those also within one block of the library were greater users of HSLS e-books (67% of respondents than those who worked more than two blocks from the library (52.3% of respondents. When respondents did come to the library, 84.3% used a HSLS print book in the past year and 64.7% used an HSLS e-book. Of the respondents who did not have time to come to the library, 55.3% used a HSLS print book and 55.3% used a HSLS e-book.When using e-books, respondents preferred such features as printing, saving, and searching over features such as bookmarking, highlighting, and annotating. Respondents also preferred e-books for general reference and pharmaceutical reference, and print books for textbooks and handbooks. A finding of significance is that “those preferring print were more flexible about using e-books than those preferring e-books were about using print” (p. 224.Conclusion – HSLS e-book use varied depending on the respondent’s role at their institution (e.g., clinical physician, researcher and type of book (e.g., reference book they used. The heaviest HSLS e-book users were students, postdoctoral fellows, researchers, and clinical physicians. Respondents who used HSLS e-books most often were also those who used print books most often, and respondents within one block of the library were some of the heaviest HSLS e-book users. Respondents felt that reference and pharmaceutical books were more suitable as e-books. Also of note was that though faculty were not using e-books heavily for assigned readings, students were using HSLS e-books to complete assignments.The greatest drive to choosing between a print and e-book was the respondent’s information need and which book format was most convenient to access at that time. Respondents were flexible in their use of print books and e-books: respondents “would be willing to use a less preferred format if it were more convenient at the time of need” (p.226. In light of respondents’ flexibility between e-book and print book usage, the authors suggest that collection development librarians could reduce the duplication of book formats.Regarding awareness of e-books, survey results from this study were comparable to that of other studies. Also, the respondent’s comments indicate that the survey itself prompted e-book awareness: respondents felt that more advertising of e-books should be done. Such responses show that passive advertisement of e-books though the library’s catalog and on the website are not enough. E-books should be advertised during library instructional sessions.Respondents also prefer Web access to HSLS e-books as well as the HSLS federated e-book search rather than to access HSLS e-books from the library catalog. The authors’ recommendation is to make sure users can easily access e-book catalog records through the Web in order to best facilitate patrons’ use of e-books.Despite the conclusions that were drawn, there were several limitations of this study. Though the sample size was large enough and all HSLS users were included, the response rate was very low. Bias could be an issue as well: non-response bias as well as an overestimation of the number of HSLS e-book users could be contributing factors to the low response rate. In addition to the small sample size and possible bias, the lack of completed responses (11% was also a concern. Finally, respondents expressed confusion over how “e-books” were defined in the survey. Because of these issues, results of this survey may not be generalizable to other libraries.

  12. Tumor diagnosis by PET: potential of seven tracers examined in five experimental tumors including an artificial metastasis model

    International Nuclear Information System (INIS)

    The potential of seven tracers for the metabolic imaging of tumors by positron emission tomography was studied using five experimental tumor models. The tracers examined were 2-deoxy-2-[18F]fluoro-D-glucose([18F]FDG), 2-deoxy-2-[18F]fluoro-D-galactose (2-[18F]FdGal) and 2-deoxy-2-[18F]fluoro-L-fucose (2-[18F]FdFuc) for investigating energy metabolism. L-[methyl-11C]Methionine ([11C]Met) and 6-[18F]fluoro-L-fucose (6-[18F]FFuc) were used for assessing protein and glycoprotein synthesis, while [3H]thymidine ([3H]Thd) and 2-deoxy-5'-[18F]fluorouridine ([18F]FdUrd) were used to investigate nucleic acid metabolism. (Author)

  13. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    Directory of Open Access Journals (Sweden)

    Ali BAYRAM

    1998-03-01

    Full Text Available In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 10, 50 and 259 mm/min. Strength properties of dual-phase steels were investigated depending on annealing temperature, ratio of martensite and loading rate.

  14. A route for polonium 210 production from alpha-particle irradiated bismuth-209 target

    International Nuclear Information System (INIS)

    A method is proposed for production of polonium-210 via the 209Bi(α,3n)210 At nuclear reaction. Bombardment of a bismuth-209 target was performed with a 37 MeV alpha-particle beam that leads to the production of astatine-210 (T1/2 = 8.1 h), which decays to polonium-210. It is purified from the bismuth target matrix by employing liquid-liquid extraction using tributyl phosphate (TBP) in para-xylene from 7 M hydrochloric acid. Back extraction of polonium-210 was performed by 9 M nitric acid. This method allows to purify a tracer amount of Po-210 (2.6 x 10-13 mol) from macroscopic amount of Bi (2.8 x 10-2 mol).

  15. Effective bond orders from two-step spin–orbit coupling approaches: The I{sub 2}, At{sub 2}, IO{sup +}, and AtO{sup +} case studies

    Energy Technology Data Exchange (ETDEWEB)

    Maurice, Rémi, E-mail: remi.maurice@subatech.in2p3.fr; Montavon, Gilles [SUBATECH, CNRS UMR 6457, IN2P3/EMN Nantes/Université de Nantes, 4 rue Alfred Kastler, BP 20722, 44307 Nantes Cedex 3 (France); Réal, Florent; Gomes, André Severo Pereira; Vallet, Valérie [Laboratoire PhLAM, CNRS UMR 8523, Université de Lille, 59655 Villeneuve d’Ascq Cedex (France); Galland, Nicolas [CEISAM, UMR CNRS 6230, Université de Nantes, 2 rue de la Houssinière, BP 92208, 44322 Nantes Cedex 3 (France)

    2015-03-07

    The nature of chemical bonds in heavy main-group diatomics is discussed from the viewpoint of effective bond orders, which are computed from spin–orbit wave functions resulting from spin–orbit configuration interaction calculations. The reliability of the relativistic correlated wave functions obtained in such two-step spin–orbit coupling frameworks is assessed by benchmark studies of the spectroscopic constants with respect to either experimental data, or state-of-the-art fully relativistic correlated calculations. The I{sub 2}, At{sub 2}, IO{sup +}, and AtO{sup +} species are considered, and differences and similarities between the astatine and iodine elements are highlighted. In particular, we demonstrate that spin–orbit coupling weakens the covalent character of the bond in At{sub 2} even more than electron correlation, making the consideration of spin–orbit coupling compulsory for discussing chemical bonding in heavy (6p) main group element systems.

  16. Effective bond orders from two-step spin–orbit coupling approaches: The I2, At2, IO+, and AtO+ case studies

    International Nuclear Information System (INIS)

    The nature of chemical bonds in heavy main-group diatomics is discussed from the viewpoint of effective bond orders, which are computed from spin–orbit wave functions resulting from spin–orbit configuration interaction calculations. The reliability of the relativistic correlated wave functions obtained in such two-step spin–orbit coupling frameworks is assessed by benchmark studies of the spectroscopic constants with respect to either experimental data, or state-of-the-art fully relativistic correlated calculations. The I2, At2, IO+, and AtO+ species are considered, and differences and similarities between the astatine and iodine elements are highlighted. In particular, we demonstrate that spin–orbit coupling weakens the covalent character of the bond in At2 even more than electron correlation, making the consideration of spin–orbit coupling compulsory for discussing chemical bonding in heavy (6p) main group element systems

  17. Different ways to improve the clinical effectiveness of radioimmunotherapy in solid tumors

    Directory of Open Access Journals (Sweden)

    Chatal Jean-Francois

    2009-09-01

    Full Text Available Radioimmunotherapy (RIT has been proven effective in the treatment of radiosensitive non-Hodgkin lymphoma but, for radioresistant solid tumors, new approaches are necessary to improve the clinical effectiveness. A real improvement has been the introduction of the pretargeting technology which appeared to be able to significantly increase tumor-to-normal organ uptake ratios.Another very promising approach consists in associating RIT with other treatment modalities. Finally the use of alpha particle-emitting radionuclides such as astatin-211 or bismuth-213 (alpha-RIT should allow to efficiently eradicate disseminated microscopic clusters of tumor cells or isolated tumor cells which fit well with the short path length of alpha particles.

  18. Sequential radioimmunotherapy with 177Lu- and 211At-labeled monoclonal antibody BR96 in a syngeneic rat colon carcinoma model

    DEFF Research Database (Denmark)

    Eriksson, Sophie E; Elgström, Erika; Bäck, Tom;

    2014-01-01

    UNLABELLED: Alpha-particle emitters, such as astatine-211 (211At), are generally considered suitable for the treatment of small cell clusters due to their short path length, while beta-particle emitters, for example, Lutetium-177 (177Lu), have a longer path length and are considered better for...... small, established tumors. A combination of such radionuclides may be successful in regimens of radioimmunotherapy. In this study, rats were treated by sequential administration of first a 177Lu-labeled antibody, followed by a 211At-labeled antibody 25 days later. METHODS: Rats bearing solid colon...... carcinoma tumors were treated with 400 MBq/kg body weight 177Lu-BR96. After 25 days, three groups of animals were given either 5 or 10 MBq/kg body weight of 211At-BR96 simultaneously with or without a blocking agent reducing halogen uptake in normal tissues. Control animals were not given any 211At-BR96...

  19. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  20. Development of 211At Chemistry for Labelling Biomolecules

    International Nuclear Information System (INIS)

    Our studies have demonstrated that high recovery of 211At can be obtained using a “wet chemistry” approach to isolation from the bismuth target. We have also demonstrated that direct labelling of antibody-B10 conjugates with 211At can be performed in high yields, and that the astatinated antibodies are stable to in vivo deastatination. While these results will allow us to enter clinical studies with 211At-labelled antibodies, the chemistry associated with 211At is not fully understood. Therefore, it is important that many more basic studies to be conducted with 211At, so the optimal labelling reagent for each type of disease-targeting agent becomes apparent

  1. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena;

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... levels of γH2AX decreased during the first 24h in both cycling and stationary cultures and complete repair was seen in all cultures but cycling cells exposed to (211)At. Compared to stationary cells alpha particles were more harmful for cycling cultures, an effect also seen at the pChk2 levels...... cultures at a modest level of damage, clearly demonstrating that cell cycle status influences the relative effectiveness of alpha particles....

  2. An improved synthesis of an 125I and 211At labelled benzamide for melanoma imaging

    International Nuclear Information System (INIS)

    Recent studies have indicated that benzamides can exhibit affinity for malignant melanoma and may be exploited diagnostically in the treatment of this cancer. Radioiodinated N-(2-diethylaminoethyl)-3-[123I/131I]iodo-4-methoxybenzamide (*I-IMBA) is a benzamide with promising diagnostic properties. A new synthesis procedure was developed to obtain 125I-IMBA suitable for use in vivo. The assets of the procedure include the use of less toxic reagents and better reproducible results when radiolabelling the precursor. The procedure also facilitates the synthesis of the astatinated N-(2-diethylaminoethyl)-3-[211At]astatine-4-methoxybenzamide (211At-AMBA), a new benzamide with a therapeutic potential. The regiospecific no-carrier-added 125I- and 211At-labeling of the benzamide is performed by demetalation of an organotin precursor. Using tributylstannyl as a leaving group, the radiochemical yield obtained after 15 minutes of reaction was 70 %-90 % for both 125I-IMBA and 211At-AMBA. The labelling was performed in a solution of MeOH:AcOH with NCS as the oxidising agent. The organotin precursor N-(2-diethylaminoethyl)-3-(tri-n-butylstannyl)-4-methoxy-benzamide was synthesized from 3-bromo-4-methoxybenzoic acid, with n-BuLi (2 eq) and Bu3SnCl (1 eq) in THF, giving 3-(tri-n-butylstannyl)-4-methoxybenzoic acid. The amide function was introduced by converting the acid group into an active N-succinimidyl-ester, a good leaving group in the reaction with 2-(diethylamino)ethylamine. The overall yield of the organotin precursor was 65 %

  3. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    Energy Technology Data Exchange (ETDEWEB)

    Marsh, B.A., E-mail: bruce.marsh@cern.ch [CERN, CH-1211 Geneva (Switzerland); Andel, B. [Comenius University, Bratislava (Slovakia); Andreyev, A.N. [University of York, Department of Physics, York YO10 5DD (United Kingdom); Antalic, S. [Comenius University, Bratislava (Slovakia); Atanasov, D. [Max-Planck-Institut für Kernphysik, Saupfercheckweg 1, 69117 Heidelberg (Germany); Barzakh, A.E. [Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, 188300 Gatchina (Russian Federation); Bastin, B. [Grand Accérateur National d’Ions Lourds (GANIL), Bd Henri Becquerel, F-14076 Caen (France); Borgmann, Ch. [Max-Planck-Institut für Kernphysik, Saupfercheckweg 1, 69117 Heidelberg (Germany); Capponi, L. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Cocolios, T.E.; Day Goodacre, T. [CERN, CH-1211 Geneva (Switzerland); University of Manchester, Manchester (United Kingdom); Dehairs, M. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Derkx, X. [University of the West of Scotland, School of Engineering, Paisley PA1 2BE (United Kingdom); De Witte, H. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fedorov, D.V. [Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, 188300 Gatchina (Russian Federation); Fedosseev, V.N.; Focker, G.J. [CERN, CH-1211 Geneva (Switzerland); Fink, D.A. [Ruprecht-Karls Universität, Seminarstr. 2, 69117 Heidelberg (Germany); CERN, CH-1211 Geneva (Switzerland); Flanagan, K.T. [University of Manchester, Manchester (United Kingdom); Franchoo, S. [CSNSM-IN2P3-CNRS, Université Paris-Sud, 91406 Orsay (France); and others

    2013-12-15

    Highlights: • Upgrade of the lasers, detectors and data acquisition for in-source resonance ionization spectroscopy at ISOLDE. • First use of the ISOLTRAP MR-ToF MS in combination with laser spectroscopy at ISOLDE. • Resonance ionization of astatine for the study of its nuclear structure. -- Abstract: At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar free ionization using the Laser Ion Source Trap, LIST (Po); isobar selective particle identification using the multi-reflection time-of-flight mass separator (MR-ToF MS) of ISOLTRAP (Au, At). These are summarized as part of an overview of the current status of the in-source resonance ionization spectroscopy setup at ISOLDE.

  4. Genetic and bibliographic information: ACTG1 [GenLibi

    Lifescience Database Archive (English)

    Full Text Available earing loss Otorhinolaryngologic Diseases (C09) > Ear Diseases (C09.218) > Hearing Disorders (C09.218.458) >... Hearing Loss (C09.218.458.341) Nervous System Diseases (C10) > Neurologic Manifestations (C10.597) > Sensation Disorders... (C10.597.751) > Hearing Disorders (C10.597.751.418) > Hearing Loss ...rologic Manifestations (C23.888.592) > Sensation Disorders (C23.888.592.763) > Hearing Disorders (C23.888.592.763.393) > Hearing Loss (C23.888.592.763.393.341) 00A0313755 ...

  5. Dicty_cDB: Contig-U15346-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available HN218Z ,1243,1475 Translated Amino Acid sequence llaywxnnsnnnnsnnninks*tkkeiniimvi*nipl**nswwifik*sk*yikertsl *fcscam... Frame B: llaywxnnsnnnnsnnninks*tkkeiniimvi*nipl**nswwifik*sk*yikertsl *fcscamgt*

  6. Choctaw National Wildlife Refuge Natural Community and Rare Plant Survey

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Choctaw National Wildlife Refuge (CNWR) administers approximately 4,218 acres along theTombigbee River in Choctaw County, Alabama (Figure 1). The Refuge contains a...

  7. The tryptophan hydroxylase 1 (TPH1) gene, schizophrenia susceptibility, and suicidal behavior: a multi-centre case-control study and meta-analysis

    DEFF Research Database (Denmark)

    Saetre, Peter; Lundmark, Per; Wang, August; Hansen, Thomas; Rasmussen, Henrik B; Djurovic, Srdjan; Melle, Ingrid; Andreassen, Ole A; Werge, Thomas; Agartz, Ingrid; Hall, Håkan; Terenius, Lars; Jönsson, Erik G

    .07-1.29). Association studies on suicide attempts are however conflicting (heterogeneity index I(2) = 0.54) and do not support the A218C/A779C polymorphisms being a susceptibility locus for suicidal behavior among individuals diagnosed with a psychiatric disorder (OR = 0.96 [0.80-1.16]). We conclude that the TPH1 A218...... associated with schizophrenia. The minor allele (A) of this polymorphism (A218C) is also more frequent in patients who have attempted suicide and individuals who died by suicide, than in healthy control individuals. In an attempt to replicate previous findings, five single nucleotide polymorphisms (SNPs......) were genotyped in 837 Scandinavian schizophrenia patients and 1,473 controls. Three SNPs spanning intron 6 and 7, including the A218C and A779C polymorphisms, were associated with schizophrenia susceptibility (P = 0.019). However there were no differences in allele frequencies of these loci between...

  8. Distribution and drug sensitivity of pathogens in diabetic foot ulcer secretions

    Institute of Scientific and Technical Information of China (English)

    李惠琴

    2013-01-01

    Objective To investigate the distribution and drug sensitivity of pathogens isolated from diabetic foot ulcer(DFU) secretions. Methods A retrospective study was carried out on the distribution and drug sensitivity of pathogens isolated from the secretions of 218 DFU

  9. WEEKLY WATCH

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    OPINION Popular Majors No More China recently issued its first blue paper on employment. Based on 218,000 valid questionnaires returned by college graduates in 2008, the blue paper says that students majoring in law, IT,

  10. Little People of America

    Science.gov (United States)

    ... information. Our Sponsors Welcome to Little People of America Little People of America (LPA) is a nonprofit organization that provides support ... survey can be seen here. © Little People of America 250 El Camino Real Suite 218, Tustin, CA ...

  11. Läänemere-ruum uurimisainese ja mõistena / Juhan Kreem

    Index Scriptorium Estoniae

    Kreem, Juhan

    2007-01-01

    Rets. rmt.: The Baltic as a Multicultural World : Sea, Region and Peoples. Marko Lehti (ed.). (The Baltic Sea Region : Nordic Dimensions - European Perspectives 4). Berliner Wissenschafts-Verlag, Berlin, 2005. 218 lk.

  12. Empirická krajina v románové krajinné vizi. Reprezentace prostoru v Balzakových Šuanech

    Czech Academy of Sciences Publication Activity Database

    Hrbata, Zdeněk

    2012-01-01

    Roč. 22, č. 45 (2012), s. 218-241. ISSN 0862-8440 Institutional support: RVO:68378068 Keywords : historical novel * narrative situation * mimetic landscape * semiotic area Subject RIV: AJ - Letters, Mass-media, Audiovision

  13. 77 FR 29981 - Marine Mammals; File No. 17086

    Science.gov (United States)

    2012-05-21

    ... was published in the Federal Register (77 FR 9627) that a request for a permit to conduct research on... to Robin Baird, Ph.D., Cascadia Research, 218\\1/2\\ W. 4th Avenue, Olympia, WA 98501, to...

  14. Neviditelný český intelektuál aneb odvaha ke středu

    Czech Academy of Sciences Publication Activity Database

    Hlaváček, Petr

    Praha : Academia, 2012 - (Hlaváček, P.), s. 203-218 ISBN 978-80-200-2083-3 Institutional support: RVO:67985955 Keywords : intellectualls * public space * Czech Republic * Europe Subject RIV: AA - Philosophy ; Religion

  15. Increasing DNA reactivity and in vitro antitumor activity of trans diiodido Pt(II) complexes with UVA light

    Czech Academy of Sciences Publication Activity Database

    Navas, F.; Perfahl, S.; Garino, C.; Salassa, L.; Nováková, Olga; Navarro-Ranninger, C.; Bednarski, P.J.; Malina, Jaroslav; Quiroga, Adoración G.

    2015-01-01

    Roč. 153, DEC2015 (2015), s. 211-218. ISSN 0162-0134 Institutional support: RVO:68081707 Keywords : Metallodrug photoactivaton * Platinum drugs * DNA interactions Subject RIV: BO - Biophysics Impact factor: 3.444, year: 2014

  16. Growth of human immunodeficiency type 1-infected and unifected children : a prospective cohort study in Kigali, Rwanda, 1988 to 1993

    OpenAIRE

    Lepage, P; Msellati, Philippe; Hitimana, D.G.; Bazubagira, A.; Van Goethem, C.; Simonon, A.; Karita, E.; Dequae-Merchadou, L.; Van de Perre, P; DABIS, F.

    1996-01-01

    To compare the anthropometric characteristics of children with an without HIV-1 infection. In a prospective cohort study of 218 children born to HIV-1 seropositive mothers and 218 children born to HIV-1 seronegative mothers in Kigali, Rwanda, 3 groups were compared : infected children (n = 46), uninfected children born to seropositive mothers (n = 140), and uninfected children born to seronegative mothers (n = 207). Weight, height and head circumference were measured at birth, every 3 months ...

  17. Decreased cerebral α4β2* nicotinic acetylcholine receptor availability in patients with mild cognitive impairment and Alzheimer's disease assessed with positron emission tomography

    International Nuclear Information System (INIS)

    Postmortem studies indicate a loss of nicotinic acetylcholine receptor (nAChRs) in Alzheimer's disease (AD). In order to establish whether these changes in the cholinergic system occur at an early stage of AD, we carried out positron emission tomography (PET) with a specific radioligand for the α4β2* nicotinic acetylcholine receptor (α4β2* nAChR) in patients with mild to moderate AD and in patients with amnestic mild cognitive impairment (MCI), who have a high risk to progress to AD. Nine patients with moderate AD, eight patients with MCI and seven age-matched healthy controls underwent 2-[18F]fluoro-3-(2(S)-azetidinylmethoxy)pyridine (2-[18F]FA-85380) PET. After coregistration with individual magnetic resonance imaging the binding potential (BPND) of 2-[18F]FA-85380 was calculated using either the corpus callosum or the cerebellum as reference regions. PET data were analysed by region of interest analysis and by voxel-based analysis. Both patients with AD and MCI showed a significant reduction in 2-[18F]FA-85380 BPND in typical AD-affected brain regions. Thereby, the corpus callosum was identified as the most suitable reference region. The 2-[18F]FA-85380 BPND correlated with the severity of cognitive impairment. Only MCI patients that converted to AD in the later course (n = 5) had a reduction in 2-[18F]FA-85380 BPND. 2-[18F]FA-85380 PET appears to be a sensitive and feasible tool for the detection of a reduction in α4β2* nAChRs which seems to be an early event in AD. In addition, 2-[18F]FA-85380 PET might give prognostic information about a conversion from MCI to AD. (orig.)

  18. Lower hybrid wave packet stochasticity revisited

    Czech Academy of Sciences Publication Activity Database

    Fuchs, Vladimír; Krlín, Ladislav; Laqua, H.P.; Pánek, Radomír; Preinhaelter, Josef; Seidl, Jakub; Urban, Jakub

    Roma : ENEA - Italian National Agency new Technologies, Energy and Sustainable Economic Development, 2013 - (Tuccillo, A.), P2.18-P2.18 ISBN N. - (ENEA). [Topical conference on radio frequency power in plasmas/20./. Sorrento (IT), 25.06.2013-28.06.2013] Institutional support: RVO:61389021 Keywords : plasma Subject RIV: BL - Plasma and Gas Discharge Physics http://www.frascati.enea.it/maratea2002/MIO/BoAbstract_v5pdf

  19. AcEST: BP913078 [AcEST

    Lifescience Database Archive (English)

    Full Text Available LE D + N L+ Sbjct: 233 SLQLFYQLMEDNVVPDGYILSTVLSACSILPFLEGGKQIHAHILRYG-LEMDASLMNVLI 291 Query: 235 DMYASCGLIANAHETFCGLGIRSIISWSSLI... D+I+WT + GY+++ EA+ VF + Sbjct: 218 EKNEATSNCLINGYMGLGNLEQAESLFNQMPVKDIISWTTMIKGYSQNKRYREAIAVFYK 277 Query: 394 MQHEG...AWNTMIGGLAEGGYWEEASEVYN 317 Query: 397 EMQHEGFAPSMVTHVCMLSACGNLGALEMGIEIHAEMARKGLLEQDLTAGNALLDMYASC 218 +MQ EG... G A G + +A+ +F +MQ Sbjct: 566 DVNLGNALINMYIRCGSLQDARNVFHSLQHRDVMSWTAMIGGCADQGEDMKAIELFWQMQ 625 Query: 388 HEG...A +G +E Sbjct: 56 IIQSGF-QSDVRVETALVNMYVKCGSIDDAQLIFDKMVERNVISWTVMIGGLAHYGRGQE 114 Query: 415 ALCVFKEMQHEGFA

  20. Selectively labelled taraxastane and lupane derivatives

    Czech Academy of Sciences Publication Activity Database

    Martinez, M. M.; Vlk, M.; Sarek, J.; Elbert, Tomáš; Hajdúch, M.

    Mariánské lázně, 2010. s. 218-218. [Radiochemical Conference /16./. 18.04.2010-23.04.2010, Mariánské lázně] Grant ostatní: GA ČR(CZ) GA305/09/1216 Institutional research plan: CEZ:AV0Z40550506 Keywords : triterpenoids * tritium * deuterium Subject RIV: CC - Organic Chemistry

  1. AcEST: DK951755 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0012_D24 615 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0012_D24. 5' end seq ... GMPHKFYHGR 60 Query: 218 TGVVWNVTKRAIGVEMNKQVNTRIVRKRI HVRIEHVQPSRCREDFIERVKKNDXXXXXXX 397 TG +WNVTKRA+GVE ... +NKQ+ RI+RKRI HVR+EHVQ SRC E+F R KKND Sbjct: 61 TGRIWNVTKRAVGVEVN ... KQIGNRIIRKRI HVRVEHVQQSRCAEEFKLRKKKNDELKAAAK 120 Query: 398 XXXX ... GMPHKFYHGR 60 Query: 218 TGVVWNVTKRAIGVEMNKQVNTRIVRKRI HVRIEHVQPSRCREDFIERVKKNDXXXXXXX 397 TG +WNVTKRA+GVE ...

  2. Improvement of an l-Leucine-Producing Mutant of Brevibacterium lactofermentum 2256 by Genetically Desensitizing It to α-Acetohydroxy Acid Synthetase

    OpenAIRE

    Tsuchida, Takayasu; Momose,Haruo

    1986-01-01

    Genetic improvement of l-leucine productivity in strain 218, an ile− 2-thiazolealanine-resistant mutant of Brevibacterium lactofermentum 2256, was attempted. In strain 218, which produced 28 mg of l-leucine per ml from 13% glucose, α-isopropylmalate synthetase was genetically desensitized and derepressed to the effect of l-leucine, whereas α-acetohydroxy acid synthetase remained unaltered, although it could be derepressed phenotypically by limiting the isoleucine concentration in the culture....

  3. POTENTIAL OF EGF-LIKE PEPTIDES TO IMPROVE CULTURE OF PIG CUMULUSOOCYTE

    Czech Academy of Sciences Publication Activity Database

    Procházka, Radek; Blaha, Milan; Němcová, Lucie

    Chester : Society for Reproduction and Fertility, 2011. s. 218-218. [27th Annual Meeting A.E.T.E. 09.09.2011-10.09.2011, Chester] R&D Projects: GA ČR GAP502/11/0593; GA MZe QI101A166 Institutional research plan: CEZ:AV0Z50450515 Keywords : peptides * pig * oocyte Subject RIV: EB - Genetics ; Molecular Biology http://www.aete.eu/pdf_publication/30.pdf

  4. Measurements of the ion fraction and mobility of alpha and beta decay products in liquid xenon using EXO-200

    CERN Document Server

    Albert, J B; Barbeau, P S; Beck, D; Belov, V; Breidenbach, M; Brunner, T; Burenkov, A; Cao, G F; Chambers, C; Cleveland, B; Coon, M; Craycraft, A; Daniels, T; Danilov, M; Daugherty, S J; Davis, C G; Davis, J; Delaquis, S; Der Mesrobian-Kabakian, A; DeVoe, R; Didberidze, T; Dolgolenko, A; Dolinski, M J; Dunford, M; Fairbank, W; Farine, J; Feldmeier, W; Fierlinger, P; Fudenberg, D; Gornea, R; Graham, K; Gratta, G; Hall, C; Hughes, M; Jewell, M J; Jiang, X S; Johnson, A; Johnson, T N; Johnston, S; Karelin, A; Kaufman, L J; Killick, R; Koffas, T; Kravitz, S; Kuchenkov, A; Kumar, K S; Leonard, D S; Licciardi, C; Lin, Y H; Ling, J; MacLellan, R; Marino, M G; Mong, B; Moore, D; Nelson, R; O'Sullivan, K; Odian, A; Ostrovskiy, I; Piepke, A; Pocar, A; Prescott, C Y; Robinson, A; Rowson, P C; Russell, J J; Schubert, A; Sinclair, D; Smith, E; Stekhanov, V; Tarka, M; Tolba, T; Tsang, R; Twelker, K; Vuilleumier, J -L; Waite, A; Walton, J; Walton, T; Weber, M; Wen, L J; Wichoski, U; Wright, J D; Wood, J; Yang, L; Yen, Y -R; Zeldovich, O Ya

    2015-01-01

    Alpha decays in the EXO-200 detector are used to measure the fraction of charged $^{218}\\mathrm{Po}$ and $^{214}\\mathrm{Bi}$ daughters created from alpha and beta decays, respectively. $^{222}\\mathrm{Rn}$ alpha decays in liquid xenon (LXe) are found to produce $^{218}\\mathrm{Po}^{+}$ ions $50.3 \\pm 3.0\\%$ of the time, while the remainder of the $^{218}\\mathrm{Po}$ atoms are neutral. The fraction of $^{214}\\mathrm{Bi}^{+}$ from $^{214}\\mathrm{Pb}$ beta decays in LXe is found to be $76.4 \\pm 5.7\\%$, inferred from the relative rates of $^{218}\\mathrm{Po}$ and $^{214}\\mathrm{Po}$ alpha decays in the LXe. The average velocity of $^{218}\\mathrm{Po}$ ions is observed to decrease for longer drift times. Initially the ions have a mobility of $0.390 \\pm 0.006~\\mathrm{cm}^2/(\\mathrm{kV}~\\mathrm{s})$, and at long drift times the mobility is $0.219 \\pm 0.004~\\mathrm{cm}^2/(\\mathrm{kV}~\\mathrm{s})$. Time constants associated with the change in mobility during drift of the $^{218}\\mathrm{Po}^{+}$ ions are found to be propor...

  5. Transport and deposition of nano-particles. Application to the free action of short-lived radon daughters; Transport et depot des aerosols nanometriques. Application a la fraction libre des descendants a vie courte du radon

    Energy Technology Data Exchange (ETDEWEB)

    Malet, J

    1997-10-10

    Short-lived radon daughters ({sup 218}Po, {sup 214}Pb, {sup 214}Bi, and {sup 214}Po) are important contributors to the natural average annual individual dose. The models describing the evolution of these aerosol in a house depend critically on a parameter, the {sup 218}Po deposition velocity, which, although aerosol deposition has been extensively studied, is poorly known. A numerical and experimental study is thus carried out for a simple case: deposition in a cylindrical tube under laminar flow condition. The numerical results help understanding the difference between the transport and deposition of these radionuclides and those of non radioactive aerosols. Comparison of these well environment does not give satisfactory correlation, requiring the study of phenomena that may affect deposition. The first of these is the possible variation in the e {sup 218}Po diffusion coefficient. Furthermore, experiments coupled with numerical calculations show that this variation could be due to {sup 218}Po neutralization. The second phenomenon concerns the effect of the surface type, which is also shown experimentally. By modelling the neutralization and using results with a piratically smooth surface, good numerical/experimental correlations are obtained. Understanding this simple case than makes possible studying a more complex case: deposition in controlled turbulent flow. Two theories are thus experimentally validated. In addition, a {sup 218}Po deposition velocity representative of our experimental conditions is determined. Finally, we report a feasibility study of radon daughters transport and deposition in a ventilated chamber taking into account all the involved phenomena. (author)

  6. Transport and deposition of nano-particles. Application to the free action of short-lived radon daughters

    International Nuclear Information System (INIS)

    Short-lived radon daughters (218Po, 214Pb, 214Bi, and 214Po) are important contributors to the natural average annual individual dose. The models describing the evolution of these aerosol in a house depend critically on a parameter, the 218Po deposition velocity, which, although aerosol deposition has been extensively studied, is poorly known. A numerical and experimental study is thus carried out for a simple case: deposition in a cylindrical tube under laminar flow condition. The numerical results help understanding the difference between the transport and deposition of these radionuclides and those of non radioactive aerosols. Comparison of these well environment does not give satisfactory correlation, requiring the study of phenomena that may affect deposition. The first of these is the possible variation in the e 218Po diffusion coefficient. Furthermore, experiments coupled with numerical calculations show that this variation could be due to 218Po neutralization. The second phenomenon concerns the effect of the surface type, which is also shown experimentally. By modelling the neutralization and using results with a piratically smooth surface, good numerical/experimental correlations are obtained. Understanding this simple case than makes possible studying a more complex case: deposition in controlled turbulent flow. Two theories are thus experimentally validated. In addition, a 218Po deposition velocity representative of our experimental conditions is determined. Finally, we report a feasibility study of radon daughters transport and deposition in a ventilated chamber taking into account all the involved phenomena. (author)

  7. Cyclic nucleotide dependent dephosphorylation of regulator of G-protein signaling 18 in human platelets.

    LENUS (Irish Health Repository)

    Gegenbauer, Kristina

    2013-11-01

    Regulator of G-protein signaling 18 (RGS18) is a GTPase-activating protein that turns off Gq signaling in platelets. RGS18 is regulated by binding to the adaptor protein 14-3-3 via phosphorylated serine residues S49 and S218 on RGS18. In this study we confirm that thrombin, thromboxane A2, or ADP stimulate the interaction of RGS18 and 14-3-3 by increasing the phosphorylation of S49. Cyclic AMP- and cyclic GMP-dependent kinases (PKA, PKG) inhibit the interaction of RGS18 and 14-3-3 by phosphorylating S216. To understand the effect of S216 phosphorylation we studied the phosphorylation kinetics of S49, S216, and S218 using Phos-tag gels and phosphorylation site-specific antibodies in transfected cells and in platelets. Cyclic nucleotide-induced detachment of 14-3-3 from RGS18 coincides initially with double phosphorylation of S216 and S218. This is followed by dephosphorylation of S49 and S218. Dephosphorylation of S49 and S218 might be mediated by protein phosphatase 1 (PP1) which is linked to RGS18 by the regulatory subunit PPP1R9B (spinophilin). We conclude that PKA and PKG induced S216 phosphorylation triggers the dephosphorylation of the 14-3-3 binding sites of RGS18 in platelets.

  8. 222Rn, 220Rn and Progeny Measured in a Limestone Cave and the Associated Radiation Dose

    International Nuclear Information System (INIS)

    Concentrations of radon, thoron and the attached and unattached fractions of the short lived alpha emitting decay progeny were measured at different locations in a limestone cave by means of CR-39 and LR-115 type II solid state nuclear track detectors in order to assess the dose due to inhalation. The committed equivalent doses per hour of exposure due to the attached and unattached fractions of 218Po and 214Po were evaluated in different tissues of the respiratory tract. The influence of the activity of the attached and unattached fractions of 218Po and 214Po and the mass of the tissue on the committed equivalent dose per hour of exposure was investigated. The annual committed effective doses due to the attached and unattached fractions of 218Po and 214Po were determined. A maximum value of 1.7 mSv was found for workers spending 1 h/d during the summer months inside the cave. (author)

  9. The Atacama Cosmology Telescope: cross correlation with Planck maps

    International Nuclear Information System (INIS)

    We present the temperature power spectrum of the Cosmic Microwave Background obtained by cross-correlating maps from the Atacama Cosmology Telescope (ACT) at 148 and 218 GHz with maps from the Planck satellite at 143 and 217 GHz, in two overlapping regions covering 592 square degrees. We find excellent agreement between the two datasets at both frequencies, quantified using the variance of the residuals between the ACT power spectra and the ACT × Planck cross-spectra. We use these cross-correlations to measure the calibration of the ACT data at 148 and 218 GHz relative to Planck, to 0.7% and 2% precision respectively. We find no evidence for anisotropy in the calibration parameter. We compare the Planck 353 GHz power spectrum with the measured amplitudes of dust and cosmic infrared background (CIB) of ACT data at 148 and 218 GHz. We also compare planet and point source measurements from the two experiments

  10. The tryptophan hydroxylase 1 (TPH1) gene, schizophrenia susceptibility, and suicidal behavior: a multi-centre case-control study and meta-analysis

    DEFF Research Database (Denmark)

    Saetre, Peter; Lundmark, Per; Wang, August;

    2010-01-01

    associated with schizophrenia. The minor allele (A) of this polymorphism (A218C) is also more frequent in patients who have attempted suicide and individuals who died by suicide, than in healthy control individuals. In an attempt to replicate previous findings, five single nucleotide polymorphisms (SNPs......) were genotyped in 837 Scandinavian schizophrenia patients and 1,473 controls. Three SNPs spanning intron 6 and 7, including the A218C and A779C polymorphisms, were associated with schizophrenia susceptibility (P = 0.019). However there were no differences in allele frequencies of these loci between...... affected individuals having attempted suicide at least once and patients with no history of suicide attempts (P = 0.84). A systematic literature review and meta-analysis support the A218C polymorphism as a susceptibility locus for schizophrenia (odds ratio 1.17, 95% confidence interval 1...

  11. The Atacama Cosmology Telescope: cross correlation with Planck maps

    Energy Technology Data Exchange (ETDEWEB)

    Louis, Thibaut; Calabrese, Erminia; Dunkley, Joanna; Næss, Sigurd [Department of Astrophysics, Oxford University, Oxford OX1 3RH (United Kingdom); Addison, Graeme E.; Hincks, Adam D. [Department of Physics and Astronomy, University of British Columbia, Vancouver, BC V6T 1Z4 (Canada); Hasselfield, Matthew; Hlozek, Renée [Department of Astrophysical Sciences, Peyton Hall, Princeton University, Princeton, NJ 08544 (United States); Bond, J. Richard; Hajian, Amir [Canadian Institute for Theoretical Astrophysics, University of Toronto, Toronto, ON M5S 3H8 (Canada); Das, Sudeep [Argonne National Laboratory, 9700 S. Cass Ave., Lemont, IL 60439 (United States); Devlin, Mark J. [Department of Physics and Astronomy, University of Pennsylvania, 209 South 33rd Street, Philadelphia, PA 19104, U.S.A (United States); Dünner, Rolando; Infante, Leopoldo [Departamento de Astronomía y Astrofísica, Facultad de Física, Pontificia Universidad Católica de Chile, Casilla 306, Santiago 22 (Chile); Gralla, Megan; Marriage, Tobias A. [Dept. of Physics and Astronomy, The Johns Hopkins University, 3400 N. Charles St., Baltimore, MD 21218-2686 (United States); Huffenberger, Kevin [Department of Physics, Florida State University, Keen Physics Building, 77 Chieftan Way, Tallahassee, Florida (United States); Kosowsky, Arthur [Department of Physics and Astronomy, University of Pittsburgh, Pittsburgh, PA, 15260 (United States); Moodley, Kavilan [Astrophysics and Cosmology Research Unit, School of Mathematical Sciences, University of KwaZulu-Natal, Durban, 4041 (South Africa); Niemack, Michael D., E-mail: Thibaut.Louis@astro.ox.ac.uk [Joseph Henry Laboratories of Physics, Jadwin Hall, Princeton University, Princeton, NJ 08544 (United States); and others

    2014-07-01

    We present the temperature power spectrum of the Cosmic Microwave Background obtained by cross-correlating maps from the Atacama Cosmology Telescope (ACT) at 148 and 218 GHz with maps from the Planck satellite at 143 and 217 GHz, in two overlapping regions covering 592 square degrees. We find excellent agreement between the two datasets at both frequencies, quantified using the variance of the residuals between the ACT power spectra and the ACT × Planck cross-spectra. We use these cross-correlations to measure the calibration of the ACT data at 148 and 218 GHz relative to Planck, to 0.7% and 2% precision respectively. We find no evidence for anisotropy in the calibration parameter. We compare the Planck 353 GHz power spectrum with the measured amplitudes of dust and cosmic infrared background (CIB) of ACT data at 148 and 218 GHz. We also compare planet and point source measurements from the two experiments.

  12. The Atacama Cosmology Telescope: Cross Correlation with Planck maps

    CERN Document Server

    Louis, Thibaut; Hasselfield, Matthew; Bond, J Richard; Calabrese, Erminia; Das, Sudeep; Devlin, Mark J; Dunkley, Joanna; Dünner, Rolando; Gralla, Megan; Hajian, Amir; Hincks, Adam D; Hlozek, Renée; Huffenberger, Kevin; Infante, Leopoldo; Kosowsky, Arthur; Marriage, Tobias A; Moodley, Kavilan; Næss, Sigurd; Niemack, Michael D; Nolta, Michael R; Page, Lyman A; Partridge, Bruce; Sehgal, Neelima; Sievers, Jonathan L; Spergel, David N; Staggs, Suzanne T; Walter, Benjamin Z; Wollack, Edward J

    2014-01-01

    We present the temperature power spectrum of the Cosmic Microwave Background obtained by cross-correlating maps from the Atacama Cosmology Telescope (ACT) at 148 and 218 GHz with maps from the Planck satellite at 143 and 217 GHz, in two overlapping regions covering 592 square degrees. We find excellent agreement between the two datasets at both frequencies, quantified using the variance of the residuals between the ACT power spectra and the ACTxPlanck cross-spectra. We use these cross-correlations to calibrate the ACT data at 148 and 218 GHz, to 0.7% and 2% precision respectively. We find no evidence for anisotropy in the calibration parameter. We compare the Planck 353 GHz power spectrum with the measured amplitudes of dust and cosmic infrared background (CIB) of ACT data at 148 and 218 GHz. We also compare planet and point source measurements from the two experiments.

  13. Measurement of radioactive aeroions mobility in atmospheric air

    International Nuclear Information System (INIS)

    Paper describes a technique to measure mobility of 218Po radon daughter ions in gas. Technique is based on aspiration technique to record aeroions grounded on ion precipitation from radon containing gas flow to the surface of semiconducting detector within electrostatic field of a plane condenser with subsequent recording of 218Po α-radiation. For ∼ 1 s ions one determined dependence of mobility on air absolute humidity. Within 3.4-13.6 g/m3 humidity variation range the mentioned dependence is shown to be negligible one. The average value of 218Po mobility according to the experiment results constituted 1.05 ± 0.05 cm2/(s W)

  14. The biokinetics of alpha-particle emitting radiopharmaceuticals

    International Nuclear Information System (INIS)

    The past two decades have seen wide interest in the application of alpha-particle emitting radionuclides for targeted endoradiotherapy and a large number of compounds labeled with 211At (T1/2 7.21 h), 212Bi (T1/2 1 h) or 213Bi (T1/2 0.78 h) have been studied. Knowledge of the biokinetic behaviour of such agents is important both for their optimal clinical exploitation and for general radiological protection purposes. Animal studies of the distribution and retention of 211At compounds, including ionic astatide, substituted aromatic compounds and labelled monoclonal antibodies, have provided new information on the biochemistry of astatine. With respect the thyroid gland the uptake of the astatide ion has been shown to be very much lower than that of the iodide ion. Less information is available for 212Bi-labelled radiopharmaceuticals. The available data for both 211At and 212Bi radiopharmaceuticals are reviewed. Cautious generic biokinetic models for inorganic and simple organic compounds of 211At and 212Bi; for [211At]-, and [212Bi]-biphosphonates and for [211At]-, and [212Bi]-monoclonal antibodies, are proposed for use in general radiological protection when compound-specific data are not available. (orig.)

  15. The radiolabeled monoclonal antibodies in immunoscintigraphy and radioimmunotherapy: current state and perspectives

    International Nuclear Information System (INIS)

    The antibodies can be satisfactorily labelled with technitium-99 m or indium-111 for tumor immunoscintigraphy. The immunoscintigraphy is not useful for the primary tumor diagnosis. It can be useful for the diagnosis of the some cancer extension and for recurrent tumor visualization. The immunoscintigraphy is widely competed with Positron Emission Tomography (PET) which gives accurate results. In the future the immunoscintigraphy, in pre-therapeutic stage, contribute to the estimation of the dose delivered to the tumor and to normal organs for adopting or not a radioimmunotherapy. The antibodies can also be labeled with Iodine-131 for an application in radioimmunotherapy (RIT). The RIT is efficient in the non-Hodgkin's lymphoma treatment because of their great radiosensitivity. Until now the results have been very modest in solid tumor treatment but methodological and biotechnological progresses have to improve the efficiency especially for the small tumors. In the future iodine-131 which requires the confinement (very expensive) of patients will be substituted by yttrium-90 beta emitter, more energetic than iodine-131 and can be injected in walking case. In the long term, the alpha emitter radionuclides (astatine-211 or bismuth-213) can be used for hematologic cancer treatment. In conclusion the future of radiolabeled monoclonal antibodies is essentially therapeutic. The radioimmunotherapy associated to the chemotherapy give promising perspectives for the radiosensitive cancer treatment and in general small solid tumor treatment (F.M.)

  16. Biological toxicity of intracellular radionuclide decay. Part of a coordinated programme on radiation biology of Auger emitters and their therapeutic applications

    International Nuclear Information System (INIS)

    Internal radiotherapy should be performed with short-lived radionuclides which emit high LET radiation and short ranged radiation, and accumulated within cancers. Based on these considerations, several radionuclides (tritium, copper-64, gallium-67, iodine-123, iodine 125, iodine-131 and astatine-211) were chosen and their toxicity was assessed using cell division in mammalian cultured cells as a criterion. It was apparent that the toxic effects obtained with 125I greatly exceeded those observed in cells treated with any other radionuclides. The possible hypotheses to explain the excessive radiosensitivity of 125I were discussed in relation to microdosimetry calculation. It was also found that the division delay induced by radionuclide decay is primarily due to damage to the cell nucleus but not to the plasma membrane. The key problem remains the development of agents which can serve as carriers for radionuclide accumulation within tumors. Although several promising approaches (Synkavit, tamoxifen, iododeoxyuridine, antibodies, liposomes) were investigated, only 125I-labelled Synkavit would be desirable for clinical application

  17. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  18. The biokinetics of alpha-particle emitting radiopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    Taylor, D.M. [School of Chemistry, Cardiff Univ., Cardiff (United Kingdom); Duffield, J.R. [Faculty of Applied Sciences, Univ. of the West of England, Bristol (United Kingdom)

    2005-07-01

    The past two decades have seen wide interest in the application of alpha-particle emitting radionuclides for targeted endoradiotherapy and a large number of compounds labeled with {sup 211}At (T{sup 1}/{sub 2} 7.21 h), {sup 212}Bi (T{sup 1}/{sub 2} 1 h) or {sup 213}Bi (T{sup 1}/{sub 2} 0.78 h) have been studied. Knowledge of the biokinetic behaviour of such agents is important both for their optimal clinical exploitation and for general radiological protection purposes. Animal studies of the distribution and retention of {sup 211}At compounds, including ionic astatide, substituted aromatic compounds and labelled monoclonal antibodies, have provided new information on the biochemistry of astatine. With respect the thyroid gland the uptake of the astatide ion has been shown to be very much lower than that of the iodide ion. Less information is available for {sup 212}Bi-labelled radiopharmaceuticals. The available data for both {sup 211}At and {sup 212}Bi radiopharmaceuticals are reviewed. Cautious generic biokinetic models for inorganic and simple organic compounds of {sup 211}At and {sup 212}Bi; for [{sup 211}At]-, and [{sup 212}Bi]-biphosphonates and for [{sup 211}At]-, and [{sup 212}Bi]-monoclonal antibodies, are proposed for use in general radiological protection when compound-specific data are not available. (orig.)

  19. Effect of cetuximab in combination with alpha-radioimmunotherapy in cultured squamous cell carcinomas

    International Nuclear Information System (INIS)

    Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 (211At-cMAb U36). Effects on 211At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with 211At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced 211At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.

  20. Tumor immunotargeting using innovative radionuclides.

    Science.gov (United States)

    Kraeber-Bodéré, Françoise; Rousseau, Caroline; Bodet-Milin, Caroline; Mathieu, Cédric; Guérard, François; Frampas, Eric; Carlier, Thomas; Chouin, Nicolas; Haddad, Ferid; Chatal, Jean-François; Faivre-Chauvet, Alain; Chérel, Michel; Barbet, Jacques

    2015-01-01

    This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality. PMID:25679452

  1. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  2. Proceedings of transuranium elements

    International Nuclear Information System (INIS)

    The identification of the first synthetic elements was established by chemical evidence. Conclusive proof of the synthesis of the first artificial element, technetium, was published in 1937 by Perrier and Segre. An essential aspect of their achievement was the prediction of the chemical properties of element 43, which had been missing from the periodic table and which was expected to have properties similar to those of manganese and rhenium. The discovery of other artificial elements, astatine and francium, was facilitated in 1939-1940 by the prediction of their chemical properties. A little more than 50 years ago, in the spring of 1940, Edwin McMillan and Philip Abelson synthesized element 93, neptunium, and confirmed its uniqueness by chemical means. On August 30, 1940, Glenn Seaborg, Arthur Wahl, and the late Joseph Kennedy began their neutron irradiations of uranium nitrate hexahydrate. A few months later they synthesized element 94, later named plutonium, by observing the alpha particles emitted from uranium oxide targets that had been bombarded with deuterons. Shortly thereafter they proved that is was the second transuranium element by establishing its unique oxidation-reduction behavior. The symposium honored the scientists and engineers whose vision and dedication led to the discovery of the transuranium elements and to the understanding of the influence of 5f electrons on their electronic structure and bonding. This volume represents a record of papers presented at the symposium

  3. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  4. Development and radiotherapeutic application of 211At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    International Nuclear Information System (INIS)

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of 131I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, 211At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of 211At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated

  5. Nuclear and chemical data for life sciences

    International Nuclear Information System (INIS)

    Use of reactor produced radionuclides is popular in life sciences. However, cyclotron production of proton rich radionuclides are being more focused in recent times. These radionuclides have already gained attention in various fields, including life sciences, provided they are obtained in pure form. This article is a representative brief of our contributions in generating nuclear data for the production of proton rich radionuclides of terbium, astatine, technetium, ruthenium, cadmium, niobium, zirconium, rhenium, etc., which may have application in clinical, biological, agriculture studies or in basic research. The chemical data required to separate the product isotopes from the corresponding target matrix have been presented along with a few propositions of radiopharmaceuticals. It also emphasizes on the development of simple empirical technique, based on the nuclear reaction model analysis, to generate reliable nuclear data for the estimation of yield and angular distribution of emitted neutrons and light charged particles from light as well as heavy ion induced reactions on thick stopping targets. These data bear utmost important in radiation dosimetry. (author)

  6. Studies of Stable Octupole Deformations in the Radium Region

    CERN Multimedia

    2002-01-01

    The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

  7. Effect of cetuximab in combination with alpha-radioimmunotherapy in cultured squamous cell carcinomas

    Energy Technology Data Exchange (ETDEWEB)

    Nestor, Marika, E-mail: marika.nestor@bms.uu.s [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden); Sundstroem, Magnus [Unit of Molecular Pathology, Department of Genetics and Pathology, Uppsala University (Sweden); Anniko, Matti [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden)

    2011-01-15

    Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ({sup 211}At-cMAb U36). Effects on {sup 211}At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with {sup 211}At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced {sup 211}At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.

  8. Alpha particle emitters in medicine

    International Nuclear Information System (INIS)

    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 (211At) and natural bismuth-212 (212Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 (223Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs

  9. Preparation of 211At-labeled humanized anti-Tac using 211At produced in disposable internal and external bismuth targets

    International Nuclear Information System (INIS)

    These studies describe the production and purification of 211At as well as the procedure for labeling humanized anti-Tac, the antibody to the α-chain of the IL-2 receptor (IL-2Rα), which has been shown to be a useful target for immunotherapy. The optimized protocol combines the advantages of the two-stage dry distillation procedure with the astatination of trialkylstannyl substances as labeling compounds for proteins. The 211At was produced by bombarding either an external or a recently developed disposable internal bismuth target with α-particles from a Cyclotron Corporation CS-30 cyclotron. The 211At was found to contain less than 0.01% 210At. The production rate for the external target was 0.15 mCi ± 0.056 μA-1 h-1 (n = 9) (5.55 MBq μA-1 h-1). The production rate for the internal target was 0.44 ± 0.14 mCi μA-1 h-1 (n = 16) (16.28 MBq μA-1 h-1)

  10. An integrated meta-analysis of two variants in HOXA1/HOXB1 and their effect on the risk of autism spectrum disorders.

    Directory of Open Access Journals (Sweden)

    Ran-Ran Song

    Full Text Available BACKGROUND: HOXA1 and HOXB1 have been strongly posed as candidate genes for autism spectrum disorders (ASD given their important role in the development of hindbrain. The A218G (rs10951154 in HOXA1 and the insertion variant in HOXB1 (nINS/INS, rs72338773 were of special interest for ASD but with inconclusive results. Thus, we conducted a meta-analysis integrating case-control and transmission/disequilibrium test (TDT studies to clearly discern the effect of these two variants in ASD. METHODS AND FINDINGS: Multiple electronic databases were searched to identify studies assessing the A218G and/or nINS/INS variant in ASD. Data from case-control and TDT studies were analyzed in an allelic model using the Catmap software. A total of 10 and 7 reports were found to be eligible for meta-analyses of A218G and nINS/INS variant, respectively. In overall meta-analysis, the pooled OR for the 218G allele and the INS allele was 0.97 (95% CI = 0.76-1.25, P(heterogeneity = 0.029 and 1.14 (95% CI = 0.97-1.33, P(heterogeneity = 0.269, respectively. No significant association was also identified between these two variants and ASD risk in stratified analysis. Further, cumulative meta-analysis in chronologic order showed the inclination toward null-significant association for both variants with continual adding studies. Additionally, although the between-study heterogeneity regarding the A218G is not explained by study design, ethnicity, and sample size, the sensitive analysis indicated the stability of the result. CONCLUSIONS: This meta-analysis suggests the HOXA1 A218G and HOXB1 nINS/INS variants may not contribute significantly to ASD risk.

  11. Carboxylicivirga linearis sp. nov., isolated from a sea cucumber culture pond.

    Science.gov (United States)

    Wang, Feng-Qing; Zhou, Yan-Xia; Lin, Xue-Zheng; Chen, Guan-Jun; Du, Zong-Jun

    2015-10-01

    A yellow-pigmented, Gram-stain-negative and facultatively anaerobic bacterium, designated FB218T, was isolated from a sediment sample collected from a sea cucumber culture pond in Rongcheng, China (36° 54′ 36″ N 122° 14′ 34″ E). Cells of strain FB218T were slender, gliding, catalase-positive and oxidase-negative. Optimal growth occurred at 30 °C, pH 6.5–7.0 and in medium containing 2–3 % (w/v) NaCl. Phylogenetic analysis based on 16S rRNA gene sequences showed that strain FB218T belonged to the genus Carboxylicivirga, family Marinilabiliaceae. The predominant fatty acids were iso-C15 : 0 and anteiso-C15 : 0. MK-7 was the main respiratory quinone. The major polar lipids of strain FB218T were two unidentified lipids and a phospholipid. The genomic DNA G+C content was 40.0 mol%. Based on the distinct phylogenetic position and the combination of physiological and phenotypic characteristics, strain FB218T represents a novel species of the genus Carboxylicivirga, for which the name Carboxylicivirga linearis sp. nov. is proposed. The type strain is FB218T ( = KCTC 42254T = MCCC 1H00106T). An emended description of the genus Carboxylicivirga is also provided. PMID:26297036

  12. Vaccine Protection against Bacillus cereus-Mediated Respiratory Anthrax-Like Disease in Mice

    OpenAIRE

    Oh, So-Young; Maier, Hannah; Schroeder, Jay; Richter, G. Stefan; Elli, Derek; Musser, James M.; Quenee, Lauriane E.; Missiakas, Dominique M.; Schneewind, Olaf

    2013-01-01

    Bacillus cereus strains harboring a pXO1-like virulence plasmid cause respiratory anthrax-like disease in humans, particularly in welders. We developed mouse models for intraperitoneal as well as aerosol challenge with spores of B. cereus G9241, harboring pBCXO1 and pBC218 virulence plasmids. Compared to wild-type B. cereus G9241, spores with a deletion of the pBCXO1-carried protective antigen gene (pagA1) were severely attenuated, whereas spores with a deletion of the pBC218-carried protecti...

  13. Benzodiazepine receptor and neurotransmitter studies in the brain of suicides

    Energy Technology Data Exchange (ETDEWEB)

    Manchon, M.; Kopp, N.; Rouzioux, J.J.; Lecestre, D.; Deluermoz, S.; Miachon, S.

    1987-12-14

    The characteristics of benzodiazepine binding sites were studied on frozen sections of hippocampus of 7 suicides and 5 controls subjects, using biochemical and autoradiographic techniques. /sup 3/H flunitrazepam was used as ligand, clonazepam and CL 218,872 as displacing agents. Some neurotransmitters or their derivatives were evaluated quantitatively in parallel in the hippocampal tissue by liquid chromatography. The authors observed mainly an increase in the Ki of CL 218,872 subtype I binding sites in suicides, and an increase in % of type I binding sites. Among neurotransmitters, only norepinephrine differed significantly between controls and suicides. 36 references, 3 figures, 1 table.

  14. Benzodiazepine receptor and neurotransmitter studies in the brain of suicides

    International Nuclear Information System (INIS)

    The characteristics of benzodiazepine binding sites were studied on frozen sections of hippocampus of 7 suicides and 5 controls subjects, using biochemical and autoradiographic techniques. 3H flunitrazepam was used as ligand, clonazepam and CL 218,872 as displacing agents. Some neurotransmitters or their derivatives were evaluated quantitatively in parallel in the hippocampal tissue by liquid chromatography. The authors observed mainly an increase in the Ki of CL 218,872 subtype I binding sites in suicides, and an increase in % of type I binding sites. Among neurotransmitters, only norepinephrine differed significantly between controls and suicides. 36 references, 3 figures, 1 table

  15. Preliminary assessment of errors of radon daughters concentration in air

    International Nuclear Information System (INIS)

    Employing an earlier elaborated computer program for simulation of depositing radon decay products: 214Po, 214Pb, 214Bi (214Po) on air filter and for computing variation of their activity against time, an assessment of errors was carried out of a methods employing measurement of 218Po + 214Po alpha activity in three time intervals. Additionally errors of the methods measuring 218Po + 214Po alpha activity in three, two and one time intervals, were assessed. A few attempts were also made to measure the alpha activity in different time intervals and to assess their measuring errors. (authors). 10 refs, 4 figs, 14 tabs

  16. Synaptic Gain-of-Function Effects of Mutant Cav2.1 Channels in a Mouse Model of Familial Hemiplegic Migraine Are Due to Increased Basal [Ca2+]i

    OpenAIRE

    Di Guilmi, Mariano N.; Wang, Tiantian; Inchauspe, Carlota Gonzalez; Forsythe, Ian D; Ferrari, Michel D; van den Maagdenberg, Arn M. J. M.; Borst, J. Gerard G.; Uchitel, Osvaldo D.

    2014-01-01

    Specific missense mutations in the CACNA1A gene, which encodes a subunit of voltage-gated CaV2.1 channels, are associated with familial hemiplegic migraine type 1 (FHM1), a rare monogenic subtype of common migraine with aura. We used transgenic knock-in (KI) mice harboring the human pathogenic FHM1 mutation S218L to study presynaptic Ca2+ currents, EPSCs, and in vivo activity at the calyx of Held synapse. Whole-cell patch-clamp recordings of presynaptic terminals from S218L KI mice showed a s...

  17. Solid waste retrieval. Phase 1, Operational basis

    International Nuclear Information System (INIS)

    This Document describes the operational requirements, procedures, and options for execution of the retrieval of the waste containers placed in buried storage in Burial Ground 218W-4C, Trench 04 as TRU waste or suspect TRU waste under the activity levels defining this waste in effect at the time of placement. Trench 04 in Burial Ground 218W-4C is totally dedicated to storage of retrievable TRU waste containers or retrievable suspect TRU waste containers and has not been used for any other purpose

  18. AcEST: DK952516 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0014_E21 641 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0014_E21. 5' end seq ... somal OS=Emericella ... 224 3e-58 sp|P77947|MASY_STRAE ... Malate synthase OS=Streptomyces arenae GN=a... 218 ... HAN 217 Query: 369 FRTTHG-GAGPFFYLPKMQHSREAAVWNSVFDRAE RALGVPHGSIKATVLIETLPAVFQM 545 FR + G G+GPFFYLPKM+HS ... REA +WNSVF+RAE + G+ GSI+ATVLIETLPAVFQM Sbjct: 218 FRRSQGQGSGPFFYLP ... KMEHSREAKIWNSVFERAE KMAGIERGSIRATVLIETLPAVFQM 277 Query: 546 NEILYELRSH ...

  19. Gclust Server: 96142 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 96142 Glv_gvip218=narB Cluster Sequences Related Sequences(208) 692 nitrate reducta...se 1 1.00e-35 0.0 0.0 4.0 0.0 0.0 0.0 Show 96142 Cluster ID 96142 Sequence ID Glv_gvip218=narB Link to cluster sequences Clus...tative annotation nitrate reductase Number of Sequences 1 Homologs 1 Clustering t...r of Sequences for each species Glv: 1 Species not appearing in this cluster ATH: 0 OSA: 0 PoTR: 0 PPT: 0 CR

  20. Conductometric study of reaction kinetics between potassium superoxide and 18-crown-6 in dimethylsulfoxide

    International Nuclear Information System (INIS)

    Complexing within KO2-18-crown-6-solvent, KOH-18-crown-6-solvent and KI-KO2-18-crown-6-solvent systems in dimethylsulfoxide was studied by measurement of electrical conductivity. It was shown that time variation of electrical conductivity under the given conditions was described by the Erofeev-Auramy equation, the coefficients of that equation for various systems were determined, time to reach equilibrium state was estimated. Linear dependences of electrical conductivity of KI-KO2 salt solutions at presence of 18-crown-6 at the state of equilibrium in contrast to the component concentrations were determined