WorldWideScience

Sample records for astatine 218

  1. Radiochemistry of astatine

    Energy Technology Data Exchange (ETDEWEB)

    Ruth, T J; Dombsky, M; D' Auria, J M; Ward, T E

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs. (DLC)

  2. Discovery of the astatine, radon, francium, and radium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-09-15

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  3. Discovery of the astatine, radon, francium, and radium isotopes

    CERN Document Server

    Fry, C

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Discovery of the astatine, radon, francium, and radium isotopes

    Science.gov (United States)

    Fry, C.; Thoennessen, M.

    2013-09-01

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  5. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Energy Technology Data Exchange (ETDEWEB)

    Uusitalo, J.; Jakobsson, U. [Department of Physics, University of Jyvaeskylae (Finland); Collaboration: RITU-Gamma Gollaboration

    2011-11-30

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  6. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Science.gov (United States)

    Uusitalo, J.; Jakobsson, U.

    2011-11-01

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  7. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  8. Measurement of the first ionization potential of astatine by laser ionization spectroscopy.

    Science.gov (United States)

    Rothe, S; Andreyev, A N; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yuri; Köster, U; Lane, J F W; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt, K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine.

  9. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Jakobsson, U., E-mail: ulrjak@kth.se; Cederwall, B. [KTH, The Division of Nuclear Physics, AlbaNova University Center, SE-10691 Stockholm (Sweden); Uusitalo, J.; Auranen, K.; Badran, H.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; Herzáň, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J. [University of Jyvaskyla, Department of Physics, P.O. Box 35, FI-40014 University of Jyvaskyla (Finland); and others

    2015-10-15

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2{sup +} state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2{sup +} state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2{sup +} state and the spherical 9/2{sup −} ground state in {sup 203}Fr and {sup 205}Fr.

  10. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Science.gov (United States)

    Jakobsson, U.; Uusitalo, J.; Auranen, K.; Badran, H.; Cederwall, B.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; HerzáÅ, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J.; Scholey, C.; Sorri, J.; Stolze, S.

    2015-10-01

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2+ state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2+ state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2+ state and the spherical 9/2- ground state in 203Fr and 205Fr.

  11. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...

  12. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    NARCIS (Netherlands)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Koester, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjoedin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical

  13. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  14. 49 CFR 571.218 - Standard No. 218; Motorcycle helmets.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 6 2010-10-01 2010-10-01 false Standard No. 218; Motorcycle helmets. 571.218 Section 571.218 Transportation Other Regulations Relating to Transportation (Continued) NATIONAL HIGHWAY... Motor Vehicle Safety Standards § 571.218 Standard No. 218; Motorcycle helmets. S1. Scope. This standard...

  15. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even sing...... of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies....

  16. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  17. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  18. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  19. Adsorption of the astatine species on a gold surface: A relativistic density functional theory study

    Science.gov (United States)

    Demidov, Yuriy; Zaitsevskii, Andréi

    2018-01-01

    We report first-principle based studies of the adsorption interaction of astatine species on a gold surface. These studies are aimed primarily at the support and interpretation of gas chromatographic experiments with superheavy elements, tennessine (Ts, Z = 117), a heavier homologue of At, and possibly its pseudo-homologue nihonium (Nh, Z = 113). We use gold clusters with up to 69 atoms to simulate the adsorption sites and estimate the desorption energies of At & AtOH from a stable gold (1 1 1) surface. To describe the electronic structure of At -Aun and AtOH -Aun complexes, we combine accurate shape-consistent relativistic pseudopotentials and non-collinear two-component relativistic density functional theory. The predicted desorption energies of At and AtOH on gold are 130 ± 10 kJ/mol and 90 ± 10 kJ/mol, respectively. These results confirm the validity of the estimates derived from chromatographic data (147 ± 15 kJ/mol for At, and 100-10+20 kJ/mol for AtOH).

  20. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  1. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  2. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  3. 10 CFR 218.32 - Review.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Review. 218.32 Section 218.32 Energy DEPARTMENT OF ENERGY OIL STANDBY MANDATORY INTERNATIONAL OIL ALLOCATION Procedures § 218.32 Review. (a) Purpose and scope. This subpart establishes the procedures for the filing of an application for review of a supply order...

  4. 20 CFR 218.27 - Vacation pay.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Vacation pay. 218.27 Section 218.27 Employees... Beginning Date § 218.27 Vacation pay. (a) From railroad employer. Vacation pay may be credited to the... vacation pay is credited to the vacation period, the annuity can begin no earlier than the day after the...

  5. 20 CFR 218.28 - Sick pay.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Sick pay. 218.28 Section 218.28 Employees... Beginning Date § 218.28 Sick pay. (a) From railroad employer. If the employee is carried on the payroll while sick, the annuity can begin no earlier than the day after the last day of sick pay. However, sick...

  6. 42 CFR 438.218 - Enrollee information.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Enrollee information. 438.218 Section 438.218 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES... and Operation Standards § 438.218 Enrollee information. The requirements that States must meet under...

  7. 7 CFR 58.218 - Surge tanks.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Surge tanks. 58.218 Section 58.218 Agriculture....218 Surge tanks. If surge tanks are used for hot milk, and temperatures of product including foam being held in the surge tank during processing, is not maintained at a minimum of 150 °F, then two or...

  8. 10 CFR 218.11 - Supply orders.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Supply orders. 218.11 Section 218.11 Energy DEPARTMENT OF ENERGY OIL STANDBY MANDATORY INTERNATIONAL OIL ALLOCATION Supply Orders § 218.11 Supply orders. (a) A supply order shall require that the firm to which it is issued take actions specified therein relating to...

  9. 10 CFR 218.12 - Pricing.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Pricing. 218.12 Section 218.12 Energy DEPARTMENT OF ENERGY OIL STANDBY MANDATORY INTERNATIONAL OIL ALLOCATION Supply Orders § 218.12 Pricing. The price for oil subject to a supply order issued pursuant to this subpart shall be based on the price conditions...

  10. Dicty_cDB: SFD218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFD218 (Link to dictyBase) - - - Contig-U15060-1 SFD218Z (Link... to Original site) - - SFD218Z 617 - - - - Show SFD218 Library SF (Link to library) Clone ID SFD218 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SF/SFD2-A/SFD218Q.Seq.d/ Representative seq. ID SFD21...8Z (Link to Original site) Representative DNA sequence >SFD218 (SFD218Q) /CSM/SF/SFD2-A/SFD218Q.Seq.d/ XXXXX...ACAAGAGGTT GGANCAACGTTTATCGTTCTCTCAAAG sequence update 2001. 6. 1 Translated Amino Acid sequence ---KGAVSEFTSAMVKKYLHYIRSF

  11. Dicty_cDB: SFJ218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFJ218 (Link to dictyBase) - - - Contig-U13936-1 SFJ218P (Link to Original site) SF...J218F 526 SFJ218Z 602 SFJ218P 1128 - - Show SFJ218 Library SF (Link to library) Clone ID SF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SF/SFJ2-A/SFJ218Q.Seq.d/ Representative seq. ID SF...J218P (Link to Original site) Representative DNA sequence >SFJ218 (SFJ218Q) /CSM/SF/SFJ2-A/SFJ...--- ---KLKDAVRESHQPLVSITLGIDARLR*dwccnprgygiprnrtqw*nlpnsfhs*few sfnssirhsww*nrtn

  12. Dicty_cDB: SFH218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFH218 (Link to dictyBase) - - - Contig-U12905-1 SFH218P (Link to Original site) SF...H218F 611 SFH218Z 763 SFH218P 1374 - - Show SFH218 Library SF (Link to library) Clone ID SF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SF/SFH2-A/SFH218Q.Seq.d/ Representative seq. ID SF...H218P (Link to Original site) Representative DNA sequence >SFH218 (SFH218Q) /CSM/SF/SFH2-A/SFH...llllllflif*NQQFLKTIRNMTTFRSEFDTFGEVKVNDEKYWGAQTQRSLEN FDIGGESEKMPLMVVRSFGILKRCAAIVNKKYGLDATIADNIAKAATEVVEGKL

  13. 31 CFR 800.218 - Lead agency.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Lead agency. 800.218 Section 800.218 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF INVESTMENT SECURITY, DEPARTMENT OF THE TREASURY REGULATIONS PERTAINING TO MERGERS, ACQUISITIONS, AND TAKEOVERS BY...

  14. 50 CFR 218.4 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Mitigation. 218.4 Section 218.4 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION... records documenting training operations should they be required for event reconstruction purposes. Logs...

  15. 50 CFR 218.183 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Mitigation. 218.183 Section 218.183 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION... should they be required for event reconstruction purposes. Logs and records will be kept for a period of...

  16. 50 CFR 218.13 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Mitigation. 218.13 Section 218.13 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION... records documenting training operations should they be required for event reconstruction purposes. Logs...

  17. 31 CFR 31.218 - Enforcement.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Enforcement. 31.218 Section 31.218 Money and Finance: Treasury Office of the Secretary of the Treasury TROUBLED ASSET RELIEF PROGRAM... employees. In such cases, the Department of Justice may make direct and derivative use of any statements and...

  18. 49 CFR 218.23 - Blue signal display.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Blue signal display. 218.23 Section 218.23... signal display. (a) Blue signals displayed in accordance with § 218.25, 218.27, or 218.29 signify that workers are on, under, or between rolling equipment. When so displayed— (1) The equipment may not be...

  19. Dicty_cDB: CFC218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC218 (Link to dictyBase) - - - Contig-U14180-1 CFC218E (Link to Original site) CFC...218F 524 CFC218Z 783 CFC218P 1307 CFC218E 1195 Show CFC218 Library CF (Link to library) Clone ID CFC...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFC2-A/CFC218Q.Seq.d/ Representative seq. ID CFC...218E (Link to Original site) Representative DNA sequence >CFC218 (CFC218Q) /CSM/CF/CFC2-A/CFC...*kry* as*rv**ssty*kw*yk*sicfcpswwfvq*iw*pw*lw*s*q*w*c*sig*swrnh*ws crs*ng*ssf***f*ses***tllvkmsnlffgnsp*ryyp

  20. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  1. 32 CFR 218.1 - Policies.

    Science.gov (United States)

    2010-07-01

    ... film badge. Of the estimated 220,000 Department of Defense participants in atmospheric nuclear weapons... THE DETERMINATION AND REPORTING OF NUCLEAR RADIATION DOSE FOR DOD PARTICIPANTS IN THE ATMOSPHERIC NUCLEAR TEST PROGRAM (1945-1962) § 218.1 Policies. (a) Upon request by the Veterans Administration in...

  2. 7 CFR 2.18 - Under Secretary for Food Safety.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Under Secretary for Food Safety. 2.18 Section 2.18... Secretaries and Assistant Secretaries § 2.18 Under Secretary for Food Safety. (a) The following delegations of authority are made by the Secretary of Agriculture to the Under Secretary for Food Safety: (1) Related to...

  3. 40 CFR 21.8 - Resubmission of application.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Resubmission of application. 21.8 Section 21.8 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL SMALL BUSINESS § 21.8 Resubmission of application. (a) A small business concern whose application is disapproved may submit an...

  4. 14 CFR 21.8 - Approval of articles.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Approval of articles. 21.8 Section 21.8 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT CERTIFICATION PROCEDURES FOR PRODUCTS AND PARTS General § 21.8 Approval of articles. If an article is required to be...

  5. 5 CFR 179.218 - Additional administrative collection action.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Additional administrative collection action. 179.218 Section 179.218 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS Salary Offset § 179.218 Additional administrative collection action...

  6. 49 CFR 218.73 - Warning signal display.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Warning signal display. 218.73 Section 218.73... signal display. (a) Warning signals, i.e., a white disk with the words “Occupied Camp Car” in black lettering during daylight hours and an illuminated white signal at night, displayed in accordance with § 218...

  7. 28 CFR 2.18 - Granting of parole.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Granting of parole. 2.18 Section 2.18 Judicial Administration DEPARTMENT OF JUSTICE PAROLE, RELEASE, SUPERVISION AND RECOMMITMENT OF PRISONERS, YOUTH OFFENDERS, AND JUVENILE DELINQUENTS United States Code Prisoners and Parolees § 2.18 Granting of parole. The granting of parole to an...

  8. 40 CFR 86.218-94 - Dynamometer calibration.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Dynamometer calibration. 86.218-94 Section 86.218-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... 1994 and Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium...

  9. 24 CFR 200.218 - Who must certify and sign.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Who must certify and sign. 200.218... Previous Participation Review and Clearance Procedure § 200.218 Who must certify and sign. All principals must certify and sign the certificate personally as to their individual record and are responsible for...

  10. 32 CFR 218.3 - Dose reconstruction methodology.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Dose reconstruction methodology. 218.3 Section... ATMOSPHERIC NUCLEAR TEST PROGRAM (1945-1962) § 218.3 Dose reconstruction methodology. (a) Concept. The specific methodology consists of the characterization of the radiation environments to which participants...

  11. 49 CFR 218.97 - Good faith challenge procedures.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Good faith challenge procedures. 218.97 Section... Derails § 218.97 Good faith challenge procedures. (a) Employee responsibility. An employee shall inform the railroad or employer whenever the employee makes a good faith determination that the employee has...

  12. 36 CFR 218.9 - Objections set aside from review.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Objections set aside from review. 218.9 Section 218.9 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE PREDECISIONAL ADMINISTRATIVE REVIEW PROCESSES Predecisional Administrative Review Process for Hazardous Fuel...

  13. 36 CFR 218.16 - Applicability and effective date.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Applicability and effective date. 218.16 Section 218.16 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE PREDECISIONAL ADMINISTRATIVE REVIEW PROCESSES Predecisional Administrative Review Process for...

  14. 36 CFR 218.7 - Who may file an objection.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Who may file an objection. 218.7 Section 218.7 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE PREDECISIONAL ADMINISTRATIVE REVIEW PROCESSES Predecisional Administrative Review Process for Hazardous Fuel...

  15. 36 CFR 218.10 - Objection time periods and process.

    Science.gov (United States)

    2010-07-01

    ... process. 218.10 Section 218.10 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE PREDECISIONAL ADMINISTRATIVE REVIEW PROCESSES Predecisional Administrative Review Process for... Objection time periods and process. (a) Time to file an objection. Written objections, including any...

  16. 36 CFR 218.15 - Information collection requirements.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Information collection requirements. 218.15 Section 218.15 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE PREDECISIONAL ADMINISTRATIVE REVIEW PROCESSES Predecisional Administrative Review Process for...

  17. 36 CFR 218.11 - Resolution of objections.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Resolution of objections. 218.11 Section 218.11 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE PREDECISIONAL ADMINISTRATIVE REVIEW PROCESSES Predecisional Administrative Review Process for Hazardous Fuel...

  18. 20 CFR 218.30 - Separation, displacement or dismissal allowance.

    Science.gov (United States)

    2010-04-01

    ... allowance, the employee gives up his or her job rights. Regardless of whether a separation allowance is paid... allowance. 218.30 Section 218.30 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE... allowance. (a) General. When an employee receives a separation, displacement or dismissal allowance from a...

  19. An automated flow system incorporating in-line acid dissolution of bismuth metal from a cyclotron irradiated target assembly for use in the isolation of astatine-211

    Energy Technology Data Exchange (ETDEWEB)

    O’Hara, Matthew J.; Krzysko, Anthony J.; Niver, Cynthia M.; Morrison, Samuel S.; Owsley, Stanley L.; Hamlin, Donald K.; Dorman, Eric F.; Scott Wilbur, D.

    2017-04-01

    Astatine-211 (211At) is a promising cyclotron-produced radionuclide being investigated for use in targeted alpha therapy of blood borne and metastatic cancers, as well as treatment of tumor remnants after surgical resections. The isolation of trace quantities of 211At, produced within several grams of a Bi metal cyclotron target, involves a complex, multi-step procedure: (1) Bi metal dissolution in strong HNO3, (2) distillation of the HNO3 to yield Bi salts containing 211At, (3) dissolution of the salts in strong HCl, (4) solvent extraction of 211At from bismuth salts with diisopropyl ether (DIPE), and (5) back-extraction of 211At from DIPE into NaOH, leading to a purified 211At product. Step (1) has been addressed first to begin the process of automating the onerous 211At isolation process. A computer-controlled Bi target dissolution system has been designed. The system performs in-line dissolution of Bi metal from the target assembly using an enclosed target dissolution block, routing the resulting solubilized 211At/Bi mixture to the subsequent process step. The primary parameters involved in Bi metal solubilization (HNO3 concentration and influent flow rate) were optimized prior to evaluation of the system performance on replicate cyclotron irradiated targets. The results indicate that the system performs reproducibly, having nearly quantitative release of 211At from irradiated targets, with cumulative 211At recoveries that follow a sigmoidal function. The predictable nature of the 211At release profile allows the user to tune the system to meet target processing requirements.

  20. Reagents for astatination of biomolecules. 2. Conjugation of anionic boron cage pendant groups to a protein provides a method for direct labeling that is stable to in vivo deastatination.

    Science.gov (United States)

    Wilbur, D Scott; Chyan, Ming-Kuan; Hamlin, Donald K; Vessella, Robert L; Wedge, Timothy J; Hawthorne, M Frederick

    2007-01-01

    Cancer-targeting biomolecules labeled with 211At must be stable to in vivo deastatination, as control of the 211At distribution is critical due to the highly toxic nature of alpha-particle emission. Unfortunately, no astatinated aryl conjugates have shown in vivo stability toward deastatination when (relatively) rapidly metabolized proteins, such as monoclonal antibody Fab' fragments, are labeled. As a means of increasing the in vivo stability of 211At-labeled proteins, we have been investigating antibody conjugates of boron cage moieties. In this investigation, protein-reactive derivatives containing a nido-carborane (2), a bis-nido-carborane derivative (Venus Flytrap Complex, 3), and four 2-nonahydro-closo-decaborate(2-) derivatives (4-7) were prepared and conjugated with an antibody Fab' fragment such that subsequent astatination and in vivo tissue distributions could be obtained. To aid in determination of stability toward in vivo deastatination, the Fab'-borane conjugates were also labeled with 125I, and that material was coinjected with the 211At-labeled Fab'. For comparison, direct labeling of the Fab' with 125I and 211At was conducted. Direct labeling with Na[125I]I and Chloramine-T gave an 89% radiochemical yield. However, direct labeling of the Fab' with Na[211At]At and Chloramine-T resulted in a yield of Studies to optimize the closo-decaborate(2-) conjugates for protein labeling are underway.

  1. 49 CFR 173.218 - Fish meal or fish scrap.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Fish meal or fish scrap. 173.218 Section 173.218... Fish meal or fish scrap. (a) Except as provided in Column (7) of the HMT in § 172.101 of this subchapter, fish meal or fish scrap, containing at least 6%, but not more than 12% water, is authorized for...

  2. 49 CFR 218.109 - Hand-operated fixed derails.

    Science.gov (United States)

    2010-10-01

    ... for an adequate job briefing. (b) General. (1) The normal position of fixed derails is in the derailing position except as provided in part 218, subpart B of this chapter, or the railroad's operating rules or special instructions. (2) Fixed derails shall be kept in the derailing position whether or not...

  3. 40 CFR 94.218 - Deterioration factor determination.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) CONTROL OF EMISSIONS FROM MARINE COMPRESSION-IGNITION ENGINES Certification Provisions § 94.218... family. (b) Calculation procedures—(1) For engines not utilizing aftertreatment technology (e.g., catalyst). For each applicable emission constituent, an additive deterioration factor shall be used; that...

  4. 18 CFR 157.218 - Changes in customer name.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Changes in customer... Act for Certain Transactions and Abandonment § 157.218 Changes in customer name. (a) Automatic... reflect the change in the name of an existing customer, if the certificate holder has filed any necessary...

  5. 20 CFR 725.218 - Conditions of entitlement; child.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Conditions of entitlement; child. 725.218... Conditions of entitlement; child. (a) An individual is entitled to benefits where he or she meets the... the child of a deceased miner who: (1) Was receiving benefits under section 415 or part C of title IV...

  6. 50 CFR 218.105 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... Complex (MIRC) § 218.105 Requirements for monitoring and reporting. (a) General Notification of Injured or....nmfs.noaa.gov/pr/permits/incidental.htm#applications) (d) Report on Monitoring required in paragraph (c...) Location; (D) Number and types of active sources used in the exercise; (E) Number and types of passive...

  7. 40 CFR 761.218 - Certificate of disposal.

    Science.gov (United States)

    2010-07-01

    ... PROHIBITIONS PCB Waste Disposal Records and Reports § 761.218 Certificate of disposal. (a) For each shipment of... Disposal among the records that it retains under § 761.180(b). (d)(1) Generators of PCB waste shall keep a copy of each Certificate of Disposal that they receive from disposers of PCB waste among the records...

  8. 36 CFR 223.218 - Consistency with plans, environmental standards, and other management requirements.

    Science.gov (United States)

    2010-07-01

    ..., environmental standards, and other management requirements. 223.218 Section 223.218 Parks, Forests, and Public... Special Forest Products § 223.218 Consistency with plans, environmental standards, and other management... with applicable land management plans. Each contract, permit, or other authorizing instrument shall...

  9. 22 CFR 218.37 - Hearings, decisions, post-termination proceedings.

    Science.gov (United States)

    2010-04-01

    ... proceedings. 218.37 Section 218.37 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NONDISCRIMINATION ON..., Conciliation, and Enforcement Procedures § 218.37 Hearings, decisions, post-termination proceedings. Certain procedural provisions applicable to title VI of the Civil Rights Act of 1964 apply to enforcement of this...

  10. 12 CFR 218.741 - Exemption for banks effecting transactions in money market funds.

    Science.gov (United States)

    2010-01-01

    ... money market funds. 218.741 Section 218.741 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS... EXCHANGE ACT OF 1934 (REGULATION R) § 218.741 Exemption for banks effecting transactions in money market... issued by a money market fund, provided that: (1) The bank either (i) Provides the customer, directly or...

  11. MicroRNA-218 inhibits cell invasion and migration of pancreatic cancer via regulating ROBO1

    OpenAIRE

    He, Hang; Hao, Si-jie; Yao, Lie; Yang, Feng; Di, Yang; Li, Ji; Jiang, Yong-Jian; Jin, Chen; Fu, De-Liang

    2014-01-01

    miRNA-218 is a highlighted tumor suppressor and its underlying role in tumor progression is still unknown. Here, we restored the expression of miRNA-218 in pancreatic cancer to clarify the function and potent downstream pathway of miRNA-218. The expressions of both miRNA-218 and its potent target gene ROBO1 were revealed by RT-PCR and western blotting analysis. Transfection of miRNA-218 precursor mimics and luciferase assay were performed to elucidate the regulation mechanism between miRNA-21...

  12. Epigenetic Repression of miR-218 Promotes Esophageal Carcinogenesis by Targeting ROBO1

    Directory of Open Access Journals (Sweden)

    Miao Yang

    2015-11-01

    Full Text Available miR-218, consisting of miR-218-1 at 4p15.31 and miR-218-2 at 5q35.1, was significantly decreased in esophageal squamous cell carcinoma (ESCC in our previous study. The aim of this study was to determine whether aberrant methylation is associated with miR-218 repression. Bisulfite sequencing analysis (BSP, methylation specific PCR (MSP, and 5-aza-2′-deoxycytidine treatment assay were applied to determine the methyaltion status of miR-218 in cells and clinical samples. In vitro assays were performed to explore the role of miR-218. Results showed that miR-218-1 was significantly CpG hypermethylated in tumor tissues (81%, 34/42 compared with paired non-tumor tissues (33%, 14/42 (p < 0.05. However, no statistical difference was found in miR-218-2. Accordingly, expression of miR-218 was negatively correlated with miR-218-1 methylation status (p < 0.05. After demethylation treatment by 5-aza-2′-deoxycytidine, there was a 2.53- and 2.40-fold increase of miR-218 expression in EC109 and EC9706, respectively. miR-218 suppressed cell proliferation and arrested cells at G1 phase by targeting 3′ untranslated region (3′UTR of roundabout guidance receptor 1 (ROBO1. A negative correlation was found between miR-218 and ROBO1 mRNA expression in clinical samples. In conclusion, our results support that aberrant CpG hypermethylation at least partly accounts for miR-218 silencing in ESCC, which impairs its tumor-suppressive function.

  13. miR-218 inhibited tumor angiogenesis by targeting ROBO1 in gastric cancer.

    Science.gov (United States)

    Zhang, Xiangyuan; Dong, Jiaqiang; He, Yan; Zhao, Ming; Liu, Zhen; Wang, Na; Jiang, Mingzuo; Zhang, Zhe; Liu, Gang; Liu, Haiming; Nie, Yongzhan; Fan, Daiming; Tie, Jun

    2017-06-05

    Aberrant expression of miRNAs is involved in several carcinogenic processes, including tumor growth, metastasis and angiogenesis. The aim of this study was to determine the role of miR-218 in gastric cancer angiogenesis. In situ hybridization was performed on a set of tissue microarray samples to assess the difference in miR-218 expression in vessels between tumor tissues and normal gastric mucosa. In vitro, ectopic expression of miR-218 disturbed the tubular structure and inhibited the migration of endothelial cells. Motility and tube formation were rescued when miR-218 was downregulated. Moreover, miR-218 suppressed endothelial cell sprouting in a fibrin bead sprouting assay. Subsequently, we identified ROBO1 as a target of miR-218 in endothelial cells and determined it was responsible for the effect of miR-218 on tumor angiogenesis. In vivo, local injection of mature miR-218 in xenografted tumors disrupted the vessel plexus and thus inhibited tumor growth. Taken together, our study demonstrated an anti-angiogenic role of miR-218 in gastric cancer and indicated that delivery of miR-218 may be a potential therapeutic strategy to inhibit tumor angiogenesis. Copyright © 2017 Elsevier B.V. All rights reserved.

  14. MicroRNA-218 inhibits cell invasion and migration of pancreatic cancer via regulating ROBO1.

    Science.gov (United States)

    He, Hang; Hao, Si-Jie; Yao, Lie; Yang, Feng; Di, Yang; Li, Ji; Jiang, Yong-Jian; Jin, Chen; Fu, De-Liang

    2014-10-01

    miRNA-218 is a highlighted tumor suppressor and its underlying role in tumor progression is still unknown. Here, we restored the expression of miRNA-218 in pancreatic cancer to clarify the function and potent downstream pathway of miRNA-218. The expressions of both miRNA-218 and its potent target gene ROBO1 were revealed by RT-PCR and western blotting analysis. Transfection of miRNA-218 precursor mimics and luciferase assay were performed to elucidate the regulation mechanism between miRNA-218 and ROBO1. Cells, stably expressing miRNA-218 followed by forced expression of mutant ROBO1, were established through co-transfections of both lentivirus vector and plasmid vector. The cell migration and invasion abilities were evaluated by migration assay and invasion assay respectively. An increased expression of ROBO1 was revealed in cell BxPC-3-LN compared with cell BxPC-3. Elevated expression of miRNA-218 would suppress the expression of ROBO1 via complementary binding to a specific region within 3'UTR of ROBO1 mRNA (sites 971-978) in pancreatic cancer cells. Stably restoring the expression of miRNA-218 in pancreatic cancer significantly downregulated the expression of ROBO1 and effectively inhibited cell migration and invasion. Forced expression of mutant ROBO1 could reverse the repression effects of miRNA-218 on cell migration and invasion. Consequently, miRNA-218 acted as a tumor suppressor in pancreatic cancer by inhibiting cell invasion and migration. ROBO1 was a functional target of miRNA-218's downstream pathway involving in cell invasion and migration of pancreatic cancer.

  15. Epigenetic Repression of miR-218 Promotes Esophageal Carcinogenesis by Targeting ROBO1.

    Science.gov (United States)

    Yang, Miao; Liu, Ran; Li, Xiajun; Liao, Juan; Pu, Yuepu; Pan, Enchun; Wang, Yi; Yin, Lihong

    2015-11-20

    miR-218, consisting of miR-218-1 at 4p15.31 and miR-218-2 at 5q35.1, was significantly decreased in esophageal squamous cell carcinoma (ESCC) in our previous study. The aim of this study was to determine whether aberrant methylation is associated with miR-218 repression. Bisulfite sequencing analysis (BSP), methylation specific PCR (MSP), and 5-aza-2'-deoxycytidine treatment assay were applied to determine the methyaltion status of miR-218 in cells and clinical samples. In vitro assays were performed to explore the role of miR-218. Results showed that miR-218-1 was significantly CpG hypermethylated in tumor tissues (81%, 34/42) compared with paired non-tumor tissues (33%, 14/42) (p ROBO1). A negative correlation was found between miR-218 and ROBO1 mRNA expression in clinical samples. In conclusion, our results support that aberrant CpG hypermethylation at least partly accounts for miR-218 silencing in ESCC, which impairs its tumor-suppressive function.

  16. KDG218, a nearby ultra-diffuse galaxy

    Science.gov (United States)

    Karachentsev, I. D.; Makarova, L. N.; Sharina, M. E.; Karachentseva, V. E.

    2017-10-01

    We present properties of the low-surface-brightness galaxy KDG218 observed with the HST/ACS. The galaxy has a half-light (effective) diameter of a e = 47″ and a central surface brightness of SB V (0) = 24.m4/□″. The galaxy remains unresolved with the HST/ACS, which implies its distance of D > 13.1 Mpc and linear effective diameter of A e > 3.0 kpc. We notice that KDG218 is most likely associated with a galaxy group around the massive lenticular NGC4958 galaxy at approximately 22 Mpc, or with the Virgo Southern Extension filament at approximately 16.5 Mpc. At these distances, the galaxy is classified as an ultra-diffuse galaxy (UDG) similar to those found in the Virgo, Fornax, and Coma clusters. We also present a sample of 15 UDG candidates in the Local Volume. These sample galaxies have the following mean parameters: 〈 D〉 = 5.1 Mpc, 〈 A e 〉 = 4.8 kpc, and 〈 SB B ( e)〉 = 27.m4/□″. All the local UDG candidates reside near massive galaxies located in the regions with the mean stellar mass density (within 1 Mpc) about 50 times greater than the average cosmic density. The local fraction of UDGs does not exceed 1.5% of the Local Volume population. We notice that the presented sample of local UDGs is a heterogeneous one containing irregular, transition, and tidal types, as well as objects consisting of an old stellar population.

  17. 14 CFR 417.218 - Hold-and-resume gate analysis.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Hold-and-resume gate analysis. 417.218 Section 417.218 Aeronautics and Space COMMERCIAL SPACE TRANSPORTATION, FEDERAL AVIATION ADMINISTRATION... hazardous debris or overpressure to endanger the populated or otherwise protected area. (2) Overflight of an...

  18. 24 CFR 884.218 - Reexamination of family income and composition.

    Science.gov (United States)

    2010-04-01

    ... composition. 884.218 Section 884.218 Housing and Urban Development Regulations Relating to Housing and Urban... Reexamination of family income and composition. (a) Regular reexaminations. The owner must reexamine the income and composition of all families at least once each year. Upon verification of the information, the...

  19. 20 CFR 218.6 - How to choose an annuity beginning date.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false How to choose an annuity beginning date. 218... RETIREMENT ACT ANNUITY BEGINNING AND ENDING DATES When an Annuity Begins § 218.6 How to choose an annuity beginning date. (a) When application is filed. The applicant may choose an annuity beginning date by— (1...

  20. 48 CFR 218.203 - Incidents of national significance, emergency declaration, or major disaster declaration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Incidents of national significance, emergency declaration, or major disaster declaration. 218.203 Section 218.203 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES EMERGENCY ACQUISITION...

  1. 22 CFR 218.01 - What is the purpose of the age discrimination regulations?

    Science.gov (United States)

    2010-04-01

    ... out the policies and procedures for the three foreign affairs agencies (State, USICA and AID) under... 22 Foreign Relations 1 2010-04-01 2010-04-01 false What is the purpose of the age discrimination regulations? 218.01 Section 218.01 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NONDISCRIMINATION ON...

  2. MiR-218 inhibits the tumorgenesis and proliferation of glioma cells by targeting Robo1.

    Science.gov (United States)

    Gu, Jian-Jun; Gao, Guang-Zhong; Zhang, Shi-Ming

    2016-01-01

    Malignant glioma is the most common primary brain tumors directly correlated with the high mortality and poor prognosis in clinical practice. MicroRNAs (miRNAs or miRs) influence numerous cancer-relevant processes including cell proliferation, differentiation and metabolism. However, the role of microRNA in malignant glioma is largely unknown. This study aimed to study the role of miR-218, a tumor-suppressive microRNA, in glioma development both in vivo and in vitro. The expression level of miR-218, Slit2 and Robo1 was examined by either quantitative (polymerase chain reaction) or western-blotting from both human glioma tissue and glioma cell lines. U87 cells were transfected with miR-218 and then the expression levels of Slit2 and Robo1 were quantified. Cell proliferation was measured both by the in vitro proliferation assay and in vivo graft studies. The luciferase reporter assay was employed to validate the downstream target of miR-218. The expression of miR-218 was lower in glioma cell lines and glioma tissues from the patients with decreased Slit2 and increased Robo1 protein levels. The over-expression of miR-218 inhibited the tumorgenesis and proliferation of glioma cells remarkably. Furthermore, the over-expressing miR-218 in glioma cells results in the downregulation of Robo1 and upregulation of Slit2. Using luciferase reporter assays, we found that Robo1 was a direct downstream target of miR-218. Over-expression of miR-218 in glioma cells may inhibit the proliferation and tumorigenicity through targeting Robo1, suggesting that miR-218 could be a potential target for developing therapies in treating glioma.

  3. MicroRNA-218 Increases the Sensitivity of Bladder Cancer to Cisplatin by Targeting Glut1

    Directory of Open Access Journals (Sweden)

    Peng Li

    2017-02-01

    Full Text Available Background/Aims: MicroRNA-218 (miR-218 is down-regulated in many malignancies that have been implicated in the regulation of diverse processes in cancer cells. However, the involvement of miR-218 in chemo-sensitivity to cisplatin and the precise mechanism of this action remained unknown in bladder cancer. Methods: qRT-PCR was used to detect miR-218 and its target Glut1 expression in bladder cancer cell lines T24 and EJ. CCK-8 method was utilized to measure the cell viability. IC 50 was calculated via a probit regression model. Glut1 was detected by western blotting for analysis of potential mechanism. Luciferase reporter assay was utilized to validate Glut1 as a direct target gene of miR-218. The intracellular level of GSH and ROS were determined using a commercial colorimetric assay kit and 2’, 7’-dichlorodihydro-fluorescein diacetate, respectively. Results: Over-expression of miR-218 significantly reduced the rate of glucose uptake and total level of GSH and enhanced the chemo-sensitivity of bladder cancer to cisplatin. Mechanistically, Glut1 was found to be a direct and functional target of miR-218. Up-regulation of Glut1 could restore chemo-resistance in T24 and EJ cells. On the contrary, knockdown of Glut1 could generate a similar effect as up-regulating the expression of miR-218. Conclusions: MiR-218 increases the sensitivity of bladder cancer to cisplatin by targeting Glut1. Restoration of miR-218 and repression of glut1 may provide a potential strategy to restore chemo-sensitivity in bladder cancer.

  4. Prognostic significance of low microRNA-218 expression in patients with different types of cancer

    Science.gov (United States)

    Duan, Fujiao; Wang, Kaijuan; Dai, Liping; Zhao, Xia; Feng, Yajing; Song, Chunhua; Cui, Shuli; Wang, Chengzeng

    2016-01-01

    Abstract Background: Mounting evidence showed that microRNAs may be useful as prognostic biomarkers of cancer. Therefore, we summarize the predictive role of microRNA-218 (miR-218) for survival in patients with various cancers. Methods: We performed a systematic literature review and assessed the quality of included studies based on Meta-analysis of Observational Studies in Epidemiology group (MOOSE). Hazard ratios (HRs) with corresponding 95% confidence intervals (CIs) were calculated to assess the correlation between miR-218 expression and prognosis of different cancers. Results: We identified 10 studies for pooled analyses. For overall survival, a lower expression levels of miR-218 significantly predicted poorer survival, with the pooled HR of 2.61 (95% CI: 2.11–3.22, P < 0.001). For disease-free survival/progressive-free survival/recurrence-free survival (DFS/PFS/RFS), a lower expression level of miR-218 significantly predicted worse DFS/PFS/RFS in various carcinomas, with the pooled HR of 2.73 (95% CI: 2.08–3.58, P < 0.001). Similarly, subgroup analysis by detection method, ethnicity and cancer subtype analysis suggested that lower expression of miR-218 correlated with. Conclusion: Our data demonstrated that lower miR-218 expression is significantly associated with poorer overall survival (OS) and DFS/PFS/RFS and may be a novel prognostic biomarker in some cancer types. PMID:27631228

  5. MiR-218 Inhibits Migration and Invasion of Lung Cancer Cell 
by Regulating Robo1 Expression

    OpenAIRE

    Chen, Ping; Zhao, Yunlong; Li, Yingjie

    2017-01-01

    Background and objective To explore the function and the potential molecular mechanism of miR-218 in lung cancer cell. Methods The expression of miR-218 mRNA was determined by real-time PCR in lung cancer tissues, adjacent tissues and lung cancer cells. Transwell assay was used to detect the migration and invasion of A549 cell after transfected with Anti-miR-218 or negative control and HC4006 cell after transfected with miR-218 mimics and miR-218 negative control. Targetscan and MiRanda were ...

  6. microRNA-218 inhibits prostate cancer cell growth and promotes apoptosis by repressing TPD52 expression

    Energy Technology Data Exchange (ETDEWEB)

    Han, Guangye, E-mail: guangyehan@126.com; Fan, Maochuan, E-mail: maochunfan@outlook.com; Zhang, Xinjun, E-mail: xinjunzhang11@163.com

    2015-01-16

    Highlights: • miR-218 expression is downregulated in prostate cancer. • miR-218 inhibits prostate tumor cells proliferation partially through promoting apoptosis. • miR-218 targets TPD52 by binding to its 3′-UTR. • miR-218 suppresses prostate cancer cell growth through inhibiting TPD52 expression. - Abstract: The tumor protein D52 (TPD52) is an oncogene overexpressed in prostate cancer (PC) due to gene amplification. Although the oncogenic effect of TPD52 is well recognized, how its expression is regulated is still not clear. This study tried to explore the regulative role of miR-218, a tumor suppressing miRNA on TPD52 expression and prostate cancer cell proliferation. We found the expression of miR-218 was significantly lower in PC specimens. Based on gain and loss of function analysis, we found miR-218 significantly inhibit cancer cell proliferation by inducing apoptosis. These results strongly suggest that miR-218 plays a tumor suppressor role in PC cells. In addition, our data firstly demonstrated that miR-218 directly regulates oncogenic TPD52 in PC3 cells and the miR-218-TPD52 axis can regulate growth of this prostate cancer cell line. Knockdown of TPD52 resulted in significantly increased cancer cell apoptosis. Clearly understanding of oncogenic TPD52 pathways regulated by miR-218 might be helpful to reveal new therapeutic targets for PC.

  7. MiR-218 inhibits invasion and metastasis of gastric cancer by targeting the Robo1 receptor.

    Science.gov (United States)

    Tie, Jun; Pan, Yanglin; Zhao, Lina; Wu, Kaichun; Liu, Jie; Sun, Shiren; Guo, Xuegang; Wang, Biaoluo; Gang, Yi; Zhang, Yongguo; Li, Quanjiang; Qiao, Taidong; Zhao, Qingchuan; Nie, Yongzhan; Fan, Daiming

    2010-03-12

    MicroRNAs play key roles in tumor metastasis. Here, we describe the regulation and function of miR-218 in gastric cancer (GC) metastasis. miR-218 expression is decreased along with the expression of one of its host genes, Slit3 in metastatic GC. However, Robo1, one of several Slit receptors, is negatively regulated by miR-218, thus establishing a negative feedback loop. Decreased miR-218 levels eliminate Robo1 repression, which activates the Slit-Robo1 pathway through the interaction between Robo1 and Slit2, thus triggering tumor metastasis. The restoration of miR-218 suppresses Robo1 expression and inhibits tumor cell invasion and metastasis in vitro and in vivo. Taken together, our results describe a Slit-miR-218-Robo1 regulatory circuit whose disruption may contribute to GC metastasis. Targeting miR-218 may provide a strategy for blocking tumor metastasis.

  8. MiR-218 inhibits invasion and metastasis of gastric cancer by targeting the Robo1 receptor.

    Directory of Open Access Journals (Sweden)

    Jun Tie

    2010-03-01

    Full Text Available MicroRNAs play key roles in tumor metastasis. Here, we describe the regulation and function of miR-218 in gastric cancer (GC metastasis. miR-218 expression is decreased along with the expression of one of its host genes, Slit3 in metastatic GC. However, Robo1, one of several Slit receptors, is negatively regulated by miR-218, thus establishing a negative feedback loop. Decreased miR-218 levels eliminate Robo1 repression, which activates the Slit-Robo1 pathway through the interaction between Robo1 and Slit2, thus triggering tumor metastasis. The restoration of miR-218 suppresses Robo1 expression and inhibits tumor cell invasion and metastasis in vitro and in vivo. Taken together, our results describe a Slit-miR-218-Robo1 regulatory circuit whose disruption may contribute to GC metastasis. Targeting miR-218 may provide a strategy for blocking tumor metastasis.

  9. MiR-218 Inhibits Migration and Invasion of Lung Cancer Cell 
by Regulating Robo1 Expression

    Directory of Open Access Journals (Sweden)

    Ping CHEN

    2017-06-01

    Full Text Available Background and objective To explore the function and the potential molecular mechanism of miR-218 in lung cancer cell. Methods The expression of miR-218 mRNA was determined by real-time PCR in lung cancer tissues, adjacent tissues and lung cancer cells. Transwell assay was used to detect the migration and invasion of A549 cell after transfected with Anti-miR-218 or negative control and HC4006 cell after transfected with miR-218 mimics and miR-218 negative control. Targetscan and MiRanda were used to calculate the potential targets of miR-218 and Luciferase reporter assay was performed to identify that the Robo1 was one target genes of miR-218. Transwell assay was used to detect whether miR-218 regulated the invasion of lung cancer cell transfected with anti-miR-218 or negative control via Robo1. Results The expression of miR-218 in the lung cancer tissues was significantly lower than that in the adjacent tissues (P<0.05. Inhibition of miR-218 improved the migration and invasion of A549 cell. Overexpression of miR-218 suppressed the migration and invasion of HCC4006 cell. The co-transfection of anti-miR-218 or miR-218 mimics and the Robo1 3′UTR increased or reduced the luciferase activity of Robo1 compared with the control group (P<0.05. Inhibition of miR-218 and Robo1 recovered the invaded cells of A549. Overexpression of miR-218 and inhibition of Robo1 reduced the number of the invased cells of HCC4006. These results suggested that miR-218 banded Robo1 directly and inhibited lung cancer cell invasion by targeting Robo1. Conclusion MiR-218 inhibited the migration and invasion of lung cancer cells through regulating Robo1 expression.

  10. [MiR-218 Inhibits Migration and Invasion of Lung Cancer Cell 
by Regulating Robo1 Expression].

    Science.gov (United States)

    Chen, Ping; Zhao, Yunlong; Li, Yingjie

    2017-07-20

    To explore the function and the potential molecular mechanism of miR-218 in lung cancer cell. The expression of miR-218 mRNA was determined by real-time PCR in lung cancer tissues, adjacent tissues and lung cancer cells. Transwell assay was used to detect the migration and invasion of A549 cell after transfected with Anti-miR-218 or negative control and HC4006 cell after transfected with miR-218 mimics and miR-218 negative control. Targetscan and MiRanda were used to calculate the potential targets of miR-218 and Luciferase reporter assay was performed to identify that the Robo1 was one target genes of miR-218. Transwell assay was used to detect whether miR-218 regulated the invasion of lung cancer cell transfected with anti-miR-218 or negative control via Robo1. The expression of miR-218 in the lung cancer tissues was significantly lower than that in the adjacent tissues (PRobo1 3'UTR increased or reduced the luciferase activity of Robo1 compared with the control group (PRobo1 recovered the invaded cells of A549. Overexpression of miR-218 and inhibition of Robo1 reduced the number of the invased cells of HCC4006. These results suggested that miR-218 banded Robo1 directly and inhibited lung cancer cell invasion by targeting Robo1. MiR-218 inhibited the migration and invasion of lung cancer cells through regulating Robo1 expression.
.

  11. MicroRNA-218 inhibits the proliferation and metastasis of esophageal squamous cell carcinoma cells by targeting BMI1

    Science.gov (United States)

    WANG, TING; CHEN, TENGFEI; NIU, HUA; LI, CHANG; XU, CHUN; LI, YUANYUAN; HUANG, RUI; ZHAO, JUN; WU, SHUYAN

    2015-01-01

    MicroRNAs (miRNAs or miRs) play a pivotal role in esophageal carcinogenesis either as oncogenes or as tumor suppressor genes. In the present study, we found that the expression level of miR-218 was significantly reduced in esophageal squamous cell carcinoma (ESCC) tissues and ESCC cell lines. Moreover, its expression was found to correlate with the clinicopathological stage of ESCC; miR-218 expression was lower in the stage III tissue samples than in the stage I and II tissue samples. Furthermore, the decreased expression of miR-218 was found to be associated with an enhanced ESCC cell proliferation and metastasis. Western blot analysis and luciferase reporter assay revealed that miR-218 decreased BMI1 expression by binding to the putative binding sites in its 3′-untranslated region (3′-UTR). The BMI1 mRNA expression levels were markedly increased and negatively correlated with the miR-218 expression level in the ESCC tissues. Functional analyses revealed that the restoration of miR-218 expression inhibited ESCC cell proliferation, migration and invasion and promoted apoptosis. The knockdown of BMI1 by siRNA showed the same phenocopy as the effect of miR-218 on ESCC cells, indicating that BMI1 was a major target of miR-218. In the present study, our findings confirm miR-218 as a tumor suppressor and identify BMI1 as a novel target of miR-218 in ESCC. Therefore, miR-218 may prove to be a useful biomarker for monitoring the initiation and development of ESCC, and may thus be an effective therapeutic target in ESCC. PMID:25999024

  12. 9 CFR 93.218 - Import permits and applications for inspection for poultry.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Import permits and applications for... PRODUCTS IMPORTATION OF CERTAIN ANIMALS, BIRDS, FISH, AND POULTRY, AND CERTAIN ANIMAL, BIRD, AND POULTRY PRODUCTS; REQUIREMENTS FOR MEANS OF CONVEYANCE AND SHIPPING CONTAINERS Poultry Mexico 8 § 93.218 Import...

  13. Challenges and Implications of Genesis 2:18 – 24 on Same-Sex ...

    African Journals Online (AJOL)

    The paper examined biblical marriage from the perspective of Genesis 2:18. The text established the divine institution and order for marriage which is simply expressed in a man and woman union. Other implications of this sacred union were glaringly elucidated through the hermeneutical study and literary analysis of some ...

  14. 30 CFR 218.304 - May I credit rental towards direct use fees?

    Science.gov (United States)

    2010-07-01

    ... MINERALS REVENUE MANAGEMENT COLLECTION OF MONIES AND PROVISION FOR GEOTHERMAL CREDITS AND INCENTIVES Geothermal Resources § 218.304 May I credit rental towards direct use fees? You may not credit annual rental... 30 Mineral Resources 2 2010-07-01 2010-07-01 false May I credit rental towards direct use fees...

  15. VizieR Online Data Catalog: K2-18 HARPS time-series (Cloutier+, 2017)

    Science.gov (United States)

    Cloutier, R.; Astudillo-Defru, N.; Doyon, R.; Bonfils, X.; Almenara, J. M.; Benneke, B.; Bouchy, F.; Delfosse, X.; Ehrenreich, D.; Forveille, T.; Lovis, C.; Mayor, M.; Menou, K.; Murgas, F.; Pepe, F.; Rowe, J.; Santos, N. C.; Udry, S.; Wuensche, A.

    2017-11-01

    HARPS time-series containing 75 measurements of the K2-18 radial velocities, Ca II H+K Mt. Wilson S index, H-alpha index, full width at half maximum of the cross-correlation function, and the bi-sector inverse slope of the cross-correlation function. (1 data file).

  16. 7 CFR 1951.218 - Use of Rural Development loans and grants for other purposes.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 14 2010-01-01 2009-01-01 true Use of Rural Development loans and grants for other... Servicing of Community and Direct Business Programs Loans and Grants § 1951.218 Use of Rural Development... the Consolidated Farm and Rural Development Act, as amended; and (3) Satisfies such additional...

  17. 12 CFR 218.722 - Exemption allowing banks to calculate trust and fiduciary compensation on a bank-wide basis.

    Science.gov (United States)

    2010-01-01

    ... for the bank's trust and fiduciary business is at least 70 percent. (b) Aggregate relationship-total... to the relationship compensation attributable to the bank's trust and fiduciary business as a whole... fiduciary compensation on a bank-wide basis. 218.722 Section 218.722 Banks and Banking FEDERAL RESERVE...

  18. 24 CFR 5.218 - Penalties for failing to disclose and verify Social Security and Employer Identification Numbers.

    Science.gov (United States)

    2010-04-01

    ... and verify Social Security and Employer Identification Numbers. 5.218 Section 5.218 Housing and Urban... REQUIREMENTS; WAIVERS Disclosure and Verification of Social Security Numbers and Employer Identification Numbers; Procedures for Obtaining Income Information Disclosure and Verification of Social Security...

  19. MiR-218 suppresses nasopharyngeal cancer progression through downregulation of survivin and the SLIT2-ROBO1 pathway.

    Science.gov (United States)

    Alajez, Nehad M; Lenarduzzi, Michelle; Ito, Emma; Hui, Angela B Y; Shi, Wei; Bruce, Jeff; Yue, Shijun; Huang, Shao H; Xu, Wei; Waldron, John; O'Sullivan, Brian; Liu, Fei-Fei

    2011-03-15

    Nasopharayngeal carcinoma (NPC) is an Epstein-Barr virus-associated malignancy most common in East Asia and Africa. Here we report frequent downregulation of the microRNA miR-218 in primary NPC tissues and cell lines where it plays a critical role in NPC progression. Suppression of miR-218 was associated with epigenetic silencing of SLIT2 and SLIT3, ligands of ROBO receptors that have been previously implicated in tumor angiogenesis. Exogenous expression of miR-218 caused significant toxicity in NPC cells in vitro and delayed tumor growth in vivo. We used an integrated trimodality approach to identify targets of miR-218 in NPC, cervical, and breast cell lines. Direct interaction between miR-218 and the 3'-untranslated regions (UTR) of mRNAs encoding ROBO1, survivin (BIRC5), and connexin43 (GJA1) was validated in a luciferase-based transcription reporter assay. Mechanistic investigations revealed a negative feedback loop wherein miR-218 regulates NPC cell migration via the SLIT-ROBO pathway. Pleotropic effects of miR-218 on NPC survival and migration were rescued by enforced expression of miR-218-resistant, engineered isoforms of survivin and ROBO1, respectively. In clinical specimens of NPC (n=71), ROBO1 overexpression was significantly associated with worse overall (P=0.04, HR=2.4) and nodal relapse-free survival (P=0.008, HR=6.0). Our findings define an integrative tumor suppressor function for miR-218 in NPC and further suggest that restoring miR-218 expression in NPC might be useful for its clinical management. © 2011 AACR.

  20. miR-218 suppresses cardiac myxoma proliferation by targeting myocyte enhancer factor 2D.

    Science.gov (United States)

    Cao, Quanxing; Dong, Pingshuan; Wang, Yanyu; Zhang, Junwei; Shi, Xinge; Wang, Yongsheng

    2015-05-01

    Cardiac myxoma is the most common type of human heart tumor, yet the molecular mechanism is still poorly understood. In the present study, we found that the level of myocyte enhancer factor 2D (MEF2D), a key regulatory protein for cardiac development, was elevated in specimens of cardiac myxoma, and was positively associated with the proliferation of myxoma cells. MEF2D suppression reduced the proliferation of myxoma cells and its tumorigenicity. Cell cycle progression was also inhibited by MEF2D suppression. miR-218, which is downregulated in myxoma, suppressed MEF2D expression by targeting its mRNA 3'UTR. Altogether, we found that miR-218/MEF2D may be an effective target for myxoma treatment.

  1. O-(2-[18F]fluoroethyl)-L-tyrosine: uptake mechanisms and clinical applications.

    Science.gov (United States)

    Langen, Karl-Josef; Hamacher, Kurt; Weckesser, Matthias; Floeth, Frank; Stoffels, Gabriele; Bauer, Dagmar; Coenen, Heinz H; Pauleit, Dirk

    2006-04-01

    O-(2-[18F]fluoroethyl)-L-tyrosine (FET) is a promising tracer for PET that has demonstrated convincing results especially in the diagnostics of brain tumors. In contrast to other radiolabeled amino acids, it can be produced with high efficiency and distributed in a satellite concept like the widely used 2-[18F]fluoro-2-deoxy-D-glucose. Although FET is not incorporated into proteins, it shows high uptake in cerebral gliomas and in extracranial squamous cell carcinomas owing to increased transport. The tracer exhibits high in vivo stability, low uptake in inflammatory tissue and suitable uptake kinetics for clinical imaging, which indicates that it may become a new standard tracer for PET. In this article, the present knowledge on the uptake mechanisms and the clinical applications of FET are reviewed and the clinical perspectives are discussed.

  2. A nanomechanical study of the effects of colistin on the Klebsiella pneumoniae AJ218 capsule.

    Science.gov (United States)

    Mularski, Anna; Wilksch, Jonathan; Hanssen, Eric; Li, Jian; Tomita, Takehiro; Pidot, Sacha James; Stinear, Tim; Separovic, Frances; Strugnell, Dick

    2017-05-01

    Atomic force microscopy measurements of capsule thickness revealed that that the wild-type Klebsiella pneumoniae AJ218 capsular polysaccharides were rearranged by exposure to colistin. The increase in capsule thickness measured near minimum inhibitory/bactericidal concentration (MIC/MBC) is consistent with the idea that colistin displaces the divalent cations that cross-bridge adjacent lipopolysaccharide (LPS) molecules through the capsule network. Cryo-electron microscopy demonstrated that the measured capsule thickness at near MIC/MBC of 1.2 μM was inflated by the disrupted outer membrane, through which the capsule is excreted and LPS is bound. Since wild-type and capsule-deficient strains of K. pneumoniae AJ218 have equivalent MICs and MBCs, the presence of the capsule appeared to confer no protection against colistin in AJ218. A spontaneously arising colistin mutant showed a tenfold increase in resistance to colistin; genetic analysis identified a single amino acid substitution (Q95P) in the PmrB sensor kinase in this colistin-resistant K. pneumoniae AJ218. Modification of the lipid A component of the LPS could result in a reduction of the net-negative charge of the outer membrane, which could hinder binding of colistin to the outer membrane and displacement of the divalent cations that bridge adjacent LPS molecules throughout the capsular polysaccharide network. Retention of the cross-linking divalent cations may explain why measurements of capsule thickness did not change significantly in the colistin-resistant strain after colistin exposure. These results contrast with those for other K. pneumoniae strains that suggest that the capsule confers colistin resistance.

  3. Detection of PRRSV in 218 field samples using six molecular methods: What we are looking for?

    DEFF Research Database (Denmark)

    Toplak, Ivan; Štukelj, Marina; Gracieux, Patrice

    2012-01-01

    Objectives The purpose of this study was to determine the sensitivity and the specificity of six molecular methods used for the detection of porcine reproductive and respiratory syndrome virus (PRRSV). Methods 218 field samples (serum, tissues) were collected between 2009 and 2011 from 50 PRRSV p......-time) Continuesly follow the genetic evaluation of especially Type I PRRSV subtype viruses and regularly update their primer sequences....

  4. Die Irrglaube in Kolosse: Aanbidding van of met engele in Kolossense 2:18?

    Directory of Open Access Journals (Sweden)

    Jacobus (Kobus Kok

    2010-02-01

    Full Text Available The Irrglaube in Colossae: Worshipping of or with angels in Colossians 2:18?In this article, the Colossian heresy will be discussed. This is, however, a very troublesome epistle to use in any assessment of a Pauline theme, due to the uncertainty of who the author of Colossians could have been, as well as the unclear nature of the heresy in question. The majority of scholars are of the opinion that the false teachers in the congregation encouraged the worshipping of angels (cf. Col 2:18. As it will transpire from the discussion, this is indeed the case when this verse is read in an objective genitive sense. This investigative discussion will help us to discern what part angels played in certain religious circles in the early church (for example as mediators of revelation. The link between the ἀγγέλων in Colossians 2:18, and the στοιχείων τοῦ κόσμου in Colossians 2:20, will also be investigated. In Colossians, the author presents Jesus as the crucified, cosmic Christ (see Col 1:15–20, which will help us to understand the early Christian reaction to heresies such as this one in Colossae, and investigate the relationship between angelology and Christology.

  5. TPH1 A218C polymorphism and temperament in major depression.

    Science.gov (United States)

    Andre, Kadri; Kampman, Olli; Viikki, Merja; Illi, Ari; Setälä-Soikkeli, Eija; Poutanen, Outi; Mononen, Nina; Leinonen, Esa; Lehtimäki, Terho

    2013-04-18

    In major depression, one of the candidate genes possibly affecting the risk and severity of symptoms has been found to be tryptophan hydroxylase (TPH1). Variation in treatment response to antidepressive agents according to TPH1 genotype has also been found in several studies. However, the relationship between temperament and TPH1 genotype in major depression is poorly understood, as only one study has been published so far. There are no earlier studies on the interaction between temperament traits, antidepressive medication response and TPH1 genotype. This interaction was studied in 97 subjects with major depression treated for six weeks with selective serotonine reuptake inhibitors. Temperament dimensions Harm Avoidance (HA), Novelty Seeking (NS), Reward Dependence (RD) and Persistence (P) scores at baseline (1) and endpoint (2) were rated with the Temperament and Character Inventory (TCI) and compared between TPH1 A218C genotypes. Multivariate analysis of co-variance (MANCOVA) was used to analyze the interaction between the TPH1 genotype, treatment response and the different temperament dimensions at baseline and endpoint. In the analysis model, treatment response was used as a covariate and TPH1 genotype as a factor. A post hoc analysis for an interaction between remission status and TPH1 A218C genotype at endpoint HA level was also performed. The number of TPH1 A-alleles was associated with increasing levels in NS1 and NS2 scores and decreasing levels in HA1 and HA2 scores between TPH1 A218C genotypes. In the MANCOVA model, TPH1 genotype and treatment response had an interactive effect on both HA1 and HA2 scores, and to a lesser degree on NS2 scores. Additionally, an interaction between remission status and TPH1 A218C genotype was found to be associated with endpoint HA score, with a more marked effect of the interaction between CC genotype and remission status compared to A-allele carriers. Our results suggest that in acute depression TPH1 A218C polymorphism

  6. Silencing of miRNA-218 promotes migration and invasion of breast cancer via Slit2-Robo1 pathway.

    Science.gov (United States)

    Yang, Longqiu; Li, Qing; Wang, Qingxiu; Jiang, Zhen; Zhang, Lei

    2012-10-01

    MiRNAs play an important role in regulating tumor migration and invasion, and abnormal expression of miRNAs occurs in various kinds of human cancers. In this essay, it is reported that the level of miRNA-218 decreases in metastatic breast cancer cells, moreover, miRNA-218 suppresses breast cancer cells migration and invasion through binding Robo1 (one of Slit receptors) to its 3'UTR. MiRNA-218 restoration suppresses Robo1 expression and inhibits breast cancer cells invasion and migration. What the results describe is that the function of Robo1 regulated by miRNA-218 may provide a new strategy for inhibiting migration and invasion of breast cancer cells. Copyright © 2012 Elsevier Masson SAS. All rights reserved.

  7. Analysis of the clustering in 212Po, 218Rn and 232U

    Science.gov (United States)

    Ibrahim, T. T.; Wyngaardt, S. M.; Kimene Kaya, B. D. C.

    2017-10-01

    We studied the ground state band properties of 212Po, 218Rn and 232U using the binary cluster model. The nuclei are treated as a 208Pb-core plus a cluster interacting via a local potential of Saxon-Woods type functional form whose parameters are derived from Michigan-3-Yukawa (M3Y) microscopic potential model. Further correction in the internal structure of the hybrid potential model is attributed to the nucleon distribution in the overlap region of the core-cluster system. Overall our calculated results are found to compare favourably well with available experimental data.

  8. Adjustable valves in normal-pressure hydrocephalus: a retrospective study of 218 patients

    DEFF Research Database (Denmark)

    Zemack, G.; Rommer, Bertil Roland

    2008-01-01

    OBJECTIVE: We sought to assess the value of adjusting shunt valve opening pressure, complications, and outcomes with the use of an adjustable shunt valve in the treatment of patients with normal-pressure hydrocephalus (NPH). METHODS: In a single-center retrospective study, 231 adjustable valves...... status. The correlation of the improvement index with the size of the individual adjustments was not significant. Complications occurred in 43 (19.7%) of 218 patients, valve malfunction occurred in 3 patients (1.3%), infection occurred in 14 patients (6.4%), and nontraumatic subdural effusion occurred...

  9. Malignant transformation of oral leukoplakia: a retrospective cohort study of 218 Chinese patients.

    Science.gov (United States)

    Liu, Wei; Wang, Yu-Feng; Zhou, Hai-Wei; Shi, Peng; Zhou, Zeng-Tong; Tang, Guo-Yao

    2010-12-16

    Oral leukoplakia (OL) is the best-known potentially malignant disorder. A new binary system to grade dysplasia was proposed by WHO, but the biological significance in predicting malignant transformation risk is unknown. The objective of this study is to estimate the rate of malignant transformation in a long-term follow-up cohort, explore the usefulness of the new binary system of grading dysplasia and identify significant risk factors of OL malignant transformation in China. A total of 218 patients with clinical and histopathologic diagnosis of OL were retrospectively reviewed. They were selected among all archived files at the Department of Oral Mucosal Diseases, Ninth People's Hospital, Shanghai Jiao Tong University School of Medicine. The mean follow-up period was 5.3 years. Among 218 cases, 39 (17.9%) OL patients developed oral cancer, with a mean duration of 5.2 years. Cox regression analysis revealed that dysplasia was an independent risk factor for OL malignant transformation, but age, gender, lesion site, diet habit, smoking and ethanol intake were not risk factors. High-risk dysplastic OL was associated with a 4.57-fold (95% confidence interval, 2.36-8.84; P treatment selection in clinical practice.

  10. Panel 2.18: logistics, information technology (IT), and telecommunications in crisis management.

    Science.gov (United States)

    De Silva, Terrence; Chikersal, Jyotsna; Snoad, Nigel; Woodworth, Brent; Ghaly, Cherif; Catterall, Martin

    2005-01-01

    This is a summary of the presentations and discussion of Panel 2.18, Logistics, Information Technology, and Telecommunications in Crisis Management of the Conference, Health Aspects of the Tsunami Disaster in Asia, convened by the World Health Organization (WHO) in Phuket, Thailand, 04-06 May 2005. The topics discussed included issues related to logistics, information technology (IT), and crisis communication pertaining to the responses to the damage created by the Tsunami. It is presented in the following major sections: (1) issues; (2) lessons learned; (3) what was done well; (4) what could have been done better; and (5) conclusions and recommendations. Each major section is presented in four sub-sections: (1) needs assessments; (2) coordination; (3) filling the gaps; and (4) capacity building.

  11. Malignant transformation of oral leukoplakia: a retrospective cohort study of 218 Chinese patients

    Directory of Open Access Journals (Sweden)

    Zhou Zeng-Tong

    2010-12-01

    Full Text Available Abstract Background Oral leukoplakia (OL is the best-known potentially malignant disorder. A new binary system to grade dysplasia was proposed by WHO, but the biological significance in predicting malignant transformation risk is unknown. The objective of this study is to estimate the rate of malignant transformation in a long-term follow-up cohort, explore the usefulness of the new binary system of grading dysplasia and identify significant risk factors of OL malignant transformation in China. Methods A total of 218 patients with clinical and histopathologic diagnosis of OL were retrospectively reviewed. They were selected among all archived files at the Department of Oral Mucosal Diseases, Ninth People's Hospital, Shanghai Jiao Tong University School of Medicine. The mean follow-up period was 5.3 years. Results Among 218 cases, 39 (17.9% OL patients developed oral cancer, with a mean duration of 5.2 years. Cox regression analysis revealed that dysplasia was an independent risk factor for OL malignant transformation, but age, gender, lesion site, diet habit, smoking and ethanol intake were not risk factors. High-risk dysplastic OL was associated with a 4.57-fold (95% confidence interval, 2.36-8.84; P Conclusions The new binary system's function in predicting OL malignant transformation risk was investigated in this survey. The utilization of high-risk dysplasia as a significant indicator for evaluating malignant transformation risk in patients with OL was suggested, which may be helpful to guide treatment selection in clinical practice.

  12. Malignant transformation of oral leukoplakia: a retrospective cohort study of 218 Chinese patients

    Science.gov (United States)

    2010-01-01

    Background Oral leukoplakia (OL) is the best-known potentially malignant disorder. A new binary system to grade dysplasia was proposed by WHO, but the biological significance in predicting malignant transformation risk is unknown. The objective of this study is to estimate the rate of malignant transformation in a long-term follow-up cohort, explore the usefulness of the new binary system of grading dysplasia and identify significant risk factors of OL malignant transformation in China. Methods A total of 218 patients with clinical and histopathologic diagnosis of OL were retrospectively reviewed. They were selected among all archived files at the Department of Oral Mucosal Diseases, Ninth People's Hospital, Shanghai Jiao Tong University School of Medicine. The mean follow-up period was 5.3 years. Results Among 218 cases, 39 (17.9%) OL patients developed oral cancer, with a mean duration of 5.2 years. Cox regression analysis revealed that dysplasia was an independent risk factor for OL malignant transformation, but age, gender, lesion site, diet habit, smoking and ethanol intake were not risk factors. High-risk dysplastic OL was associated with a 4.57-fold (95% confidence interval, 2.36-8.84; P < 0.001) increased risk of malignant transformation, compared with low-risk dysplasia. Consistent with this result, high-risk dysplastic OL had signicantly higher malignant incidence than low-risk dysplasia, particularly during the first 2-3 years of follow-up, by Kaplan-Meier analysis (Log-rank test, P < 0.001). Conclusions The new binary system's function in predicting OL malignant transformation risk was investigated in this survey. The utilization of high-risk dysplasia as a significant indicator for evaluating malignant transformation risk in patients with OL was suggested, which may be helpful to guide treatment selection in clinical practice. PMID:21159209

  13. Anticonvulsant and reproductive toxicological studies of the imidazole-based histamine H3R antagonist 2-18 in mice

    Directory of Open Access Journals (Sweden)

    Bastaki SM

    2018-01-01

    Full Text Available Salim M Bastaki,1 Yousef M Abdulrazzaq,2 Mohamed Shafiullah,1 Małgorzata Więcek,3 Katarzyna Kieć-Kononowicz,3 Bassem Sadek1 1Department of Pharmacology and Therapeutics, College of Medicine and Health Science, United Arab Emirates University, Al Ain, 2Department of Medical Education, Dubai Health Authority, Dubai, UAE; 3Department of Technology and Biotechnology of Drugs, Faculty of Pharmacy, Jagiellonian University Medical College, Medyczna, Kraków, Poland Abstract: The imidazole-based H3R antagonist 2-18 with high in vitro H3R antagonist affinity, excellent in vitro selectivity profile, and high in vivo H3R antagonist potency was tested for its anticonvulsant effect in maximal electroshock (MES-induced convulsions in mice having valproic acid (VPA as a reference antiepileptic drug (AED. Additionally, H3R antagonist 2-18 was evaluated for its reproductive toxicity in the same animal species. The results show that acute systemic administration (intraperitoneal; i.p. of H3R antagonist 2-18 (7.5, 15, 30, and 60 mg/kg, i.p. significantly and dose dependently protected male as well as female mice against MES-induced convulsion. The protective action observed for H3R antagonist 2-18 in both mice sexes was comparable to that of VPA and was reversed when mice were pretreated with the selective H3R agonist (R-alpha-methylhistamine (RAMH, 10 mg/kg, i.p.. Moreover, the results show that acute systemic administration of single (7.5, 15, 30, or 60 mg/kg, i.p. or multiple doses (15×3 mg/kg, i.p. of H3R antagonist 2-18 on gestation day (GD 8 or 13 did not affect the maternal body weight of mice when compared with the control group. Furthermore, no significant differences were observed in the average number of implantations and resorptions between the control and H3R antagonist 2-18-treated group at the early stages of gestation and the organogenesis period. However, oral treatment with H3R antagonist 2-18 (15 mg/kg on GD 8 induced a reduced number of

  14. 5 CFR 792.218 - Does the law apply only to on-site Federal child care centers that are utilized by Federal families?

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Does the law apply only to on-site Federal child care centers that are utilized by Federal families? 792.218 Section 792.218 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) FEDERAL EMPLOYEES' HEALTH AND COUNSELING PROGRAMS Agency Us...

  15. Cooked oatmeal consumption is associated with better diet quality, better nutrient intakes, and reduced risk for central adiposity and obesity in Children 2-18 years

    Science.gov (United States)

    The objective of this study was to assess the association between oatmeal consumption and nutrient intake, diet quality, and weight/adiposity of children aged 2-18. A nationally representative sample of children aged 2-18 (N=14,690) participating in National Health and Nutrition Examination Survey 2...

  16. MicroRNA 218 mediates the effects of Tbx5a over-expression on zebrafish heart development.

    Directory of Open Access Journals (Sweden)

    Elena Chiavacci

    Full Text Available tbx5, a member of the T-box gene family, encodes one of the key transcription factors mediating vertebrate heart development. Tbx5 function in heart development appears to be exquisitely sensitive to gene dosage, since both haploinsufficiency and gene duplication generate the cardiac abnormalities associated with Holt-Oram syndrome (HOS, a highly penetrant autosomal dominant disease characterized by congenital heart defects of varying severity and upper limb malformation. It is suggested that tight integration of microRNAs and transcription factors into the cardiac genetic circuitry provides a rich and robust array of regulatory interactions to control cardiac gene expression. Based on these considerations, we performed an in silico screening to identify microRNAs embedded in genes highly sensitive to Tbx5 dosage. Among the identified microRNAs, we focused our attention on miR-218-1 that, together with its host gene, slit2, is involved in heart development. We found correlated expression of tbx5 and miR-218 during cardiomyocyte differentiation of mouse P19CL6 cells. In zebrafish embryos, we show that both Tbx5 and miR-218 dysregulation have a severe impact on heart development, affecting early heart morphogenesis. Interestingly, down-regulation of miR-218 is able to rescue the heart defects generated by tbx5 over-expression supporting the notion that miR-218 is a crucial mediator of Tbx5 in heart development and suggesting its possible involvement in the onset of heart malformations.

  17. Effect of Shot Peening on the Fatigue Strength of Automotive Tubular Stabilizer Bars DC 218

    Directory of Open Access Journals (Sweden)

    Wittek A.M.

    2016-12-01

    Full Text Available This paper concerns issues related to the development of designs of stabilizer bars for new motor vehicle models. It involves not only the designing of a stabilizer bar with the shape required by the manufacturer, but also the preparation of bending and heat treatment processes as well as the performance of strength and fatigue tests. In the prototype development phase, the simulations techniques (FEM may be used to assess the design. The article contains a detailed analysis of a stabilizer bar designated with the DC 218 VA symbol. Performed numerical strength and fatigue calculations showed that the developed stabilizer bar design with the desired shape did not achieve the required number of fatigue cycles. It was also proven at the test stand by testing a prototype stabilizer bar. Therefore, it was suggested to supplement the technological process with an additional shot peening operation whose main aim was to reduce the length of microcracks on the stabilizer bar’s surface. This effect was confirmed during comparative metallographic tests of not shot – peened and shot – peened stabilizer bars. After shot peening, the analysed stabilizer bar reached a fatigue strength which exceeded the limits set by the manufacturer.

  18. 2-18F-fluoro-2-deoxyglucose positron emission tomography in delirium.

    Science.gov (United States)

    Haggstrom, Lucy R; Nelson, Julia A; Wegner, Eva A; Caplan, Gideon A

    2017-11-01

    Delirium is a common, serious, yet poorly understood syndrome. Growing evidence suggests cerebral metabolism is fundamentally disturbed; however, it has not been investigated using 2-18F-fluoro-2-deoxyglucose (FDG) positron emission tomography (PET) in delirium. This prospective study thus explored FDG PET patterns of cerebral glucose metabolism in older inpatients with delirium. A particular emphasis was on the posterior cingulate cortex (PCC), a key region for attention, which is a central feature of delirium. Delirium scans were compared with post-delirium scans using visual analysis and semi-quantitative analysis with NeuroQ; 13 participants (8 female, median 84 y) were scanned during delirium, and 6 scanned again after resolution. On visual analysis, cortical hypometabolism was evident in all participants during delirium (13/13), and improved with delirium resolution (6/6). Using NeuroQ, glucose metabolism was higher post-delirium in the whole brain and bilateral PCC compared to during delirium ( p delirium duration. This research found widespread, reversible cortical hypometabolism during delirium and PCC hypometabolism was associated with inattention during delirium.

  19. Characteristics and sequelae of erupted supernumerary teeth: A study of 218 cases among Sri Lankan children.

    Science.gov (United States)

    Herath, Chandra; Jayawardena, Chantha; Nagarathne, Nandani; Perera, Kanthi

    2016-12-19

    In the present study, we investigated the characteristics and sequelae of erupted supernumerary teeth (ST) in a sample of Sri Lankan children. Data were recorded from patients' clinical records, radiographs, models, and extracted teeth. The sample consisted of 239 ST from 218 patients. The mean age of the sample was 9.08 ± 2.47 years. The male-to-female ratio was 2.8:1. The majority (42.66%) of patients with ST were in aged 8-10 years. Many (94.94%) of the ST were located in the premaxilla (incisor), followed by the canine (4.22%), premolar (0.42%), and molar (0.42%) regions. The most common shape of ST teeth was conical. Malocclusion (59.83%) was the major problem associated with ST, and the clinical impact was highest on the 8-10-year age group. A strong association was observed between patients' age and clinical impact to the dentition (χ(2) =42.09, P=.000). Because the majority of ST can lead to malocclusion, especially in mixed dentition, awareness, early detection, and timely clinical intervention of ST are recommended. © 2016 John Wiley & Sons Australia, Ltd.

  20. The historical (218 ± 14 aBP) explosive eruption of Tutupaca volcano (Southern Peru)

    Science.gov (United States)

    Samaniego, Pablo; Valderrama, Patricio; Mariño, Jersy; van Wyk de Vries, Benjamín; Roche, Olivier; Manrique, Nélida; Chédeville, Corentin; Liorzou, Céline; Fidel, Lionel; Malnati, Judicaëlle

    2015-06-01

    The little known Tutupaca volcano (17° 01' S, 70° 21' W), located at the southern end of the Peruvian arc, is a dacitic dome complex that experienced a large explosive eruption during historical times. Based on historic chronicles and our radiometric data, this eruption occurred 218 ± 14 aBP, probably between 1787 and 1802 AD. This eruption was characterised by a large sector collapse that triggered a small debris avalanche (<1 km3) and an associated pyroclastic eruption whose bulk volume was 6.5-7.5 × 107 m3. Both units were emplaced synchronously and spread onto the plain situated to the northeast of Tutupaca volcano. The spatial and temporal relationship between the debris avalanche and the pyroclastic density current deposits, coupled with the petrological similarity between the juvenile fragments in the debris avalanche, the pyroclastic density current deposits and the pre-avalanche domes, indicates that juvenile magma was involved in the sector collapse. Large amounts of hydrothermally altered material are also found in the avalanche deposit. Thus, the ascent of a dacitic magma, coupled with the fact that the Tutupaca dome complex was constructed on top of an older, altered volcanic sequence, probably induced the destabilisation of the hydrothermally active edifice, producing the debris avalanche and its related pyroclastic density currents. This eruption probably represents the youngest debris avalanche in the Andes and was accompanied by one of the larger explosive events to have occurred in Southern Peru during historical times.

  1. Whole-body distribution and dosimetry of O-(2-[18F]fluoroethyl)-L-tyrosine.

    Science.gov (United States)

    Pauleit, Dirk; Floeth, Frank; Herzog, Hans; Hamacher, Kurt; Tellmann, Lutz; Müller, Hans-W; Coenen, Heinz H; Langen, Karl-J

    2003-04-01

    The whole-body distribution of O-(2-[(18)F]fluoroethyl)- l-tyrosine (FET) was studied in seven patients with brain tumours by positron emission tomography (PET). Based on the IMEDOSE and MIRDOSE procedures, radiation absorbed doses were estimated from whole-body PET scans acquired approximately 70 and 200 min after i.v. injection of 400 MBq FET. After injection of FET, the peak of radioactivity in the blood was observed after 1.5 min, and a plateau of nearly constant radioactivity was reached at 20 min. The whole-body distribution of FET showed the highest activities in the urinary tract. All other organs exhibited only moderate FET uptake (SUV

  2. lncRNA HOTAIR Contributes to 5FU Resistance through Suppressing miR-218 and Activating NF-κB/TS Signaling in Colorectal Cancer

    Directory of Open Access Journals (Sweden)

    Peilong Li

    2017-09-01

    Full Text Available One major reason for the failure of advanced colorectal cancer (CRC treatment is the occurrence of chemoresistance to fluoropyrimidine (FU-based chemotherapy. Long non-coding RNA HOTAIR has been considered as a pro-oncogene in multiple cancers. However, the precise functional mechanism of HOTAIR in chemoresistance is not well known. In this study, we investigated the biological and clinical role of HOTAIR in 5FU resistance in CRC. Our results showed that HOTAIR negatively regulated miR-218 expression in CRC through an EZH2-targeting miR-218-2 promoter regulatory axis. HOTAIR knockdown dramatically inhibited cell viability and induced G1-phase arrest by promoting miR-218 expression. VOPP1 was shown to be a functional target of miR-218, and the main downstream signaling, NF-κB, was inactivated by HOTAIR through the suppression of miR-218 expression. Additionally, HOTAIR knockdown partially reversed 5FU resistance through promoting miR-218 and inactivating NF-κB signaling. Furthermore, HOTAIR restrained 5FU-induced cytotoxicity on CRC cells through promotion of thymidylate synthase expression. More importantly, high HOTAIR expression was associated with poor response to 5FU treatment. In conclusion, we demonstrated that HOTAIR contributes to 5FU resistance through suppressing miR-218 and activating NF-κB signaling in CRC. Thus, HOTAIR may serve as a promising therapeutic target for CRC patients.

  3. 12 CFR 218.700 - Defined terms relating to the networking exception from the definition of “broker.”

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Defined terms relating to the networking... THE SECURITIES EXCHANGE ACT OF 1934 (REGULATION R) § 218.700 Defined terms relating to the networking... (“Networking”) Exception from the definition of the term “broker” in section 3(a)(4)(B)(i) of the Act (15 U.S.C...

  4. 12 CFR 218.701 - Exemption from the definition of “broker” for certain institutional referrals.

    Science.gov (United States)

    2010-01-01

    ... GOVERNORS OF THE FEDERAL RESERVE SYSTEM EXCEPTIONS FOR BANKS FROM THE DEFINITION OF BROKER IN THE SECURITIES EXCHANGE ACT OF 1934 (REGULATION R) § 218.701 Exemption from the definition of “broker” for certain... of “broker” under section 3(a)(4)(B)(i) of the Act (15 U.S.C. 78c(a)(4)(B)(i)), other than section 3...

  5. Body mass index reference charts for individuals with Down syndrome aged 2-18 years,

    Directory of Open Access Journals (Sweden)

    Fabio Bertapelli

    Full Text Available Abstract: Objective: To develop Brazilian growth charts for body mass index (BMI-for-age for individuals with Down syndrome (DS. The secondary objective was to compare the BMI-for-age with the Centers for Disease Control and Prevention standards (CDC. Methods: A retrospective and cross-sectional growth study of 706 youth with DS (56.7% males was performed in 51 centers in São Paulo state, Brazil. Weight and height were used to calculate the BMI (kg/m2. The LMS method was applied to construct the growth charts. Z-scores were based on the CDC 2000 growth standards. Results: The BMI-for-age reference charts showed excellent goodness of fit statistics for boys and girls with DS aged 2-18 years. At 2 years of age, the mean BMI Z-scores of boys and girls with DS were lower compared to those of the CDC (Z-score = −0.2. In contrast, children with DS aged 3-18 years had higher mean Z-scores for BMI-for-age when compared to those of the CDC (Z-scores = +0.2 to +1.3. Conclusions: The BMI of Brazilian youth with DS differs from those references established by CDC. These are the first Brazilian BMI-for-age charts for individuals with DS and will hopefully guide clinicians and parents in the evaluation and management of the nutritional status in children and adolescents with DS in Brazil.

  6. Identification of growing bacteria during litter decomposition in freshwater through H218O quantitative stable isotope probing.

    Science.gov (United States)

    Hayer, Michaela; Schwartz, Egbert; Marks, Jane C; Koch, Benjamin J; Morrissey, Ember M; Schuettenberg, Alexa A; Hungate, Bruce A

    2016-12-01

    Identification of microorganisms that facilitate the cycling of nutrients in freshwater is paramount to understanding how these ecosystems function. Here, we identify growing aquatic bacteria using H218O quantitative stable isotope probing. During 8 day incubations in 97 atom % H218O, 54% of the taxa grew. The most abundant phyla among growing taxa were Proteobacteria (45%), Bacteroidetes (30%) and Firmicutes (10%). Taxa differed in isotopic enrichment, reflecting variation in DNA replication of bacterial populations. At the class level, the highest atom fraction excess was observed for OPB41 and δ-Proteobacteria. There was no linear relationship between 18 O incorporation and abundance of taxa. δ-Proteobacteria and OPB41 were not abundant, yet the DNA of both taxa was highly enriched in 18 O. Bacteriodetes, in contrast, were abundant but not highly enriched. Our study shows that a large proportion of the bacterial taxa found on decomposing leaf litter grew slowly, and several low abundance taxa were highly enriched. These findings indicating that rare organisms may be important for the decomposition of leaf litter in streams, and that quantitative stable isotope probing with H218O can be used to advance our understanding of microorganisms in freshwater by identifying species that are growing in complex communities. © 2016 Society for Applied Microbiology and John Wiley & Sons Ltd.

  7. Phosphothreonine 218 is required for the function of SR45.1 in regulating flower petal development in Arabidopsis.

    Science.gov (United States)

    Zhang, Xiao-Ning; Mo, Cecilia; Garrett, Wesley M; Cooper, Bret

    2014-01-01

    RNA splicing is crucial to the production of mature mRNAs (mRNA). In Arabidopsis thaliana, the protein Arginine/Serine-rich 45 (SR45) acts as an RNA splicing activator and initiates the spliceosome assembly. SR45 is alternatively spliced into 2 isoforms. Isoform 1 (SR45.1) plays an important role in the flower petal development whereas isoform 2 (SR45.2) is important for root growth. In this study, we used immunoprecipitation to isolate an SR45.1-GFP fusion protein from transgenic plants complementing a null mutant, sr45-1. Mass spectrometry suggested a single phosphorylation event in a peptide from the alternatively spliced region unique to SR45.1. Substituting alanine for threonine 218, a candidate site for phosphorylation, did not complement the sr45-1 mutant with narrow flower petals whereas substituting aspartic acid or glutamic acid for threonine 218 did complement the sr45-1 mutant. Mass spectrometry also revealed that other proteins involved in the spliceosome co-precipitated with SR45.1, and RT-qPCR revealed that phosphorylation of threonine 218 promotes the function of SR45.1 in promoting the constitutive splicing of SR30 mRNA. This is the first demonstration of a specific phosphorylation site that differentially regulates the function of a plant splicing activator in physiologically and morphologically distinct plant tissues.

  8. Paxillin promotes tumor progression and predicts survival and relapse in oral cavity squamous cell carcinoma by microRNA-218 targeting.

    Science.gov (United States)

    Wu, De-Wei; Chuang, Chun-Yi; Lin, Wea-Long; Sung, Wen-Wei; Cheng, Ya-Wen; Lee, Huei

    2014-08-01

    High-risk human papillomavirus (HPV) 16-infected oral cavity squamous cell carcinoma (OCSCC) differs significantly from non-HPV-infected OCSCC. However, the molecular pathogenesis of HPV-infected OCSCC remains unclear. Paxillin (PXN) has been reported to promote lung tumor progression by miR-218 targeting. In addition, expression of miR-218 has been shown to be reduced by HPV16 E6 in cervical cancer. We thus asked whether PXN can promote tumor progression by E6-reduced miR-218 in OCSCC, especially in HPV-infected OCSCC. Mechanistic studies demonstrated that PXN expression increased markedly upon E6-mediated reductions in miR-218, resulting in increased colony formation and invasion capabilities in HPV-infected OCSCC cells. Among tumor specimens, HPV16/18 infection was negatively associated with miR-218 expression and positively associated with PXN expression. Kaplan-Meier and Cox regression models demonstrated that patients with low-miR-218 tumors or high-PXN tumors exhibited shorter overall survival (OS) and relapse-free survival (RFS) than those with high-miR-218 tumors or low-PXN tumors. Interestingly, HPV-infected patients with low-miR-218, high-PXN tumors and both combinations exhibited the worst OS and RFS compared with patients in their counterparts. These observations in patients were consistent with the findings from the cell model. Therefore, we suggest that PXN might be targeted to suppress tumor progression and consequently to improve outcomes in OCSCC, especially in HPV-infected OCSCC. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  9. miR-218 inhibits the migration and invasion of glioma U87 cells through the Slit2-Robo1 pathway.

    Science.gov (United States)

    Gu, Jian-Jun; Gao, Guang-Zhong; Zhang, Shi-Ming

    2015-04-01

    Malignant gliomas are the most common primary brain tumors in adults and are associated with the highest mortality rate. Glioma invasion is one of the most notable causes of the poor prognosis of this cancer. Preventing the invasive behavior of malignant glioma cells by altering effector molecules can significantly improve the prognosis of a patient. microRNAs (miRNAs) are small noncoding RNAs, ~22 nucleotides in length, that are able to function as oncogenes or tumor suppressors in human cancer. In the present study, the expression level of miRNA 218 (miR-218) was found to be markedly downregulated in glioma cell lines and human primary glioma tissues. miR-218 upregulation was found to dramatically reduce the migratory speed and invasive ability of glioma cells. Furthermore, it was demonstrated that ectopic expression of miR-218 in glioma cells resulted in the downregulation of roundabout, axon guidance receptor, homolog 1 (Robo1), upregulation of Slit homolog 2 (Slit2) and the expression of associated proteins following Robo1 knockdown by small interfering RNA. In addition, it was demonstrated that miR-218 inactivated the Slit2-Robo1 pathway through downregulating Robo1 expression by directly targeting the 3'-untranslated region (3'-UTR) of Robo1. The present results indicate that miR-218 plays important roles in preventing the invasiveness of glioma cells, and reveals a novel mechanism of miRNA-mediated direct suppression of the Slit2-Robo1 pathway in glioma.

  10. Numerical Investigations of the Deposition of Unattached {sup 218}Po and {sup 212}Pb from Natural Convection Enclosure Flow

    Energy Technology Data Exchange (ETDEWEB)

    Nazaroff, W.W.; Kong, D.; Gadgil, A.J.

    1992-02-01

    We report numerical predictions of the deposition to enclosure surfaces of unattached {sup 218}Po and {sup 212}Pb, short-lived decay products of {sup 222}Rn and {sup 220}Rn, respectively. The simulations are conducted for square and rectangular two-dimensional enclosures under laminar natural convection flow with Grashof numbers in the range 7 x 10{sup 7} to 8 x 10{sup 10}. The predictions are based upon a finite-difference natural-convection fluid-mechanics model that has been extended to simulate the behavior of indoor radon decay products. In the absence of airborne particles, the deposition velocity averaged over the enclosure surface was found to be in the range (2-4) x 10{sup -4} m s{sup -1} for {sup 218}Po and (1-3) x 10{sup -4} m s{sup -1} for {sup 212}Pb. In each simulation, the deposition rate varied by more than an order of magnitude around the surface of the enclosure with the largest rates occurring near corners. Attachment of decay products to airborne particles increased the deposition velocity; for example, attachment of {sup 218}Po at a rate of 50 h{sup -1} increased the predicted average deposition velocity by 30-70% over values in the absence of attachment. The simulation results have significance for assessing the health risk associated with indoor exposure to {sup 222}Rn and {sup 220}Rn decay products and for investigating the more general problem of the interaction of air pollutants with indoor surfaces.

  11. An Analysis of 34,218 Pediatric Outpatient Controlled Substance Prescriptions.

    Science.gov (United States)

    George, Jessica A; Park, Paul S; Hunsberger, Joanne; Shay, Joanne E; Lehmann, Christoph U; White, Elizabeth D; Lee, Benjamin H; Yaster, Myron

    2016-03-01

    Prescription errors are among the most common types of iatrogenic errors. Because of a previously reported 82% error rate in handwritten discharge narcotic prescriptions, we developed a computerized, web-based, controlled substance prescription writer that includes weight-based dosing logic and alerts to reduce the error rate to (virtually) zero. Over the past 7 years, >34,000 prescriptions have been created by hospital providers using this platform. We sought to determine the ongoing efficacy of the program in prescription error reduction and the patterns with which providers prescribe controlled substances for children and young adults (ages 0-21 years) at hospital discharge. We examined a database of 34,218 controlled substance discharge prescriptions written by our institutional providers from January 1, 2007 to February 14, 2014, for demographic information, including age and weight, type of medication prescribed based on patient age, formulation of dispensed medication, and amount of drug to be dispensed at hospital discharge. In addition, we randomly regenerated 2% (700) of prescriptions based on stored data and analyzed them for errors using previously established error criteria. Weights that were manually entered into the prescription writer by the prescriber were compared with the patient's weight in the hospital's electronic medical record. Patients in the database averaged 9 ± 6.1 (range, 0-21) years of age and 36.7 ± 24.9 (1-195) kg. Regardless of age, the most commonly prescribed opioid was oxycodone (73%), which was prescribed as a single agent uncombined with acetaminophen. Codeine was prescribed to 7% of patients and always in a formulation containing acetaminophen. Liquid formulations were prescribed to 98% of children 12 years of age (the remaining 84% received tablet formulations). Regardless of opioid prescribed, the amount of liquid dispensed averaged 106 ± 125 (range, 2-3240) mL, and the number of tablets dispensed averaged 51 ± 51 (range

  12. Identification of a Toluene-Degrading Bacterium from a Soil Sample through H218O DNA Stable Isotope Probing ▿†

    Science.gov (United States)

    Woods, Angela; Watwood, Maribeth; Schwartz, Egbert

    2011-01-01

    DNA stable isotope probing (DNA-SIP) with H218O was used to identify a toluene-degrading bacterium in soil amended with 48 ppm toluene. After quantification of toluene degradation rates in soil, DNA was extracted from soil incubated with H218O, H216O, H216O and 48 ppm toluene, or H218O and 48 ppm toluene. A single DNA band formed along a cesium chloride gradient after isopycnic centrifugation of extracts from soils incubated with H216O. With extracts from soils to which only H218O was added, two distinct DNA bands formed, while three bands formed when DNA extracted from soil incubated with both H218O and toluene was analyzed. We suggest that this third band formed because toluene does not contain any oxygen atoms and toluene-degrading organisms had to transfer oxygen atoms from H218O into metabolic intermediates to form nucleic acids de novo. We extracted the third DNA band and amplified a large fraction of the bacterial 16S rRNA gene. Direct sequencing of the PCR product obtained from the labeled DNA, as well as cloned 16S rRNA amplicons, identified a known toluene degrader, Rhodococcus jostii RHA1. A toluene-degrading bacterial strain was subsequently isolated from soil and shown to be Rhodococcus jostii RHA1. Finally, quantitative real-time PCR analysis showed that the abundance of the 16S rRNA gene of Rhodococcus jostii RHA1 increased in soil after toluene exposure but not in soils from which toluene was withheld. This study indicates that H218O DNA-SIP can be a useful method for identifying pollutant-degrading bacteria in soil. PMID:21742928

  13. Novel one-pot one-step synthesis of 2'-[(18)F]fluoroflumazenil (FFMZ) for benzodiazepine receptor imaging.

    Science.gov (United States)

    Yoon, Young Hyun; Jeong, Jae Min; Kim, Hyung Woo; Hong, Sung Hyun; Lee, Yun-Sang; Kil, Hee Sup; Chi, Dae Yoon; Lee, Dong Soo; Chung, June-Key; Lee, Myung Chul

    2003-07-01

    We describe the synthesis of 2'-[(18)F]fluoroflumazenil (FFMZ), which differs from the typically used [(18)F]fluoroethylflumazenil (FEFMZ) for benzodiazepine receptor imaging. For one-pot one-step labeling, the precursors, 2'-tosyloxyflumazenil (TFMZ) and 2'-mesyloxyflumazenil (MFMZ), were synthesized in three steps. The precursors were successfully labeled with no-carrier-added (18)F-fluoride which was activated by repeated azeotropic distillation with Kryptofix 2.2.2./potassium carbonate in MeCN. An automated system for labeling and purification of [(18)F]FFMZ was developed. Labeling efficiency and radiochemical purity of [(18)F]FFMZ after synthesis by the automated system were 68% and 98%, respectively. Specific binding of [(18)F]FFMZ to central benzodiazepine receptor of rats was demonstrated by phosphoimaging.

  14. A Yeast Toxic Mutant of HET-s(218-289) Prion Displays Alternative Intermediates of Amyloidogenesis

    Science.gov (United States)

    Berthelot, Karine; Lecomte, Sophie; Géan, Julie; Immel, Françoise; Cullin, Christophe

    2010-01-01

    Amyloids are thought to be involved in various types of neurodegenerative disorders. Several kinds of intermediates, differing in morphology, size, and toxicity, have been identified in the multistep amyloidogenesis process. However, the mechanisms explaining amyloid toxicity remain unclear. We previously generated a toxic mutant of the nontoxic HET-s(218-289) amyloid in yeast. Here we report that toxic and nontoxic amyloids differ not only in their structures but also in their assembling process. We used multiple and complementary methods to investigate the intermediates formed by these two amyloids. With the methods used, no intermediates were observed for the nontoxic amyloid; however, under the same experimental conditions, the toxic mutant displayed visible oligomeric and fibrillar intermediates. PMID:20713008

  15. Partially-deuterated samples of HET-s(218–289) fibrils: assignment and deuterium isotope effect

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Albert A.; Ravotti, Francesco; Testori, Emilie; Cadalbert, Riccardo; Ernst, Matthias, E-mail: maer@ethz.ch [ETH Zürich, Physical Chemistry (Switzerland); Böckmann, Anja, E-mail: a.bockmann@ibcp.fr [Institut de Biologie et Chimie des Protéines, Bases Moléculaires et Structurales des Systèmes Infectieux, Labex Ecofect, UMR 5086 CNRS, Université de Lyon (France); Meier, Beat H., E-mail: beme@ethz.ch [ETH Zürich, Physical Chemistry (Switzerland)

    2017-02-15

    Fast magic-angle spinning and partial sample deuteration allows direct detection of {sup 1}H in solid-state NMR, yielding significant gains in mass sensitivity. In order to further analyze the spectra, {sup 1}H detection requires assignment of the {sup 1}H resonances. In this work, resonance assignments of backbone H{sup N} and Hα are presented for HET-s(218–289) fibrils, based on the existing assignment of Cα, Cβ, C’, and N resonances. The samples used are partially deuterated for higher spectral resolution, and the shifts in resonance frequencies of Cα and Cβ due to the deuterium isotope effect are investigated. It is shown that the deuterium isotope effect can be estimated and used for assigning resonances of deuterated samples in solid-state NMR, based on known resonances of the protonated protein.

  16. Partially-deuterated samples of HET-s(218-289) fibrils: assignment and deuterium isotope effect.

    Science.gov (United States)

    Smith, Albert A; Ravotti, Francesco; Testori, Emilie; Cadalbert, Riccardo; Ernst, Matthias; Böckmann, Anja; Meier, Beat H

    2017-02-01

    Fast magic-angle spinning and partial sample deuteration allows direct detection of 1H in solid-state NMR, yielding significant gains in mass sensitivity. In order to further analyze the spectra, 1H detection requires assignment of the 1H resonances. In this work, resonance assignments of backbone HN and Hα are presented for HET-s(218-289) fibrils, based on the existing assignment of Cα, Cβ, C', and N resonances. The samples used are partially deuterated for higher spectral resolution, and the shifts in resonance frequencies of Cα and Cβ due to the deuterium isotope effect are investigated. It is shown that the deuterium isotope effect can be estimated and used for assigning resonances of deuterated samples in solid-state NMR, based on known resonances of the protonated protein.

  17. Integrative bioinformatics analysis identifies ROBO1 as a potential therapeutic target modified by miR-218 in hepatocellular carcinoma.

    Science.gov (United States)

    Wang, Junqing; Zhou, Yunyun; Fei, Xiaochun; Chen, Xunhua; Chen, Rui; Zhu, Zhenggang; Chen, Yongjun

    2017-09-22

    Patients diagnosed with advanced hepatocellular carcinoma (HCC) presented poor prognosis and short survival time. Althouth accumulating contribution of continuous research has gradually revealed complex tumorigenesis mechanism of HCC with numerous and jumbled biomarkers, those specific ones for HCC diagnose and therapeutic treatment are required illustration. Multiple genes over-expressed in HCC specimens with at least 1.5 fold change were cohorted, compared with the non-cancerous tissues through integrative bioinformatics analysis from Gene Expression Omnibus (GEO) datasets GSE14520 and GSE6764, including 445 and 45 cases of samples spearatly, along with intensive exploration on the Cancer Genome Altas (TCGA) dataset of liver cancer. Thirteen genes significantly highly expressed, overlapping in the datasets above. The Database for Annotation Visualization and Integrated Discovery (DAVID) program was utilized for functional pathway enrichment analysis. Protein-protein Interaction (PPI) analysis was conducted through the Search Tool for the Retrieval of Interacting Genes (STRING) database. ROBO1 was highlighted as one of the most probable molecules among the 13 candidates participating in cancer process. Cancer Cell Line Encycolopedia (CCLE) database was utilized exploring ROBO1 expression in cell lines. Immunochemistry analysis and qRT-PCR assay were performed in our medical center, which indicates significant over-expression status in either HCC tumor specimens and 3 HCC cell lines. Furtherly, we recognized that miR-218, a tumor suppressor, might be an upstream regulator for ROBO1 directly binding to the mRNA 3'UTR and potentially modifying the expression and function of ROBO1. Herein, we conclude that ROBO1 is a mighty therapeutic targets modified by miR-218 in HCC deserving further investigation.

  18. 31 CFR 585.218 - Trade in United Nations Protected Areas of Croatia and those areas of the Republic of Bosnia and...

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Trade in United Nations Protected... HERZEGOVINA SANCTIONS REGULATIONS Prohibitions § 585.218 Trade in United Nations Protected Areas of Croatia... importation from, exportation to, or transshipment of goods through the United Nations Protected Areas in the...

  19. Whole-Genome Sequences of the Archetypal K1 Escherichia coli Neonatal Isolate RS218 and Contemporary Neonatal Bacteremia Clinical Isolates SCB11, SCB12, and SCB15

    OpenAIRE

    Day, Michael W.; Jackson, Lydgia A.; Akins, Darrin R.; Dyer, David W.; Chavez-Bueno, Susana

    2015-01-01

    Neonatal bacteremia Escherichia?coli strains commonly belong to the K1 capsular type. Their ability to cause invasive neonatal disease appears to be determined by other virulence factors that have yet to be identified. We report here the genome sequences of four E.?coli neonatal bacteremia isolates, including that of the archetypal strain RS218.

  20. Association between A218C polymorphism of the tryptophan-hydroxylase-1 gene, harm avoidance and binge eating behavior in bulimia nervosa.

    Science.gov (United States)

    Monteleone, Palmiero; Tortorella, Alfonso; Martiadis, Vassilis; Serino, Ismene; Di Filippo, Carmela; Maj, Mario

    2007-06-21

    Genes involved in serotonin transmission are likely involved in the biological predisposition to bulimia nervosa. We investigated whether the A218C polymorphism of the tryptophan-hydroxylase-1 gene was associated to bulimia nervosa and/or to some phenotypic aspects of the disorder. One hundred eighty Caucasian women (91 patients with bulimia nervosa and 89 healthy controls) were enrolled into the study. They underwent a blood sample collection for A218C polymorphism of the tryptophan-hydroxylase-1 genotyping and a clinical evaluation assessing comorbidity for Axis I and II psychiatric disorders, harm avoidance personality dimension and bulimic symptoms. The distribution of both tryptophan-hydroxylase-1 A218C genotypes and alleles did not significantly differ between patients and controls. Bulimic women with the AA genotype exhibited a more severe binge eating behavior and higher harm avoidance scores than those with CC genotype. These findings support the idea that tryptophan-hydroxylase-1 A218C polymorphism does not play a part in the genetic susceptibility to bulimia nervosa, but it seems to be involved in predisposing bulimic patients to a more disturbed eating behavior and higher harm avoidance.

  1. Bacillus velezensis RC 218 as a biocontrol agent to reduce Fusarium head blight and deoxynivalenol accumulation: Genome sequencing and secondary metabolite cluster profiles

    Science.gov (United States)

    Bacillus velezensis RC 218 was originally isolated for the anthers of wheat as a potential antagonist of Fusarium graminearium, the causal agent of Fusarium head blight. It was demonstrated to have antagonist activity against the plant pathogen with in vitro and greenhouse assays. The current study ...

  2. The usefulness of dynamic O-(2-18F-fluoroethyl)-L-tyrosine PET in the clinical evaluation of brain tumors in children and adolescents

    DEFF Research Database (Denmark)

    Dunkl, Veronika; Cleff, Corvin; Stoffels, Gabriele

    2015-01-01

    UNLABELLED: Experience regarding O-(2-(18)F-fluoroethyl)-L-tyrosine ((18)F-FET) PET in children and adolescents with brain tumors is limited. METHODS: Sixty-nine (18)F-FET PET scans of 48 children and adolescents (median age, 13 y; range, 1-18 y) were analyzed retrospectively. Twenty-six scans to...

  3. Factors associated with upper respiratory tract disease caused by feline herpesvirus, feline calicivirus, Chlamydophila felis and Bordetella bronchiseptica in cats: experience from 218 European catteries

    NARCIS (Netherlands)

    Helps, C.R.; Lait, P.; Damhuis, A.; Björnehammar, U.; Bolta, D.; Brovida, C.; Chabanne, L.; Egberink, H.; Ferrand, G.; Fontbonne, A.; Pennisi, M.G.; Gruffydd-Jones, T.; Gunn-Moore, D.; Hartmann, K.; Lutz, H.; Malandain, E.; Möstl, K.; Stengel, C.; Harbour, D.A.; Graat, E.A.M.

    2005-01-01

    A full history of the management practices and the prevalence of upper respiratory tract disease (URTD) at 218 rescue shelters, breeding establishments and private households with five or more cats was recorded. Oropharyngeal and conjunctival swabs and blood samples were taken from 1748 cats. The

  4. CRYSTAL-STRUCTURE OF DEOXYGENATED LIMULUS-POLYPHEMUS SUBUNIT-II HEMOCYANIN AT 2.18-ANGSTROM RESOLUTION - CLUES FOR A MECHANISM FOR ALLOSTERIC REGULATION

    NARCIS (Netherlands)

    HAZES, B; MAGNUS, KA; BONAVENTURA, C; BONAVENTURA, J; DAUTER, Z; KALK, KH; HOL, WGJ

    The crystal structure of Limulus polyphemus subunit type II hemocyanin in the deoxygenated state has been determined to a resolution of 2.18 angstrom. Phase information for this first structure of a cheliceratan hemocyanin was obtained by molecular replacement using the crustacean hemocyanin

  5. The anti-ErbB2 antibody H2-18 and the pan-PI3K inhibitor GDC-0941 effectively inhibit trastuzumab-resistant ErbB2-overexpressing breast cancer.

    Science.gov (United States)

    Wang, Lingfei; Yu, Xiaojie; Wang, Chao; Pan, Shujun; Liang, Beibei; Zhang, Yajun; Chong, Xiaodan; Meng, Yanchun; Dong, Jian; Zhao, Yirong; Yang, Yang; Wang, Huajing; Gao, Jie; Wei, Huafeng; Zhao, Jian; Wang, Hao; Hu, Chaohua; Xiao, Wenze; Li, Bohua

    2017-08-08

    Trastuzumab, an anti-ErbB2 humanized antibody, brings benefit to patients with ErbB2-amplified metastatic breast cancers. However, the resistance to trastuzumab is common. Our previously reported H2-18, an anti-ErbB2 antibody, potently induced programmed cell death in trastuzumab-resistant breast cancer cells. Here, we aim to investigate the antitumor efficacy of H2-18 in combination with the pan-PI3K inhibitor GDC-0941 in trastuzumab-resistant breast cancer cell lines. The results showed that H2-18 and GDC-0941 synergistically inhibited the in vitro proliferation of BT-474, SKBR-3, HCC-1954 and HCC-1419 breast cancer cells. H2-18 plus GDC-0941 showed significantly enhanced programmed cell death-inducing activity compared with each drug used alone. The combination of H2-18 and GDC-0941 did not increase the effect of single agent on ROS production, cell cycle and ErbB2 signaling. Importantly, the in vivo antitumor efficacy of H2-18 plus GDC-0941 was superior to that of single agent. Thus, the enhanced in vivo antitumor efficacy of H2-18 plus GDC-0941 may mainly be attributable to its increased programmed cell death-inducing activity. Collectively, H2-18 plus GDC-0941 could effectively inhibit tumor growth, suggesting the potential to be translated into clinic as an efficient strategy for ErbB2-overexpressing breast cancers.

  6. Evaluation of surgical outcome of Jack vertebral dilator kyphoplasty for osteoporotic vertebral compression fracture-clinical experience of 218 cases.

    Science.gov (United States)

    Fan, Jin; Shen, Yimin; Zhang, Ning; Ren, Yongxin; Cai, Weihua; Yu, Lipeng; Wu, Naiqing; Yin, Guoyong

    2016-04-30

    Osteoporotic vertebral compression fracture is a serious complication of osteoporosis. Various vertebral kyphoplasty surgeries, which have their own unique features, are commonly used for osteoporotic vertebral compression fracture. Based on the anatomic property of the thoracolumbar vertebral pedicle that its horizontal diameter is twice that of the vertical diameter, we designed Jack vertebral dilator for better restoration of the vertebral height by manipulating the mechanical force. A total of 218 patients (236 vertebrae) with osteoporotic vertebral compression fracture were treated with Jack vertebral dilator. Surgery was successfully completed in all cases, and all the 218 patients were followed up for an average of 14.2 months (range 3 to 30 months). Bone cement leakage occurred in 12 cases, but no symptoms were reported. No other complications were noticed. The VAS scores were 8.2 ± 1.3, 1.7 ± 0.9, and 1.8 ± 0.8 and the ODI was 78.2 ± 13.3 %, 18.5 ± 7.3 %, and 20.9 ± 6.8 % before surgery and 1 week after surgery and at the final follow-up, respectively. The anterior vertebral body height was 19.3 ± 3.2, 25.1 ± 2.6, and 24.9 ± 2.6 mm and the central vertebral body height was 18.7 ± 3.0, 24.8 ± 3.0, and 24.5 ± 2.9 mm before surgery and 1 week after surgery and at the final follow-up, respectively. Cobb angle was 16.2° ± 6.6°, 8.1° ± 5.6°, and 8.5° ± 5.6° before surgery and 1 week after surgery and at the final follow-up, respectively. Jack vertebral dilator kyphoplasty for osteoporotic vertebral compression fracture is safe, feasible, and effective and has the prospect of further broad application in the future.

  7. Odontogenic tumors: a collaborative study of 218 cases diagnosed over 12 years and comprehensive review of the literature.

    Science.gov (United States)

    Sekerci, Ahmet-Ercan; Nazlim, Sinan; Etoz, Meryem; Deniz, Kemal; Yasa, Yasin

    2015-01-01

    The objective of this study was to analyze the frequency and distribution of odontogenic tumors (OTs) in the Cappadocia region of Turkey, and to compare the findings with those reported in the literature. The records of the Oral and Maxillofacial Surgery and Pathology Departments at Erciyes University, with histologic diagnosis of odontogenic tumors (based on the World Health Organization classification, 2005), over a 12-year period, were analyzed. The relative frequency of different types of tumors was also analyzed and compared with the literature. OTs in the present study constituted 2.74% of all the 7,942 registered biopsies. A total of 218 cases of OTs were collected and reviewed. Of these, (94.04%) were benign and (5.96%) were malignant. The mandible was the most commonly affected anatomic location, with 170 cases (77.9%). Ameloblastoma with a predilection for the posterior mandible was the most frequent odontogenic tumor (30.28%), followed by keratocystic odontogenic tumor (19.5%), odontoma (13.4%), and odontogenic myxoma (8.5%). OTs are rare neoplasms and appear to show geographic variations in the world. In Cappadocia, Turkey, they are more common in the mandible, with ameloblastoma followed by keratocystic odontogenic tumors with the incidences observed in the present study being similar to those of previous studies from Asia and Africa, and in contrast to those reported from American countries.

  8. [Automated synthesis of 2-[(18)F]-fluoro-2-deoxy-D-glucose by on-column hydrolysis].

    Science.gov (United States)

    Luo, Lei; Tang, Ganghua; Tang, Xiaolan

    2009-11-01

    To study automated synthesis of 2-[(18)F]-fluoro-2-deoxy-D-glucose ((18)F-FDG) via on-column hydrolysis. Automated synthesis of (18)F-FDG was performed by the on-column hydrolysis procedure in TRACERlab FXF-N synthesizer. (18)F-FDG injection was obtained via nucleophilic fluorination of 1, 3, 4, 6-tetra-O-acetyl-2-O-trifluoromethanesulfony-beta-D-mannopyranose as the precursor molecule with (18)F-fluoride, hydrolysis of the (18)F-labeled intermediate on SEP-PAK C18 cartridges with 2 mol/L NaOH solution, and purification and neutralization with SEP-PAK cartridges. The uncorrected radiochemical yield of (18)F-FDG was more than 60% within the total synthesis time shorter than 20 min. The radiochemical purity of (18)F-FDG was above 99%. On-column hydrolysis is simple and practical for the automated synthesis of (18)F-FDG. (18)F-FDG injection produced by this procedure can be used in clinical PET imaging.

  9. No evidence of an association between A218C polymorphism of the tryptophan hydroxylase 1 gene and aggression in schizophrenia in a Korean population.

    Science.gov (United States)

    Kim, Youl-Ri; Lee, Joo Young; Min, Sung Kil

    2010-01-01

    We investigated the association between the tryptohan hydroxylase 1 (TPH1) gene and aggression in schizophrenia in a Korean population. The sample included 61 aggressive patients as well as 104 non-aggressive patients from psychiatric hospitals and 335 healthy volunteers in Korea. Blood samples were collected from all participants for TPH1 A218C genotyping. The patients were administered standard psychiatric interviews as well as a self-report questionnaire for anger-related traits. In the case-control phenotypic comparisons, there was no significant association between the aggressive patients and the TPH1 A218C polymorphism. There was no significant effect of the TPH1 genotype on the anger-related traits, or no significant interaction between the genotype and group (aggressive and non-aggressive patients). These findings suggest that TPH1 does not play a major role in aggressive behavior via anger in schizophrenic patients.

  10. First observation of the beta decay of neutron-rich $^{218}Bi$ by the pulsed-release technique and resonant laser ionization

    CERN Document Server

    De Witte, H; Borzov, I N; Caurier, E; Cederkäll, J; De Smet, A; Eckhaudt, S; Fedorov, D V; Fedosseev, V; Franchoo, S; Górska, M; Grawe, H; Huber, G; Huyse, M; Janas, Z; Köster, U; Kurcewicz, W; Kurpeta, J; Plochocki, A; Van Duppen, P; Van de Vel, K; Weissman, L

    2004-01-01

    The neutron-rich isotope /sup 218/Bi has been produced in proton- induced spallation of a uranium carbide target at the ISOLDE facility at CERN, extracted from the ion source by the pulsed-release technique and resonant laser ionization, and its beta decay is studied for the first time. A half-life of 33(1)s was measured and is discussed in the self-consistent continuum-quasi particle-random- phase approximation framework that includes Gamow-Teller and first- forbidden transitions. A level scheme was constructed for /sup 218 /Po, and a deexcitation pattern of stretched E2 transitions 8/sup +/ to 6/sup +/ to 4/sup +/ to 2/sup +/ to 0/sup +/ to the ground state is suggested. Shell-model calculations based on the Kuo-Herling interaction reproduce the experimental results satisfactorily. (28 refs).

  11. Fiber Diffraction of the Prion-Forming Domain HET-s(218-289) Shows Dehydration-Induced Deformation of a Complex Amyloid Structure

    Energy Technology Data Exchange (ETDEWEB)

    Wan, William; Stubbs, Gerald [Vanderbilt

    2014-05-01

    Amyloids are filamentous protein aggregates that can be formed by many different proteins and are associated with both disease and biological functions. The pathogenicities or biological functions of amyloids are determined by their particular molecular structures, making accurate structural models a requirement for understanding their biological effects. One potential factor that can affect amyloid structures is hydration. Previous studies of simple stacked β-sheet amyloids have suggested that dehydration does not impact structure, but other studies indicated dehydration-related structural changes of a putative water-filled nanotube. Our results show that dehydration significantly affects the molecular structure of the fungal prion-forming domain HET-s(218–289), which forms a β-solenoid with no internal solvent-accessible regions. The dehydration-related structural deformation of HET-s(218–289) indicates that water can play a significant role in complex amyloid structures, even when no obvious water-accessible cavities are present.

  12. Epigenetic silencing of microRNA-218 via EZH2-mediated H3K27 trimethylation is involved in malignant transformation of HBE cells induced by cigarette smoke extract.

    Science.gov (United States)

    Wang, Bairu; Liu, Yi; Luo, Fei; Xu, Yuan; Qin, Yu; Lu, Xiaolin; Xu, Wenchao; Shi, Le; Liu, Qizhan; Xiang, Quanyong

    2016-02-01

    Abnormal expression of miRNAs has been implicated in the pathogenesis of human lung cancers, most of which are attributable to cigarette smoke. The mechanisms of action, however, remain obscure. Here, we report that there are decreased expression of miR-218 and increased expression of EZH2 and H3K27me3 during cigarette smoke extract (CSE)-induced transformation of human bronchial epithelial (HBE) cells. Depletion of EZH2 by siRNA or by the EZH2 inhibitor, 3-deazaneplanocin A, attenuated CSE-induced decreases of miR-218 levels and increases of H3K27me3, which epigenetically controls gene transcription, and BMI1, an oncogene. Furthermore, ChIP assays demonstrated that EZH2 and H3K27me3 are enriched at the miR-218-1 promoter in HBE cells exposed to CSE, indicating that EZH2 mediates epigenetic silencing of miR-218 via histone methylation. In addition, miR-218 directly targeted BMI1, through which miR-218 ablates cancer stem cells (CSCs) self-renewal in transformed HBE cells. In CSE-transformed HBE cells, the protein level of Oct-4 and mRNA levels of CD133 and CD44, indicators of the acquisition of CSC-like properties, were reduced by over-expression of miR-218, and over-expression of miR-218 decreased the malignancy of transformed HBE cells. Thus, we conclude that epigenetic silencing of miR-218 via EZH2-mediated H3K27 trimethylation is involved in the acquisition of CSC-like properties and malignant transformation of HBE cells induced by CSE and thereby contributes to the carcinogenesis of cigarette smoke.

  13. Role of the hydrophobic and charged residues in the 218-226 region of apoA-I in the biogenesis of HDL.

    Science.gov (United States)

    Fotakis, Panagiotis; Kateifides, Andreas K; Gkolfinopoulou, Christina; Georgiadou, Dimitra; Beck, Melissa; Gründler, Katharina; Chroni, Angeliki; Stratikos, Efstratios; Kardassis, Dimitris; Zannis, Vassilis I

    2013-12-01

    We investigated the significance of hydrophobic and charged residues 218-226 on the structure and functions of apoA-I and their contribution to the biogenesis of HDL. Adenovirus-mediated gene transfer of apoA-I[L218A/L219A/V221A/L222A] in apoA-I⁻/⁻ mice decreased plasma cholesterol and apoA-I levels to 15% of wild-type (WT) control mice and generated pre-β- and α4-HDL particles. In apoA-I⁻/⁻ × apoE⁻/⁻ mice, the same mutant formed few discoidal and pre-β-HDL particles that could not be converted to mature α-HDL particles by excess LCAT. Expression of the apoA-I[E223A/K226A] mutant in apoA-I⁻/⁻ mice caused lesser but discrete alterations in the HDL phenotype. The apoA-I[218-222] and apoA-I[E223A/K226A] mutants had 20% and normal capacity, respectively, to promote ABCA1-mediated cholesterol efflux. Both mutants had ∼65% of normal capacity to activate LCAT in vitro. Biophysical analyses suggested that both mutants affected in a distinct manner the structural integrity and plasticity of apoA-I that is necessary for normal functions. We conclude that the alteration of the hydrophobic 218-222 residues of apoA-I disrupts apoA-I/ABCA1 interactions and promotes the generation of defective pre-β particles that fail to mature into α-HDL subpopulations, thus resulting in low plasma apoA-I and HDL. Alterations of the charged 223, 226 residues caused milder but discrete changes in HDL phenotype.

  14. Survey of 218 organic contaminants in groundwater derived from the world's largest untreated wastewater irrigation system: Mezquital Valley, Mexico.

    Science.gov (United States)

    Lesser, Luis E; Mora, Abrahan; Moreau, Cristina; Mahlknecht, Jürgen; Hernández-Antonio, Arturo; Ramírez, Aldo I; Barrios-Piña, Héctor

    2018-05-01

    The Mezquital Valley system is the world's oldest and largest example with regard to use of untreated wastewater for agricultural irrigation. Because of the artificial high recharge associated with the Mezquital Valley aquifers, groundwater is extracted for human consumption, and there are plans to use this groundwater as a water resource for Mexico City. Thus, this study analyzed 218 organic micro-contaminants in wastewater, springs, and groundwater from Mezquital Valley. Five volatile organic compounds (VOCs) and nine semi-volatile organic compounds (SVOCs) were detected in the wastewater used for irrigation. Only two SVOCs [bis-2-(ethylhexyl) phthalate and dibutyl phthalate] were detected in all the wastewater canals and groundwater sources, whereas no VOCs were detected in groundwater and springs. Of the 118 pharmaceutically active compounds (PhACs) and 7 reproductive hormones measured, 65 PhACs and 3 hormones were detected in the wastewater. Of these, metformin, caffeine, and acetaminophen account for almost sixty percent of the total PhACs in wastewater. Nevertheless, 23 PhACs were detected in groundwater sources, where the majority of these compounds have low detection frequencies. The PhACs sulfamethoxazole, N,N-diethyl-meta-toluamide, carbamazepine, and benzoylecgonine (primary cocaine metabolite) were frequently detected in groundwater, suggesting that although the soils act as a filter adsorbing and degrading the majority of the organic pollutant content in wastewater, these PhACs still reach the aquifer. Therefore, the presence of these PhACs, together with the high levels of the endocrine disruptor bis-2-(ethylhexyl) phthalate, indicate that water sources derived from the recharge of the studied aquifers may pose a risk to consumer health. Copyright © 2018 The Authors. Published by Elsevier Ltd.. All rights reserved.

  15. O-(2-[18F]fluoroethyl)-L-tyrosine PET combined with MRI improves the diagnostic assessment of cerebral gliomas.

    Science.gov (United States)

    Pauleit, Dirk; Floeth, Frank; Hamacher, Kurt; Riemenschneider, Markus J; Reifenberger, Guido; Müller, Hans-Wilhelm; Zilles, Karl; Coenen, Heinz H; Langen, Karl-Josef

    2005-03-01

    MRI is commonly used to determine the location and extent of cerebral gliomas. We investigated whether the diagnostic accuracy of MRI could be improved by the additional use of PET with the amino acid O-(2-[18F]fluoroethyl)-l-tyrosine (FET). In a prospective study, PET with FET and MRI was performed in 31 patients with suspected cerebral gliomas. PET and MRIs were co-registered and 52 neuronavigated tissue biopsies were taken from lesions with both abnormal MRI signal and increased FET uptake (match), as well as from areas with abnormal MR signal but normal FET uptake or vice versa (mismatch). Biopsy sites were labelled by intracerebral titanium pellets. The diagnostic performance for the identification of cellular tumour tissue was analysed for either MRI alone or MRI combined with FET PET using alternative free response receiver operating characteristic curves (ROCs). Histologically, 26 biopsy samples corresponded to cellular glioma tissue and 26 to peritumoral brain tissue. The diagnostic performance, as determined by the area under the ROC curve (Az), was Az = 0.80 for MRI alone and Az = 0.98 for the combined MRI and FET PET approach (P < 0.001). MRI yielded a sensitivity of 96% for the detection of tumour tissue but a specificity of only 53%, and combined use of MRI and FET PET yielded a sensitivity of 93% and a specificity of 94%. Combined use of MRI and FET PET in patients with cerebral gliomas significantly improves the identification of cellular glioma tissue and allows definite histological tumour diagnosis. Thus, our findings may have considerable impact on target selection for diagnostic biopsies as well as therapy planning.

  16. REVIEW ARTICLE 218

    African Journals Online (AJOL)

    boaz

    1) Financial resources were slow to arrive, 2) Political leadership did not appreciate the enormous consequences that even a small Ebola outbreak could have on civil institutions, 3) Lack of Nigerian health workers willing to care for Ebola because of a lack of information and training on how to care for Ebola patients, ...

  17. REVIEW ARTICLE 218

    African Journals Online (AJOL)

    boaz

    CONTAINMENT OF EBOLA – STEPS TO PREVENT SPREAD OF EMERGING INFECTIOUS DISEASES, THE. NIGERIA ... 1) Epidemiology/ Surveillance, 2) Case Management/ Infection Control, 3) Social mobilization, 4) Laboratory Services, 5) Point of Entry and 6) .... proven structures for the delivery of public health in.

  18. Heterogeneous Seeding of a Prion Structure by a Generic Amyloid Form of the Fungal Prion-forming Domain HET-s(218-289)

    Energy Technology Data Exchange (ETDEWEB)

    Wan, William; Bian, Wen; McDonald, Michele; Kijac, Aleksandra; Wemmer, David E.; Stubbs, Gerald [UCB; (Vanderbilt); (LBNL)

    2013-11-13

    The fungal prion-forming domain HET-s(218–289) forms infectious amyloid fibrils at physiological pH that were shown by solid-state NMR to be assemblies of a two-rung β-solenoid structure. Under acidic conditions, HET-s(218–289) has been shown to form amyloid fibrils that have very low infectivity in vivo, but structural information about these fibrils has been very limited. We show by x-ray fiber diffraction that the HET-s(218–289) fibrils formed under acidic conditions have a stacked β-sheet architecture commonly found in short amyloidogenic peptides and denatured protein aggregates. At physiological pH, stacked β-sheet fibrils nucleate the formation of the infectious β-solenoid prions in a process of heterogeneous seeding, but do so with kinetic profiles distinct from those of spontaneous or homogeneous (seeded with infectious β-solenoid fibrils) fibrillization. Several serial passages of stacked β-sheet-seeded solutions lead to fibrillization kinetics similar to homogeneously seeded solutions. Our results directly show that structural mutation can occur between substantially different amyloid architectures, lending credence to the suggestion that the processes of strain adaptation and crossing species barriers are facilitated by structural mutation.

  19. Retraction Statement: 'MicroRNA-218 increases cellular sensitivity to Rapamycin via targeting Rictor in cervical cancer' by Li J, Wang J, Wang Y, Qiu H.

    Science.gov (United States)

    2017-02-01

    The above article from APMIS, published online on 24 April 2015 in Wiley Online Library (wileyonlinelibrary.com) and in Volume 123, pp. 562-570, has been retracted by agreement between the authors, the journal Editors in Chief, Professors Bodil Norrild, Ben Vainer and Elisabeth Ralfkiaer, and John Wiley & Sons Ltd. The article has been retracted due to errors in the reported results. In this study, the authors used HeLa and SiHa cell lines to investigate the biological roles of miR-218. However, subsequently it emerged that the two cell lines were contaminated in the laboratory by other unknown cell lines. When repeating the experiments, it was found that the functions of miR-218 were not as significant as had been previously reported, especially its effects on rapamycin sensitivity. Reference Li J, Li X, Wang J, Wang Y, Qiu H. MicroRNA-218 increases cellular sensitivity to Rapamycin via targeting Rictor in cervical cancer. APMIS 2015; 123:562-570. doi: 10.1111/apm.12387. © 2016 APMIS. Published by John Wiley & Sons Ltd.

  20. Enhanced stability and permeation potential of nanoemulsion containing sefsol-218 oil for topical delivery of amphotericin B.

    Science.gov (United States)

    Hussain, Afzal; Samad, Abdus; Singh, Sandeep Kumar; Ahsan, Mohd Neyaz; Faruk, Abdul; Ahmed, Farhan Jalees

    2015-05-01

    To characterize the enhanced stability and permeation potential of amphotericin B nanoemulsion comprising sefsol-218 oil at varying pH and temperature of aqueous continuous phase. Several batches of amphotericin B loaded nanoemulsion were prepared and evaluated for their physical and chemical stability at different pH and temperature. Also, a comparative study of ex vivo drug permeation across the albino rat skin was investigated with commercial Fungisome® and drug solution at 37 °C for 24 h. The extent of drug penetrated through the rat skin was thereby evaluated using the confocal laser scanning microscopy (CLSM). The optimized nanoemulsion demonstrated the highest flux rate 17.85 ± 0.5 µg/cm(2)/h than drug solution (5.37 ± 0.01 µg/cm(2)/h) and Fungisome® (7.97 ± 0.01 µg/cm(2)/h). Ex vivo drug penetration mechanism from the developed formulations at pH 6.8 and pH 7.4 of aqueous phase pH using the CLSM revealed enhanced penetration. Ex vivo drug penetration studies of developed formulation comprising of CLSM revealed enhanced penetration in aqueous phase at pH 6.8 and 7.4. The aggregation behavior of nanoemulsion at both the pH was found to be minimum and non-nephrotoxic. The stability of amphotericin B was obtained in terms of pH, optical density, globular size, polydispersity index and zeta potential value at different temperature for 90 days. The slowest drug degradation was observed in aqueous phase at pH 7.4 with shelf life 20.03-folds higher when stored at 4 °C (3.8 years) and 5-fold higher at 25 °C (0.951 years) than at 40 °C. The combined results suggested that nanoemulsion may hold an alternative for enhanced and sustained topical delivery system for amphotericin B.

  1. PET with O-(2-18F-Fluoroethyl)-L-Tyrosine in peripheral tumors: first clinical results.

    Science.gov (United States)

    Pauleit, Dirk; Stoffels, Gabriele; Schaden, Winfried; Hamacher, Kurt; Bauer, Dagmar; Tellmann, Lutz; Herzog, Hans; Bröer, Stefan; Coenen, Heinz H; Langen, Karl-Josef

    2005-03-01

    O-(2-18F-Fluoroethyl)-L-Tyrosine (18F-FET) PET has shown promising results in brain tumor diagnosis. The aim of this prospective study was to evaluate 18F-FET PET in comparison with 18F-FDG PET in patients with peripheral tumors. Forty-four consecutive patients with suspected malignant tumors underwent 18F-FET PET and 18F-FDG PET within 7 d. Whole-body PET studies were performed 1 h after intravenous injection of 370 MBq of 18F-FET or 18F-FDG. Six patients were excluded from the analysis because a malignant tumor could not be verified. In 38 patients (7 with colorectal cancer, 6 with pancreatic cancer, 9 with head-neck cancer, 4 with lymphomas, 3 with lung cancer, 3 with ovarian cancer, 4 with breast cancer, and 2 with prostatic cancer), 18F-FET PET and 18F-FDG PET were compared. 18F-FET was positive in only 13 of 38 patients (8 with head-neck cancer, 3 with breast cancer, and 2 with lung cancer), whereas 18F-FDG exhibited increased uptake in 37 of 38 patients. All squamous cell carcinomas were found to be 18F-FET-positive tumors (8 head-neck cancer and 2 lung cancer), whereas most adenocarcinomas were found to be 18F-FET-negative tumors. In patients with colorectal cancer, pancreatic cancer, ovarian cancer, prostatic cancer, and lymphomas, no increased 18F-FET uptake could be identified. All lesions that exhibited increased 18F-FET uptake also showed increased 18F-FDG uptake. No additional lesion was identified by 18F-FET PET but not by 18F-FDG PET. A subgroup analysis of patients with head-neck carcinomas allowed a better distinction between malignant and inflammatory tissues with 18F-FET than with 18F-FDG. 18F-FET is inferior to 18F-FDG as a PET tracer for general tumor diagnosis. Our preliminary results suggest rather selective uptake of 18F-FET in squamous cell carcinomas. Compared with 18F-FDG PET, 18F-FET PET may allow a better distinction between tumors and inflammatory tissues in patients with squamous cell carcinomas.

  2. Prognostic value of O-(2-18F-fluoroethyl)-L-tyrosine PET and MRI in low-grade glioma.

    Science.gov (United States)

    Floeth, Frank W; Pauleit, Dirk; Sabel, Michael; Stoffels, Gabriele; Reifenberger, Guido; Riemenschneider, Markus J; Jansen, Paul; Coenen, Heinz H; Steiger, Hans-Jakob; Langen, Karl-Josef

    2007-04-01

    In glioma of World Health Organization (WHO) grade II (low-grade glioma), the natural course of a particular patient is not predictable and the treatment strategy is controversial. We determined prognostic factors in adult patients with untreated, nonenhancing, supratentorial low-grade glioma with special regard to PET using the amino acid O-(2-(18)F-fluoroethyl)-L-tyrosine ((18)F-FET) and MRI. In a prospective study, baseline (18)F-FET PET and MRI analyses were performed on 33 consecutive patients with histologically confirmed low-grade glioma. None of the patients had radiation or chemotherapy. Clinical, histologic, therapeutic (initial cytoreduction vs. biopsy), (18)F-FET uptake, and MRI morphologic parameters were analyzed for their prognostic significance. Statistical endpoints were clinical or radiologic tumor progression, malignant transformation to glioma of WHO grade III or IV (high-grade glioma), and death. Baseline (18)F-FET uptake and a diffuse versus circumscribed tumor pattern on MRI were highly significant predictors of prognosis (P < 0.01). By the combination of these prognostically significant variables, 3 major prognostic subgroups of low-grade glioma patients could be identified. The first of these subgroups was patients with circumscribed low-grade glioma on MRI without (18)F-FET uptake (n = 11 patients, progression in 18%, no malignant transformation and no death). The second subgroup was patients with circumscribed low-grade glioma with (18)F-FET uptake (n = 13 patients, progression in 46%, malignant transformation to a high-grade glioma in 15%, and death in 8%). The third subgroup was patients with diffuse low-grade glioma with (18)F-FET uptake (n = 9 patients, progression in 100%, malignant transformation to a high-grade glioma in 78%, and death in 56%). We conclude that baseline amino acid uptake on (18)F-FET PET and a diffuse versus circumscribed tumor pattern on MRI are strong predictors for the outcome of patients with low-grade glioma.

  3. MicroRNA-218 acts by repressing TNFR1-mediated activation of NF-κB, which is involved in MUC5AC hyper-production and inflammation in smoking-induced bronchiolitis of COPD.

    Science.gov (United States)

    Xu, Hui; Sun, Qian; Lu, Lu; Luo, Fei; Zhou, Liang; Liu, Jianping; Cao, Lei; Wang, Qiushi; Xue, Junchao; Yang, Qianlei; Yang, Ping; Lu, Jiachun; Xiang, Quanyong; Liu, Qizhan

    2017-10-05

    Dysregulation of microRNAs (miRNAs) has been implicated in the pathogenesis of chronic obstructive pulmonary disease (COPD), which is largely attributable to cigarette smoke (CS). However, little is known about the effect of miRNAs on CS-induced mucus hypersecretion and the inflammatory response in the airway epithelium, which are pathological characteristics of COPD-related chronic bronchiolitis. As determined in the present investigation, population-based data indicate that smokers with COPD had serious airflow obstruction and inflammation, whereas smokers without COPD had mild airflow obstruction and inflammation. Moreover, levels of serum miR-218 positively correlated with FEV1/FVC% and negatively correlated with levels of serum IL-6 and IL-8. In human bronchial epithelial (HBE) cells, cigarette smoke extract (CSE) decreased miR-218 levels and increased levels of MUC5AC, interleukin-6 (IL-6), interleukin-8 (IL-8), tumor necrosis factor receptor 1 (TNFR1), and p-p65. Enhancement of miR-218 levels by an miR-218 mimic blocked these CSE-induced changes. Moreover, luciferase reporter assays confirmed that miR-218 bound to the 3'UTR region of TNFR1 mRNA. Down-regulation of TNFR1 blocked the CSE-induced increases of MUC5AC, IL-6, and IL-8 and the activation of NF-κB. Furthermore, over-expression of miR-218 attenuated the CSE-induced overproduction of MUC5AC, IL-6, and IL-8, effects that were reversed by elevated expression of TNFR1. In sum, our findings provide a mechanism by which miR-218 regulates CSE-induced MUC5AC hyper-production and inflammation by targeting TNFR1-mediated activation of NF-κB, indicating that overexpression of miR-218 may be a strategy against cigarette smoking-induced bronchiolitis in COPD. Copyright © 2017. Published by Elsevier B.V.

  4. One-step radiosynthesis of 4-nitrophenyl 2-[(18) F]fluoropropionate ([(18) F]NFP); improved preparation of radiolabeled peptides for PET imaging.

    Science.gov (United States)

    Haskali, Mohammad B; Roselt, Peter D; Karas, John A; Noonan, Wayne; Wichmann, Christian W; Katsifis, Andrew; Hicks, Rodney J; Hutton, Craig A

    2013-12-01

    The versatile (18) F-labeled prosthetic group, 4-nitrophenyl 2-[(18) F]fluoropropionate ([(18) F]NFP), was synthesized in a single step in 45 min from 4-nitrophenyl 2-bromopropionate, with a decay corrected radiochemical yield of 26.2% ± 2.2%. Employing this improved synthesis of [(18) F]NFP, [(18) F]GalactoRGD - the current 'gold standard' tracer for imaging the expression of αV β3 integrin - was prepared with high specific activity in 90 min and 20% decay corrected radiochemical yield from [(18) F]fluoride. Copyright © 2013 John Wiley & Sons, Ltd.

  5. Asp218 participates with Asp213 to bind a Ca2+ atom into the S1 subsite of aminopeptidase A: a key element for substrate specificity.

    Science.gov (United States)

    Claperon, Cédric; Rozenfeld, Raphael; Iturrioz, Xavier; Inguimbert, Nicolas; Okada, Mayumi; Roques, Bernard; Maigret, Bernard; Llorens-Cortes, Catherine

    2008-11-15

    APA (aminopeptidase A; EC 3.4.11.7) is a membrane-bound zinc metallopeptidase, also activated by Ca(2+), involved in the formation of brain angiotensin III, which exerts a tonic stimulatory action on the central control of blood pressure in hypertensive animals. In the present study, in the three-dimensional model of the ectodomain of mouse APA, we docked the specific APA inhibitor glutamate phosphonate, in the presence of Ca(2+). The model showed the presence of one Ca(2+) atom in an hydrophilic pocket corresponding to the S1 subsite in which the lateral chain of the inhibitor is pointing. In this pocket, the Ca(2+) atom was hexaco-ordinated with the acidic side chains of Asp(213) and Asp(218), the carbonyl group of Glu(215) and three water molecules, one of them being engaged in a hydrogen bond with the negatively charged carboxylate side chain of the inhibitor. Mutagenic replacement of Asp(213) and Asp(218) with a conservative residue maintained the ability of mutated APAs to be activated by Ca(2+). However, the replacement by a non-conservative residue abolished this property, demonstrating the crucial role of these residues in Ca(2+) binding. We also showed the involvement of these residues in the strict specificity of APA in the presence of Ca(2+) for N-terminal acidic residues from substrates or inhibitors, since mutagenic replacement of Asp(213) and Asp(218) induced a decrease of the inhibitory potencies of inhibitors homologous with acidic residues. Finally, this led to the rational design of a new potent APA inhibitor, NI926 (K(i)=70 nM), which allowed us to precisely localize Asp(213) at the entrance and Asp(218) at the bottom of the S1 subsite. Taken together, these data provide new insight into the organization and functional role of the APA S1 subsite and will allow the design of pharmacophore of the inhibitor, helpful for the development of a new generation of APA inhibitors as central-acting antihypertensive agents.

  6. Freshwater balance and the sources of deep and bottom waters in the Arctic Ocean inferred from the distribution of H218O

    OpenAIRE

    Bauch, Dorothea; Schlosser, Peter; Fairbanks, Richard G.

    1995-01-01

    Data from sections across the Eurasian Basin of the Arctic Ocean occupied in 1987 and 1991 are used to derive information on the freshwater balance of the Arctic Ocean and on sources of the deep waters of the Nansen, Amundsen and Makarov basins. Using salinity, H218O, and mass balances we estimate the river-runoff and the sea-ice melt water fractions contained in the upper waters of the Arctic Ocean and infer pathways of the river-runoff signal from the shelf seas across the central Arctic Oc...

  7. ExoMol molecular line lists XIX: high-accuracy computed hot line lists for H218O and H217O

    Science.gov (United States)

    Polyansky, Oleg L.; Kyuberis, Aleksandra A.; Lodi, Lorenzo; Tennyson, Jonathan; Yurchenko, Sergei N.; Ovsyannikov, Roman I.; Zobov, Nikolai F.

    2017-04-01

    Hot line lists for two isotopologues of water, H218O and H217O, are presented. The calculations employ newly constructed potential energy surfaces (PES), which take advantage of a novel method for using the large set of experimental energy levels for H216O to give high-quality predictions for H218O and H217O. This procedure greatly extends the energy range for which a PES can be accurately determined, allowing an accurate prediction of higher lying energy levels than are currently known from direct laboratory measurements. This PES is combined with a high-accuracy, ab initio dipole moment surface of water in the computation of all energy levels, transition frequencies and associated Einstein A coefficients for states with rotational excitation up to J = 50 and energies up to 30 000 cm-1. The resulting HotWat78 line lists complement the well-used BT2 H216O line list. Full line lists are made available online as Supporting Information and at www.exomol.com.

  8. MicroRNAs MiR-218, MiR-125b, and Let-7g predict prognosis in patients with oral cavity squamous cell carcinoma.

    Directory of Open Access Journals (Sweden)

    Shih-Chi Peng

    Full Text Available MicroRNAs (miRNAs have a major impact on regulatory networks in human carcinogenesis. In this study, we sought to investigate the prognostic significance of miRNAs in patients with oral cavity squamous cell carcinoma (OSCC. In a discovery phase, RNA was extracted from 58 OSCC tumor samples and paired normal tissues. MiRNAs expression was evaluated with TaqMan Array Card and TaqMan MicroRNA assays. The prognostic significance of the miRNA signature identified in the discovery phase was validated by qRT-PCR in a replication set consisting of 141 formalin-fixed, paraffin-embedded (FFPE samples. We identified a miRNA regulatory network centered on the three hub genes (SP1, MYC, and TP53 that predicted distinct clinical endpoints. Three miRNAs (miR-218, miR-125b, and let-7g and their downstream response genes had a concordant prognostic significance on disease-free survival and disease-specific survival rates. In addition, patients with a reduced expression of miR-218, miR-125b, and let-7g have a higher risk of poor outcomes in presence of specific risk factors (p-stage III-IV, pT3-4, or pN+. Our findings indicate that specific miRNAs have prognostic significance in OSCC patients and may improve prognostic stratification over traditional risk factors.

  9. Epigenetic silencing of miR-218 by the lncRNA CCAT1, acting via BMI1, promotes an altered cell cycle transition in the malignant transformation of HBE cells induced by cigarette smoke extract.

    Science.gov (United States)

    Lu, Lu; Xu, Hui; Luo, Fei; Liu, Xinlu; Lu, Xiaolin; Yang, Qianlei; Xue, Junchao; Chen, Chao; Shi, Le; Liu, Qizhan

    2016-08-01

    Cigarette smoking is the strongest risk factor for the development of lung cancer, the leading cause of cancer-related deaths. However, the molecular mechanisms leading to lung cancer are largely unknown. A long-noncoding RNA (lncRNA), CCAT1, regarded as cancer-associated, has been investigated extensively. Moreover, the molecular mechanisms of lncRNAs in regulation of microRNAs (miRNAs) induced by cigarette smoke remain unclear. In the present investigation, cigarette smoke extract (CSE) caused an altered cell cycle and increased CCAT1 levels and decreased miR-218 levels in human bronchial epithelial (HBE) cells. Depletion of CCAT1 attenuated the CSE-induced decreases of miR-218 levels, suggesting that miR-218 is negatively regulated by CCAT1 in HBE cells exposed to CSE. The CSE-induced increases of BMI1 levels and blocked by CCAT1 siRNA were attenuated by an miR-218 inhibitor. Moreover, in CSE-transformed HBE cells, the CSE-induced cell cycle changes and elevated neoplastic capacity were reversed by CCAT1 siRNA or BMI1 siRNA. This epigenetic silencing of miR-218 by CCAT1 induces an altered cell cycle transition through BMI1 and provides a new mechanism for CSE-induced lung carcinogenesis. Copyright © 2016 Elsevier Inc. All rights reserved.

  10. Characterization of the K2-18 multi-planetary system with HARPS. A habitable zone super-Earth and discovery of a second, warm super-Earth on a non-coplanar orbit

    Science.gov (United States)

    Cloutier, R.; Astudillo-Defru, N.; Doyon, R.; Bonfils, X.; Almenara, J.-M.; Benneke, B.; Bouchy, F.; Delfosse, X.; Ehrenreich, D.; Forveille, T.; Lovis, C.; Mayor, M.; Menou, K.; Murgas, F.; Pepe, F.; Rowe, J.; Santos, N. C.; Udry, S.; Wünsche, A.

    2017-12-01

    Aims: The bright M2.5 dwarf K2-18 (Ms = 0.36 M⊙, Rs = 0.41 R⊙) at 34 pc is known to host a transiting super-Earth-sized planet orbiting within the star's habitable zone; K2-18b. Given the superlative nature of this system for studying an exoplanetary atmosphere receiving similar levels of insolation as the Earth, we aim to characterize the planet's mass which is required to interpret atmospheric properties and infer the planet's bulk composition. Methods: We have obtained precision radial velocity measurements with the HARPS spectrograph. We then coupled those measurements with the K2 photometry to jointly model the observed radial velocity variation with planetary signals and a correlated stellar activity model based on Gaussian process regression. Results: We measured the mass of K2-18b to be 8.0 ± 1.9M⊕ with a bulk density of 3.3 ± 1.2 g/cm3 which may correspond to a predominantly rocky planet with a significant gaseous envelope or an ocean planet with a water mass fraction ≳50%. We also find strong evidence for a second, warm super-Earth K2-18c (mp,csinic = 7.5 ± 1.3 M⊕) at approximately nine days with a semi-major axis 2.4 times smaller than the transiting K2-18b. After re-analyzing the available light curves of K2-18 we conclude that K2-18c is not detected in transit and therefore likely has an orbit that is non-coplanar with the orbit of K2-18b although only a small mutual inclination is required for K2-18c to miss a transiting configuration; | Δi| 1-2°. A suite of dynamical integrations are performed to numerically confirm the system's dynamical stability. By varying the simulated orbital eccentricities of the two planets, dynamical stability constraints are used as an additional prior on each planet's eccentricity posterior from which we constrain eb < 0.43 and ec < 0.47 at the level of 99% confidence. Conclusions: The discovery of the inner planet K2-18c further emphasizes the prevalence of multi-planet systems around M dwarfs. The

  11. Estimation of the release and migration of nickel through soils and groundwater at the Hanford Site 218-E-12B Burial Ground

    Energy Technology Data Exchange (ETDEWEB)

    Rhoads, K.; Bjornstad, B.N.; Lewis, R.E. [and others

    1994-05-01

    An assessment was performed to evaluate release and transport of nickel from large metal components containing nickel-bearing alloys at the Hanford Site 218-E-12B Burial Ground. The potential for nickel within the components to enter groundwater under the burial site was investigated by examining available data on the site`s geology, geochemistry, and geohydrology to develop a conceptual model for release and transport of nickel from the components. In addition, laboratory studies were performed to provide information needed for the model, but which was not available from existing databases. Estimates of future concentrations of nickel radioisotopes ({sup 59}Ni and {sup 63}Ni) and total elemental nickel in the unconfined aquifer and in the Columbia River were developed based on this information.

  12. Assessment of radionuclidic impurities in 2-[18F]fluoro-2-deoxy-d-glucose ([18F]FDG) routine production.

    Science.gov (United States)

    Marengo, Mario; Lodi, Filippo; Magi, Silvia; Cicoria, Gianfranco; Pancaldi, Davide; Boschi, Stefano

    2008-03-01

    In this paper, radionuclidic impurities generated during the bombardment of [18 O]water in the routine production of 2-[18F]fluoro-2-deoxy-d-glucose ([18F]FDG) were studied. In order to assess such impurities and the efficacy of purification methods through the different steps of the synthesis, samples of the target filters, purification columns, [18 O]water recovered after the synthesis, and the final solution was collected and their activities measured and analyzed by means of a gamma-ray spectrometry system. The data demonstrated that purification methods adopted for the synthesis provide the [18F]FDG radionuclidically pure, as requested by the EU Pharmacopeia.

  13. Metabolic liver function in humans measured by 2-(18)F-fluoro-2-deoxy-D-galactose PET/CT-reproducibility and clinical potential

    DEFF Research Database (Denmark)

    Bak-Fredslund, Kirstine P; Lykke Eriksen, Peter; Munk, Ole L

    2017-01-01

    Background: PET/CT with the radioactively labelled galactose analogue 2-18F-fluoro-2-deoxy-D-galactose (18F-FDGal) can be used to quantify the hepatic metabolic function and visualise regional metabolic heterogeneity. We determined the day-to-day variation in humans with and without liver disease....... Furthermore, we examined whether the standardised uptake value (SUV) of 18F-FDGal from static scans can substitute the hepatic systemic clearance of 18F- FDGal (Kmet, mL blood/min/mL liver tissue/) quantified from dynamic scans as measure of metabolic function. Four patients with cirrhosis and six healthy......,070), significantly higher than in the patients (P hepatic metabolic function. Total SUV of 18F-FDGal is a promising tool for quantification of metabolic liver function in pre-treatment evaluation...

  14. The Atacama Cosmology Telescope: A Measurement of the Cosmic Microwave Background Power Spectrum at 148 AND 218 GHz from the 2008 Southern Survey

    Science.gov (United States)

    Das, Sudeep; Marriage, Tobias A.; Ade, Peter A. R.; Aguirre, Paula; Amiri, Mandana; Appel, John W.; Barrientos, L. Felipe; Battistelli, Elia A.; Bond, J. Richard; Brown, Ben; hide

    2010-01-01

    We present measurements of the cosmic microwave background (CMB) power spectrum made by the Atacama Cosmology Telescope at 148 GHz and 218 GHz, as well as the cross-frequency spectrum between the two channels. Our results dearly show the second through the seventh acoustic peaks in the CMB power spectrum. The measurements of these higher-order peaks provide an additional test of the ACDM cosmological model. At l > 3000, we detect power in excess of the primary anisotropy spectrum of the CMB. At lower multipoles 500 < l < 3000, we find evidence for gravitational lensing of the CMB in the power spectrum at the 2.8(sigma) level. We also detect a low level of Galactic dust in our maps, which demonstrates that we can recover known faint, diffuse signals.

  15. An Ammonia Spectral Map of the L1495-B218 Filaments in the Taurus Molecular Cloud. I. Physical Properties of Filaments and Dense Cores

    Science.gov (United States)

    Seo, Young Min; Shirley, Yancy L.; Goldsmith, Paul; Ward-Thompson, Derek; Kirk, Jason M.; Schmalzl, Markus; Lee, Jeong-Eun; Friesen, Rachel; Langston, Glen; Masters, Joe; Garwood, Robert W.

    2015-06-01

    We present deep NH3 observations of the L1495-B218 filaments in the Taurus molecular cloud covering over a 3° angular range using the K-band focal plane array on the 100 m Green Bank Telescope. The L1495-B218 filaments form an interconnected, nearby, large complex extending over 8 pc. We observed NH3 (1, 1) and (2, 2) with a spectral resolution of 0.038 km s-1 and a spatial resolution of 31″. Most of the ammonia peaks coincide with intensity peaks in dust continuum maps at 350 and 500 μm. We deduced physical properties by fitting a model to the observed spectra. We find gas kinetic temperatures of 8-15 K, velocity dispersions of 0.05-0.25 km s-1, and NH3 column densities of 5 × 1012 to 1 × 1014 cm-2. The CSAR algorithm, which is a hybrid of seeded-watershed and binary dendrogram algorithms, identifies a total of 55 NH3 structures, including 39 leaves and 16 branches. The masses of the NH3 sources range from 0.05 to 9.5 {{M}⊙ }. The masses of NH3 leaves are mostly smaller than their corresponding virial mass estimated from their internal and gravitational energies, which suggests that these leaves are gravitationally unbound structures. Nine out of 39 NH3 leaves are gravitationally bound, and seven out of nine gravitationally bound NH3 leaves are associated with star formation. We also found that 12 out of 30 gravitationally unbound leaves are pressure confined. Our data suggest that a dense core may form as a pressure-confined structure, evolve to a gravitationally bound core, and undergo collapse to form a protostar.

  16. Increased Antimicrobial Resistance in a Novel CMY-54 AmpC-Type Enzyme with a GluLeu(217-218) Insertion in the Ω-Loop.

    Science.gov (United States)

    Pérez-Llarena, Francisco José; Vázquez-Ucha, Juan Carlos; Kerff, Frédéric; Zamorano, Laura; Miró, Elisenda; Cabral, María Póvoa; Fleites, Ana; Lantero, Marta; Martínez-Martínez, Luis; Oliver, Antonio; Galleni, Moreno; Navarro, Ferrán; Beceiro, Alejandro; Bou, Germán

    2017-06-30

    During a Spanish surveillance study, a natural variant of a CMY-type β-lactamase related to CMY-2 with a GluLeu(217-218) insertion in the Ω-loop (designated CMY-54) was found to increase the minimum inhibitory concentractions to β-lactams in a clinical strain of Escherichia coli. The aim of this study was to characterize CMY-54 by genetic, microbiological, and biochemical analysis. The blaCMY-54 gene is encoded by a plasmid of around 100 kb that hybridizes with K and FIB probes. The genetic context of blaCMY-54 and blaCMY-2 genes was found to be very similar. E. coli expressing CMY-54 under isogenic conditions showed a clear fourfold to eightfold increase in MICs to penicillins, cefotaxime, ceftazidime, and aztreonam compared with CMY-2. The catalytic efficiencies of pure CMY-2 and CMY-54 proteins correlated with their microbiological parameters. CMY-2 protein was more resistant to thermal denaturation than CMY-54, indicating than the Ω-loop of CMY-54 may be wider and more relaxed and probably enables better accommodation of these antimicrobials. Otherwise, the higher stabilization of CMY-2 may induce a slight reduction of the dynamics of this enzyme and primarily affect the hydrolysis of some of the bulkiest antibiotics. In summary, the GluLeu(217-218) insertion observed in CMY-54 compared to CMY-2 produces a β-lactamase with a distinctive catalytic efficacy for β-lactam antimicrobials likely caused by an increased flexibility slightly affecting the active site shape, highlighting the relevance of single mutations on the hydrolytic spectrum in class C β-lactamases.

  17. Pertussis Toxin Exploits Host Cell Signaling Pathways Induced by Meningitis-Causing E. coli K1-RS218 and Enhances Adherence of Monocytic THP-1 Cells to Human Cerebral Endothelial Cells.

    Science.gov (United States)

    Starost, Laura Julia; Karassek, Sascha; Sano, Yasuteru; Kanda, Takashi; Kim, Kwang Sik; Dobrindt, Ulrich; Rüter, Christian; Schmidt, Marcus Alexander

    2016-10-13

    Pertussis toxin (PTx), the major virulence factor of the whooping cough-causing bacterial pathogen Bordetella pertussis , permeabilizes the blood-brain barrier (BBB) in vitro and in vivo. Breaking barriers might promote translocation of meningitis-causing bacteria across the BBB, thereby facilitating infection. PTx activates several host cell signaling pathways exploited by the neonatal meningitis-causing Escherichia coli K1-RS218 for invasion and translocation across the BBB. Here, we investigated whether PTx and E. coli K1-RS218 exert similar effects on MAPK p38, NF-κB activation and transcription of downstream targets in human cerebral endothelial TY10 cells using qRT-PCR, Western blotting, and ELISA in combination with specific inhibitors. PTx and E. coli K1-RS218 activate MAPK p38, but only E. coli K1-RS218 activates the NF-κB pathway. mRNA and protein levels of p38 and NF-κB downstream targets including IL-6, IL-8, CxCL-1, CxCL-2 and ICAM-1 were increased. The p38 specific inhibitor SB203590 blocked PTx-enhanced activity, whereas E. coli K1-RS218's effects were inhibited by the NF-κB inhibitor Bay 11-7082. Further, we found that PTx enhances the adherence of human monocytic THP-1 cells to human cerebral endothelial TY10 cells, thereby contributing to enhanced translocation. These modulations of host cell signaling pathways by PTx and meningitis-causing E. coli support their contributions to pathogen and monocytic THP-1 cells translocation across the BBB.

  18. Change in expression of miR-let7c, miR-100, and miR-218 from high grade localized prostate cancer to metastasis.

    Science.gov (United States)

    Leite, Katia R M; Sousa-Canavez, Juliana M; Reis, Sabrina T; Tomiyama, Alberto H; Camara-Lopes, Luiz H; Sañudo, Adriana; Antunes, Alberto A; Srougi, Miguel

    2011-01-01

    MicroRNAs (miRNAs) are small noncoding regulatory RNAs (19-25 nucleotides) that play a major role in regulation of gene expression. They are responsible for the control of fundamental cellular processes that has been reported to be involved in human tumorigenesis. The characterization of miRNA profiles in human tumors is crucial for the understanding of carcinogenesis processes, finding of new tumor markers, and discovering of specific targets for the development of innovative therapies. The aim of this study is to find miRNAs involved in prostate cancer progression comparing the profile of miRNA expressed by localized high grade carcinoma and bone metastasis. Two groups of tumors where submitted to analyses. The first is characterized by 18 patients who underwent radical prostatectomy for treatment of localized high grade prostate carcinoma (PC) with mean Gleason score 8.6, all staged pT3. The second group is composed of 4 patients with metastatic, androgen-independent prostate carcinoma, and 2 PC cell lines. LNCaP derived from a metastatic PC to a lymph node, and another derived from an obstructive, androgen-independent PC (PcBRA1). Expression analysis of 14 miRNAs was carried out using quantitative RT-PCR. miR-let7c, miR-100, and miR-218 were significantly overexpressed by all localized high GS, pT3 PC in comparison with metastatic carcinoma. (35.065 vs. 0.996 P<0.001), (55.550 vs. 8.314, P=0.010), and (33.549 vs. 2.748, P=0.001), respectively. We hypothesize that miR-let7c, miR-100, and miR-218 may be involved in the process of metastasization of PC, and their role as controllers of the expression of RAS, c-myc, Laminin 5 β3, THAP2, SMARCA5, and BAZ2A should be matter of additional studies. Copyright © 2011 Elsevier Inc. All rights reserved.

  19. Radiosynthesis and biological evaluation of N-(2-[18F]fluoropropionyl)-3,4-dihydroxy-l-phenylalanine as a PET tracer for oncologic imaging.

    Science.gov (United States)

    Tang, Caihua; Nie, Dahong; Tang, Ganghua; Gao, Siyuan; Liu, Shaoyu; Wen, Fuhua; Tang, Xiaolan

    2017-07-01

    Several 11C and 18F labeled 3,4-dihydroxy-l-phenylalanine (l-DOPA) analogues have been used for neurologic and oncologic diseases, especially for brain tumors and neuroendocrine tumors PET imaging. However, 18F-labeled N-substituted l-DOPA analogues have not been reported so far. In the current study, radiosynthesis and biological evaluation of a new 18F-labeled l-DOPA analogue, N-(2-[18F]fluoropropionyl)-3,4-dihydroxy-l-phenylalanine ([18F]FPDOPA) for tumor PET imaging are performed. The synthesis of [18F]FPDOPA was via a two-step reaction sequence from 4-nitrophenyl-2-[18F]fluoropropionate ([18F]NFP). The biodistribution of [18F]FPDOPA was determined in normal Kunming mice. In vitro competitive inhibition and protein incorporation experiments were performed with SPC-A-1 lung adenocarcinoma cell lines. PET/CT studies of [18F]FPDOPA were conducted in C6 rat glioma and SPC-A-1 human lung adenocarcinoma and H460 human large cell lung cancer-bearing nude mice. [18F]FPDOPA was prepared with a decay-corrected radiochemical yield of 28±5% and a specific activity of 50±15GBq/μmol (n=10) within 125min. In vitro cell experiments showed that [18F]FPDOPA uptake in SPC-A-1 cells was primarily transported through Na+-independent system L, with Na+-dependent system B0,+ and system ASC partly involved in it. Biodistribution data in mice showed that renal-bladder route was the main excretory system of [18F]FPDOPA. PET imaging demonstrated intense accumulation of [18F]FPDOPA in several tumor xenografts, with (8.50±0.40)%ID/g in C6 glioma, (6.30±0.12)%ID/g in SPC-A-1 lung adenocarcinoma, and (6.50±0.10)%ID/g in H460 large cell lung cancer, respectively. A novel N-substituted 18F-labeled L-DOPA analogue [18F]FPDOPA is synthesized and evaluated in vitro and in vivo. The results support that [18F]FPDOPA seems to be a potential PET tracer for tumor imaging, especially be a better potential PET tracer than [18F]fluoro-2-deoxy-d-glucose ([18F]FDG) for brain tumor imaging. Copyright

  20. An improved radiosynthesis of O-(2-[(18) F]fluoroethyl)-O-(p-nitrophenyl)methylphosphonate: A first-in-class cholinesterase PET tracer.

    Science.gov (United States)

    Neumann, Kiel D; Thompson, Charles M; Blecha, Joseph E; Gerdes, John M; VanBrocklin, Henry F

    2017-06-15

    O-(2-Fluoroethyl)-O-(p-nitrophenyl) methylphosphonate 1 is an organophosphate cholinesterase inhibitor that creates a phosphonyl-serine covalent adduct at the enzyme active site blocking cholinesterase activity in vivo. The corresponding radiolabeled O-(2-[(18) F]fluoroethyl)-O-(p-nitrophenyl) methylphosphonate, [(18) F]1, has been previously prepared and found to be an excellent positron emission tomography imaging tracer for assessment of cholinesterases in live brain, peripheral tissues, and blood. However, the previously reported [(18) F]1 tracer synthesis was slow even with microwave acceleration, required high-performance liquid chromatography separation of the tracer from impurities, and gave less optimal radiochemical yields. In this paper, we report a new synthetic approach to circumvent these shortcomings that is reliant on the facile reactivity of bis-(O,O-p-nitrophenyl) methylphosphonate, 2, with 2-fluoroethanol in the presence of DBU. The cold synthesis was successfully translated to provide a more robust radiosynthesis. Using this new strategy, the desired tracer, [(18) F]1, was obtained in a non-decay-corrected radiochemical yield of 8 ± 2% (n = 7) in >99% radiochemical and >95% chemical purity with a specific activity of 3174 ± 345 Ci/mmol (EOS). This new facile radiosynthesis routinely affords highly pure quantities of [(18) F]1, which will further enable tracer development of OP cholinesterase inhibitors and their evaluation in vivo. Copyright © 2017 John Wiley & Sons, Ltd.

  1. Preliminary Thermal Modeling of Hi-Storm 100S-218 Version B Storage Modules at Hope Creek Nuclear Power Station ISFSI

    Energy Technology Data Exchange (ETDEWEB)

    Cuta, Judith M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Adkins, Harold E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2013-08-30

    This report fulfills the M3 milestone M3FT-13PN0810022, “Report on Inspection 1”, under Work Package FT-13PN081002. Thermal analysis is being undertaken at Pacific Northwest National Laboratory (PNNL) in support of inspections of selected storage modules at various locations around the United States, as part of the Used Fuel Disposition Campaign of the U.S. Department of Energy, Office of Nuclear Energy (DOE-NE) Fuel Cycle Research and Development. This report documents pre-inspection predictions of temperatures for four modules at the Hope Creek Nuclear Generating Station ISFSI that have been identified as candidates for inspection in late summer or early fall/winter of 2013. These are HI-STORM 100S-218 Version B modules storing BWR 8x8 fuel in MPC-68 canisters. The temperature predictions reported in this document were obtained with detailed COBRA-SFS models of these four storage systems, with the following boundary conditions and assumptions.

  2. Dynamic 2-[18F]fluoro-2-deoxy-D-glucose positron emission tomography of liver tumours without blood sampling

    DEFF Research Database (Denmark)

    Keiding, S; Munk, O L; Schiøtt, K M

    2000-01-01

    Positron emission tomography (PET) using 2-[18F]fluoro-2-deoxy-D-glucose (FDG) is a useful diagnostic tool for the detection of tumours. Using dynamic FDG PET, net metabolic clearance of FDG, K, can be calculated by Gjedde-Patlak analysis of the time course of the radioactivity concentrations...... on the corresponding TACs and compared with those based on TACs of the arterial blood sample radioactivity concentrations. The aorta VOI which gave K values that were in best agreement with the K values based on the arterial blood sample measurements was called the AORTA-VOI. Use of the AORTA-VOI was subsequently...... tested in a test group of 19 tumour patients by comparing the K values from the AORTA-VOI with the K values based on the arterial blood sample measurements. The AORTA-VOI consisted of the sum of small regions of interest (ROIs) drawn in the centre of the aorta (approximately six pixels of 2.4x2.4 mm per...

  3. Dual time point 2-deoxy-2-[18F]fluoro-D-glucose PET/CT: nodal staging in locally advanced breast cancer.

    Science.gov (United States)

    García Vicente, A M; Soriano Castrejón, A; Cruz Mora, M Á; Ortega Ruiperez, C; Espinosa Aunión, R; León Martín, A; González Ageitos, A; Van Gómez López, O

    2014-01-01

    To assess dual time point 2-deoxy-2-[(18)F]fluoro-D-glucose (18)(F)FDG PET-CT accuracy in nodal staging and in detection of extra-axillary involvement. Dual time point [(18)F] FDG PET/CT scan was performed in 75 patients. Visual and semiquantitative assessment of lymph nodes was performed. Semiquantitative measurement of SUV and ROC-analysis were carried out to calculate SUV(max) cut-off value with the best diagnostic performance. Axillary and extra-axillary lymph node chains were evaluated. Sensitivity and specificity of visual assessment was 87.3% and 75%, respectively. SUV(max) values with the best sensitivity were 0.90 and 0.95 for early and delayed PET, respectively. SUV(max) values with the best specificity were 1.95 and 2.75, respectively. Extra-axillary lymph node involvement was detected in 26.7%. FDG PET/CT detected extra-axillary lymph node involvement in one-fourth of the patients. Semiquantitative lymph node analysis did not show any advantage over the visual evaluation. Copyright © 2013 Elsevier España, S.L. and SEMNIM. All rights reserved.

  4. An evaluation of 2-deoxy-2-[18F]fluoro-D-glucose and 3'-deoxy-3'-[18F]-fluorothymidine uptake in human tumor xenograft models.

    Science.gov (United States)

    Keen, Heather; Pichler, Bernd; Kukuk, Damaris; Duchamp, Olivier; Raguin, Olivier; Shannon, Aoife; Whalley, Nichola; Jacobs, Vivien; Bales, Juliana; Gingles, Neill; Ricketts, Sally-Ann; Wedge, Stephen R

    2012-06-01

    The aim of this study is to assess the variability of 2-deoxy-2-[(18)F]fluoro-D: -glucose ([(18)F]-FDG) and 3'-deoxy-3'-[(18)F]-fluorothymidine ([(18)F]-FLT) uptake in pre-clinical tumor models and examine the relationship between imaging data and related histological biomarkers. [(18)F]-FDG and [(18)F]-FLT studies were carried out in nine human tumor xenograft models in mice. A selection of the models underwent histological analysis for endpoints relevant to radiotracer uptake. Comparisons were made between in vitro uptake, in vivo imaging, and ex vivo histopathology data using quantitative and semi-quantitative analysis. In vitro data revealed that [1-(14)C]-2-deoxy-D: -glucose ([(14)C]-2DG) uptake in the tumor cell lines was variable. In vivo, [(18)F]-FDG and [(18)F]-FLT uptake was highly variable across tumor types and uptake of one tracer was not predictive for the other. [(14)C]-2DG uptake in vitro did not predict for [(18)F]-FDG uptake in vivo. [(18)F]-FDG SUV was inversely proportional to Ki67 and necrosis levels and positively correlated with HKI. [(18)F]-FLT uptake positively correlated with Ki67 and TK1. When evaluating imaging biomarkers in response to therapy, the choice of tumor model should take into account in vivo baseline radiotracer uptake, which can vary significantly between models.

  5. Prevalence of Pneumococcal Nasopharyngeal Carriage Among Children 2-18 Months of Age: Baseline Study Pre Introduction of Pneumococcal Vaccination in Cuba.

    Science.gov (United States)

    Toledo, María E; Casanova, Maria F; Linares-Pérez, Nivaldo; García-Rivera, Dagmar; Toraño Peraza, Gilda; Barcos Pina, Indira; Montes de Oca, Martha; Rodriguez-Noda, Laura M; Mirabal, Mayelín; Paredes, Beatriz; Chávez Amaro, Dunia M; Santana Mederos, Darielys; Valdés-Balbín, Yury; Verez-Bencomo, Vicente

    2017-01-01

    A new vaccine candidate against pneumococcus is being developed in Cuba, and it is a priority of the national health system. There is limited information on nasopharyngeal colonization burden, though it is essential for monitoring the impact of the vaccine. The study aims to estimate the prevalence of nasopharyngeal colonization in children 2-18 months of age and identify circulating serotypes, antimicrobial resistance and its association with selected risk factors. A cross-sectional study was conducted between October and December 2013 in Cienfuegos municipality. Inclusion criteria were evaluated, and informed consent was obtained from the parents. Clinical and epidemiologic data were collected through a semistructured questionnaire. Nasopharyngeal swabs according to established protocols were taken. Data analysis included frequency distributions and comparison of proportions. The association between colonization and selected risk factors was assessed by multivariate analysis. A total of 984 children (87.2% living in urban areas) were included. The overall prevalence of colonization was 21.6%. The most frequent serotypes isolated were 6A (23.1%), 23F (10.8%), 6B (10.3%), 19F (8.5%) and 14 (3.3%). We found no resistance to β-lactamases in circulating serotypes. Living with sibling younger than 5 years, previous respiratory infections, previous hospitalization and day-care attendance were determinants of nasopharyngeal carriage. The findings suggest that the burden of pneumococcal disease and colonization in Cuba could be significantly affected after vaccine introduction.

  6. Chelator-Accelerated One-Pot ‘Click’ Labeling of Small Molecule Tracers with 2-[18F]Fluoroethyl Azide

    Directory of Open Access Journals (Sweden)

    Erik Årstad

    2013-05-01

    Full Text Available 2-[18F]Fluoroethyl azide ([18F]FEA can readily be obtained by nucleophilic substitution of 2-azidoethyl-4-toluenesulfonate with [18F]fluoride (half-life 110 min, and has become widely used as a reagent for ‘click’ labeling of PET tracers. However, distillation of [18F]FEA is typically required, which is time-consuming and unpractical for routine applications. In addition, copper(I-catalyzed cycloaddition of [18F]FEA with non-activated alkynes, and with substrates containing labile functional groups, can be challenging. Herein, we report a highly efficient and practical ligand-accelerated one-pot/two-step method for ‘click’ labeling of small molecule tracers with [18F]FEA. The method exploits the ability of the copper(I ligand bathophenanthrolinedisulfonate to accelerate the rate of the cycloaddition reaction. As a result, alkynes can be added directly to the crude reaction mixture containing [18F]FEA, and as cyclisation occurs almost immediately at room temperature, the reaction is tolerant to labile functional groups. The method was demonstrated by reacting [18F]FEA with a series of alkyne-functionalized 6-halopurines to give the corresponding triazoles in 55–76% analytical radiochemical yield.

  7. Monitoring of Radiochemotherapy in Patients with Glioblastoma Using O-(2-[18F]Fluoroethyl-L-Tyrosine Positron Emission Tomography: Is Dynamic Imaging Helpful?

    Directory of Open Access Journals (Sweden)

    Marc D. Piroth

    2013-09-01

    Full Text Available Monitoring of radiochemotherapy (RCX in patients with glioblastoma is difficult because unspecific alterations in magnetic resonance imaging with contrast enhancement can mimic tumor progression. Changes in tumor to brain ratios (TBRs in positron emission tomography (PET using O-(2-[18F]fluoroethyl-L-tyrosine (18F-FET after RCX with temozolomide of patients with glioblastoma have been shown to be valuable parameters to predict survival. The kinetic behavior of 18F-FET in the tumors is another promising parameter to analyze tumor metabolism. In this study, we investigated the predictive value of dynamic 18F-FET PET during RCX of glioblastoma. Time-activity curves (TACs of 18F-FET uptake of 25 patients with glioblastoma were evaluated after surgery (FET-1, early (7–10 days after completion of RCX (FET-2, and 6 to 8 weeks later (FET-3. Changes in the time to peak (TTP and the slope of the TAC (10–50 minutes postinjection were analyzed and related to survival. Changes in kinetic parameters of 18F-FET uptake after RCX showed no relationship with survival time. In contrast, the high predictive value of changes of TBR to predict survival was confirmed. We conclude that dynamic 18F-FET PET does not provide additional prognostic information during RCX. Static 18F-FET PET imaging (20–40 minutes postinjection appears to be sufficient for this purpose and reduces costs.

  8. Use of H2(18)O2 to measure absolute rates of dark H2O2 production in freshwater systems.

    Science.gov (United States)

    Vermilyea, Andrew W; Dixon, Taylor C; Voelker, Bettina M

    2010-04-15

    Photochemical production is usually considered to be the main source of H2O2 in freshwater systems; here we show that significant dark production also occurs. We used isotope-labeled H2O2 as a tracer to simultaneously determine H2O2 production and decay rates in incubations of unfiltered water samples. Our new technique for H2(18)O2 analysis, requiring only small sample volumes and simple field equipment, allows for preservation of samples in remote locations, followed by gas chromatography mass spectrometry (GCMS) analysis up to six days later. Dark H2O2 production rates of 29-122 nM/h were observed in several lakewater samples. Measured production and decay rates were consistent with pseudo steady-state, early morning [H2O2] measurements made in each water body. Dark H2O2 production is likely to be more important than photochemical production for the total H2O2 budget over 24 h in the freshwater systems we examined. Our results imply that processes usually assumed to be photochemically induced in freshwaters, such as metal redox cycling mediated by H2O2 and O2(-), and production of strong oxidants from the reaction of H2O2 with Fe(II) (Fenton's reaction) could also be occurring at significant rates in the absence of light.

  9. Tropospheric water vapour isotopologue data (H216O, H218O, and HD16O) as obtained from NDACC/FTIR solar absorption spectra

    Science.gov (United States)

    Barthlott, Sabine; Schneider, Matthias; Hase, Frank; Blumenstock, Thomas; Kiel, Matthäus; Dubravica, Darko; García, Omaira E.; Sepúlveda, Eliezer; Mengistu Tsidu, Gizaw; Takele Kenea, Samuel; Grutter, Michel; Plaza-Medina, Eddy F.; Stremme, Wolfgang; Strong, Kim; Weaver, Dan; Palm, Mathias; Warneke, Thorsten; Notholt, Justus; Mahieu, Emmanuel; Servais, Christian; Jones, Nicholas; Griffith, David W. T.; Smale, Dan; Robinson, John

    2017-01-01

    We report on the ground-based FTIR (Fourier transform infrared) tropospheric water vapour isotopologue remote sensing data that have been recently made available via the database of NDACC (Network for the Detection of Atmospheric Composition Change; MUSICA/" target="_blank">ftp://ftp.cpc.ncep.noaa.gov/ndacc/MUSICA/) and via doi:10.5281/zenodo.48902. Currently, data are available for 12 globally distributed stations. They have been centrally retrieved and quality-filtered in the framework of the MUSICA project (MUlti-platform remote Sensing of Isotopologues for investigating the Cycle of Atmospheric water). We explain particularities of retrieving the water vapour isotopologue state (vertical distribution of H216O, H218O, and HD16O) and reveal the need for a new metadata template for archiving FTIR isotopologue data. We describe the format of different data components and give recommendations for correct data usage. Data are provided as two data types. The first type is best-suited for tropospheric water vapour distribution studies disregarding different isotopologues (comparison with radiosonde data, analyses of water vapour variability and trends, etc.). The second type is needed for analysing moisture pathways by means of H2O, δD-pair distributions.

  10. Positron emission tomographical studies of 1-11C-acetoacetate, 2-18F-fluoro-deoxy-D-glucose, and L-1-11C-tyrosine uptake by cat brain with an experimental lesion

    NARCIS (Netherlands)

    Prenen, G H; Go, K G; Paans, A M; Zuiderveen, F; Vaalburg, W; Kamman, R L; Molenaar, W M; Zijlstra, S; Elsinga, P H; Sebens, J B; Korf, J

    1989-01-01

    In cat brain with a freezing injury, the uptake of 1-11C-acetoacetate (11C-ACAC), 2-18F-fluorodeoxy-D-glucose (18FDG), and L-1-11C-tyrosine (11C-TYR) was monitored by positron emission tomography following intravenous administration of the tracers, at 1 day, and 1-3 weeks after the injury. The

  11. IUPAC critical evaluation of the rotational-vibrational spectra of water vapor. Part IV. Energy levels and transition wavenumbers for D216O, D217O, and D218O

    Science.gov (United States)

    Tennyson, Jonathan; Bernath, Peter F.; Brown, Linda R.; Campargue, Alain; Császár, Attila G.; Daumont, Ludovic; Gamache, Robert R.; Hodges, Joseph T.; Naumenko, Olga V.; Polyansky, Oleg L.; Rothman, Laurence S.; Vandaele, Ann Carine; Zobov, Nikolai F.; Dénes, Nóra; Fazliev, Alexander Z.; Furtenbacher, Tibor; Gordon, Iouli E.; Hu, Shui-Ming; Szidarovszky, Tamás; Vasilenko, Irina A.

    2014-07-01

    This paper is the fourth of a series of papers reporting critically evaluated rotational-vibrational line positions, transition intensities, pressure dependences, and energy levels, with associated critically reviewed assignments and uncertainties, for all the main isotopologues of water. This paper presents energy level and transition data for the following doubly and triply substituted isotopologues of water: D216O, D217O, and D218O. The MARVEL (Measured Active Rotational-Vibrational Energy Levels) procedure is used to determine the levels, the lines, and their self-consistent uncertainties for the spectral regions 0-14 016, 0-7969, and 0-9108 cm-1 for D216O, D217O, and D218O, respectively. For D216O, D217O, and D218O, 53 534, 600, and 12 167 lines are considered, respectively, from spectra recorded in absorption at room temperature and in emission at elevated temperatures. The number of validated energy levels is 12 269, 338, and 3351 for D216O, D217O, and D218O, respectively. The energy levels have been checked against the ones determined, with an average accuracy of about 0.03 cm-1, from variational rovibrational computations employing exact kinetic energy operators and an accurate potential energy surface. Furthermore, the rovibrational labels of the energy levels have been validated by an analysis of the computed wavefunctions using the rigid-rotor decomposition (RRD) scheme. The extensive list of MARVEL lines and levels obtained is deposited in the Supplementary Material of this paper, in a distributed information system applied to water, W@DIS, and on the official MARVEL website, where they can easily be retrieved.

  12. Sensitivity of 2-[18F]fluoro-2-deoxyglucose positron emission tomography for advanced colorectal neoplasms: a large-scale analysis of 7505 asymptomatic screening individuals.

    Science.gov (United States)

    Sekiguchi, Masau; Kakugawa, Yasuo; Terauchi, Takashi; Matsumoto, Minori; Saito, Hiroshi; Muramatsu, Yukio; Saito, Yutaka; Matsuda, Takahisa

    2016-12-01

    The sensitivity of 2-[18F]fluoro-2-deoxyglucose positron emission tomography (FDG-PET) for advanced colorectal neoplasms among healthy subjects is not yet fully understood. The present study aimed to clarify the sensitivity by analyzing large-scale data from an asymptomatic screening population. A total of 7505 asymptomatic screenees who underwent both FDG-PET and colonoscopy at our Cancer Screening Division between February 2004 and March 2013 were analyzed. FDG-PET and colonoscopy were performed on consecutive days, and each examination was interpreted in a blinded fashion. The results of the two examinations were compared for each of the divided six colonic segments, with those from colonoscopy being set as the reference. The relationships between the sensitivity of FDG-PET and clinicopathological features of advanced neoplasms were also evaluated. Two hundred ninety-one advanced neoplasms, including 24 invasive cancers, were detected in 262 individuals. Thirteen advanced neoplasms (advanced adenomas) were excluded from the analysis because of the coexistence of lesions in the same colonic segment. The sensitivity, specificity, and positive and negative predictive values of FDG-PET for advanced neoplasms were 16.9 % [95 % confidence interval (CI) 12.7-21.8 %], 99.3 % (95 % CI 99.2-99.4 %), 13.5 % (95 % CI 10.1-17.6 %), and 99.4 % (95 % CI 99.3-99.5 %), respectively. The sensitivity was lower for lesions with less advanced histological grade, of smaller size, and flat-type morphology, and for those located in the proximal part of the colon. FDG-PET is believed to be difficult to use as a primary screening tool in population-based colorectal cancer screening because of its low sensitivity for advanced neoplasms. Even when it is used in opportunistic cancer screening, the limit of its sensitivity should be considered.

  13. Miocene palynoflora from the KRAM-P 218 leaf assemblage from the Bełchatów Lignite Mine (Central Poland

    Directory of Open Access Journals (Sweden)

    Worobiec Elżbieta

    2016-12-01

    Full Text Available During a palynological analysis of four samples from the Bełchatów KRAM-P 218 collection of plant macroremains 95 fossil species of sporomorphs were identified. Among the non-pollen palynomorphs was the fossil species Desmidiaceaesporites cosmarioformis, previously not reported from fossil floras of Poland, most probably related to the zygospores of desmids. The pollen analysis indicates the presence of a freshwater body (probably an oxbow lake and shows the dominant role of wetland, predominantly riparian vegetation, at the time of sedimentation. The riparian forests probably consisted of Carya, Pterocarya, Celtis, and Ulmus, accompanied by Alnus, Acer, Fraxinus, Juglans, Liquidambar, Vitis, Zelkova, and Salix. In mixed forests there probably were Fagus, Quercus, Carpinus, Eucommia, Corylus, Tilioideae, and conifers, as well as some thermophilous taxa (e.g. Castanea, Symplocos, Reevesia, Mastixiaceae, and plants producing pollen of the fossil species Tricolporopollenites pseudocingulum. Taxodium, Nyssa, and presumably Glyptostrobus and Alnus were components of swamp communities that might have overgrown the adjacent area with higher groundwater. Members of the families Ericaceae, Cyrillaceae, and Clethraceae, as well as Myrica and probably also Ilex, may have been components of swamp forests and bush swamps. Our analysis indicates that the climate was warm temperate and moderately wet. The palynoflora is most similar in composition to the spore-pollen spectra of the X climatic phase - the Nyssapollenites spore-pollen zone. Deposits bearing assemblages of the Nyssapollenites spore-pollen zone were deposited during the Sarmatian and early Pannonian. Our results are consistent with those from plant macroremains from the same collection.

  14. O-(2-18F-fluoroethyl)-L-tyrosine PET for evaluation of brain metastasis recurrence after radiotherapy: an effectiveness and cost-effectiveness analysis.

    Science.gov (United States)

    Heinzel, Alexander; Müller, Dirk; Yekta-Michael, Sareh Said; Ceccon, Garry; Langen, Karl-Josef; Mottaghy, Felix M; Wiesmann, Martin; Kocher, Martin; Hattingen, Elke; Galldiks, Norbert

    2017-09-01

    Conventional MRI is the standard method to diagnose recurrence of brain metastases after radiation. However, following radiation therapy, reactive transient blood-brain barrier alterations with consecutive contrast enhancement can mimic brain metastasis recurrence. Recent studies have suggested that O-(2-18F-fluoroethyl)-L-tyrosine (FET) PET improves the correct differentiation of brain metastasis recurrence from radiation injury. Based on published evidence and clinical expert opinion, we analyzed effectiveness and cost-effectiveness of the use of FET PET in addition to MRI compared with MRI alone for the diagnosis of recurrent brain metastases. A decision-tree model was designed to compare the 2 diagnostic strategies from the perspective of the German Statutory Health Insurance (SHI) system. Effectiveness was defined as correct diagnosis of recurrent brain metastasis and was compared between FET PET with MRI and MRI alone. Costs were calculated for a baseline scenario and for a more expensive scenario. Robustness of the results was tested using sensitivity analyses. Compared with MRI alone, FET PET in combination with MRI increases the rate of correct diagnoses by 42% (number needed to diagnose of 3) with an incremental cost-effectiveness ratio of €2821 (baseline scenario) and €4014 (more expensive scenario) per correct diagnosis. The sensitivity analyses confirmed the robustness of the results. The model suggests that the additional use of FET PET with conventional MRI for the diagnosis of recurrent brain metastases may be cost-effective. Integration of FET PET has the potential to avoid overtreatment with corresponding costs as well as unnecessary side effects.

  15. Sick-leave track record and other potential predictors of a disability pension. A population based study of 8,218 men and women followed for 16 years

    Directory of Open Access Journals (Sweden)

    Rosengren Annika

    2009-04-01

    Full Text Available Abstract Background A number of previous studies have investigated various predictors for being granted a disability pension. The aim of this study was to test the efficacy of sick-leave track record as a predictor of being granted a disability pension in a large dataset based on subjects sampled from the general population and followed for a long time. Methods Data from five ongoing population-based Swedish studies was used, supplemented with data on all compensated sick leave periods, disability pensions granted, and vital status, obtained from official registers. The data set included 8,218 men and women followed for 16 years, generated 109,369 person years of observation and 97,160 sickness spells. Various measures of days of sick leave during follow up were used as independent variables and disability pension grant was used as outcome. Results There was a strong relationship between individual sickness spell duration and annual cumulative days of sick leave on the one hand and being granted a disability pension on the other, among both men and women, after adjustment for the effects of marital status, education, household size, smoking habits, geographical area and calendar time period, a proxy for position in the business cycle. The interval between sickness spells showed a corresponding inverse relationship. Of all the variables studied, the number of days of sick leave per year was the most powerful predictor of a disability pension. For both men and women 245 annual sick leave days were needed to reach a 50% probability of transition to disability. The independent variables, taken together, explained 96% of the variation in disability pension grantings. Conclusion The sick-leave track record was the most important predictor of the probability of being granted a disability pension in this study, even when the influences of other variables affecting the outcome were taken into account.

  16. Metabolic liver function in humans measured by 2-(18)F-fluoro-2-deoxy-D-galactose PET/CT-reproducibility and clinical potential.

    Science.gov (United States)

    Bak-Fredslund, Kirstine P; Lykke Eriksen, Peter; Munk, Ole L; Villadsen, Gerda E; Keiding, Susanne; Sørensen, Michael

    2017-08-29

    PET/CT with the radioactively labelled galactose analogue 2-(18)F-fluoro-2-deoxy-D-galactose ((18)F-FDGal) can be used to quantify the hepatic metabolic function and visualise regional metabolic heterogeneity. We determined the day-to-day variation in humans with and without liver disease. Furthermore, we examined whether the standardised uptake value (SUV) of (18)F-FDGal from static scans can substitute the hepatic systemic clearance of (18)F-FDGal (K met, mL blood/min/mL liver tissue/) quantified from dynamic scans as measure of metabolic function. Four patients with cirrhosis and six healthy subjects underwent two (18)F-FDGal PET/CT scans within a median interval of 15 days for determination of day-to-day variation. The correlation between K met and SUV was examined using scan data and measured arterial blood concentrations of (18)F-FDGal (blood samples) from 14 subjects from previous studies. Regional and whole-liver values of K met and SUV along with total metabolic liver volume and total metabolic liver function (total SUV, average SUV multiplied by total metabolic liver volume) were calculated. No significant day-to-day differences were found for K met or SUV. SUV had higher intraclass correlation coefficients than K met (0.92-0.97 vs. 0.49-0.78). The relationship between K met and SUV was linear. Total metabolic liver volume had non-significant day-to-day variation (median difference 50 mL liver tissue; P = 0.6). Mean total SUV in healthy subjects was 23,840 (95% CI, 21,609; 26,070), significantly higher than in the patients (P metabolic function. Total SUV of (18)F-FDGal is a promising tool for quantification of metabolic liver function in pre-treatment evaluation of individual patients.

  17. Association between Body Mass Index and Health-Related Quality of Life: The "Obesity Paradox" in 21,218 Adults of the Chinese General Population.

    Directory of Open Access Journals (Sweden)

    Yanbo Zhu

    Full Text Available There was no consistent recognition of the association between high or low body mass index (BMI and health related quality of life (HRQL. The aim of this research was to study the association between BMI and HRQL in Chinese adults, and to further explore the stability of that association in the subgroup analysis stratified by status of chronic conditions.A total of 21,218 adults aged 18 and older were classified as underweight, normal weight, overweight, class I obese, and class II obese based on their BMI. HRQL was measured by the SF-36 Health Survey. The independent impact of each BMI category on HRQL was examined through standard least squares regression by comparing the difference of SF-36 scores and the minimum clinically important differences (MCID, which was defined as 3 points.Compared to the normal weight, the class I obese was significantly associated with better HRQL scores in the mental component summary (MCS (75.1 vs. 73.4, P<0.001. The underweight had the lowest score in both the physical components summary (PCS (75.4 vs. 77.5, P<0.001 and mental components summary (MCS (71.8 vs. 73.4, P<0.001. For the MCID, the HRQL score was reduced by more than 3 points in the physical functioning for the class II obese (D=-3.43 and the general health for the underweight (D=-3.71. Stratified analyses showed a similar result in the health subjects and chronic conditions, and it was significant in the chronic conditions.The class I obese showed the best HRQL, especially in the mental domain. The worst HRQL was found in the underweight. The class II obese reduced HRQL in the physical functioning only. "Obesity paradox" was more obvious in the participants with chronic conditions.

  18. The use of dynamic O-(2-18F-fluoroethyl)-l-tyrosine PET in the diagnosis of patients with progressive and recurrent glioma.

    Science.gov (United States)

    Galldiks, Norbert; Stoffels, Gabriele; Filss, Christian; Rapp, Marion; Blau, Tobias; Tscherpel, Caroline; Ceccon, Garry; Dunkl, Veronika; Weinzierl, Martin; Stoffel, Michael; Sabel, Michael; Fink, Gereon R; Shah, Nadim J; Langen, Karl-Josef

    2015-09-01

    We evaluated the diagnostic value of static and dynamic O-(2-[(18)F]fluoroethyl)-L-tyrosine ((18)F-FET) PET parameters in patients with progressive or recurrent glioma. We retrospectively analyzed 132 dynamic (18)F-FET PET and conventional MRI scans of 124 glioma patients (primary World Health Organization grade II, n = 55; grade III, n = 19; grade IV, n = 50; mean age, 52 ± 14 y). Patients had been referred for PET assessment with clinical signs and/or MRI findings suggestive of tumor progression or recurrence based on Response Assessment in Neuro-Oncology criteria. Maximum and mean tumor/brain ratios of (18)F-FET uptake were determined (20-40 min post-injection) as well as tracer uptake kinetics (ie, time to peak and patterns of the time-activity curves). Diagnoses were confirmed histologically (95%) or by clinical follow-up (5%). Diagnostic accuracies of PET and MR parameters for the detection of tumor progression or recurrence were evaluated by receiver operating characteristic analyses/chi-square test. Tumor progression or recurrence could be diagnosed in 121 of 132 cases (92%). MRI and (18)F-FET PET findings were concordant in 84% and discordant in 16%. Compared with the diagnostic accuracy of conventional MRI to diagnose tumor progression or recurrence (85%), a higher accuracy (93%) was achieved by (18)F-FET PET when a mean tumor/brain ratio ≥2.0 or time to peak PET parameters differentiate progressive or recurrent glioma from treatment-related nonneoplastic changes with higher accuracy than conventional MRI. © The Author(s) 2015. Published by Oxford University Press on behalf of the Society for Neuro-Oncology. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  19. Physical activity attenuates the influence of FTO variants on obesity risk: a meta-analysis of 218,166 adults and 19,268 children.

    Directory of Open Access Journals (Sweden)

    Tuomas O Kilpeläinen

    2011-11-01

    Full Text Available The FTO gene harbors the strongest known susceptibility locus for obesity. While many individual studies have suggested that physical activity (PA may attenuate the effect of FTO on obesity risk, other studies have not been able to confirm this interaction. To confirm or refute unambiguously whether PA attenuates the association of FTO with obesity risk, we meta-analyzed data from 45 studies of adults (n = 218,166 and nine studies of children and adolescents (n = 19,268.All studies identified to have data on the FTO rs9939609 variant (or any proxy [r(2>0.8] and PA were invited to participate, regardless of ethnicity or age of the participants. PA was standardized by categorizing it into a dichotomous variable (physically inactive versus active in each study. Overall, 25% of adults and 13% of children were categorized as inactive. Interaction analyses were performed within each study by including the FTO×PA interaction term in an additive model, adjusting for age and sex. Subsequently, random effects meta-analysis was used to pool the interaction terms. In adults, the minor (A- allele of rs9939609 increased the odds of obesity by 1.23-fold/allele (95% CI 1.20-1.26, but PA attenuated this effect (p(interaction  = 0.001. More specifically, the minor allele of rs9939609 increased the odds of obesity less in the physically active group (odds ratio  = 1.22/allele, 95% CI 1.19-1.25 than in the inactive group (odds ratio  = 1.30/allele, 95% CI 1.24-1.36. No such interaction was found in children and adolescents.The association of the FTO risk allele with the odds of obesity is attenuated by 27% in physically active adults, highlighting the importance of PA in particular in those genetically predisposed to obesity.

  20. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  1. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  2. The Non-Destructive Determination of Burn-Up by Means of the Pr{sup l44} 2.18 M Gamma Activity

    Energy Technology Data Exchange (ETDEWEB)

    Forsyth, R.S.; Blackadder, W.H.

    1965-05-15

    In recent years, gamma scanning has been used at several establishments for the determination of the burn-up profile along irradiated fuel elements, the 0.75 MeV gamma from Zr-95/Nb-95 being most often employed as the monitored radiation. Difficulties in establishing the geometry and the self-absorption of the gamma activity in the fuel have tended to prevent the application of the method to quantitative burn-up determination, which has usually been carried out by dissolution of selected portions of the fuel followed by conventional fission product separation or by uranium depletion methods. The present paper describes experiments carried out to calibrate a gamma scanner for quantitative measurements by counting the 2.18 MeV gamma activity due to Pr-144, the short-lived daughter of Ce-144 (t{sub 1/2} = 285 days) from selected pellets in several UO{sub 2} fuel specimens. Accurate burn-up values were then determined by dissolution and application of the isotopic dilution method, using stable molybdenum fission products. The elements, which were rotated about their longitudinal axes to minimize asymmetry effects, were viewed by a sodium iodide crystal and a multichannel analyser through a suitable collimator. Correction for attenuation of the gamma activity (much less than for 0.75 MeV) in the fuel elements which were of different diameters (12.6 to 15.04 mm) was made by applying relative attenuation factors and the effective geometry factor of the instrument was determined. In order to check the corrections applied, the counter factor was also calculated, for the 0.75 MeV activity from Zr-95/Nb-95 and in certain cases for the 0.66 MeV activity from Cs-137. The results obtained, demonstrate that at least over the range of diameters and cooling times used the method is suitable for quantitative determinations. Preliminary experiments to explore the possibility of using the high energy gammas (2.35, 2.65 MeV) from Rh-106 as a method for estimating the fraction of

  3. Physical Activity Attenuates the Influence of FTO Variants on Obesity Risk: A Meta-Analysis of 218,166 Adults and 19,268 Children

    Science.gov (United States)

    Kilpeläinen, Tuomas O.; Qi, Lu; Brage, Soren; Sharp, Stephen J.; Sonestedt, Emily; Demerath, Ellen; Ahmad, Tariq; Mora, Samia; Kaakinen, Marika; Sandholt, Camilla Helene; Holzapfel, Christina; Autenrieth, Christine S.; Hyppönen, Elina; Cauchi, Stéphane; He, Meian; Kutalik, Zoltan; Kumari, Meena; Stančáková, Alena; Meidtner, Karina; Balkau, Beverley; Tan, Jonathan T.; Mangino, Massimo; Timpson, Nicholas J.; Song, Yiqing; Zillikens, M. Carola; Jablonski, Kathleen A.; Garcia, Melissa E.; Johansson, Stefan; Bragg-Gresham, Jennifer L.; Wu, Ying; van Vliet-Ostaptchouk, Jana V.; Onland-Moret, N. Charlotte; Zimmermann, Esther; Rivera, Natalia V.; Tanaka, Toshiko; Stringham, Heather M.; Silbernagel, Günther; Kanoni, Stavroula; Feitosa, Mary F.; Snitker, Soren; Ruiz, Jonatan R.; Metter, Jeffery; Larrad, Maria Teresa Martinez; Atalay, Mustafa; Hakanen, Maarit; Amin, Najaf; Cavalcanti-Proença, Christine; Grøntved, Anders; Hallmans, Göran; Jansson, John-Olov; Kuusisto, Johanna; Kähönen, Mika; Lutsey, Pamela L.; Nolan, John J.; Palla, Luigi; Pedersen, Oluf; Pérusse, Louis; Renström, Frida; Scott, Robert A.; Shungin, Dmitry; Sovio, Ulla; Tammelin, Tuija H.; Rönnemaa, Tapani; Lakka, Timo A.; Uusitupa, Matti; Rios, Manuel Serrano; Ferrucci, Luigi; Bouchard, Claude; Meirhaeghe, Aline; Fu, Mao; Walker, Mark; Borecki, Ingrid B.; Dedoussis, George V.; Fritsche, Andreas; Ohlsson, Claes; Boehnke, Michael; Bandinelli, Stefania; van Duijn, Cornelia M.; Ebrahim, Shah; Lawlor, Debbie A.; Gudnason, Vilmundur; Harris, Tamara B.; Sørensen, Thorkild I. A.; Mohlke, Karen L.; Hofman, Albert; Uitterlinden, André G.; Tuomilehto, Jaakko; Lehtimäki, Terho; Raitakari, Olli; Isomaa, Bo; Njølstad, Pål R.; Florez, Jose C.; Liu, Simin; Ness, Andy; Spector, Timothy D.; Tai, E. Shyong; Froguel, Philippe; Boeing, Heiner; Laakso, Markku; Marmot, Michael; Bergmann, Sven; Power, Chris; Khaw, Kay-Tee; Chasman, Daniel; Ridker, Paul; Hansen, Torben; Monda, Keri L.; Illig, Thomas; Järvelin, Marjo-Riitta; Wareham, Nicholas J.; Hu, Frank B.; Groop, Leif C.; Orho-Melander, Marju; Ekelund, Ulf; Franks, Paul W.; Loos, Ruth J. F.

    2011-01-01

    Background The FTO gene harbors the strongest known susceptibility locus for obesity. While many individual studies have suggested that physical activity (PA) may attenuate the effect of FTO on obesity risk, other studies have not been able to confirm this interaction. To confirm or refute unambiguously whether PA attenuates the association of FTO with obesity risk, we meta-analyzed data from 45 studies of adults (n = 218,166) and nine studies of children and adolescents (n = 19,268). Methods and Findings All studies identified to have data on the FTO rs9939609 variant (or any proxy [r 2>0.8]) and PA were invited to participate, regardless of ethnicity or age of the participants. PA was standardized by categorizing it into a dichotomous variable (physically inactive versus active) in each study. Overall, 25% of adults and 13% of children were categorized as inactive. Interaction analyses were performed within each study by including the FTO×PA interaction term in an additive model, adjusting for age and sex. Subsequently, random effects meta-analysis was used to pool the interaction terms. In adults, the minor (A−) allele of rs9939609 increased the odds of obesity by 1.23-fold/allele (95% CI 1.20–1.26), but PA attenuated this effect (p interaction  = 0.001). More specifically, the minor allele of rs9939609 increased the odds of obesity less in the physically active group (odds ratio  = 1.22/allele, 95% CI 1.19–1.25) than in the inactive group (odds ratio  = 1.30/allele, 95% CI 1.24–1.36). No such interaction was found in children and adolescents. Conclusions The association of the FTO risk allele with the odds of obesity is attenuated by 27% in physically active adults, highlighting the importance of PA in particular in those genetically predisposed to obesity. Please see later in the article for the Editors' Summary PMID:22069379

  4. Characterization of Growing Soil Bacterial Communities across a pH gradient Using H218O DNA-Stable Isotope Probing

    Science.gov (United States)

    Welty-Bernard, A. T.; Schwartz, E.

    2014-12-01

    Recent studies have established consistent relationships between pH and bacterial diversity and community structure in soils from site-specific to landscape scales. However, these studies rely on DNA or PLFA extraction techniques from bulk soils that encompass metabolically active and inactive, or dormant, communities, and loose DNA. Dormant cells may comprise up to 80% of total live cells. If dormant cells dominate a particular environment, it is possible that previous interpretations of the soil variables assumed to drive communities could be profoundly affected. We used H218O stable isotope probing and bar-coded illumina sequencing of 16S rRNA genes to monitor the response of actively growing communities to changes in soil pH in a soil microcosm over 14 days. This substrate-independent approach has several advantages over 13C or 15N-labelled molecules in that all growing bacteria should be able to make use of water, allowing characterization of whole communities. We hypothesized that Acidobacteria would increasingly dominate the growing community and that Actinobacteria and Bacteroidetes would decline, given previously established responses by these taxa to soil pH. Instead, we observed the reverse. Actinobacteria abundance increased three-fold from 26 to 76% of the overall community as soil pH fell from pH 5.6 to pH 4.6. Shifts in community structure and decreases in diversity with declining soil pH were essentially driven by two families, Streptomyceaca and Microbacteracea, which collectively increased from 2 to 40% of the entire community. In contrast, Acidobacteria as a whole declined although numbers of subdivision 1 remained stable across all soil pH levels. We suggest that the brief incubation period in this SIP study selected for growth of acid-tolerant Actinobacteria over Acidobacteria. Taxa within Actinomycetales have been readily cultured over short time frames, suggesting rapid growth patterns. Conversely, taxa within Acidobacteria have been

  5. Comparing 2-[18F]fluoro-2-deoxy-D-glucose and [68Ga]gallium-citrate translocation in Arabidopsis thaliana.

    Science.gov (United States)

    Fatangare, Amol; Gebhardt, Peter; Saluz, Hanspeter; Svatoš, Aleš

    2014-10-01

    2-[(18)F]fluoro-2-deoxy-D-glucose ((18)FDG) is a glucose surrogate commonly used in clinical or animal imaging but rarely in plant imaging to trace glucose metabolism. Recently, (18)FDG has been employed in plant imaging for studying photoassimilate translocation and glycoside biosynthesis. There is growing evidence that (18)FDG could be used as a tracer in plant imaging studies to trace sugar dynamics. However, to confirm this hypothesis, it was necessary to show that the observed (18)FDG distribution in an intact plant is an outcome of the chemical nature of the introduced radiotracer and not of the plant vascular architecture or radiotracer introduction method. In the present work, we fed (18)FDG and [(68)Ga]gallium-citrate ((68)Ga-citrate) solution through mature Arabidopsis thaliana leaf and monitored subsequent radioactivity distribution using positron autoradiography. The possible route of radioactivity translocation was elucidated through stem-girdling experiments. We also employed a bi-functional positron emission tomography/computed tomography (PET/CT) modality to capture (18)FDG radiotracer dynamics in one of the plants in order to assess applicability of PET/CT for 4-D imaging in an intact plant. Autoradiography results showed that [(18)F] radioactivity accumulated mostly in roots and young growing parts such as the shoot apex, which are known to act as sinks for photoassimilate. [(18)F] radioactivity translocation, in this case, occurred mainly via phloem. PET/CT results corroborated with autoradiography. [(68)Ga] radioactivity, on the other hand, was mainly translocated to neighboring leaves and its translocation occurred via both xylem and phloem. The radioactivity distribution pattern and translocation route observed after (18)FDG feeding is markedly different from that of (68)Ga-citrate. [(18)F] radioactivity distribution pattern in an intact plant is found similar to the typical distribution pattern of photoassimilates. Despite its limitations in

  6. Positron emission tomography with 2-[18F]-Fluoro-2-Deoxy-D-Glucose for initial staging of hodgkin lymphoma: a single center experience in Brazil

    Directory of Open Access Journals (Sweden)

    Juliano Julio Cerci

    2009-06-01

    Full Text Available BACKGROUND: 2-[18F]-Fluoro-2-Deoxy-D-Glucose (FDG-PET is a well established functional imaging modality for the initial staging of Hodgkin lymphoma (HL in patients from Western Europe and North America. The reliability of FDG-PET in populations of different ethnic groups is unclear, as all investigations published to date have come from developed countries. PURPOSE: The aim of the present study was to investigate the effectiveness of FDG-PET in the initial staging of HL patients in a Brazilian population. METHODS: Eighty-two patients with newly diagnosed HL were prospectively included in the study. All patients were staged with both conventional clinical staging (CCS methods, including computed tomography (CT and whole-body FDG-PET methods. A standard of reference for the nodal regions and the extranodal organs was determined using all available information, including the CCS methods, FDG-PET, the diagnostic histology and the follow-up examinations. The results of the CCS were then compared to the FDG-PET results. RESULTS: The sensitivity of FDG-PET was higher for nodal staging than that of CT (87.8% vs. 61.6%, respectively. FDG-PET was also more sensitive than CT in regard to evaluating the extranodal organs for lymphomatous involvement (96.2% vs. 40.0%, respectively. FDG-PET detected all 16 patients who were characterized by a positive bone marrow biopsy and identified an additional 4 patients with bone marrow disease. The incorporation of FDG-PET coupled with CCS in the staging procedure upstaged 20% (17/82 of the patients and downstaged 11% (9/82 of the patients. As a result of these changes in staging, 15% (13/82 of the patients would have received a different therapeutic regimen. CONCLUSIONS: The FDG-PET method is superior to CT for the detection of nodal and extra-nodal HL. The observation that the FDG-PET method upstaged the disease was the most common result (20% of patients brought about by the addition of PET to the staging algorithm

  7. Role of O-(2-18F-fluoroethyl)-L-tyrosine PET as a diagnostic tool for detection of malignant progression in patients with low-grade glioma.

    Science.gov (United States)

    Galldiks, Norbert; Stoffels, Gabriele; Ruge, Maximilian I; Rapp, Marion; Sabel, Michael; Reifenberger, Guido; Erdem, Zuhal; Shah, Nadim J; Fink, Gereon R; Coenen, Heinz H; Langen, Karl-Josef

    2013-12-01

    In patients with low-grade glioma (LGG) of World Health Organization (WHO) grade II, early detection of progression to WHO grade III or IV is of high clinical importance because the initiation of a specific treatment depends mainly on the WHO grade. In a significant number of patients with LGG, however, information on tumor activity and malignant progression cannot be obtained on the basis of clinical or conventional MR imaging findings only. We here investigated the potential of O-(2-(18)F-fluoroethyl)-L-tyrosine ((18)F-FET) PET to noninvasively detect malignant progression in patients with LGG. Twenty-seven patients (mean age ± SD, 44 ± 15 y) with histologically proven LGG (WHO grade II) were investigated longitudinally twice using dynamic (18)F-FET PET and routine MR imaging. Initially, MR imaging and PET scans were performed, and diagnosis was confirmed on the basis of biopsy. Subsequently, PET scans were obtained when clinical findings or contrast-enhanced MR imaging suggested malignant progression. Maximum and mean tumor-to-brain ratios (20-40 min after injection) (TBRmax and TBRmean, respectively) of (18)F-FET uptake as well as tracer uptake kinetics (i.e., time to peak [TTP] and patterns of the time-activity curves) were determined. The diagnostic accuracy of imaging parameters for the detection of malignant progression was evaluated by receiver-operating-characteristic analyses and by Fisher exact test for 2 × 2 contingency tables. In patients with histologically proven malignant progression toward WHO grade III or IV (n = 18), TBRmax and TBRmean increased significantly, compared with baseline (TBRmax, 3.8 ± 1.0 vs. 2.4 ± 1.0; TBRmean, 2.2 ± 0.3 vs. 1.6 ± 0.6; both P PET parameters (i.e., changes of TBRmax, TTP, or time-activity curve pattern) yielded a significantly higher diagnostic accuracy for the detection of malignant progression than changes of contrast enhancement in MR imaging (accuracy, 81% vs. 63%; P = 0.003). Both tumor-to-brain ratio

  8. Differential uptake of O-(2-18F-fluoroethyl)-L-tyrosine, L-3H-methionine, and 3H-deoxyglucose in brain abscesses.

    Science.gov (United States)

    Salber, Dagmar; Stoffels, Gabriele; Pauleit, Dirk; Oros-Peusquens, Anna-Maria; Shah, Nadim Jon; Klauth, Peter; Hamacher, Kurt; Coenen, Heinz Hubert; Langen, Karl-Josef

    2007-12-01

    The amino acid O-(2-(18)F-fluoroethyl)-L-tyrosine ((18)F-FET) has been shown to be a useful tracer for brain tumor imaging. Experimental studies demonstrated no uptake of (18)F-FET in inflammatory cells but increased uptake has been reported in single cases of human brain abscesses. To explore this inconsistency, we investigated the uptake of (18)F-FET in comparison with that of L-[methyl-(3)H]methionine ((3)H-MET) and D-(3)H-deoxyglucose ((3)H-DG) in brain and calf abscesses in rats. Abscesses were induced in the brain (n = 9) and calf (n = 5) of Fisher CDF rats after inoculation of Staphylococcus aureus. Five days later, (18)F-FET and (3)H-MET (n = 10) or (18)F-FET and (3)H-DG (n = 4) were injected intravenously. One hour after injection the rats were sacrificed, and the brain or calf muscle was investigated using dual-tracer autoradiography. Lesion-to-background ratios (L/B) and standardized uptake values (SUVs) were calculated. The autoradiograms were compared with histology and immunostaining for glial fibrillary acidic protein (GFAP), CD68 for macrophages, and CD11b for microglia. (18)F-FET uptake in the area of macrophage infiltration and activated microglia at the rim of the brain abscesses was low (L/B, 1.5 +/- 0.4). In contrast, high uptake was observed for (3)H-MET as well as for (3)H-DG (L/B, 4.1 +/- 1.1 for (3)H-MET vs. 3.1 +/- 1.5 for (3)H-DG; P < 0.01 vs. (18)F-FET). Results for calf abscesses were similar. In the vicinity of the brain abscesses, slightly increased uptake was noted for (18)F-FET (L/B, 1.8 +/- 0.3) and (3)H-MET (L/B, 1.8 +/- 0.4), whereas (3)H-DG distribution was normal (L/B, 1.2 +/- 0.2). Anti-GFAP immunofluorescence showed a diffuse astrocytosis in those areas. Our results demonstrate that there is no accumulation of (18)F-FET in macrophages and activated microglia in experimental brain abscesses, whereas (3)H-MET and (3)H-DG exhibit high uptake in these cells. Thus, the specificity of (18)F-FET for gliomas may be superior to that

  9. A cost-utility analysis of NRG Oncology/Gynecologic Oncology Group Protocol 218: incorporating prospectively collected quality-of-life scores in an economic model of treatment of ovarian cancer.

    Science.gov (United States)

    Cohn, David E; Barnett, Jason C; Wenzel, Lari; Monk, Bradley J; Burger, Robert A; Straughn, J Michael; Myers, Evan R; Havrilesky, Laura J

    2015-02-01

    To estimate quality-of-life (QOL)-adjusted cost-utility with addition of bevacizumab (B) to intravenous paclitaxel/carboplatin (PC) for primary treatment of advanced-stage epithelial ovarian cancer. A modified Markov state transition model of 3 regimens evaluated in GOG 218 (PC, PC+concurrent B [PCB], and PCB+maintenance B [PCB+B]) was populated by prospectively collected survival, adverse event, and QOL data from GOG 218. Progression-free survival (PFS) and overall survival (OS) were modeled using primary event data. Costs of grade 4 hypertension, grade 3-5 bowel events, and growth factor support were incorporated. QOL scores were converted to utilities and incorporated into the model. Monte Carlo probabilistic sensitivity analysis was performed to account for uncertainty in estimates. PC was the least expensive ($4044) and least effective (mean 1.1 quality-adjusted progression-free years [QA-PFY]) regimen. PCB ($43,703 and 1.13 QA-PFY) was dominated by a combination of PC and PCB+B. PCB+B ($122,700 and 1.25 QA-PFY) was the most expensive regimen with an incremental cost-effectiveness ratio of $792,380/QA-PFY compared to PC. In a model not incorporating QOL, the incremental cost-effectiveness ratio (ICER) of PCB+B was $632,571/PFY compared to PC. In this cost-utility model, incorporation of QOL into an analysis of GOG 218 led to less favorable ICER (by >$150,000/QA-PFY) in regimens containing B compared with those that do not include B. Continued investigation of populations with ovarian cancer in whom the efficacy of treatment with bevacizumab is expected to be increased (or in whom QOL is expected to increase with use) is critical. Copyright © 2014 Elsevier Inc. All rights reserved.

  10. Comparison of O-(2-18F-fluoroethyl)-L-tyrosine PET and 3-123I-iodo-alpha-methyl-L-tyrosine SPECT in brain tumors.

    Science.gov (United States)

    Pauleit, Dirk; Floeth, Frank; Tellmann, Lutz; Hamacher, Kurt; Hautzel, Hubertus; Müller, Hans-W; Coenen, Heinz H; Langen, Karl-J

    2004-03-01

    The aim of this study was to compare PET with O-(2-(18)F-fluoroethyl)-L-tyrosine ((18)F-FET) and SPECT with 3-(123)I-iodo-alpha-methyl- L-tyrosine ((123)I-IMT) in patients with brain tumors. Twenty patients with a suspected brain tumor were investigated by (18)F-FET PET, (123)I-IMT SPECT, and MRI within 3 wk. Region-of-interest analyses were performed on coregistered PET/SPECT/MRI images and the tumor-to-brain ratio (TBR), muscle-to-brain ratio (MBR), cerebellum-to-brain ratio (CerBR), and sinus-to-brain ratio (SBR) were calculated. In addition, the presence of tumor and the discrimination of anatomic structures on (18)F-FET PET and (123)I-IMT SPECT images were visually determined by 3 observers who were unaware of clinical data. The TBR of (18)F-FET and (123)I-IMT uptake in cerebral tumors showed a highly significant correlation (r = 0.96; P < 0.001). In the visual analysis for the presence or absence of tumors, no differences for (123)I-IMT SPECT and (18)F-FET PET were found in 19 of 20 patients; in one patient a low-grade glioma was only identified on (18)F-FET PET images but not on (123)I-IMT SPECT images. The contrast between tumor and normal brain was significantly higher in (18)F-FET PET (TBR, 2.0 +/- 0.9) than in (123)I-IMT SPECT (TBR, 1.5 +/- 0.5). The discrimination of anatomic structures yielded a significantly better score on (18)F-FET PET images (rating score, 2.6 +/- 0.9) compared with (123)I-IMT SPECT images (rating score, 1.7 +/- 0.9). The uptake of (18)F-FET in the muscles was significantly higher compared with (123)I-IMT (MBR (18)F-FET, 1.4 +/- 0.3; MBR (123)I-IMT, 0.6 +/- 0.2; P < 0.001) and (18)F-FET demonstrated a significantly higher blood-pool radioactivity than (123)I-IMT (SBR (18)F-FET, 1.3 +/- 0.2; SBR (123)I-IMT, 0.8 +/- 0.2; P < 0.001). The significant correlation of the TBRs of (18)F-FET and (123)I-IMT indicates that clinical experiences of brain tumor diagnostics with (123)I-IMT SPECT might be valid for (18)F-FET PET although

  11. RESOLUTE PET/MRI Attenuation Correction for O-(2-18F-fluoroethyl-L-tyrosine (FET in Brain Tumor Patients with Metal Implants

    Directory of Open Access Journals (Sweden)

    Claes N. Ladefoged

    2017-08-01

    Full Text Available Aim: Positron emission tomography (PET imaging is a useful tool for assisting in correct differentiation of tumor progression from reactive changes, and the radiolabeled amino acid analog tracer O-(2-18F-fluoroethyl-L-tyrosine (FET-PET is amongst the most frequently used. The FET-PET images need to be quantitatively correct in order to be used clinically, which require accurate attenuation correction (AC in PET/MRI. The aim of this study was to evaluate the use of the subject-specific MR-derived AC method RESOLUTE in post-operative brain tumor patients.Methods: We analyzed 51 post-operative brain tumor patients (68 examinations, 200 MBq [18F]-FET investigated in a PET/MRI scanner. MR-AC maps were acquired using: (1 the Dixon water fat separation sequence, (2 the ultra short echo time (UTE sequences, (3 calculated using our new RESOLUTE methodology, and (4 a same day low-dose CT used as reference “gold standard.” For each subject and each AC method the tumor was delineated by isocontouring tracer uptake above a tumor(T-to-brain background (B activity ratio of 1.6. We measured B, tumor mean and maximal activity (TMEAN, TMAX, biological tumor volume (BTV, and calculated the clinical metrics TMEAN/B and TMAX/B.Results: When using RESOLUTE 5/68 studies did not meet our predefined acceptance criteria of TMAX/B difference to CT-AC < ±0.1 or 5%, TMEAN/B < ±0.05 or 5%, and BTV < ±2 mL or 10%. In total, 46/68 studies failed our acceptance criteria using Dixon, and 26/68 using UTE. The 95% limits of agreement for TMAX/B was for RESOLUTE (−3%; 4%, Dixon (−9%; 16%, and UTE (−7%; 10%. The absolute error when measuring BTV was 0.7 ± 1.9 mL (N.S with RESOLUTE, 5.3 ± 10 mL using Dixon, and 1.7 ± 3.7 mL using UTE. RESOLUTE performed best in the identification of the location of peak activity and in brain tumor follow-up monitoring using clinical FET PET metrics.Conclusions: Overall, we found RESOLUTE to be the AC method that most robustly

  12. Cooked oatmeal consumption is associated with better diet quality, better nutrient intakes, and reduced risk for central adiposity and obesity in children 2-18 years: NHANES 2001-2010.

    Science.gov (United States)

    O'Neil, Carol E; Nicklas, Theresa A; Fulgoni, Victor L; DiRienzo, Maureen A

    2015-01-01

    None of the studies of whole grains that have looked either at diet or weight/adiposity measures have focused exclusively on oatmeal. The objective of this study was to assess the association between oatmeal consumption and nutrient intake, diet quality, and weight/adiposity of children aged 2-18. A nationally representative sample of children aged 2-18 (N=14,690) participating in National Health and Nutrition Examination Survey 2001-2010 was used. Intake was determined from a single 24-h dietary recall. Diet quality was measured using the Healthy Eating Index-2010 (HEI-2010). Covariate-adjusted regression analyses, using appropriate sample weights, were used to determine differences between oatmeal consumers and non-consumers for demographics, nutrient intakes, diet quality, and weight/adiposity measures (poatmeal consumers were more likely to be younger and less likely to be smokers. Consumers had higher intakes of dietary fiber, vitamin A, thiamin, riboflavin, calcium, phosphorus, magnesium, iron, copper, and potassium, and significantly lower intakes of total, monounsaturated and saturated fatty acids, cholesterol, and sodium. Oatmeal consumers had higher dietary quality scores attributable to higher intakes of whole grains and lower intakes of refined grains and empty calories. Children consuming oatmeal were at lower risk for having central adiposity and being obese. Consumption of oatmeal by children was associated with better nutrient intake, diet quality, and reduced risk for central adiposity and obesity and should be encouraged as part of an overall healthful diet.

  13. A phase I study on stereotactic body radiotherapy of liver metastases based on functional treatment planning using positron emission tomography with 2-[(18)F]fluoro-2-deoxy-d-galactose

    DEFF Research Database (Denmark)

    Fode, Mette Marie; Bak-Fredslund, Kirstine; Petersen, Jørgen Baltzer

    2017-01-01

    BACKGROUND AND PURPOSE: The galactose analog 2-[18F]fluoro-2-deoxy-d-galactose (FDGal) is used for quantification of regional hepatic metabolic capacity by functional positron emission tomography computerized tomography (PET/CT). In the present study, FDGal PET/CT was used for functional treatment...... planning (FTP) of stereotactic body radiotherapy (SBRT) of liver metastases with the aim of minimizing radiation dose to the best functioning liver tissue. MATERIAL AND METHODS: Fourteen patients referred for SBRT had FDGal PET/CT performed before and one month after the treatment. The planning CT...... and the FDGal PET/CT images were deformable co-registered. RESULTS: A reduction in the mean dose of approximately 2 Gy to the best functioning sub-volumes was obtained. One patient developed grade 2 acute morbidity and no patients experienced grade 3 or higher acute morbidities. The regional hepatic metabolic...

  14. Early interim 2-[18F]fluoro-2-deoxy-D-glucose positron emission tomography is prognostically superior to international prognostic score in advanced-stage Hodgkin's lymphoma: a report from a joint Italian-Danish study

    DEFF Research Database (Denmark)

    Loft, Annika; Gallamini, Andrea; Hutchings, Martin

    2007-01-01

    PURPOSE: Starting from November 2001, 260 newly diagnosed patients with Hodgkin's lymphoma (HL) were consecutively enrolled in parallel Italian and Danish prospective trials to evaluate the prognostic role of an early interim 2-[(18)F]fluoro-2-deoxy-D-glucose positron emission tomography (FDG-PET...... the prognostic value of IPS and emerges as the single most important tool for planning of risk-adapted treatment in advanced HL.......-PET) scan and the International Prognostic Score (IPS) in advanced HL, treated with conventional ABVD (doxorubicin, bleomycin, vinblastine, and dacarbazine) therapy. PATIENTS AND METHODS: Most patients (n = 190) presented with advanced disease (stages IIB through IVB), whereas 70 presented in stage IIA...

  15. Synthesis, Quality Control and Stability Studies of 2-[(18)F]Fluoro-2-Deoxy-D-Glucose((18)F-FDG) at Different Conditions of Temperature by Physicochemical and Microbiological Assays.

    Science.gov (United States)

    Rahmani, Siyavash; Shahhoseini, Soraya; Mohamadi, Reza; Vojdani, Mostafa

    2017-01-01

    The introduction of 2-[(18)F] fluor-2-deoxy-D-glucose ((18)FDG) has provided a valuable tool for the study of glucose metabolism in both normal and diseased tissue in conjunction with positron emission tomography (PET). (18)FDG is the most important radiopharmaceutical to be used in Nuclear Medicine for studying the brain, heart and tumor. The advancement in synthesis and quality control of (18)FDG and its approval by US FDA are main reasons for increasing clinical application of (18)FDG over the last 20 years. In this manuscript we explain the synthesis, quality control and stability studies of (18)FDG (evaluate the physicochemical and microbiological stability of (18)FDG, stored at room temperature (18 - 23 °C), and 35 - 40 °C, at different time intervals). We investigated how the influence of environmental factors in different lengths of time, alters the quality of this radiopharmaceutical. The pH, radionuclidic identity and purity, radiochemical identity and purity, chemical purity, bacterial endotoxins and sterility of (18)FDG were evaluated according to the European Pharmacopoeia 7ed. analytical methods and acceptance criteria. The results suggest that under experimental conditions (18)FDG has physicochemical and microbiological stability up to 10 h after the end of synthesis.

  16. Request for interim approval to operate Trench 94 of the 218-E-12B Burial Ground as a chemical waste landfill for disposal of polychlorinated biphenyl waste in submarine reactor compartments. Revision 2

    Energy Technology Data Exchange (ETDEWEB)

    Cummins, G.D.

    1994-06-01

    This request is submitted to seek interim approval to operate a Toxic Substances Control Act (TSCA) of 1976 chemical waste landfill for the disposal of polychlorinated biphenyl (PCB) waste. Operation of a chemical waste landfill for disposal of PCB waste is subject to the TSCA regulations of 40 CFR 761. Interim approval is requested for a period not to exceed 5 years from the date of approval. This request covers only the disposal of small 10 quantities of solid PCB waste contained in decommissioned, defueled submarine reactor compartments (SRC). In addition, the request applies only to disposal 12 of this waste in Trench 94 of the 218-E-12B Burial Ground (Trench 94) in the 13 200 East Area of the US Department of Energy`s (DOE) Hanford Facility. Disposal of this waste will be conducted in accordance with the Compliance 15 Agreement (Appendix H) between the DOE Richland Operations Office (DOE-RL) and 16 the US Environmental Protection Agency (EPA), Region 10. During the 5-year interim approval period, the DOE-RL will submit an application seeking final 18 approval for operation of Trench 94 as a chemical waste landfill, including 19 any necessary waivers, and also will seek a final dangerous waste permit from 20 the Washington State Department of Ecology (Ecology) for disposal of lead 21 shielding contained in the SRCS.

  17. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  18. Crown ether inclusion complexes of the early actinide elements, [AnO2(18-crown-6)]n+, An = U, Np, Pu and n = 1, 2: a relativistic density functional study.

    Science.gov (United States)

    Shamov, Grigory A; Schreckenbach, Georg; Martin, Richard L; Hay, P Jeffrey

    2008-03-03

    The title compounds, [AnO2(18-crown-6)]n+, An = U, Np, and Pu and n = 1 and 2, as well as the related (experimentally observed) complex [UO2(dicyclohexyl-18-crown-6)]2+ are studied using relativistic density functional theory (DFT). Different relativistic methods (large-core and small-core effective core potentials, all-electron scalar four-component) and two flavors of approximate DFT (B3LYP and PBE) are used. Calculated bond lengths agree well with the available experimental data for the NpV complex, while larger differences for the UVI complexes appear to be related to the large uncertainties in the experimental data. The axial AnO bonds are found to be weaker and longer than in the corresponding penta-aquo complexes, though still of partial triple-bond character. The AnO bond lengths and strengths decrease along the actinide series, consistent with the actinide contraction. Gas-phase binding energies calculated for the penta-aquo complexes and crown-ether complexes of the actinides studied, as well as ligand-exchange energies, show that there is no intrinsic preference, or "better fit", for actinyl(V) cations as compared to actinyl(VI) ones. Rather, the ability of NpO2+ (NpV) to form in-cavity 18-crown-6 complexes in water, which is impossible for UO22+, is traced to solvation effects in polar solvents. Thus, the experimentally observed stabilization of the pentavalent oxidation state as compared to the hexavalent one is due to the effective screening of the charge provided by the macrocycle, and this leads to destabilization of the AnVI crown complexes relative to their AnV counterparts.

  19. Immunogenicity and safety of a single dose of a CRM-conjugated meningococcal ACWY vaccine in children and adolescents aged 2-18 years in Taiwan: results of an open label study.

    Science.gov (United States)

    Huang, Li-Min; Chiu, Nan-Chang; Yeh, Shu-Jen; Bhusal, Chiranjiwi; Arora, Ashwani Kumar

    2014-09-08

    MenACWY-CRM (Menveo®, Novartis Vaccines, Siena, Italy) is a quadrivalent meningococcal conjugate vaccine developed to help prevent invasive meningococcal disease caused by Neisseria meningitidis serogroups A, C, W, and Y. It is approved within the European Union in persons >2 years of age and in persons from 2 months to 55 years of age in the United States, among other countries. Little is known about the immunogenicity and safety of this vaccine in Taiwanese children >2 years and adolescents. This study assessed the immunogenicity and safety of a single injection of MenACWY-CRM vaccine in Taiwanese subjects aged 2-18 years old. In this phase III, multicentre, open-label study 341 subjects received one dose of MenACWY-CRM. Immunogenicity measures were rates of seroresponse (defined as the proportion of subjects with a postvaccination hSBA ≥1:8 if the prevaccination (baseline) titre was CRM vaccination at Day 29 for the serogroups A, C, W, and Y were 83%, 93%, 50%, and 65%, respectively. At Day 29 the percentages of subjects with hSBA ≥1:8 against all four serogroups A, C, W and Y were: 83%, 96%, 96% and 82%, respectively. GMTs against all serogroups rose by ≥7-fold from baseline to Day 29. The vaccine was well tolerated. A single dose of MenACWY-CRM demonstrated a robust immune response, and an acceptable safety profile in Taiwanese children and adolescents. Copyright © 2014 Elsevier Ltd. All rights reserved.

  20. Lipidomics and H218O labeling techniques reveal increased remodeling of DHA-containing membrane phospholipids associated with abnormal locomotor responses in α-tocopherol deficient zebrafish (danio rerio embryos

    Directory of Open Access Journals (Sweden)

    Melissa Q. McDougall

    2016-08-01

    Full Text Available We hypothesized that vitamin E (α-tocopherol is required by the developing embryonic brain to prevent depletion of highly polyunsaturated fatty acids, especially docosahexaenoic acid (DHA, 22:6, the loss of which we predicted would underlie abnormal morphological and behavioral outcomes. Therefore, we fed adult 5D zebrafish (Danio rerio defined diets without (E− or with added α-tocopherol (E+, 500 mg RRR-α-tocopheryl acetate/kg diet for a minimum of 80 days, and then spawned them to obtain E− and E+ embryos. The E− compared with E+ embryos were 82% less responsive (p<0.01 to a light/dark stimulus at 96 h post-fertilization (hpf, demonstrating impaired locomotor behavior, even in the absence of gross morphological defects. Evaluation of phospholipid (PL and lysophospholipid (lyso-PL composition using untargeted lipidomics in E− compared with E+ embryos at 24, 48, 72, and 120 hpf showed that four PLs and three lyso-PLs containing docosahexaenoic acid (DHA, including lysophosphatidylcholine (LPC 22:6, required for transport of DHA into the brain, p<0.001, were at lower concentrations in E− at all time-points. Additionally, H218O labeling experiments revealed enhanced turnover of LPC 22:6 (p<0.001 and three other DHA-containing PLs in the E− compared with the E+ embryos, suggesting that increased membrane remodeling is a result of PL depletion. Together, these data indicate that α-tocopherol deficiency in the zebrafish embryo causes the specific depletion and increased turnover of DHA-containing PL and lyso-PLs, which may compromise DHA delivery to the brain and thereby contribute to the functional impairments observed in E− embryos.

  1. 36 CFR 2.18 - Snowmobiles.

    Science.gov (United States)

    2010-07-01

    ... of total snowmobile noise that exceeds 78 decibels measured on the A-weighted scale measured at 50... decibels on the A-weighted scale at 50 feet. Snowmobiles manufactured prior to July 1, 1973 shall not register more than 86 decibels on the A-weighted scale at 50 feet. All decibel measurements shall be based...

  2. 49 CFR 218.93 - Definitions.

    Science.gov (United States)

    2010-10-01

    .... Siding means an auxiliary track, adjacent and connected to a main track, used for meeting or passing trains. Signaled siding means a siding within traffic control system (TCS) territory or within interlocking limits where a signal indication authorizes the siding's use. Switchtender means a qualified...

  3. Publications | Page 218 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Report of the Ghana School Survey Results Dissemination workshop, Accra, Ghana, September 2012 (restricted access). During the transition period from childhood to adolescence, poor dietary habits are often established which are hard to reverse later in life. Evidence suggests that early child nutrition sets the stage for ...

  4. 27 CFR 24.218 - Other wine.

    Science.gov (United States)

    2010-04-01

    ... kinds of fruit. (3) Wine made with sugar other than pure dry sugar, liquid pure sugar, and invert sugar... wines considered to be other wine include: (1) Wine made with sugar, water, or sugar and water beyond.... Other wine will have a basic character derived from the primary winemaking material. If sugar is used to...

  5. GPCR Interaction: 218 [GRIPDB[Archive

    Lifescience Database Archive (English)

    Full Text Available faces of RXFP2 A Relaxin Type 2 RXFP2 A Relaxin Type 2 RXFP2 Experiment RXFP1 needs to homodimerize in order to be transported from ER to the cell membrane. 19416159 ... NP_570718.1 ...

  6. BDML Metadata: 218 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available NC-SA 0.150 2a3c851a-29f8-43da-a783-3c09668238da 0.105 x 0.105 x 0.5 (micrometer), 40 (second) http://ssbd.qbic.riken.jp/data.../source/Ce_KK_P002/RNAi_T20G5.2_040909_01/ http://ssbd.qbic.riken.jp/data.../bdml/Ce_KK_P002/RNAi_T20G5.2_040909_01.bdml0.15.xml http://ssbd.qbic.riken.jp/data/pdpml/Ce_KK_P00...2.pdpml0.05.xml http://ssbd.qbic.riken.jp/search/2a3c851a-29f8-43da-a783-3c09668238da/ http://ssbd.qbic.riken.jp/omero/webclient/?show=dataset-159 ...

  7. Reference: 218 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available the previously identified At5g23960 gene lacked the emission of three sesquiterp... monoterpene and sesquiterpene emissions suggesting that floral terpene volatiles must play some significant

  8. 49 CFR 218.5 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... their components, including brake systems. Members of train and yard crews are excluded except when... sufficiently lighted so as to make the blue signal clearly distinguishable. Camp car means any on-track vehicle, including outfit, camp, or bunk cars or modular homes mounted on flat cars used to house rail employees. It...

  9. 50 CFR 218.104 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ... to ensure quick and effective communication within the command structure in order to facilitate... Underwater Detonations (up to 10-lb charges): (i) Exclusion Zones—All demolitions and ship mine... communication to assure immediate notification to the dropping plane that the target area may have been fouled...

  10. 50 CFR 218.23 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ... Coordinator for any unusual marine mammal behavior and any stranding, beached live/dead, or floating marine...-off location. (C) “Big Eyes” on the ship shall be used to monitor a 600-yd (548-m) buffer zone for... are detected within or approaching the 600-yd (548-m) buffer zone. If marine mammals are present...

  11. 29 CFR 1910.218 - Forging machines.

    Science.gov (United States)

    2010-07-01

    ... a man to reach the full length of the die without placing his hand or arm between the dies. (vii... shall be closed and locked in the off position while the hammer is being adjusted, repaired, or serviced...

  12. 49 CFR 218.22 - Utility employee.

    Science.gov (United States)

    2010-10-01

    ... one or more locomotives coupled, with or without cars) and before commencing any duties with the crew... authorized to work as part of the crew. Thereafter, communication shall be maintained in such a manner that... uncouple air hoses and other electrical or mechanical connections; prepare rail cars for coupling; set...

  13. 36 CFR 218.14 - Judicial proceedings.

    Science.gov (United States)

    2010-07-01

    ... ADMINISTRATIVE REVIEW PROCESSES Predecisional Administrative Review Process for Hazardous Fuel Reduction Projects... process set forth in this subpart fully implements Congress' design for a predecisional administrative... hazardous fuel reduction project by exhausting the administrative review process set out in this subpart...

  14. 36 CFR 218.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... ADMINISTRATIVE REVIEW PROCESSES Predecisional Administrative Review Process for Hazardous Fuel Reduction Projects... administrative review of a proposed authorized hazardous fuel reduction project as defined in the HFRA. Objection... notice in the Federal Register. Objection process: Those procedures established for predecisional...

  15. 36 CFR 218.13 - Secretary's authority.

    Science.gov (United States)

    2010-07-01

    ... ADMINISTRATIVE REVIEW PROCESSES Predecisional Administrative Review Process for Hazardous Fuel Reduction Projects... Secretary constitutes the final administrative determination of the Department of Agriculture. ...

  16. 36 CFR 218.6 - Reviewing officer.

    Science.gov (United States)

    2010-07-01

    ... ADMINISTRATIVE REVIEW PROCESSES Predecisional Administrative Review Process for Hazardous Fuel Reduction Projects... the administrative review processes of other Federal agencies, for authorized hazardous fuel reduction... administrative review. ...

  17. Publications | Page 218 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Merger control and state ownership (restricted access) · Benarkah rumahsakit pemerintah menggunakan manajemen keluhan pasien untuk melindungi pembayar pajak? : studi reformasi birokrasi di rumahsakit Bantul diy (restricted access). Background: Hospitals are generally moving towards a system of management ...

  18. 48 CFR 218.201 - Contingency operation.

    Science.gov (United States)

    2010-10-01

    ... preparation for overseas contingency, humanitarian, or peacekeeping operations. See 213.270(c)(3) and (5). (4... humanitarian or peacekeeping operation may use the Governmentwide commercial purchase card to make a purchase... threshold in support of a contingency operation or a humanitarian or peacekeeping operation. See 213.305-3(d...

  19. Comparative Oncology: Evaluation of 2-Deoxy-2-[18F]fluoro-D-glucose (FDG Positron Emission Tomography/Computed Tomography (PET/CT for the Staging of Dogs with Malignant Tumors.

    Directory of Open Access Journals (Sweden)

    Stefanie M F Seiler

    Full Text Available 2-Deoxy-2-[18F]fluoro-D-glucose PET/CT is a well-established imaging method for staging, restaging and therapy-control in human medicine. In veterinary medicine, this imaging method could prove to be an attractive and innovative alternative to conventional imaging in order to improve staging and restaging. The aim of this study was both to evaluate the effectiveness of this image-guided method in canine patients with spontaneously occurring cancer as well as to illustrate the dog as a well-suited animal model for comparative oncology.Ten dogs with various malignant tumors were included in the study and underwent a whole body FDG PET/CT. One patient has a second PET-CT 5 months after the first study. Patients were diagnosed with histiocytic sarcoma (n = 1, malignant lymphoma (n = 2, mammary carcinoma (n = 4, sertoli cell tumor (n = 1, gastrointestinal stromal tumor (GIST (n = 1 and lung tumor (n = 1. PET/CT data were analyzed with the help of a 5-point scale in consideration of the patients' medical histories.In seven of the ten dogs, the treatment protocol and prognosis were significantly changed due to the results of FDG PET/CT. In the patients with lymphoma (n = 2 tumor extent could be defined on PET/CT because of increased FDG uptake in multiple lymph nodes. This led to the recommendation for a therapeutic polychemotherapy as a treatment. In one of the dogs with mammary carcinoma (n = 4 and in the patient with the lung tumor (n = 1, surgery was cancelled due to the discovery of multiple metastasis. Consequently no treatment was recommended.FDG PET/CT offers additional information in canine patients with malignant disease with a potential improvement of staging and restaging. The encouraging data of this clinical study highlights the possibility to further improve innovative diagnostic and staging methods with regard to comparative oncology. In the future, performing PET/CT not only for staging but also in therapy control could offer a

  20. PET imaging of hepatocellular carcinoma with 2-deoxy-2[18F]fluoro-D-glucose, 6-deoxy-6[18F] fluoro-D-glucose, [1-11C]-acetate and [N-methyl-11C]-choline.

    Science.gov (United States)

    Salem, N; Kuang, Y; Wang, F; Maclennan, G T; Lee, Z

    2009-04-01

    This study was designed to investigate the performance of positron emission tomography (PET) imaging for hepatocellular carcinoma (HCC) on a hepatitis viral infection-induced woodchuck model using existing tracers such as 2-deoxy-2[(18)F]fluoro-D-glucose (2FDG), 6-deoxy-6[(18)F]fluoro-D-glucose (6FDG), [1(-11)C]acetate (acetate) and [N-methyl(-11)C]choline (choline). Fourteen woodchucks with HCC were imaged with different radiotracers: 13 (10 with HCC and 3 controls) with 2FDG; 4 (3 with HCC and 1 control) with 6FDG; 13 (10 with HCC and 3 controls) with acetate; 4 (2 with HCC and 2 controls) with choline. The woodchucks were euthanized after imaging experiments and liver tissues were harvested for histology, for enzymatic activities including hexokinase (HK), glucose-6-phosphatase, acetyl-CoA synthetase (ACAS) and choline kinase (CK), and for differential gene expressions between the HCCs and the surrounding hepatic tissues. 2FDG detected 7/13 tumors with a tumor-to-liver uptake ratio (T/L) of 1.36+/-0.13. Five of these HCCs were moderately- or poorly-differentiated. The HK/glucose-6-phosphatase ratio was significantly higher in HCCs compared to the surrounding liver tissues (P=0.05). None of the HCCs imaged with 6FDG were detected by PET (T/L=1.01+/-0.11). Acetate detected 16/17 HCCs (T/L=2.02+/-0.7). ACAS activity was significantly higher in HCCs (P=0.01) and lipids-related genes were found up-regulated. Choline imaging detected all HCCs (T/L=1.63+/-0.34). CK activity was significantly higher in HCCs (P=0.001). Well-differentiated and some moderately-differentiated HCCs do not uptake 2FDG more than the surrounding liver tissues, but display increased acetate uptake. There is no contrast between HCCs and the surrounding liver tissues on the 6FDG PET images. Despite elevated background signal from the liver, choline uptake seems to be detectable in the HCCs scanned in this study.

  1. Comparison of the image-derived radioactivity and blood-sample radioactivity for estimating the clinical indicators of the efficacy of boron neutron capture therapy (BNCT): 4-borono-2-18F-fluoro-phenylalanine (FBPA) PET study.

    Science.gov (United States)

    Isohashi, Kayako; Shimosegawa, Eku; Naka, Sadahiro; Kanai, Yasukazu; Horitsugi, Genki; Mochida, Ikuko; Matsunaga, Keiko; Watabe, Tadashi; Kato, Hiroki; Tatsumi, Mitsuaki; Hatazawa, Jun

    2016-12-01

    In boron neutron capture therapy (BNCT), positron emission tomography (PET) with 4-borono-2-18F-fluoro-phenylalanine (FBPA) is the only method to estimate an accumulation of 10B to target tumor and surrounding normal tissue after administering 10B carrier of L-paraboronophenylalanine and to search the indication of BNCT for individual patient. Absolute concentration of 10B in tumor has been estimated by multiplying 10B concentration in blood during BNCT by tumor to blood radioactivity (T/B) ratio derived from FBPA PET. However, the method to measure blood radioactivity either by blood sampling or image data has not been standardized. We compared image-derived blood radioactivity of FBPA with blood sampling data and studied appropriate timing and location for measuring image-derived blood counts. We obtained 7 repeated whole-body PET scans in five healthy subjects. Arterialized venous blood samples were obtained from the antecubital vein, heated in a heating blanket. Time-activity curves (TACs) of image-derived blood radioactivity were obtained using volumes of interest (VOIs) over ascending aorta, aortic arch, pulmonary artery, left and right ventricles, inferior vena cava, and abdominal aorta. Image-derived blood radioactivity was compared with those measured by blood sampling data in each location. Both the TACs of blood sampling radioactivity in each subject, and the TACs of image-derived blood radioactivity showed a peak within 5 min after the tracer injection, and promptly decreased soon thereafter. Linear relationship was found between blood sampling radioactivity and image-derived blood radioactivity in all the VOIs at any timing of data sampling (p < 0.001). Image-derived radioactivity measured in the left and right ventricles 30 min after injection showed high correlation with blood radioactivity. Image-derived blood radioactivity was lower than blood sampling radioactivity data by 20 %. Reduction of blood radioactivity of FBPA in left ventricle

  2. Comparative Oncology: Evaluation of 2-Deoxy-2-[18F]fluoro-D-glucose (FDG) Positron Emission Tomography/Computed Tomography (PET/CT) for the Staging of Dogs with Malignant Tumors.

    Science.gov (United States)

    Seiler, Stefanie M F; Baumgartner, Christine; Hirschberger, Johannes; Beer, Ambros J; Brühschwein, Andreas; Kreutzmann, Nina; Laberke, Silja; Wergin, Melanie C; Meyer-Lindenberg, Andrea; Brandl, Johanna; von Thaden, Anne-Kathrin; Farrell, Eliane; Schwaiger, Markus

    2015-01-01

    2-Deoxy-2-[18F]fluoro-D-glucose PET/CT is a well-established imaging method for staging, restaging and therapy-control in human medicine. In veterinary medicine, this imaging method could prove to be an attractive and innovative alternative to conventional imaging in order to improve staging and restaging. The aim of this study was both to evaluate the effectiveness of this image-guided method in canine patients with spontaneously occurring cancer as well as to illustrate the dog as a well-suited animal model for comparative oncology. Ten dogs with various malignant tumors were included in the study and underwent a whole body FDG PET/CT. One patient has a second PET-CT 5 months after the first study. Patients were diagnosed with histiocytic sarcoma (n = 1), malignant lymphoma (n = 2), mammary carcinoma (n = 4), sertoli cell tumor (n = 1), gastrointestinal stromal tumor (GIST) (n = 1) and lung tumor (n = 1). PET/CT data were analyzed with the help of a 5-point scale in consideration of the patients' medical histories. In seven of the ten dogs, the treatment protocol and prognosis were significantly changed due to the results of FDG PET/CT. In the patients with lymphoma (n = 2) tumor extent could be defined on PET/CT because of increased FDG uptake in multiple lymph nodes. This led to the recommendation for a therapeutic polychemotherapy as a treatment. In one of the dogs with mammary carcinoma (n = 4) and in the patient with the lung tumor (n = 1), surgery was cancelled due to the discovery of multiple metastasis. Consequently no treatment was recommended. FDG PET/CT offers additional information in canine patients with malignant disease with a potential improvement of staging and restaging. The encouraging data of this clinical study highlights the possibility to further improve innovative diagnostic and staging methods with regard to comparative oncology. In the future, performing PET/CT not only for staging but also in therapy control could offer a significant

  3. Steric versus electronic factors in metallacarborane isomerisation: nickelacarboranes with 3,1,2-, 4,1,2- and 2,1,8-NiC2B9 architectures and pendant carborane groups, derived from 1,1'-bis(o-carborane).

    Science.gov (United States)

    Mandal, Dipendu; Man, Wing Y; Rosair, Georgina M; Welch, Alan J

    2016-10-14

    Metalation of the [7-(1'-1',2'-closo-C2B10H11)-7,8-nido-C2B9H10](2-) dianion with various {NiPP(2+)} or {NiP2(2+)} fragments (PP = chelating diphosphine; P = monodentate phosphine or phosphite) leads either to unisomerised 3,1,2-NiC2B9 species or to isomerised 4,1,2-NiC2B9 or 2,1,8-NiC2B9 species, all with a pendant C2B10 substituent. The products [1-(1'-1',2'-closo-C2B10H11)-3-dppe-3,1,2-closo-NiC2B9H10] (1), [2-(1'-1',2'-closo-C2B10H11)-4-dppe-4,1,2-closo-NiC2B9H10] (2), [8-(1'-1',2'-closo-C2B10H11)-2-dmpe-2,1,8-closo-NiC2B9H10] (3), [1-(1'-1',2'-closo-C2B10H11)-3,3-(PMe3)2-3,1,2-closo-NiC2B9H10] (4), [1-(1'-1',2'-closo-C2B10H11)-3,3-(PMe2Ph)2-3,1,2-closo-NiC2B9H10] (6), [1-(1'-1',2'-closo-C2B10H11)-3,3-{P(OMe)3}2-3,1,2-closo-NiC2B9H10] (9) and [1-(1'-1',2'-closo-C2B10H11)-2,2-{P(OMe)3}2-2,1,8-closo-NiC2B9H10] (10) were fully characterised spectroscopically and crystallographically, whilst [2-(1'-1',2'-closo-C2B10H11)-4,4-(PMePh2)2-4,1,2-closo-NiC2B9H10] (8) was characterised spectroscopically. Overall the results suggest that an important factor in a 3,1,2 to 4,1,2 isomerisation is the relief gained from steric crowding, whereas a 3,1,2 to 2,1,8 isomerisation appears to be favoured by strongly electron-donating ligands on the metal.

  4. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  5. Study of systemic disease IgG4. Usefulness of 2-[18F]-fluoro-2-deoxy-D-glucose -positron emission tomography/computed tomography for staging, selection of biopsy site, evaluation of treatment response and follow-up.

    Science.gov (United States)

    Martinez-Pimienta, Guillermo; Noriega-Álvarez, Edel; Simó-Perdigó, Marc

    2017-09-01

    Immunoglobulin G4-related systemic disease (IgG4-RSD) is a recently emerging disorder characterized by swelling lesions with storiform fibrosis and lymphoplasmacytic infiltration enriched with IgG4-positive plasma cells. IgG4-RSD has been found in multiple organs/tissues. The diagnosis requires the integration of clinical, serological, imaging, histopathological, and immunohistological features. The 2-[18F]-fluoro-2-deoxy-D-glucose-positron emission tomography/computed tomography (18F-FDG PET/CT) enables the acquisition of whole-body images and provides functional information about disease activity. However, its current role in IgG4-RSD is not well established in clinical practice. In our case, we studied a patient with systemic symptoms, submaxillary adenopathy, and imaging explorations that initially guided toward a lymphoproliferative process. However, the differential diagnosis with an autoimmune systemic disease type IgG4 was considered because of elevated levels of serum immunoglobulins. The study was completed with 18F-FDG PET/CT that not only allowed us to assess the extension disease and to locate the best lesion for biopsy but also allowed us to evaluate the response to treatment and to diagnose the suspicion of recurrence. In this case, PET/CT shows its usefulness in clinical practice.

  6. Hybrid microPET imaging for dosimetric applications in mice: improvement of activity quantification in dynamic microPET imaging for accelerated dosimetry applied to 6-[18 F]fluoro-L-DOPA and 2-[18 F]fluoro-L-tyrosine.

    Science.gov (United States)

    Bretin, F; Mauxion, T; Warnock, G; Bahri, M A; Libert, L; Lemaire, C; Luxen, A; Bardiès, M; Seret, A; Plenevaux, A

    2014-06-01

    Dynamic microPET imaging has advantages over traditional organ harvesting, but is prone to quantification errors in small volumes. Hybrid imaging, where microPET activities are cross-calibrated using post scan harvested organs, can improve quantification. Organ harvesting, dynamic imaging and hybrid imaging were applied to determine the human and mouse radiation dosimetry of 6-[18 F]fluoro-L-DOPA and 2-[18 F]fluoro-L-tyrosine and compared. Two-hour dynamic microPET imaging was performed with both tracers in four separate mice for 18 F-FDOPA and three mice for 18 F-FTYR. Organ harvesting was performed at 2, 5, 10, 30, 60 and 120 min post tracer injection with n = 5 at each time point for 18 F-FDOPA and n = 3 at each time point for 18 F-FTYR. Human radiation dosimetry projected from animal data was calculated for the three different approaches for each tracer using OLINDA/EXM. S-factors for the MOBY phantom were used to calculate the animal dosimetry. Correlations between dose estimates based on organ harvesting and imaging was improved from r = 0.997 to r = 0.999 for 18 F-FDOPA and from r = 0.985 to r = 0.996 (p < 0.0001 for all) for 18 F-FTYR by using hybrid imaging. Hybrid imaging yields comparable results to traditional organ harvesting while partially overcoming the limitations of pure imaging. It is an advantageous technique in terms of number of animals needed and labour involved.

  7. All projects related to | Page 218 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-04-01

    Promoting Innovation in the Services Sector: Toward Productivity and Competitiveness. Project. The services sector is increasingly important to the economies of Latin America and the Caribbean, but productivity remains relatively low. Start Date: April 1, 2012. End Date: March 12, 2014. Topic: LATIN AMERICA, SERVICE ...

  8. 218-IJBCS-Article-Dr S Nwodo Chinedu

    African Journals Online (AJOL)

    Dr Gatsing

    Common agro-wastes found in Lagos, Nigeria (cassava shavings, corncob, sawdust, and sugarcane pulp) were compared with ... the substrates investigated, cassava shavings have the best potential to serve as substrate for fermentation by. Penicillium ... including wood, fabrics and leather objects. While some species ...

  9. 218-IJBCS-Article-Dr S Nwodo Chinedu

    African Journals Online (AJOL)

    Dr Gatsing

    3(2): 203-208, 2009. 204 penetrate the dead plant matter and utilize the cell wall components as growth substrates. (Grant and Long, 1981). Among them is ..... Nwodo-Chinedu S, Okochi VI, Smith HA,. Omidiji O. 2005. Isolation of cellulolytic microfungi involved in wood-waste decomposition: Prospect for enzymatic.

  10. Dicty_cDB: VFK218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FYSXFVVRQLDXVLTHSGYDXDVFPFNFMPGLXWYIFP*xss*rvygqxw f Translated Amino Acid sequence (All Frames) Frame A: --...YSAPFGFTASYAHPVEXVFLGIATFAP VLIIRPHYXTFYSXFVVRQLDXVLTHSGYDXDVFPFNFMPGLXWYIFP*xss*rvygqxw f Homology vs CSM-c

  11. Dicty_cDB: VSG218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence rivdsgltlkhlmellnhrnpnslhtavllrkkeglkvevpvkymgfdipmvfiigygld faenyrelpylgelkeecykk*INFKEKK--- ---E...---EDIVDSGLTLKHLMELLNHRNPNSLHTAVLLRKKEGLKVEVPVKYMGFDIPMVFIIG YGLDFAENYRELP Translated Amino Acid sequence...EVPVKYMGFDIPMVFIIG YGLDFAENYRELP Frame B: rivdsgltlkhlmellnhrnpnslhtavllrkkeglkvevpvkymgfdipmvfiigygld

  12. 50 CFR 218.184 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... and without test events in order to compare density, geographical distribution and behavioral... observers' schedule. (v) MMOs shall monitor for marine mammals from the same height above water as the Navy...) Number of individuals; (iv) Calves observed (y/n); (v) Initial detection sensor; (vi) Indication of...

  13. Dicty_cDB: VSF218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available significant alignments: (bits) Value N BD092935 |BD092935.1 Methods and compositions for synthesis of long c...hain polyunsaturated fatty acids in plants. 936 0.0 1 BD082645 |BD082645.1 Methods and composition...s for synthesis of long chain polyunsaturated fatty acids. 936 0.0 1 BD082630 |BD082630.1 Methods and composition

  14. 50 CFR 218.2 - Permissible methods of taking.

    Science.gov (United States)

    2010-10-01

    ... of 68 annually); (G) Clymene dolphin (S. clymene)—165 (an average of 33 annually); (H) Atlantic... average of 3 annually); (C) Rough-toothed dolphin (Steno bredanensis)—5 (an average of 1 annually); (D) Bottlenose dolphin (Tursiops truncatus)—145 (an average of 29 annually); (E) Pantropical spotted dolphin...

  15. 50 CFR 218.24 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... animal(s) (such as animal closing to bow ride, paralleling course/speed, floating on surface and not... proposal that factor into its priority. (2) A method for annually reviewing, with NMFS, monitoring results... Annual Monitoring Plan Report, if that is how the Navy chooses to submit the information) if submitted...

  16. 50 CFR 218.14 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... bow ride, paralleling course/speed, floating on surface and not swimming etc.), including speed and... clearly describes the characteristics of a proposal that factor into its priority. (2) A method for... Report, if that is how the Navy chooses to submit the information) if submitted within 3 months of...

  17. 50 CFR 218.5 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... bow ride, paralleling course/speed, floating on surface and not swimming etc.), including speed and... clearly describes the characteristics of a proposal that factor into its priority. (2) A method for... chooses to submit the information) if submitted within 3 months of receipt. These reports shall be...

  18. Aeronautical Engineering: A Continuing Bibliography with Indexes (Supplement 218)

    Science.gov (United States)

    1987-10-01

    case over a University, Japan), KEISUKE SAWADA (Kawasaki Heavy Industries , 3-to-1 range of initial pulse strengths. Author Ltd., Aircraft Engineering...CHRONOGRAM Ishikawajima - Harima Engineering Review (ISSN 0578-7904), vol. FOR THE COMPRESSORS OF AIRCRAFT GAS TURBINE 27, Jan. 1987, p. 36-41. In Japanese...research is the possibility of relieving airport congestion in the PETER JOST (Airbus Industrie Canada, Montreal) (CASI, Annual near future, especially in

  19. Dicty_cDB: VFF218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 124000-223 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck... USDA-FP_125000-394 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck

  20. 49 CFR 218.99 - Shoving or pushing movements.

    Science.gov (United States)

    2010-10-01

    ... employee who will direct the move. The job briefing shall include the means of communication to be used... (ii) Giving signals or instructions necessary to control the movement. (c) Additional requirements for... stopped; and (2) If technology is relied upon, whether primarily or as a safeguard, to provide pull-out...

  1. 1935 15' Quad #218 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  2. 218 GAGANIJA, MS, *MKOMA, SL and LEMA, ES

    African Journals Online (AJOL)

    Osondu

    2012-03-24

    Mar 24, 2012 ... noise emission, contributing about 55% to the total noise (Pandya 2002; Sinha and Sridharan,. 2003). The growing vehicle population gives rise to unrestrained noise pollution and associated health effects and can cause psychological and physiological disorders. The effects of noise are seldom ...

  3. 32 CFR 724.218 - Limitation-Continuance and Postponements.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 5 2010-07-01 2010-07-01 false Limitation-Continuance and Postponements. 724... Limitation—Continuance and Postponements. (a) A continuance of a discharge review hearing may be authorized... option to resubmit when the case is fully ready for review. (b) Postponements of scheduled reviews...

  4. Dicty_cDB: AFO218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available a and immune antigen for suppressing growth of plasmodium. 58 4e-19 6 BD183625 |B...D183625.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium. 58 4e-19

  5. 49 CFR 218.25 - Workers on a main track.

    Science.gov (United States)

    2010-10-01

    ... locomotive. (c) When emergency repair work is to be done on, under, or between a locomotive or one or more cars coupled to a locomotive, and blue signals are not available, the engineman or operator must be...

  6. TU-C-218-02: Effective Oncology Physics Education.

    Science.gov (United States)

    Burmeister, J; Coffey, C; Salehpour, M; Ibbott, G

    2012-06-01

    The education of medical physicists has historically been quite varied and medical physicists have entered the field through several pathways including specialized educational programs, postdoctoral fellowships, and on-the-job training. It is argued that the contributions of viewpoints from different branches of physics has contributed to the development of novel solutions and advances in radiation oncology. However, there also has been an effort recently to make graduate education of medical physicists more consistent and uniform, particularly for the preparation of clinically oriented therapy physicists. The trend towards a more systematic approach has been guided in part by the requirements for graduate program accreditation developed by CAMPEP and by the requirements for medical physicist certification by the ABR. At the same time, there has been criticism of this approach as being too confining and guiding graduates toward a career as technicians rather than independent thinkers. Educational programs have had to balance the requirements of accreditation and certification against the goal of preparing students for careers as independent researchers. Three speakers will describe the approaches taken by their graduate educational programs to meet the requirements of CAMPEP and adequately prepare graduates for certification by the ABR, while maintaining a commitment to providing a comprehensive education in medical physics. 1. Understand the requirements for graduate program accreditation 2. Understand the education and experience requirements for certification 3. Learn the approaches taken by several graduate programs to meet the requirements for accreditation and certification while providing a comprehensive education in medical physics. © 2012 American Association of Physicists in Medicine.

  7. 36 CFR 218.8 - Filing an objection.

    Science.gov (United States)

    2010-07-01

    ... ADMINISTRATIVE REVIEW PROCESSES Predecisional Administrative Review Process for Hazardous Fuel Reduction Projects... objection process. (b) Incorporation of documents by reference is not allowed, except for the following list...

  8. 36 CFR 218.1 - Purpose and scope.

    Science.gov (United States)

    2010-07-01

    ... ADMINISTRATIVE REVIEW PROCESSES Predecisional Administrative Review Process for Hazardous Fuel Reduction Projects... a predecisional administrative review (hereinafter referred to as “objection”) process for proposed...). The objection process is the sole means by which administrative review of a proposed authorized...

  9. 50 CFR 218.21 - Permissible methods of taking.

    Science.gov (United States)

    2010-10-01

    ... (Stenella attenuata)—100 (an average of 20 annually); (iii) Clymene dolphin (S. clymene)—150 (an average of...) Striped dolphin (S. coeruleoalba)—100 (an average of 20 annually); (vi) Spinner dolphin (S. longirostris...

  10. 50 CFR 218.181 - Permissible methods of taking.

    Science.gov (United States)

    2010-10-01

    ... (Stenella frontalis)—2,355 (an average of 471 annually); (v) Pantropical spotted dolphin (S. attenuata)—115 (an average of 23 annually); (vi) Striped dolphin (S. coeruleoalba)—25 (an average of 5 annually...) Atlantic spotted dolphin (Stenella frontalis)—10 (an average of 2 annually); (iii) Pantropical spotted...

  11. 50 CFR 218.102 - Permissible methods of taking.

    Science.gov (United States)

    2010-10-01

    ... (an average of 1,289 annually); (L) Striped dolphin (Stenella coeruleoalba)—44,290 (an average of 8... average of 4,615 annually); (Q) Pantropical spotted dolphin (Stenella attenuata)—162,495 (an average of 32...) Spinner dolphin (Stenella longirostris)—10,720 (an average of 2,144 annually); and (T) Unidentified...

  12. 50 CFR 218.11 - Permissible methods of taking.

    Science.gov (United States)

    2010-10-01

    ... dolphin (Stenella attenuata)—100 (an average of 20 annually); (iii) Clymene dolphin (S. clymene)—100 (an...) Striped dolphin (S. coeruleoalba)—100 (an average of 20 annually); (vi) Risso's dolphin (Grampus griseus...

  13. Publications | Page 218 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, de la mise en commun des connaissances et de la formation. Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons à ...

  14. Dicty_cDB: SFI218 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CTFCADQKAMGKDDFTKIPNGVNGVEDRMSIVWEDGVNTGKLTWCQFVRATSSEAARIFN IYPRKGRIDVGCDGDIVIWDPNQSKTISKDTHHHAADFNIFEGIKVTGIAVTTIVAGNIV...CTFCADQKAMGKDDFTKIPNGVNGVEDRMSIVWEDGVNTGKLTWCQFVRATSSEAARIFN IYPRKGRIDVGCDGDIVIWDPNQSKTISKDTHHHAADFNIFEGIKVTGIAVTTIVAGNIV

  15. Can 3'-Deoxy-3'-((18)F) Fluorothymidine Out Perform 2-Deoxy-2-((18)F) Fluoro-D-Glucose Positron Emission Tomography/Computed Tomography in the Diagnosis of Cervical Lymphadenopathy in Patients With Oral/Head and Neck Cancer?

    Science.gov (United States)

    Schaefferkoetter, Joshua D; Carlson, Eric R; Heidel, Robert E

    2015-07-01

    The present study investigated the performance of cellular metabolism imaging with 2-deoxy-2-((18)F) fluoro-D-glucose (FDG) versus cellular proliferation imaging with 3'-deoxy-3'-((18)F) fluorothymidine (FLT) in the detection of cervical lymph node metastases in oral/head and neck cancer. We conducted a prospective cohort study to assess a head-to-head performance of FLT imaging and clinical FDG imaging for characterizing cervical lymph node metastases in patients with squamous cell carcinoma (SCC) of the oral/head and neck region. The primary predictor variable of the study was the presence of FDG or FLT avidity within the cervical lymph nodes. The primary outcome variable was the histologic presence of metastatic SCC in the cervical lymph nodes. The performance was reported in terms of the sensitivity, specificity, accuracy, and positive and negative predictive values. The overall accuracy for discriminating positive from negative lymph nodes was evaluated as a function of the positron emission tomography (PET) standardized uptake value (SUV). Receiver operating characteristic (ROC) analyses were performed for both tracers. Eleven patients undergoing surgical resection of SCC of the oral/head and neck region underwent preoperative FDG and FLT PET-computed tomography (CT) scans on separate days. The interpretation of the FDG PET-CT imaging resulted in sensitivity, specificity, accuracy, positive predictive value, and negative predictive value of 43.2, 99.5, 94.4, 88.9, and 94.7%, respectively. The sensitivity, specificity, accuracy, positive predictive value, and negative predictive value for FLT PET-CT imaging was 75.7, 99.2, 97.1, 90.3, and 97.7%, respectively. The areas under the curve for the ROC curves were 0.9 and 0.84 for FDG and FLT, respectively. Poor correlation was observed between the SUV for FDG and FLT within the lymph nodes and tumors. FLT showed better overall performance for detecting lymphadenopathy on qualitative assessment within the total

  16. Using positron emission tomography (PET) response criteria in solid tumours (PERCIST) 1.0 for evaluation of 2'-deoxy-2'-[18F] fluoro-D-glucose-PET/CT scans to predict survival early during treatment of locally advanced non-small cell lung cancer (NSCLC).

    Science.gov (United States)

    Fledelius, Joan; Khalil, Azza Ahmed; Hjorthaug, Karin; Frøkiaer, Jørgen

    2016-04-01

    The demand for early-response evaluation with 2'-deoxy-2'-[18F] fluoro-D-glucose (F-18-FDG) positron emission tomography combined with whole body CT (PET/CT) is rapidly growing. This study was initiated to evaluate the applicability of the PET response criteria in solid tumours (PERCIST 1.0) for response evaluation. We performed a retrospective study of 21 patients with locally advanced non-small cell lung cancer (NSCLC), who had undergone both a baseline and a follow-up F-18-FDG-PET/CT scan during their treatments. The scans were performed at our institution in the period September 2009 and March 2011 and were analysed visually and according to PERCIST 1.0 by one board-certified nuclear medicine physician. The response was compared with overall survival (OS) and progression-free survival (PFS). The variation in key parameters affecting the F-18-FDG uptake was assessed. A kappa of 0.94 corresponding to an almost perfect agreement was found for the comparison of the visual evaluation with PERCIST. Patients with partial metabolic response and stable metabolic disease (as evaluated by PERCIST 1.0) had statistically significant longer median time to progression: 8.4 months (confidence interval (CI) 5.1-11.8 months) as compared with 2.7 months (CI 0-5.6 months) in patients classified with progression. The variation in uptake time between baseline and follow-up scans was more than the recommended 15 min in 48% of patients. PERCIST 1.0 is readily implementable and highly comparable with visual evaluation of response using early F-18-FDG-PET/CT scanning for locally advanced NSCLC patients. In spite of variations in parameters affecting F-18-FDG uptake, evaluation of F-18-FDG-PET/CT during treatment with PERCIST 1.0 is shown to separate non-responders from responders, each with statistically significant differences in both OS and PFS. © 2015 The Royal Australian and New Zealand College of Radiologists.

  17. 23 CFR 450.218 - Self-certifications, Federal findings, and Federal approvals.

    Science.gov (United States)

    2010-04-01

    ... 23 U.S.C., regarding the prohibition of discrimination based on gender; and (10) Section 504 of the... discrimination on the basis of race, color, creed, national origin, sex, or age in employment or business... part 93; (8) The Older Americans Act, as amended (42 U.S.C. 6101), prohibiting discrimination on the...

  18. Calibration of ground-based lidar instrument WLS7-218

    DEFF Research Database (Denmark)

    Gómez Arranz, Paula; Wagner, Rozenn

    This report presents the result of the lidar calibration performed for the given WLS7 Windcube at DTU’s test site for large wind turbine at Høvsøre, Denmark. Calibration is here understood as the establishment of a relation between the reference wind speed measurements with measurement uncertaint......This report presents the result of the lidar calibration performed for the given WLS7 Windcube at DTU’s test site for large wind turbine at Høvsøre, Denmark. Calibration is here understood as the establishment of a relation between the reference wind speed measurements with measurement...... uncertainties provided by measurement standard and corresponding lidar wind speed indications with associated measurement uncertainties. The lidar calibration concerns the 10 minute mean wind speed measurements. The comparison of the lidar measurements of the wind direction with that from wind vanes...

  19. Calibration of ground-based Lidar instrument WLS7-218

    DEFF Research Database (Denmark)

    Yordanova, Ginka; Gómez Arranz, Paula

    This report presents the result of the lidar calibration performed for the given WLS7 Windcube at DTU’s test site for large wind turbines at Høvsøre, Denmark. Calibration is here understood as the establishment of a relation between the reference wind speed measurements with measurement uncertain......This report presents the result of the lidar calibration performed for the given WLS7 Windcube at DTU’s test site for large wind turbines at Høvsøre, Denmark. Calibration is here understood as the establishment of a relation between the reference wind speed measurements with measurement...... uncertainties provided by measurement standard and corresponding lidar wind speed indications with associated measurement uncertainties. The lidar calibration concerns the 10 minute mean wind speed measurements. The comparison of the lidar measurements of the wind direction with that from wind vanes...

  20. Histological evidence of testicular dysgenesis in contralateral biopsies from 218 patients with testicular germ cell cancer

    DEFF Research Database (Denmark)

    Hoei-Hansen, Christina E; Holm, Mette; Rajpert-De Meyts, Ewa

    2003-01-01

    patients, areas with immature and morphologically distorted tubules were also noted. Spermatogenesis was qualitatively normal in 51.4%, whereas 11.5% had very poor or absent spermatogenesis. It is concluded that microscopic testicular dysgenesis is a frequent feature in contralateral biopsies from patients...

  1. Page 1 218 M G Nadkarni Let T be an analytic invertible ...

    Indian Academy of Sciences (India)

    and Smith show that a necessary and sufficient condition that there exists invariant integrals of a certain type on S, or part of S, is that S be not compressible into an arbitrarily small area. This result is an intuitive statement of their result which we explain below. They begin by introducing a function p(e), e being a measurable ...

  2. Using Interactive Videodiscs in Open University Courses. I.E.T. Papers on Broadcasting No. 218.

    Science.gov (United States)

    Fuller, Robert G., Ed.

    This nine-paper collection from a June 1983 Open University (OU) campus workshop in Milton Keynes, England, describes an interactive video project developed for an OU undergraduate course, T252, Introduction to Engineering Materials, and discusses varied aspects of interactive videodisc program development. The following papers are included:…

  3. Yeast Interacting Proteins Database: YGR218W, YML007W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available subunits from the nucleus; exportin Rows with this bait as bait (6) Rows with this bait as prey (0) YML007W YAP1 Bas...ait (6) Rows with this bait as prey Rows with this bait as prey (0) Prey ORF YML007W Prey gene name YAP1 Prey description Bas

  4. 30 CFR 218.101 - Royalty and rental remittance (naval petroleum reserves).

    Science.gov (United States)

    2010-07-01

    ... INTERIOR MINERALS REVENUE MANAGEMENT COLLECTION OF MONIES AND PROVISION FOR GEOTHERMAL CREDITS AND... necessary identification information and sent direct to the Director, Naval Petroleum Reserves in California. ...

  5. 50 CFR 218.1 - Specified activity, specified geographical area and effective dates.

    Science.gov (United States)

    2010-10-01

    ... OPAREA is located 37 nautical miles (nm) off the entrance to Delaware Bay at latitude 38°45′ N, the... events indicated in paragraph (c)(1)(ii) of this section: (i) Underwater Explosives: (A) AGM-114...) Training Events: (A) Mine Exercise (MINEX) (Mine Neutralization )—up to 150 exercises over the course of 5...

  6. Challenges and Implications of Genesis 2:18 – 24 on Same-Sex ...

    African Journals Online (AJOL)

    Journal of Religion and Human Relations. Journal Home · ABOUT · Advanced Search · Current Issue · Archives · Journal Home > Vol 1, No 3 (2010) >. Log in or Register to get access to full text downloads.

  7. 218. Asistencia circulatoria de larga duración. Experiencia inicial

    Directory of Open Access Journals (Sweden)

    J. Otero

    2012-04-01

    Conclusiones: La asistencia ventricular de larga duración es una terapia segura y efectiva en pacientes con cardiopatías terminales, ya sea como puente a trasplante, recuperación o terapia de destino.

  8. Yeast Interacting Proteins Database: YML064C, YJL218W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available termination of M-phase; controls actomyosin and septin dynamics during cytokinesis Rows with this bait as bait...termination of M-phase; controls actomyosin and septin dynamics during cytokinesis Rows with this bait as bait

  9. Heterogeneous seeding of HET-s(218–289) and the mutability of prion structures

    Energy Technology Data Exchange (ETDEWEB)

    Wan, William; Stubbs, Gerald

    2014-02-18

    One fundamental property of prions is the formation of strains—prions that have distinct biological effects, despite a common amino acid sequence. The strain phenomenon is thought to be caused by the formation of different molecular structures, each encoding for a particular biological activity. While the precise mechanism of the formation of strains is unknown, they tend to arise following environmental changes, such as passage between different species. One possible mechanism discussed here is heterogeneous seeding; the formation of a prion nucleated by a different molecular structure. While heterogeneous seeding is not the only mechanism of prion mutation, it is consistent with some observations on species adaptation and drug resistance. Heterogeneous seeding provides a useful framework to understand how prions can adapt to new environmental conditions and change biological phenotypes.

  10. Structure of Even-Even 218-230 Ra Isotopes within the Interacting Boson Approximation Model

    Directory of Open Access Journals (Sweden)

    Diab S. M.

    2008-01-01

    Full Text Available A good description of the excited positive and negative parity states of radium nuclei (Z=88, N=130-142 is achieved using the interacting boson approximation model (IBA-1. The potential energy surfaces, energy levels, parity shift, electromagnetic transition rates B(E1, B(E2 and electric monopole strength X(E0/E2 are calculated for each nucleus. The analysis of the eigenvalues of the model Hamiltonian reveals the presence of an interaction between the positive and negative parity bands. Due to this interaction the $Delta I = 1$ staggering effect, between the energies of the ground state band and the negative parity state band, is produced including beat patterns.

  11. 47 CFR 25.218 - Off-axis EIRP envelopes for FSS earth station operations.

    Science.gov (United States)

    2010-10-01

    ... sidelobe exceeds the envelope given above by more than 3 dB. For digital SCPC using frequency division... SCPC using code division multiple access (CDMA) technique, N is the maximum number of co-frequency... SCPC using frequency division multiple access (FDMA) or time division multiple access (TDMA) technique...

  12. WE-D-218-01: Ultrasound Scanner Innovations and Clinical Practice.

    Science.gov (United States)

    Thomenius, K

    2012-06-01

    Of all the imaging modalities, ultrasound scanners have gone through the most profound changes over the last several decades in terms of their size, capability, and cost. Much of this is due to the small data acquisition devices (ultrasound transducers) and Moore's Law dependent signal/image processors that comprise and ultrasound scanner. These are in direct contrast with the front ends of MRI or CT scanners with their sizeable power hungry gantries. Thus ultrasound has been a direct beneficiary of the miniaturization associated with the semiconductor industry; this has enabled the migration of much hardware functionality to software and development of much smaller devices even including handheld scanners. Such changes are having a significant impact on clinical utilization of ultrasound. This talk will review some of these including the recent introduction of complete software backends, i.e. ultrasound scanners composed of analog front ends which are connected to processors with minimal dedicated digital hardware. 1. Understand the architecture of an ultrasound scanner and how it has changed with evolving technology. 2. Understand the implications to clinical practice from these changes. 3. Understand the possibilities for the future of ultrasound scanners both from the view of new technical capabilities and how these might impact the clinic. © 2012 American Association of Physicists in Medicine.

  13. Structure of Even-Even 218-230 Ra Isotopes within the Interacting Boson Approximation Model

    OpenAIRE

    Diab S. M.

    2008-01-01

    A good description of the excited positive and negative parity states of radium nuclei (Z=88, N=130-142) is achieved using the interacting boson approximation model (IBA-1). The potential energy surfaces, energy levels, parity shift, electromagnetic transition rates B(E1), B(E2) and electric monopole strength X(E0/E2) are calculated for each nucleus. The analysis of the eigenvalues of the model Hamiltonian reveals the presence of an interaction between the positive and negative parity bands. ...

  14. 49 CFR 218.105 - Additional operational requirements for hand-operated main track switches.

    Science.gov (United States)

    2010-10-01

    ... § 214.323, or train coordination under § 214.325, when a roadway worker qualified to operate hand-operated main track switches is granted permission by the roadway worker in charge to occupy or otherwise..., or a roadway worker in charge. (c) Additional job briefing requirements for hand-operated main track...

  15. Environmental Assessment: Demolish Buildings 212, 218, 819, 820 at Grand Forks Air Force Base

    Science.gov (United States)

    2007-01-31

    I (wet meadow) to Type V (open freshwater ). Approximately 59,500 acres of wetland Type I to V are used for wetland habitat. Wetland Types IV and...mosquito control. Herbicides, such as picloram, nonselective glyphosate and 2, 4-D are used to maintain areas on base. Military Public Health and

  16. Page 1 218 JV. SINGH . . The nodal anatomy of all the species other ...

    Indian Academy of Sciences (India)

    It occu- pies an axillary position and constitutes the vascular cylinder of the axillary branch (Figs. 19, 20). At a higher level the sheathing leaf-base become differentiated into a median Swollen portion and a membranous wing on either side (Fig. 21). The two wings joined together by a strip of tissue separate from the median.

  17. : tous les projets | Page 218 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: ACCESS TO MARKETS, LABOUR MARKET, Capacity building, Competition policy, STRATEGIC PLANNING, COMPETITION LAW, AFRICA. Région: South Africa, North of Sahara, South of Sahara. Programme: Emploi et croissance. Financement total : CA$ 751,100.00. Forum africain de la concurrence : à l'appui de ...

  18. Histological evidence of testicular dysgenesis in contralateral biopsies from 218 patients with testicular germ cell cancer

    DEFF Research Database (Denmark)

    Hoei-Hansen, Christina E; Holm, Mette; Rajpert-De Meyts, Ewa

    2003-01-01

    dysgenesis, microscopic dysgenetic features were quantified in contralateral testicular biopsies in patients with a testicular germ cell tumour. Two hundred and eighty consecutive contralateral testicular biopsies from Danish patients with testicular cancer diagnosed in 1998-2001 were evaluated...... retrospectively. Two hundred and eighteen specimens were subsequently included in this study, after 63 patients who did not meet inclusion criteria had to be excluded. The presence of carcinoma in situ (which is believed to originate from transformed gonocytes) was detected in 8.7% of biopsies. The incidence...... patients, areas with immature and morphologically distorted tubules were also noted. Spermatogenesis was qualitatively normal in 51.4%, whereas 11.5% had very poor or absent spermatogenesis. It is concluded that microscopic testicular dysgenesis is a frequent feature in contralateral biopsies from patients...

  19. Yeast Interacting Proteins Database: YGL044C, YDL218W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available starvation and aerobic conditions; expression also induced in cells treated with the mycotoxin patulin Rows ...egulated by Azf1p and induced by starvation and aerobic conditions; expression also induced in cells treated with the mycotoxin patul...in Rows with this prey as prey Rows with this prey as prey (1) Rows with this prey

  20. The Differentiation of Childhood Psychoses: An Analysis of Checklists for 2,218 Psychotic Children

    Science.gov (United States)

    Rimland, Bernard

    1971-01-01

    Rimland's Diagnostic Checklist for Behavior-Disturbed Children, Form E-2, a checklist method of diagnosing early infantile autism, is described and statistics cited to show Form E-2 effective in differentiating truly autistic from autistic-type children. (KW)

  1. Yeast Interacting Proteins Database: YGR218W, YGR178C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available involved in export of proteins, RNAs, and ribosomal subunits from the nucleus; exportin Rows with this... involved in export of proteins, RNAs, and ribosomal subunits from the nucleus; exportin Rows with this

  2. Yeast Interacting Proteins Database: YGR218W, YMR124W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available involved in export of proteins, RNAs, and ribosomal subunits from the nucleus; exportin Rows with this... involved in export of proteins, RNAs, and ribosomal subunits from the nucleus; exportin Rows with this

  3. Yeast Interacting Proteins Database: YGR218W, YDL065C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available involved in export of proteins, RNAs, and ribosomal subunits from the nucleus; exportin Rows with this... involved in export of proteins, RNAs, and ribosomal subunits from the nucleus; exportin Rows with this

  4. Yeast Interacting Proteins Database: YGR218W, YOL149W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available involved in export of proteins, RNAs, and ribosomal subunits from the nucleus; exportin Rows with this... involved in export of proteins, RNAs, and ribosomal subunits from the nucleus; exportin Rows with this

  5. http://www.se.org.pk/File-Download.aspx?publishedid=218

    Directory of Open Access Journals (Sweden)

    Syed Saqlain Hussain, Muhammad Jamil, Muhammad Sadiq and Shahzada Munawar Mehdi

    2012-05-01

    Full Text Available It is an established fact that temporary waterlogging occurs at first irrigation to wheat crop in rice-wheat cropping system. This is also true in saline sodic soils. Wheat crop becomes pale yellow just after first irrigation resulting in severe reduction in growth and yield. This study was planned to address this problem by various management strategies like irrigation at 25 days after sowing (DAS without fertilizer, irrigation at 25 DAS + 120-110-70 NPK kg ha-1, irrigation at 25 DAS + 120-110-70 NPK kg ha-1 + 25 kg sulphuric acid per hectare, irrigation at 25 DAS+ 120-110-70 NPK kg ha-1 +12 kg sulphuric acid per hectare and irrigation at 40 DAS +120-110-70 NPK kg ha-1. A saline sodic field {pHs =8.92, ECe =5.70 (dS m-1 and SAR=23.71 (mmol L-11/2} was selected. Maximum grain yield (3.01 t ha-1, number of tillers (437 m-2, 1000-grain weight (35.43 g and number of grains spike-1 (40 were produced with the application of 120-110-70 NPK kg ha-1 + 25 kg ha -1 sulphuric acid at first irrigation applied 25 days after sowing in saline sodic soil.

  6. Challenges and Implications of Genesis 2:18 – 24 on Same-Sex ...

    African Journals Online (AJOL)

    Religion Dept

    In fact, in an ideal society, every child should be raised by both a father and a mother. The complementary efforts of two are ideally important both for short and long term effects on the children (Blankenhorn reported in Newsroom 2008). Marriage was instituted by God from the foundation of the world to be a sacred union.

  7. 49 CFR Appendix D to Part 218 - Requirements and Considerations for Implementing Technology Aided Point Protection

    Science.gov (United States)

    2010-10-01

    ... remotely monitored from somewhere else has become a railroading reality as cameras have become smaller, less expensive, and have increased resolution. It is possible to set up these cameras and monitors so...

  8. 36 CFR 218.12 - Timing of authorized hazardous fuel reduction project decision.

    Science.gov (United States)

    2010-07-01

    ... SERVICE, DEPARTMENT OF AGRICULTURE PREDECISIONAL ADMINISTRATIVE REVIEW PROCESSES Predecisional Administrative Review Process for Hazardous Fuel Reduction Projects Authorized by the Healthy Forests Restoration...

  9. 36 CFR 218.4 - Authorized hazardous fuel reduction projects not subject to objection.

    Science.gov (United States)

    2010-07-01

    ... SERVICE, DEPARTMENT OF AGRICULTURE PREDECISIONAL ADMINISTRATIVE REVIEW PROCESSES Predecisional Administrative Review Process for Hazardous Fuel Reduction Projects Authorized by the Healthy Forests Restoration...

  10. A New Polarimetric Study of Cygnus A Using JVLA from 2-18GHz

    Science.gov (United States)

    Lerato Sebokolodi, Makhuduga; Perley, Rick; Carilli, Chris; Smirnov, Oleg M.; Makhathini, Sphesihle

    2018-01-01

    Polarimetric studies of Cygnus A [5, 1, 2, 3] have shown that this radio galaxy has unusually large rotation measures ranging from -4000 to +3000 rad m -2 for the eastern lobe (E-lobe) and -2000 to +1300 rad m -2 for western lobe(W-lobe). A challenge since then has been to identify the medium(s) responsible for these high Faraday rotations (FR). Although a majority of the FR must arise from the surrounding cluster gas, an unknown portion may arise either in the sheath or within the lobes. In these cases, some depolarization must result, along with a non λ 2 rotation of the plane of polarization. Detecting such a depolarization will enable an estimate of the internal (and/or sheath) thermal gas density. [1] found significant depolarization associated with the inner regions of the E-lobe and no depolarization associated with the W-lobe. This depolarization could be either internal to the source (Faraday depolarization) or due to unresolved small-scale fluctuations in the foreground screen (beam depolarization) [1]. The former is expected to impose significant deviations in the λ2 -law, none of which have been found to date, nor could have been found due to the limited number of frequencies employed in these studies.Since 2015, new JVLA polarimetric observations of Cygnus A have been taken, in all four configurations, covering the frequency range from 2 to 18GHz. These new data provide thousands of frequency channels at high resolution and sensitivity – opening a new opportunity to study in great detail the physics of the jets, lobes and the magnetic field of the X-ray cluster medium and lobes. Our objective is to analyze these new polarimetric data with the expectation of extending the previous work and more importantly, to investigate the possibility of any significantdeviations from the λ2-law. Initial analysis shows significant deviations from λ2 -law associated with the W-lobe. We will present these results in detail, and also the results from RM-synthesis [6, 4] and other model fitting techniques.[1] Perley et.al, 1996, 168[2] Carilli et.al, 1988, APJL, 334, L73[3] Dreher et.al, 1987, AJ, 316, 611[4] Brentjens et.al 2005, A&A, 441, 1217[5] Perley et.al. 1984, APJL, 285, L35[6] Burn 1966, MNRAS 133, 67

  11. 30 CFR 218.52 - How does a lessee designate a Designee?

    Science.gov (United States)

    2010-07-01

    ... your operating rights ownership in the lease; (5) The name, address, Taxpayer Identification Number (TIN), and phone number of your Designee; (6) The name, address, and phone number of the individual to... notification for each lease must include the following: (1) The lease number for the lease; (2) The type of...

  12. 38 CFR 1.218 - Security and law enforcement at VA facilities.

    Science.gov (United States)

    2010-07-01

    ... not reside in quarters on the property, is prohibited. Acts of prostitution or solicitation for acts of prostitution on VA property is prohibited. For the purposes of this paragraph, an act of prostitution is defined as the performance or the offer or agreement to perform any sexual act for money or...

  13. Geohydrology of the 218-W-5 Burial Ground, 200-West Area, Hanford Site

    Energy Technology Data Exchange (ETDEWEB)

    Bjornstad, B.N.

    1990-05-01

    Construction a disposal facility for solid, mixed low-level radioactive and hazardous wastes at the Hanford Site in southeastern Washington State (Figure 1) is planned. A site-specific performance assessment for each new disposal facility to ensure that wastes will be isolated from the environment is required. To demonstrate the adequacy of the facility for isolating the wastes, computer codes are used to simulate the physical processes that could cause the waste to migrate to underground water supplies or to the land's surface. The purpose of this report is provide a compilation and interpretation of geologic and hydrologic data available use in the performance assessment modeling. A variety of data are needed to model flow and transport from a solid-waste burial trench. These data include soil water content, soil moisture potential, saturated and unsaturated hydraulic conductivity, and phase mineralogy of the soils and sediments within the vadose zone. The hydrologic data that are critical for quantifying the water storage and transport properties for unsaturated soils require a characterization of the heterogeneities of various soil layers and the moisture characteristic curves for these layers. Hydraulic properties and mineralogic data for the saturated sediments are also important for modelling the flow and transport of wastes in the unconfined aquifer. This report begins with a discussion of the procedures and methods used to gather data both in the field and in the laboratory. This is followed by a summary of the geology, including the stratigraphic framework, lithofacies, and mineralogic/geochemical characteristics of the suprabasalt sediments. The hydrology of the region of the site is discussed next. In this discussion, the characteristics of the uppermost aquifer(s), unsaturated zone, and the various hydrogeologic units are presented. 54 refs., 39 figs., 11 tabs.

  14. WE-E-218-01: Writing and Reviewing Papers in Medical Physics.

    Science.gov (United States)

    Hendee, W; Slattery, P; Rogers, D; Karellas, A

    2012-06-01

    There is an art to writing a scientific paper so that it communicates accurately, succinctly, and comprehensively. Developing this art comes with experience, and sharing that experience with younger physicists is an obligation of senior scientists, especially those with editorial responsibilities for the journal. In this workshop, the preparation of a scientific manuscript will be dissected so participants can appreciate how each part is developed and then assembled into a complete paper. Then the review process for the paper will be discussed, including how to examine a paper and write an insightful and constructive review. Finally, we will consider the challenge of accommodating the concerns and recommendations of a reviewer in preparing a revision of the paper. A second feature of the workshop will be a discussion of the process of electronic submission of a paper for consideration by Medical Physics. The web-based PeerX-Press engine for manuscript submission and management will be examined, with attention to special features such as epaps and line-referencing. Finally, new features of Medical Physics will be explained, such as Vision 20/20 manuscripts, Physics Letters and the standardized formatting of book reviews. 1. Improve the participants' abilities to write a scientific manuscript. 2. Understand the review process for Medical Physics manuscripts and how to participate in and benefit from it. 3. Appreciate the many features of the PeerX-Press electronic management process for Medical Physics manuscripts. 4. Develop a knowledge of new features of Medical Physics. © 2012 American Association of Physicists in Medicine.

  15. TU-C-218-01: Effective Medical Imaging Physics Education.

    Science.gov (United States)

    Sprawls, P

    2012-06-01

    A practical and applied knowledge of physics and the associated technology is required for the clinically effective and safe use of the various medical imaging modalities. This is needed by all involved in the imaging process, including radiologists, especially residents in training, technologists, and physicists who provide consultation on optimum and safe procedures and as educators for the other imaging professionals. This area of education is undergoing considerable change and evolution for three reasons: 1. Increasing capabilities and complexity of medical imaging technology and procedures, 2.Expanding scope and availability of educational resources, especially on the internet, and 3. A significant increase in our knowledge of the mental learning process and the design of learning activities to optimize effectiveness and efficiency, especially for clinically applied physics. This course will address those three issues by providing guidance on establishing appropriate clinically focused learning outcomes, a review of the brain function for enhancing clinically applied physics, and the design and delivery of effective learning activities beginning with the classroom and continuing through learning physics during the clinical practice of radiology. Characteristics of each type of learning activity will be considered with respect to effectiveness and efficiency in achieving appropriate learning outcomes. A variety of available resources will be identified and demonstrated for use in the different phases of learning process. A major focus is on enhancing the role of the medical physicist in clinical radiology both as a resource and educator with contemporary technology being the tool, but not the teacher. 1. Develop physics learning objectives that will support effective and safe medical imaging procedures. 2. Understand specific brain functions that are involved in learning and applying physics. 3. Describe the characteristics and development of mental knowledge structures for applied clinical physics. 4. List the established levels of learning and associate each with specific functions that can be performed. 5. Analyze the different types of learning activities (classroom, individual study, clinical, etc.) with respect to effectiveness and efficiency. 6. Design and Provide a comprehensive physics education program with each activity optimized with respect to outcomes and available resources. © 2012 American Association of Physicists in Medicine.

  16. 12 CFR 218.721 - Defined terms relating to the trust and fiduciary activities exception from the definition of...

    Science.gov (United States)

    2010-01-01

    ... management; (iv) A flat or capped per order processing fee, paid by or on behalf of a customer or beneficiary...—account-by-account test. Chiefly compensated shall mean the relationship-total compensation percentage for each trust or fiduciary account of the bank is greater than 50 percent. (2) The relationship-total...

  17. 49 CFR 218.101 - Leaving rolling and on-track maintenance-of-way equipment in the clear.

    Science.gov (United States)

    2010-10-01

    ... will foul a connecting track unless: (1) The equipment is standing on a main track and a siding track... (2) The equipment is standing on a siding and a main track switch that the equipment is fouling is lined for the siding on which the equipment is standing; or (3) The equipment is standing on a yard...

  18. 12 CFR 218.760 - Exemption from definition of “broker” for banks accepting orders to effect transactions in...

    Science.gov (United States)

    2010-01-01

    ... any Web site, newspaper, magazine or other periodical, radio, television, telephone or tape recording... section; (2) Advertisements. Advertisements by or on behalf of the bank do not: (i) Advertise that the... retirement accounts or similar accounts, except as part of advertising the other custodial or safekeeping...

  19. Integrative bioinformatics analysis identifies ROBO1 as a potential therapeutic target modified by miR-218 in hepatocellular carcinoma

    OpenAIRE

    Wang, Junqing; Zhou, Yunyun; Fei, Xiaochun; Chen, Xunhua; Chen, Rui; Zhu, Zhenggang; Chen, Yongjun

    2017-01-01

    Patients diagnosed with advanced hepatocellular carcinoma (HCC) presented poor prognosis and short survival time. Althouth accumulating contribution of continuous research has gradually revealed complex tumorigenesis mechanism of HCC with numerous and jumbled biomarkers, those specific ones for HCC diagnose and therapeutic treatment are required illustration. Multiple genes over-expressed in HCC specimens with at least 1.5 fold change were cohorted, compared with the non-cancerous tissues thr...

  20. 34A, miRNA-944, miRNA-101 and miRNA-218 in cervical cancer

    African Journals Online (AJOL)

    Furthermore, 85 % of the cervical cancers occur in developing countries, such as China and India. [2]. Currently, chemotherapy is the commonly used strategy to prevent the relapse and metastasis of cervical cancer besides surgery [3]. However, early diagnosis is the most important strategy for treating cervical cancer [4].

  1. Hanging Maneuver for Stomach Traction in Laparoscopic Distal Pancreatic Resections: An Original Technique Applied in 218 Patients.

    Science.gov (United States)

    Dokmak, Safi; Aussilhou, Béatrice; Ftériche, Fadhel Samir; Belghiti, Jacques; Sauvanet, Alain

    2017-01-01

    Stomach traction done to expose the pancreas is still a problem in laparoscopic left pancreatic resections. We developed a simple hanging maneuver to retract the stomach rapidly and effectively. After dividing the gastrocolic ligament, the stomach was encircled with a tape, turned along its horizontal axis and pulled with an epigastric trocar, which was later removed. This technique was used in all patients who underwent laparoscopic left pancreatic resections including 165 distal pancreatectomies (DP), 35 central pancreatectomies (CP) and 18 enucleations (En). Demographics, surgical and postoperative outcome data were recorded. There were no mortalities. The mean operative time for DP, CP and En were 174, 191 and 104 min, respectively. The transfusion (0-4%) and conversion (0-3%) rates were low for all procedures. Morbidity was mainly represented by pancreatic fistula and grades (B + C) for DP, CP and En were observed in 26, 22 and 17%, respectively. No complication related to hanging of the stomach, like gastric perforation, was observed. Re-intervention and the mean hospital stay for DP, CP and En were observed in 5, 11 and 0% and were 16, 22 and 12, respectively. The readmission rate was low (0-9%). Hanging maneuver of the stomach is a simple procedure to rapidly, safely and effectively retract the stomach during left laparoscopic pancreatic resections. © 2016 S. Karger AG, Basel.

  2. Session 21.8 - Challenges and Solutions to Light Pollution, RFI and Implementing IAU Resolution 2009 B5

    Science.gov (United States)

    Green, Richard

    2016-10-01

    The closing session included a panel on the challenge of raising cultural awareness of the negative effects of light pollution and RFI, and a discussion about the means to implement the IAU Resolution on the Right to Starlight. The strongest arguments to the public are that light pollution wastes precious energy and adds greenhouse gases, and that artificial light at night can be damaging to human health and to the natural environment. As astronomers, our community is concerned that the world is blinding itself to the electromagnetic radiation connecting us to the Universe. An outcome of successful advocacy would be to create demand for commercial products that minimize blue light and upward radiation. Implementation of the resolution on the Right to Starlight has multiple aspects. The IAU, through its site protection commission, should provide a clear technical description of "astronomy friendly" lighting and specifications for protection of the near zones around optical observatories. In addition, the commission should provide reference materials for astronomers giving public presentations, provide a forum for those seeking stronger local or national regulation, seek IAU approval for endorsement of protected status of sites and regions, and support the process of gaining UNESCO World Heritage Status for observatories and their regions.

  3. 77 FR 69503 - Comment Request for Information Collection on the ETA 218, Benefit Rights and Experience Report...

    Science.gov (United States)

    2012-11-19

    ... that requested data can be provided in the desired format, reporting burden (time and financial... data are used by the National Office in solvency studies, cost estimating and modeling, and assessment of state benefit formulas. II. Review Focus The Department is particularly interested in comments...

  4. High frequency microphone measurements for transition detection on airfoils. Risø C2-18 appendix report

    DEFF Research Database (Denmark)

    Døssing, Mads

    Time series of pressure fluctuations has been obtained using high frequency microphones distributed over the surface of airfoils undergoing wind tunnel tests in the LM Windtunnel, owned by ’LM Glasfiber’, Denmark. The present report describes the dataanalysis, with special attention given...... to transition detection. It is argued that the transition point can be detected by observing the increase in the mean of the Fourier spectre and that thismethod is very stable froma numerical point of view. Other important issues are also discussed, e.g. the variation of pressure standard deviations (sound...

  5. The Structure of Even-Even 218-230 Ra Isotopes within the Interacting Boson Approximation Model

    Directory of Open Access Journals (Sweden)

    Diab S. M.

    2008-01-01

    Full Text Available A good description of the excited positive and negative parity states of radium nuclei ( Z = 88, N = 130–142 is achieved using the interacting boson approximation model (IBA-1. The potential energy surfaces, energy levels, parity shift, electromagnetic tran- sition rates B ( E 1 , B ( E 2 and electric monopole strength X ( E 0 / E 2 are calculated for each nucleus. The analysis of the eigenvalues of the model Hamiltonian reveals the presence of an interaction between the positive and negative parity bands. Due to this interaction the I = 1 staggering e ect, between the energies of the ground state band and the negative parity state band, is produced including beat patterns.

  6. The Structure of Even-Even 218-230 Ra Isotopes within the Interacting Boson Approximation Model

    OpenAIRE

    Diab S. M.

    2008-01-01

    A good description of the excited positive and negative parity states of radium nuclei ( Z = 88, N = 130–142) is achieved using the interacting boson approximation model (IBA-1). The potential energy surfaces, energy levels, parity shift, electromagnetic tran- sition rates B ( E 1) , B ( E 2) and electric monopole strength X ( E 0 / E 2 ) are calculated for each nucleus. The analysis of the eigenvalues of the ...

  7. HIV treatment and care services for adolescents: a situational analysis of 218 facilities in 23 sub-Saharan African countries.

    Science.gov (United States)

    Mark, Daniella; Armstrong, Alice; Andrade, Catarina; Penazzato, Martina; Hatane, Luann; Taing, Lina; Runciman, Toby; Ferguson, Jane

    2017-05-16

    In 2013, an estimated 2.1 million adolescents (age 10-19 years) were living with HIV globally. The extent to which health facilities provide appropriate treatment and care was unknown. To support understanding of service availability in 2014, Paediatric-Adolescent Treatment Africa (PATA), a non-governmental organisation (NGO) supporting a network of health facilities across sub-Saharan Africa, undertook a facility-level situational analysis of adolescent HIV treatment and care services in 23 countries. Two hundred and eighteen facilities, responsible for an estimated 80,072 HIV-infected adolescents in care, were surveyed. Sixty per cent of the sample were from PATA's network, with the remaining gathered via local NGO partners and snowball sampling. Data were analysed using descriptive statistics and coding to describe central tendencies and identify themes. Respondents represented three subregions: West and Central Africa (n = 59; 27%), East Africa (n = 77, 35%) and southern Africa (n = 82, 38%). Half (50%) of the facilities were in urban areas, 17% peri-urban and 33% rural settings. Insufficient data disaggregation and outcomes monitoring were critical issues. A quarter of facilities did not have a working definition of adolescence. Facilities reported non-adherence as their key challenge in adolescent service provision, but had insufficient protocols for determining and managing poor adherence and loss to follow-up. Adherence counselling focused on implications of non-adherence rather than its drivers. Facilities recommended peer support as an effective adherence and retention intervention, yet not all offered these services. Almost two-thirds reported attending to adolescents with adults and/or children, and half had no transitioning protocols. Of those with transitioning protocols, 21% moved pregnant adolescents into adult services earlier than their peers. There was limited sexual and reproductive health integration, with 63% of facilities offering these services within their HIV programmes and 46% catering to the special needs of HIV-infected pregnant adolescents. Results indicate that providers are challenged by adolescent adherence and reflect an insufficiently targeted approach for adolescents. Guidance on standard definitions for adherence, retention and counselling approaches is needed. Peer support may create an enabling environment and sensitize personnel. Service delivery gaps should be addressed, with standardized transition and quality counselling. Integrated, comprehensive sexual reproductive health services are needed, with support for pregnant adolescents.

  8. 50 CFR 226.218 - Critical habitat for the U.S. DPS of smalltooth sawfish (Pristis pectinata).

    Science.gov (United States)

    2010-10-01

    ... eastern extent at the mouth of Shell Creek at 81°59.467′ W, and the northern extent of the Charlotte... Boulevard) to Orange River Boulevard, then by Orange River Boulevard to Buckingham Road, then by Buckingham...

  9. Derivation of Soil Screening Guidelines for Gross Alpha/Beta Radioactivity for United States Air Force Deployment Sites

    Science.gov (United States)

    2007-04-19

    the emission of 7 alpha particles and 4 beta particles. Three radionuclides ( francium -223, astatine-215, and polonium-211) are not listed below...no no Uranium-233 159,200 y alpha yes no Thorium-229 7,300 y alpha yes no Radium-225 14.9 d beta no no Actinium-225 10.0 d alpha no no Francium

  10. δ37Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine.

  11. δ³⁷Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine. This thesis presents the first chlorine

  12. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  13. SU-D-218-04: Evaluation of the Performance of the Solid State X-Ray Image Intensifier (SSXII) Using Generalized Metrics.

    Science.gov (United States)

    Gupta, S; Huang, Y; Jain, A; Bednarek, D; Rudin, S

    2012-06-01

    To evaluate the performance of the Solid State X-ray Image Intensifier (SSXII) using generalized linear-system metrics and to study the effect of different scatter fractions, object magnifications, and focal spots onits performance. The SSXII is a high-resolution and high- sensitivity region-of-interest x-ray imaging detector that provides real-timeimaging with low instrumentation noise. To evaluate the total system performance for a clinical environment, we used generalized metrics that include the effects of scattered radiation, finite focal-spot size, and geometric unsharpness. For comparison, a commercial standard flat-panel detector (FPD) was used. The focal-spot MTF was obtained by taking theFourier Transform of the point-spread function of x-ray pin-hole images. The detector MTF was measured using the standard edge method. The scatter MTF was simulated with a theoretical model. We have calculated the GMTF and GDQE for the SSXII and FPD. Three focal-spots (small, medium, and large), different object magnifications and scatter fractions were used for the GMTF and GDQE comparison. The GMTF andthe GDQE were shown to be degraded significantly from that of the detectoralone at the higher spatial frequencies because of blur due to the finite sizeof the focal-spot, and at the lower frequencies because of scatter. Furthermore, the degradation increases even more as the focal-spot size,object magnification and scatter fraction increases. The GMTF and the GDQE for the FPD were similar to those of the SSXII at lower frequencies, but were limited to frequencies below its 2.5 cycles/mm Nyquist frequency due to the 194-micron pixel size compared to the 18.9 cycles/mm Nyquist frequency of the 26.4-micron pixel-size SSXII. This work demonstrates that the SSXII and the FPD have similar performance at thelower spatial frequencies, whereas, the SSXII demonstrates superior performance over the FPD at higher frequencies. Supported in part by: NIH Grants R01-EB008425, R01-EB002873 and an equipment grant from Toshiba Medical Systems Corp. © 2012 American Association of Physicists in Medicine.

  14. Measurement of gross photosynthesis, respiration in the light and mesophyll conductance in leaves using H218O labeling and high precision isotope ratio mass spectrometry

    Science.gov (United States)

    Griffin, K. L.; Gauthier, P. P.; Battle, M. O.; Bender, M. L.

    2016-12-01

    A fundamental challenge in plant physiology is independently determining the rates of gross O2 production by photosynthesis and O2 consumption by respiration, photorespiration, and other processes. Previous studies on isolated chloroplasts or leaves have separately constrained net and gross O2 production (NOP and GOP, respectively) by labeling ambient O2 with 18O while leaf water was unlabeled. Here, we introduce a new method to accurately measure GOP and NOP of whole detached leaves in a cuvette as a routine gas exchange measurement. The petiole is immersed in water enriched to a δ18O of 10,000‰, and the leaf is labeled through the transpiration stream. GOP is calculated from the increase in δ18O of O2 as air passes through the cuvette. NOP is determined from the increase in O2/N2. Both terms are measured by isotope ratio mass spectrometry. CO2 assimilation and other standard gas exchange parameters are also measured. Reproducible measurements are made on a single leaf for up to 15 hours. By investigating the light response curve of NOP and GOP in Phaseolus vulgaris, we found that respiration is inhibited in the light (Kok effect) when [O2]=21% but not when [O2]=2%. The ratio of NOP to net CO2 assimilation was 1.03 ± 0.01 for all leaves studied. Additionally, using GOP as a constraint, we determined chloroplastic [CO2], and we found that mesophyll conductance increases with light intensity. An extensive list of gas exchange properties is measured with this O2 method, making it a unique tool to study and understand leaf physiological traits and the biogeochemistry of carbon cycling.

  15. Characterization of primary prostate carcinoma by anti-1-amino-2-[18F] -fluorocyclobutane-1-carboxylic acid (anti-3-[18F] FACBC) uptake

    Science.gov (United States)

    Schuster, David M; Taleghani, Pooneh A; Nieh, Peter T; Master, Viraj A; Amzat, Rianot; Savir-Baruch, Bital; Halkar, Raghuveer K; Fox, Tim; Osunkoya, Adeboye O; Moreno, Carlos S; Nye, Jonathon A; Yu, Weiping; Fei, Baowei; Wang, Zhibo; Chen, Zhengjia; Goodman, Mark M

    2013-01-01

    Anti-1-amino-3-[18F] fluorocyclobutane-1-carboxylic acid (anti-3-[18F] FACBC) is a synthetic amino acid positron emission tomography (PET) radiotracer with utility in the detection of recurrent prostate carcinoma. The aim of this study is to correlate uptake of anti-3-[18F] FACBC with histology of prostatectomy specimens in patients undergoing radical prostatectomy and to determine if uptake correlates to markers of tumor aggressiveness such as Gleason score. Ten patients with prostate carcinoma pre-radical prostatectomy underwent 45 minute dynamic PET-CT of the pelvis after IV injection of 347.8 ± 81.4 MBq anti-3-[18F] FACBC. Each prostate was co-registered to a separately acquired MR, divided into 12 sextants, and analyzed visually for abnormal focal uptake at 4, 16, 28, and 40 min post-injection by a single reader blinded to histology. SUVmax per sextant and total sextant activity (TSA) was also calculated. Histology and Gleason scores were similarly recorded by a urologic pathologist blinded to imaging. Imaging and histologic analysis were then compared. In addition, 3 representative sextants from each prostate were chosen based on highest, lowest and median SUVmax for immunohistochemical (IHC) analysis of Ki67, synaptophysin, P504s, chromogranin A, P53, androgen receptor, and prostein. 79 sextants had malignancy and 41 were benign. Highest combined sensitivity and specificity was at 28 min by visual analysis; 81.3% and 50.0% respectively. SUVmax was significantly higher (psextants (5.1±2.6 at 4 min; 4.5±1.6 at 16 min; 4.0±1.3 at 28 min; 3.8±1.0 at 40 min) compared to non-malignant sextants (4.0±1.9 at 4 min; 3.5±0.8 at 16 min; 3.4±0.9 at 28 min; 3.3±0.9 at 40 min), though there was overlap of activity between malignant and non-malignant sextants. SUVmax also significantly correlated (psextants or between Gleason score levels, we believe that anti-3-[18F] FACBC PET should not be used alone for radiation therapy planning but may be useful to guide biopsy to the most aggressive lesion. PMID:23342303

  16. Preliminary Thermal Modeling of HI-Storm 100S-218 Version B Storage Modules at Hope Creek Cuclear Power Station ISFSI

    Energy Technology Data Exchange (ETDEWEB)

    Cuta, Judith M.; Adkins, Harold E.

    2013-08-30

    As part of the Used Fuel Disposition Campaign of the U. S. Department of Energy, Office of Nuclear Energy (DOE-NE) Fuel Cycle Research and Development, a consortium of national laboratories and industry is performing visual inspections and temperature measurements of selected storage modules at various locations around the United States. This report documents thermal analyses in in support of the inspections at the Hope Creek Nuclear Generating Station ISFSI. This site utilizes the HI-STORM100 vertical storage system developed by Holtec International. This is a vertical storage module design, and the thermal models are being developed using COBRA-SFS (Michener, et al., 1987), a code developed by PNNL for thermal-hydraulic analyses of multi assembly spent fuel storage and transportation systems. This report describes the COBRA-SFS model in detail, and presents pre-inspection predictions of component temperatures and temperature distributions. The final report will include evaluation of inspection results, and if required, additional post-test calculations, with appropriate discussion of results.

  17. miR-218 inhibits the migration and invasion of glioma U87 cells through the Slit2-Robo1 pathway

    OpenAIRE

    GU, JIAN-JUN; GAO, GUANG-ZHONG; ZHANG, SHI-MING

    2015-01-01

    Malignant gliomas are the most common primary brain tumors in adults and are associated with the highest mortality rate. Glioma invasion is one of the most notable causes of the poor prognosis of this cancer. Preventing the invasive behavior of malignant glioma cells by altering effector molecules can significantly improve the prognosis of a patient. microRNAs (miRNAs) are small noncoding RNAs, ~22 nucleotides in length, that are able to function as oncogenes or tumor suppressors in human can...

  18. http://dx.doi.org/10.4314/ajtcam.v10i2.18 E-mail: hkshin@kiom.re.kr

    African Journals Online (AJOL)

    AJTCAM

    Introduction. Acute gastric injury is induced by agents such as ethanol, stress, and nonsteroidal anti-inflammatory drugs. (NSAIDs) when the gastric mucosal membrane ... with the NIH Guidelines for the care and use of laboratory animals and the National Animal Welfare Law of Korea. Absolute ethanol-induced gastric injury.

  19. Aberrant expression of miR-218 and miR-204 in human mesial temporal lobe epilepsy and hippocampal sclerosis-Convergence on axonal guidance

    DEFF Research Database (Denmark)

    Kaalund, Sanne S; Venø, Morten T; Bak, Mads

    2014-01-01

    OBJECTIVE: Mesial temporal lobe epilepsy (MTLE) is one of the most common types of the intractable epilepsies and is most often associated with hippocampal sclerosis (HS), which is characterized by pronounced loss of hippocampal pyramidal neurons. microRNAs (miRNAs) have been shown to be dysregul...

  20. 2-[18F]fluoro-2-deoxyglucose positron-emission tomography in staging, response evaluation, and treatment planning of lymphomas

    DEFF Research Database (Denmark)

    Specht, Lena; Specht, Lena

    2007-01-01

    residual lymphoma. Hence, new revised response criteria have been proposed, incorporating the result of FDG-PET at the end of treatment. An early interim FDG-PET scan after 1 to 3 cycles of chemotherapy is a very strong predictor of outcome, and trials are now in progress testing treatment modifications...... on this basis. With regard to treatment planning, in the context of combined-modality therapy, radiotherapy for lymphomas is moving toward more conformal techniques reducing the irradiated volume to include only the macroscopic lymphoma. In this situation, accurate imaging is essential, and FDG-PET coregistered...... with the planning computed tomography (CT) scan is used increasingly. The availability of PET/CT scanners suited for virtual simulation has aided this process. However, clinical data evaluating this technique are at present sparse....

  1. 30 CFR 218.306 - May I receive a credit against production royalties for in-kind deliveries of electricity I...

    Science.gov (United States)

    2010-07-01

    ... royalties for in-kind deliveries of electricity I provide under contract to a State or county government... electricity I provide under contract to a State or county government? (a) You may receive a credit against royalties for in-kind deliveries of electricity you provide under contract to a State or county government...

  2. SU-F-T-218: Validation of An In-Vivo Proton Range Verification Method for Reducing the Risk of Permanent Alopecia in the Treatment of Pediatric Medulloblastoma

    Energy Technology Data Exchange (ETDEWEB)

    Lucconi, G [Department of Medical Physics, S. Orsola-Malpighi University Hospital, Bologna (Italy); Department of Radiation Oncology, Massachusetts General Hospital, Boston, MA (United States); Bentefour, E; Janssens, G [Advanced Technology Group, Ion Beam Applications (IBA), Louvain la Neuve (Belgium); Deepak, S [Department of Physics, Central University of Karnataka, Karnataka 585367 (India); Weaver, K; Moteabbed, M; Lu, H-M [Department of Radiation Oncology, Massachusetts General Hospital, Boston, MA (United States)

    2016-06-15

    Purpose: The clinical commissioning of a workflow for pre-treatment range verification/adjustment for the head treatment of pediatric medulloblastoma patients, including dose monitoring during treatment. Methods: An array of Si-diodes (DIODES Incorporated) is placed on the patient skin on the opposite side to the beam entrance. A “scout” SOBP beam, with a longer beam range to cover the diodes in its plateau, is delivered; the measured signal is analyzed and the extracted water equivalent path lengths (WEPL) are compared to the expected values, revealing if a range correction is needed. Diodes stay in place during treatment to measure dose. The workflow was tested in solid water and head phantoms and validated against independent WEPL measurements. Both measured WEPL and skin doses were compared to computed values from the TPS (XiO); a Markus chamber was used for reference dose measurements. Results: The WEPL accuracy of the method was verified by comparing it with the dose extinction method. It resulted, for both solid water and head phantom, in the sub-millimeter range, with a deviation less than 1% to the value extracted from the TPS. The accuracy of dose measurements in the fall-off part of the dose profile was validated against the Markus chamber. The entire range verification workflow was successfully tested for the mock-treatment of head phantom with the standard delivery of 90 cGy per field per fraction. The WEPL measurement revealed no need for range correction. The dose measurements agreed to better than 4% with the prescription dose. The robustness of the method and workflow, including detector array, hardware set and software functions, was successfully stress-tested with multiple repetitions. Conclusion: The performance of the in-vivo range verification system and related workflow meet the clinical requirements in terms of the needed WEPL accuracy for pretreatment range verification with acceptable dose to the patient.

  3. Rendueles, Cesar. (2015. Capitalismo canalla: una historia del capitalismo a través de la literatura. Seix Barral: Barcelona. 218 pp.

    Directory of Open Access Journals (Sweden)

    Antón Sánchez Testas

    2015-12-01

    Full Text Available El dramático final de Las uvas de la ira, la novela más importante de Steinbeck, ha quedado tristemente olvidado después de que John Ford, en su adaptación al cine, decidiera cambiarlo por uno más apropiado para Hollywood. Después de todas las miserias que vive la familia Joad en su viaje a California, acaban protegidos de una crecida de agua en un endeble cobertizo. Hambrientos y agotados, la Gran Depresión se consuma para ellos en su definitiva desnudez material. Despojados de identidad cultural al ser desahuciados de sus tierras, nihilizados y explotados por el mercado laboral, no tienen otra cosa que sus cuerpos debilitados. Así, Rose of Sharon alimenta, con la leche materna destinada a un bebé que jamás llegará a nacer, al resto de proletarios, nadas sociales, en un alivio inmediato de la miseria, preludio de mayor incertidumbre. [...

  4. SU-F-J-218: Predicting Radiation-Induced Xerostomia by Dosimetrically Accounting for Daily Setup Uncertainty During Head and Neck IMRT

    Energy Technology Data Exchange (ETDEWEB)

    Park, S; Quon, H; McNutt, T; Lee, J [Johns Hopkins University, Baltimor, MD (United States); Plishker, W [IGI Technologies, Inc., College Park, MD (United States); Shekhar, R [IGI Technologies, Inc., College Park, MD (United States); Children’s National Medical Center, Washington, DC (United States)

    2016-06-15

    Purpose: To determine if the accumulated parotid dosimetry using planning CT to daily CBCT deformation and dose re-calculation can predict for radiation-induced xerostomia. Methods: To track and dosimetrically account for the effects of anatomical changes on the parotid glands, we propagated physicians’ contours from planning CT to daily CBCT using a deformable registration with iterative CBCT intensity correction. A surface mesh for each OAR was created with the deformation applied to the mesh to obtain the deformed parotid volumes. Daily dose was computed on the deformed CT and accumulated to the last fraction. For both the accumulated and the planned parotid dosimetry, we tested the prediction power of different dosimetric parameters including D90, D50, D10, mean, standard deviation, min/max dose to the combined parotids and patient age to severe xerostomia (NCI-CTCAE grade≥2 at 6 mo follow-up). We also tested the dosimetry to parotid sub-volumes. Three classification algorithms, random tree, support vector machine, and logistic regression were tested to predict severe xerostomia using a leave-one-out validation approach. Results: We tested our prediction model on 35 HN IMRT cases. Parameters from the accumulated dosimetry model demonstrated an 89% accuracy for predicting severe xerostomia. Compared to the planning dosimetry, the accumulated dose consistently demonstrated higher prediction power with all three classification algorithms, including 11%, 5% and 30% higher accuracy, sensitivity and specificity, respectively. Geometric division of the combined parotid glands into superior-inferior regions demonstrated ∼5% increased accuracy than the whole volume. The most influential ranked features include age, mean accumulated dose of the submandibular glands and the accumulated D90 of the superior parotid glands. Conclusion: We demonstrated that the accumulated parotid dosimetry using CT-CBCT registration and dose re-calculation more accurately predicts for severe xerostomia and that the superior portion of the parotid glands may be particularly important in predicting for severe xerostomia. This work was supported in part by NIH/NCI under grant R42CA137886 and in part by Toshiba big data research project funds.

  5. Investigating the impact of light and water status on the exchange of COS, 13CO2, CO18O and H218O from bryophytes

    Science.gov (United States)

    Gimeno, Teresa; Royles, Jessica; Ogee, Jerome; Jones, Samuel; Burlett, Regis; West, Jason; Sauze, Joana; Wohl, Steven; Genty, Bernard; Griffiths, Howard; Wingate, Lisa

    2016-04-01

    Terrestrial surfaces are often covered by photoautotrophic communities that play a significant role in the biological fixation of C and N at the global scale. Bryophytes (mosses, liverworts and hornworts) are key members in these communities and are especially adapted to thrive in hostile environments, by growing slowly and surviving repeated dehydration events. Consequently, bryophyte communities can be extremely long-lived (>1500yrs) and can serve as valuable records of historic climate change. In particular the carbon and oxygen isotope compositions of mosses can be used as powerful proxies describing how growing season changes in atmospheric CO2 and rainfall have changed in the distant past over the land surface. Interpreting the climate signals of bryophyte biomass requires a robust understanding of how changes in photosynthetic activity and moisture status regulate the growth and isotopic composition of bryophyte biomass. Thus theoretical models predicting how changes in isotopic enrichment and CO2 discrimination respond to dehydration and rehydration are used to tease apart climatic and isotopic source signals. Testing these models with high resolution datasets obtained from new generation laser spectrometers can provide more information on how these plants that lack stomata cope with water loss. In addition novel tracers such as carbonyl sulfide (COS) can also be measured at high resolution and precision (pattern in the fluxes of CO2 and COS during the desiccation cycle. Initially when the bryophyte was wet and a barrier to diffusion existed, net CO2 and COS uptake rates were low. As the water film on the bryophyte disappeared the net rates of CO2 and COS uptake increased to a steady maximum rate whilst relative water content values remained above 100%. Thereafter, the bryophyte turned from a COS sink to a source. In this talk we will further explore how the COS exchange rate of bryophytes varies with light level and whether there is any evidence for differences in the activity of the enzyme carbonic anhydrase with light and moisture status. We also use the data to develop and test a new theoretical model of COS exchange for astomatous plants for the first time.

  6. Physical Activity Attenuates the Influence of FTO Variants on Obesity Risk : A Meta-Analysis of 218,166 Adults and 19,268 Children

    NARCIS (Netherlands)

    Kilpelaeinen, Tuomas O.; Qi, Lu; Brage, Soren; Sharp, Stephen J.; Sonestedt, Emily; Demerath, Ellen; Ahmad, Tariq; Mora, Samia; Kaakinen, Marika; Sandholt, Camilla Helene; Holzapfel, Christina; Autenrieth, Christine S.; Hyppoenen, Elina; Cauchi, Stephane; He, Meian; Kutalik, Zoltan; Kumari, Meena; Stancakova, Alena; Meidtner, Karina; Balkau, Beverley; Tan, Jonathan T.; Mangino, Massimo; Timpson, Nicholas J.; Song, Yiqing; Zillikens, M. Carola; Jablonski, Kathleen A.; Garcia, Melissa E.; Johansson, Stefan; Bragg-Gresham, Jennifer L.; Wu, Ying; van Vliet-Ostaptchouk, Jana V.; Onland-Moret, N. Charlotte; Zimmermann, Esther; Rivera, Natalia V.; Tanaka, Toshiko; Stringham, Heather M.; Silbernagel, Guenther; Kanoni, Stavroula; Feitosa, Mary F.; Snitker, Soren; Ruiz, Jonatan R.; Metter, Jeffery; Martinez Larrad, Maria Teresa; Atalay, Mustafa; Hakanen, Maarit; Amin, Najaf; Cavalcanti-Proenca, Christine; Grontved, Anders; Hallmans, Goran; Jansson, John-Olov; Kuusisto, Johanna; Kahonen, Mika; Lutsey, Pamela L.; Nolan, John J.; Palla, Luigi; Pedersen, Oluf; Perusse, Louis; Renstrom, Frida; Scott, Robert A.; Shungin, Dmitry; Sovio, Ulla; Tammelin, Tuija H.; Ronnemaa, Tapani; Lakka, Timo A.; Uusitupa, Matti; Serrano Rios, Manuel; Ferrucci, Luigi; Bouchard, Claude; Meirhaeghe, Aline; Fu, Mao; Walker, Mark; Borecki, Ingrid B.; Dedoussis, George V.; Fritsche, Andreas; Ohlsson, Claes; Boehnke, Michael; Bandinelli, Stefania; van Duijn, Cornelia M.; Ebrahim, Shah; Lawlor, Debbie A.; Gudnason, Vilmundur; Harris, Tamara B.; Sorensen, Thorkild I. A.; Mohlke, Karen L.; Hofman, Albert; Uitterlinden, Andre G.; Tuomilehto, Jaakko; Lehtimaki, Terho; Raitakari, Olli; Isomaa, Bo; Njolstad, Pal R.; Florez, Jose C.; Liu, Simin; Ness, Andy; Spector, Timothy D.; Tai, E. Shyong; Froguel, Philippe; Boeing, Heiner; Laakso, Markku; Marmot, Michael; Bergmann, Sven; Power, Chris; Khaw, Kay-Tee; Chasman, Daniel; Ridker, Paul; Hansen, Torben; Monda, Keri L.; Illig, Thomas; Jarvelin, Marjo-Riitta; Wareham, Nicholas J.; Hu, Frank B.; Groop, Leif C.; Orho-Melander, Marju; Ekelund, Ulf; Franks, Paul W.; Loos, Ruth J. F.

    2011-01-01

    Background: The FTO gene harbors the strongest known susceptibility locus for obesity. While many individual studies have suggested that physical activity (PA) may attenuate the effect of FTO on obesity risk, other studies have not been able to confirm this interaction. To confirm or refute

  7. Physical activity attenuates the influence of FTO variants on obesity risk: A meta-analysis of 218,166 adults and 19,268 children

    NARCIS (Netherlands)

    T.O. Kilpeläinen (Tuomas); L. Qi (Lu); S. Brage (Soren); S.J. Sharp (Stephen); E. Sonestedt (Emily); E.W. Demerath (Ellen); T. Ahmad (Tariq); S. Mora (Samia); M. Kaakinen (Marika); C. Sandholt (Camilla); C. Holzapfel (Christina); C.S. Autenrieth (Christine); E. Hyppönen (Elina); S. Cauchi (Stephane); M. He (Meian); Z. Kutalik (Zoltán); M. Kumari (Meena); A. Stancáková (Alena); K. Meidtner (Karina); B. Balkau (Beverley); J.T. Tan (Jonathan); M. Mangino (Massimo); N.J. Timpson (Nicholas); Y. Song (Yiqing); M.C. Zillikens (Carola); K.A. Jablonski (Kathleen); M. Garcia (Melissa); S. Johansson (Stefan); J.L. Bragg-Gresham (Jennifer L.); Y. Wu (Ying); J.V. van Vliet-Ostaptchouk (Jana); N.C. Onland-Moret (Charlotte); E. Zimmermann (Esther); N.V. Rivera (Natalia); T. Tanaka (Toshiko); H.M. Stringham (Heather); G. Silbernagel (Günther); S. Kanoni (Stavroula); M.F. Feitosa (Mary Furlan); S. Snitker (Soren); J.R. Ruiz (Jonatan); J. Metter (Jeffery); M.T.M. Larrad; M. Atalay (Mustafa); M. Hakanen (Maarit); N. Amin (Najaf); C. Cavalcanti-Proença (Christine); A. Grøntved (Anders); G. Hallmans (Göran); J.O. Jansson; J. Kuusisto (Johanna); M. Kähönen (Mika); P.L. Lutsey (Pamela); J.J. Nolan (John); L. Palla (Luigi); O. Pedersen (Oluf); L. Pérusse (Louis); F. Renström (Frida); R.A. Scott (Robert); D. Shungin (Dmitry); U. Sovio (Ulla); T.H. Tammelin (Tuija); T. Rönnemaa (Tapani); T.A. Lakka (Timo); M. Uusitupa (Matti); M.S. Rios; L. Ferrucci (Luigi); C. Bouchard (Claude); A. Meirhaeghe (Aline); M. Fu (Mao); M. Walker (Mark); I.B. Borecki (Ingrid); G.V. Dedoussis (George); A. Fritsche (Andreas); C. Ohlsson (Claes); M. Boehnke (Michael); S. Bandinelli (Stefania); P. Tikka-Kleemola (Päivi); D.A. Lawlor (Debbie); V. Gudnason (Vilmundur); T.B. Harris (Tamara); T.I.A. Sørensen (Thorkild); K.L. Mohlke (Karen); A. Hofman (Albert); A.G. Uitterlinden (André); J. Tuomilehto (Jaakko); T. Lehtimäki (Terho); O. Raitakari (Olli); B. Isomaa (Bo); P. Njolstad (Pal); J.C. Florez (Jose); S. Liu (Simin); A.R. Ness (Andrew); T.D. Spector (Timothy); E.S. Tai (Shyong); P. Froguel (Philippe); H. Boeing (Heiner); M. Laakso (Markku); M. Marmot (Michael); S.M. Bergmann (Sven); C. Power (Chris); K.-T. Khaw; D.I. Chasman (Daniel); P.M. Ridker (Paul); T. Hansen (Torben); K.L. Monda (Keri); T. Illig (Thomas); M.R. Järvelin; N.J. Wareham (Nick); S. Ebrahim (Shanil); F.B. Hu (Frank); L. Groop (Leif); M. Orho-Melander (Marju); U. Ekelund (Ulf); P.W. Franks (Paul); R.J.F. Loos (Ruth)

    2011-01-01

    textabstractBackground: The FTO gene harbors the strongest known susceptibility locus for obesity. While many individual studies have suggested that physical activity (PA) may attenuate the effect of FTO on obesity risk, other studies have not been able to confirm this interaction. To confirm or

  8. 75 FR 32773 - Auction of 218-219 MHz Service and Phase II 220 MHz Service Licenses Scheduled for December 7...

    Science.gov (United States)

    2010-06-09

    ... licenses covering a total of 727 Cellular Market Areas (CMAs). ii. Phase II 220 MHz Service Licenses 4... three percent will be more effective in deterring defaults. Given the history of these services and the...

  9. EFSA Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids (CEF); Scientific Opinion on Flavouring Group Evaluation 218, Revision 1 (FGE.218Rev1): alpha,beta-Unsaturated aldehydes and precursors from subgroup 4.2 of FGE.19: Furfural derivatives

    DEFF Research Database (Denmark)

    Larsen, John Christian; Nørby, Karin Kristiane; Beltoft, Vibe Meister

    The European Food Safety Authority (EFSA) asked the Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids (the Panel) to provide scientific advice to the Commission on the implications for human health of chemically defined flavouring substances used in or on foodstuffs...... to 5-[(sulphoxy)methyl]furfural which shows genotoxic potential in vitro, 5-hydroxymethylfurfural could not be evaluated through the Procedure. Accordingly, the Panel concluded that 5-methylfurfural could not be evaluated through the Procedure either. Industry has submitted additional data on the 5...

  10. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  11. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita

    2011-01-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  12. Production cross section of At radionuclides from 7Li+natPb and 9Be+natTl reactions

    Science.gov (United States)

    Maiti, Moumita; Lahiri, Susanta

    2011-12-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from 6,7Li- and 9Be-induced reactions on natural lead and thallium targets, respectively. The production of astatine radionuclides were investigated experimentally with two heavy-ion-induced reactions: 9Be + natTl and 7Li + natPb. Formation cross sections of the evaporation residues, 207,208,209,210At, produced in the (HI,xn) channel, were measured by the stacked-foil technique followed by off-line γ spectrometry at low incident energies (<50 MeV). Measured excitation functions were interpreted in terms of a compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach models. Measured cross-section values are lower than the respective theoretical predictions.

  13. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    Energy Technology Data Exchange (ETDEWEB)

    Koziorowski, J

    1998-10-01

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on {sup 211}At and {sup 124}I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[{sup 211}At]astato-2`-deoxyuridine (AUdR) and N-succinimidyl-4-[{sup 211}At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [{sup 124}I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[{sup 124}I]iodo-2`-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for

  14. Germán Rodas Chaves. Eloy Alfaro y Cuba en el Siglo XIX. La Habana: Fondo Editorial Casa de las Américas, 2013. 218 páginas.

    Directory of Open Access Journals (Sweden)

    René Villaboy Zaldivar

    2015-01-01

    Full Text Available A propósito de que la República del Ecuador fuera el país invitado de honor a la XXIII Feria Internacional del Libro de la Habana, numerosas ediciones relacionadas con la literatura, el arte, la historia, la política y, en general, sobre la rica cultura del país andino vieron la luz en febrero de 2014. A una de ellas dedico este comentario. Se trata de Eloy Alfaro y Cuba en el siglo XIX, del historiador ecuatoriano Germán Rodas Chaves, publicada con excelente factura dentro de la colección investigaciones del Fondo Editorial de la Casa de las Américas.

  15. CTD Data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 Miles North of Oahu, Hawaii for Cruises HOT218-227 during 2010) (NODC Accession 0087584)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  16. Cortical synaptic transmission in CaV2.1 knockin mice with the S218L missense mutation which causes a severe familial hemiplegic migraine syndrome in humans.

    OpenAIRE

    Dania eVecchia; Angelita eTottene; van den Maagdenberg, Arn M. J. M.; Daniela ePietrobon

    2015-01-01

    Familial hemiplegic migraine type 1 (FHM1) is caused by gain-of-function mutations in CaV2.1 (P/Q-type) Ca2+ channels. Knockin (KI) mice carrying the FHM1 R192Q missense mutation show enhanced cortical excitatory synaptic transmission at pyramidal cell synapses but unaltered cortical inhibitory neurotransmission at fast-spiking interneuron synapses. Enhanced cortical glutamate release was shown to cause the facilitation of cortical spreading depression (CSD) in R192Q KI mice. It, however, rem...

  17. Abnormal cortical synaptic transmission in CaV2.1 knockin mice with the S218L missense mutation which causes a severe familial hemiplegic migraine syndrome in humans

    OpenAIRE

    Vecchia, Dania; Tottene, Angelita; van den Maagdenberg, Arn M. J. M.; Pietrobon, Daniela

    2015-01-01

    Familial hemiplegic migraine type 1 (FHM1) is caused by gain-of-function mutations in CaV2.1 (P/Q-type) Ca2+ channels. Knockin (KI) mice carrying the FHM1 R192Q missense mutation show enhanced cortical excitatory synaptic transmission at pyramidal cell synapses but unaltered cortical inhibitory neurotransmission at fast-spiking interneuron synapses. Enhanced cortical glutamate release was shown to cause the facilitation of cortical spreading depression (CSD) in R192Q KI mice. It, however, rem...

  18. Niskin Bottle Data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 Miles North of Oahu, Hawaii for Cruises HOT218-227 during 2010 (NCEI Accession 0087596)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  19. Influence of 2-(18F) fluoro-2-deoxy-D-glucose positron emission tomography/computed tomography on recurrent ovarian cancer diagnosis and on selection of patients for secondary cytoreductive surgery

    DEFF Research Database (Denmark)

    Risum, Signe; Høgdall, Claus; Markova, Elena

    2009-01-01

    ) and to evaluate the influence of PET/CT on referral of patients with solitary recurrence to secondary cytoreductive surgery. From April 2005 to November 2007, 60 patients were consecutively included to PET/CT 68 times. The inclusion criteria were remission of 3 months or longer and recurrent OC suspected from...... physical examination, US, or increasing cancer antigen 125 (CA125) level (>50 U/mL or >15% above baseline level). Recurrent OC was diagnosed 58 times in 52 patients. The sensitivities of US, CT, and PET/CT for diagnosing recurrence were 66% (P = 0.003), 81% (P = 0.0001), and 97% (P ..., prospective clinical trials are needed to specify the characteristics of patients most likely to undergo complete secondary surgery and to further clarify the role of PET/CT in selecting patients for secondary surgery....

  20. Caries dental en niños de 2-18 años con enfermedades hematooncológicas. Hospital Manuel de Jesús Rivera, Managua, Nicaragua. Febrero- agosto 2011

    National Research Council Canada - National Science Library

    Alicia Samanta Espinoza-Palma

    2011-01-01

    .... This child population is susceptible to oral health problems such as cavities, dental extraction, and gingivitis, not for age related condition but also as a secondary effect of cancer treatment...

  1. Caries dental en niños de 2-18 años con enfermedades hematooncológicas. Hospital Manuel de Jesús Rivera, Managua, Nicaragua. Febrero- agosto 2011

    OpenAIRE

    Espinoza-Palma, Alicia Samanta

    2012-01-01

    El cáncer infantil cada día es más frecuente, y representa un problema de salud pública debido a la elevada tasa de mortalidad y recurrencia que presentan los pacientes tratados. A pesar de que las terapias antineoplásicas han mejorado sustancialmente en los últimos años. Esta población infantil es susceptible a problemas bucodentales como caries, pérdida dental y gingivitis, condición que se agrava por un efecto secundario al tratamiento antineoplásico. La salud bucal en el paciente oncológi...

  2. Subtask 2.18 - Advancing CO2 Capture Technology: Partnership for CO2 Capture (PCO2C) Phase III

    Energy Technology Data Exchange (ETDEWEB)

    Kay, John; Azenkeng, Alexander; Fiala, Nathan; Jensen, Melanie; Laumb, Jason; Leroux, Kerryanne; McCollor, Donald; Stanislowski, Joshua; Tolbert, Scott; Curran, Tyler

    2016-03-31

    Industries and utilities continue to investigate ways to decrease their carbon footprint. Carbon capture and storage (CCS) can enable existing power generation facilities to meet the current national CO2 reduction goals. The Partnership for CO2 Capture Phase III focused on several important research areas in an effort to find ways to decrease the cost of capture across both precombustion and postcombustion platforms. Two flue gas pretreatment technologies for postcombustion capture, an SO2 reduction scrubbing technology from Cansolv Technologies Inc. and the Tri-Mer filtration technology that combines particulate, NOx, and SO2 control, were evaluated on the Energy & Environmental Research Center’s (EERC’s) pilot-scale test system. Pretreating the flue gas should enable more efficient, and therefore less expensive, CO2 capture. Both technologies were found to be effective in pretreating flue gas prior to CO2 capture. Two new postcombustion capture solvents were tested, one from the Korea Carbon Capture and Sequestration R&D Center (KCRC) and one from CO2 Solutions Incorporated. Both of these solvents showed the ability to capture CO2 while requiring less regeneration energy, which would reduce the cost of capture. Hydrogen separation membranes from Commonwealth Scientific and Industrial Research Organisation were evaluated through precombustion testing. They are composed of vanadium alloy, which is less expensive than the palladium alloys that are typically used. Their performance was comparable to that of other membranes that have been tested at the EERC. Aspen Plus® software was used to model the KCRC and CO2 Solutions solvents and found that they would result in significantly improved overall plant performance. The modeling effort also showed that the parasitic steam load at partial capture of 45% is less than half that of 90% overall capture, indicating savings that could be accrued if 90% capture is not required. Modeling of three regional power plants using the Carnegie Mellon Integrated Environmental Control Model showed that, among other things, the use of a bypass during partial capture may minimize the size of the capture tower(s) and result in a slight reduction in the revenue required to operate the capture facility. The results reinforced that a one-size-fits-all approach cannot be taken to adding capture to a power plant. Laboratory testing indicated that Fourier transform infrared spectroscopy could be used to continuously sample stack emissions at CO2 capture facilities to detect and quantify any residual amine or its degradation products, particularly nitrosamines. The information gathered during Phase III is important for utility stakeholders as they determine how to reduce their CO2 emissions in a carbon-constrained world. This subtask was funded through the EERC–U.S. Department of Energy (DOE) Joint Program on Research and Development for Fossil Energy-Related Resources Cooperative Agreement No. DE-FC26-08NT43291. Nonfederal funding was provided by the North Dakota Industrial Commission, PPL Montana, Nebraska Public Power District, Tri-Mer Corporation, Montana–Dakota Utilities Co., Basin Electric Power Cooperative, KCRC/Korean Institute of Energy Research, Cansolv Technologies, and CO2 Solutions, Inc.

  3. Initial report of the IMAGES VIII/PAGE 127 gas hydrate and paleoclimate cruise on the RV Marion Dufresne in the Gulf of Mexico, 2-18 July 2002

    Science.gov (United States)

    Winters, William J.; Lorenson, T.D.; Paull, Charles K.

    2007-01-01

    The northern Gulf of Mexico contains many documented gas hydrate deposits near the sea floor. Although gas hydrate often is present in shallow subbottom sediment, the extent of hydrate occurrence deeper than 10 meters below sea floor in basins away from vents and other surface expressions is unknown. We obtained giant piston cores, box cores, and gravity cores and performed heat-flow analyses to study these shallow gas hydrate deposits aboard the RV Marion Dufresne in July 2002. This report presents measurements and interpretations from that cruise. Our results confirm the presence of gas hydrate in vent-related sediments near the sea bed. The presence of gas hydrate near the vents is governed by the complex interaction of regional and local factors, including heat flow, fluid flow, faults, pore-water salinity, gas concentrations, and sediment properties. However, conditions appropriate for extensive gas hydrate formation were not found away from the vents.

  4. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...

  5. Aluminum Lithium Alloy 2195 Fusion Welding Improvements with New Filler Wire

    Science.gov (United States)

    Russell, C.

    2001-01-01

    The objective of this research was to assess the B218 weld filler wire for Super Lightweight External Tank production, which could improve current production welding and repair productivity. We took the following approaches: (1) Perform a repair weld quick look evaluation between 4043/B218 and B218/B218 weld filler wire combinations and evaluation tensile properties for planished and unplanished conditions; and (2) Perform repair weld evaluation on structural simulation panel using 4043-B218 and B218/B218 weld filler wire combinations and evaluation tensile and simulated service fracture properties for planished and unplanished conditions.

  6. Gclust Server: 164736 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Bsu_BSU24360=spoIIIAH Cluster Sequences - 218 mutants block sporulation after engulfment (stage III sporulation)...Sequence length 218 Representative annotation mutants block sporulation after engulfment (stage III sporulation)

  7. Diethyl 6,13-dioxo-5,7,12,13b,13c,14-hexahydro-6H,13H-5a,6a,12a,13a-tetraazabenz[5,6]azuleno[2,1,8-ija]benz[f]azulene-13b,13c-dicarboxylate 1,2-dichloroethane solvate

    Directory of Open Access Journals (Sweden)

    Hong-Xia Liu

    2009-11-01

    Full Text Available In the title inclusion compound, C26H26N4O6·C2H4Cl2, the solvent molecule occupies a cavity inside the clip-type molecule which is based on the glycoluril skeleton with two ethyl acetate substituents on the convex face of the glycoluril system. The dihedral angle between the aromatic rings of the host is 43.59 (4° and the centroid–centroid distance is 6.741 (5 Å. The 1,2-dichloroetane molecule adopts a gauche conformation enabling it to participate in C—H...π interactions with the host. The packing motif in the title compound differs from that observed in the crystal structures of the host and in the benzene solvate. The host molecules are linked into tapes by π–π stacking interactions (centroid–centroid distance = 3.733 Å and are further assembled into layers via C—H...O interactions. One of the ethyl groups is disorded over two positions with site-occupancy factors of 0.702 (14 and 0.298 (14.

  8. Study Fails to Link ILL Usage Patterns to Liaison Activities. A Review of: Leykam, Andrew. “Exploring Interlibrary Loan Usage Patterns and Liaison Activities: The Experience at a U.S. University.” Interlending & Document Supply 36.4 (2008: 218-24.

    Directory of Open Access Journals (Sweden)

    Scott Marsalis

    2009-06-01

    Full Text Available Objective - To investigate Interlibrary Loan (ILL usage patterns, and connect them to liaison activities beyond collection development.Design – Pattern analysis of ILL requests.Setting – Library of The College of Staten Island, a mid-size, public university with predominantly undergraduate enrolment.Subjects – 4,875 identifiable requests over a three-year period.Methods – A data set of requests for ILLs of monographs over a period of three years was acquired from OCLC resource sharing statistics. This data was manually reviewed to remove duplicate records of the same request, but not multiple requests for the same item. The data included requestor status, department, publication date and subject classification of requested items.Main Results – Differences in use across user statuses and departments were identified.Conclusion – Usage Patterns can accurately illustrate trends in the borrowing behaviour of patrons, and be used to inform liaison librarians about user needs.

  9. (1R,4S,8R,9R,12S,13S,14R,16S,17R,19R-17-[(Ethylsulfanylmethyl]-9,14-dihydroxy-7,7-dimethyl-2,18-dioxo-3,10-dioxapentacyclo[14.2.1.01,13.04,12.08,12]nonadecan-19-yl acetate acetone solvate

    Directory of Open Access Journals (Sweden)

    Hao Shi

    2009-01-01

    Full Text Available The title compound, C24H32O8S·C3H6O, features three six-membered and two five-membered rings. The six-membered rings adopt chair, boat and slightly distorted boat conformations whereas one five-membered ring adopts an approximate envelope conformation and the other a twist conformation. Disorder was modelled for the ethylthio group with the ethyl-C atoms resolved over three positions with occupancies of 0.58 (4, 0.23 (4 and 0.19 (3. In the crystal, an O—H...O hydrogen bond links the molecules into chains.

  10. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    More Details Fulltext PDF. pp 204-218 General Article. Sir Alfred Bray Kempe-An Amateur Kinematician · A K Mallik · More Details Fulltext PDF. pp 218-218 General Article. Errata · More Details Fulltext PDF. pp 219-219 Science Smiles. Science Smiles · Ayan Guha · More Details Fulltext PDF. pp 220-237 General Article.

  11. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    Directory of Open Access Journals (Sweden)

    Ali BAYRAM

    1998-03-01

    Full Text Available In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 10, 50 and 259 mm/min. Strength properties of dual-phase steels were investigated depending on annealing temperature, ratio of martensite and loading rate.

  12. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  13. Nuclear and in-source laser spectroscopy with the ISAC yield station

    Energy Technology Data Exchange (ETDEWEB)

    Kunz, Peter, E-mail: pkunz@triumf.ca; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning [TRIUMF, 4004 Wesbrook Mall, Vancouver, British Columbia V6T 2A3 (Canada); Andreoiu, Corina; Wong, Fiona [Department of Chemistry, Simon Fraser University, Burnaby, British Columbia V5A 1S6 (Canada)

    2014-05-15

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10{sup 11} ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of {sup 46}K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  14. Nuclear and in-source laser spectroscopy with the ISAC yield station.

    Science.gov (United States)

    Kunz, Peter; Andreoiu, Corina; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning; Wong, Fiona

    2014-05-01

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10(11) ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of (46)K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  15. Radiopharmaceutical chemistry of targeted radiotherapeutics, part 4: Strategies for211At labeling at high activities and radiation doses of211At α-particles.

    Science.gov (United States)

    Pozzi, Oscar R; Zalutsky, Michael R

    2017-03-01

    Alpha particles are radiation of high energy and short range, properties that can lead to radiolysis-mediated complications in labeling chemistry at the high radioactivity levels required for clinical application. In previous papers in this series, we have shown that radiation dose has a profound effect on the astatine species that are present in the labeling reaction and their suitability for the synthesis of N-succinimidyl 3-[ 211 At]astatobenzoate. The purpose of this study was to evaluate the effects of adding N-chlorosuccinimide (NCS) to the methanol solution used for initial isolation of 211 At after distillation, a process referred to as 211 At stabilization, on 211 At chemistry after exposure to high radiation doses. High performance liquid chromatography was used to evaluate the distribution of 211 At species present in methanol in the 500-65,000Gy radiation dose range and the synthesis of SAB from N-succinimidyl 3-(tri-n-butylstannyl)benzoate in the 500-120,000Gy radiation dose range using different 211 At timeactivity combinations under conditions with/without 211 At stabilization. In the absence of NCS stabilization, a reduced form of astatine, At(2), increased with increasing radiation dose, accounting for about half the total activity by about 15,000Gy, while with stabilization, At(2) accounted for 60,000Gy. SAB yields without stabilization rapidly declined with increasing dose, falling to ~20% at about 5000Gy while with stabilization, yields >80% were obtained with 211 At solutions stored for more than 23h and receiving radiation doses >100,000Gy. Adding NCS to the methanol solution used for initial isolation of 211 At is a promising strategy for countering the deleterious effects of radiolysis on 211 At chemistry. This strategy could facilitate the ability to perform 211 At labeling at sites remote from its production and at the high activity levels required for clinical applications. Copyright © 2016 Elsevier Inc. All rights reserved.

  16. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC218 (Link to dictyBase) - - - Contig-U12091-1 VFC218P (Link... to Original site) VFC218F 487 VFC218Z 391 VFC218P 878 - - Show VFC218 Library VF (Link to library) Clone ID VFC218 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12091-1 Original site URL http://dict... J03515 |J03515.1 Slime mold (D.discoideum) severin mRNA, complete cds. 856 0.0 3 U66525 |U66525.1 Dictyoste...mic 24.0 %: mitochondrial 20.0 %: nuclear 4.0 %: peroxisomal >> prediction for VF

  17. Low Response Rate and Other Factors Render Academic Health Science Library System Study Ungeneralizable. A Review of: Folb, B. L., Wessel, C. B., & Czechowski, L. J. (2011. Clinical and academic use of electronic and print books: The Health Sciences Library System e-book study at the University of Pittsburgh. Journal of the Medical Library Association, 99(3, 218-228. doi:10.3163/1536-5050.99.3.009

    Directory of Open Access Journals (Sweden)

    Maria Melssen

    2012-06-01

    Full Text Available Objective – To determine the factors, barriersand facilitators, preference, and intended useof e-book compared to print book usage by allpatrons in a health science library system,which serves a university with health sciencedegree programs and a hospital system.Design – Two online surveys.Setting – University of Pittsburgh HealthSciences Library System, which includes theUniversity of Pittsburgh’s six schools of healthsciences (medicine, dental medicine, nursing,pharmacy, public health, and rehabilitationand the University of Pittsburgh MedicalCenter hospitals and programs.Subjects – All health sciences library systemusrers, including faculty, researchers, clinicians,residents, fellows, employees, and students.Methods – Two versions of the survey weredeployed in 2009 using Opinio. There were 46questions for the University of PittsburghMedical Center (UPMC survey and 47questions for the University of Pittsburgh (Pittsurvey. The surveys were pilot tested byHealth Sciences Library System (HSLSlibrarians and graduate students in a surveymethods class. The survey was edited based onthe feedback provided and receivedinstitutional review board approval as anexempt study.A total of 5,292 email addresses wererandomly selected by SPSS from a pool of 9,472 UPMC and Pitt patrons registered with a HSLS remote access password; 2,684 patrons from UPMC and 2,608 patrons from Pitt were selected. HSLS librarians were excluded from the survey. Participants were emailed a link to the survey in March of 2009. Three email reminders were sent at five day intervals. Data was collected for 22 days and exported from Opinio to SPSS statistics software. Survey results were analyzed using basic descriptive statistics and cross-tabulations.Main Results – Of the 5,292 emails sent, 979 surveys were submitted and 871 were completed fully. The 108 partially completed the surveys were analyzed using pair wise deletion. All HSLS user groups were represented and all rated their confidence in computer skills high. The mean age of respondents was 39.9 with the majority of respondents being female.Of the 871 completed surveys, over half (55.4% of the respondents reported using HSLS e-books: 66.7% men and 54.9% women. HSLS e-books were used for in-depth reading by 53.4% of men and 36.8% of women. At UPMC, 70% of attending physicians, interns, residents, fellows, and Pitt postdoctoral/fellows use HSLS e-books. The primary use of the e-books was for clinical care, by 75.3% of attending physicians; 86% of interns, residents, and fellows; and 38.9% of nurses. HSLS e-books are also used by 61.8% of respiratory care and physical therapists, 28.6% of administrators, and 56.8% of researchers.At Pitt, 73% of postdoctoral students or fellows and 64.7% of faculty used HSLS e-books. The primary use of the e-books was to support research. 76.5% of postdoctoral students and fellows and 54.1% of faculty used e-books for this purpose. Only 21.3% of faculty assigned e-books for class readings. Though 14% of undergraduate and 33.5% of medical students responded that they had been assigned readings from e-books, 51% of undergraduates and 62.1% of graduate and medical students used an e-book to complete an assignment.Over half (65.5% of respondents saw information about HSLS e-books on the HSLS website and 55.4% of respondents used an HSLS e-book. When using an e-book, 56.6% look up brief, factual information while 41.9% use e-books for in-depth study.Uses of HSLS e-book search tools were rated: the federated full text search tool was used by 67.2% of respondents and 74.3% of those who use this tool rated it as moderately to extremely useful. Google books and the library catalog were also rated moderately to extremely useful by respondents. The catalog received the lowest rating of the HSLS e-book search tools.More respondents (95.4% use the library’s website than come to the physical library (63.8%; however, 66.9% say they use both the website and physical library. Of the 63.8% of respondents who came to one of the HSLS libraries, 67.2% borrowed or used a HSLS print book. When using a book at the library, 23.4% only use print, 14.8% only use e-books, 44.7% use both, and 17.1% use neither. Fewer respondents (46.4% agreed or completely agreed they could locate an e-book compared to those who agreed or completely agreed they could locate a print book (66.7%.Nearly half (45.3% agreed that both HSLS e-books and print books were accessible where they needed to use them; however, only 27.9% agreed or completely agreed that they had time to go to the library and use a print book when they needed it. The closer a respondent worked to the library the more likely they used the physical library. Those also within one block of the library were greater users of HSLS e-books (67% of respondents than those who worked more than two blocks from the library (52.3% of respondents. When respondents did come to the library, 84.3% used a HSLS print book in the past year and 64.7% used an HSLS e-book. Of the respondents who did not have time to come to the library, 55.3% used a HSLS print book and 55.3% used a HSLS e-book.When using e-books, respondents preferred such features as printing, saving, and searching over features such as bookmarking, highlighting, and annotating. Respondents also preferred e-books for general reference and pharmaceutical reference, and print books for textbooks and handbooks. A finding of significance is that “those preferring print were more flexible about using e-books than those preferring e-books were about using print” (p. 224.Conclusion – HSLS e-book use varied depending on the respondent’s role at their institution (e.g., clinical physician, researcher and type of book (e.g., reference book they used. The heaviest HSLS e-book users were students, postdoctoral fellows, researchers, and clinical physicians. Respondents who used HSLS e-books most often were also those who used print books most often, and respondents within one block of the library were some of the heaviest HSLS e-book users. Respondents felt that reference and pharmaceutical books were more suitable as e-books. Also of note was that though faculty were not using e-books heavily for assigned readings, students were using HSLS e-books to complete assignments.The greatest drive to choosing between a print and e-book was the respondent’s information need and which book format was most convenient to access at that time. Respondents were flexible in their use of print books and e-books: respondents “would be willing to use a less preferred format if it were more convenient at the time of need” (p.226. In light of respondents’ flexibility between e-book and print book usage, the authors suggest that collection development librarians could reduce the duplication of book formats.Regarding awareness of e-books, survey results from this study were comparable to that of other studies. Also, the respondent’s comments indicate that the survey itself prompted e-book awareness: respondents felt that more advertising of e-books should be done. Such responses show that passive advertisement of e-books though the library’s catalog and on the website are not enough. E-books should be advertised during library instructional sessions.Respondents also prefer Web access to HSLS e-books as well as the HSLS federated e-book search rather than to access HSLS e-books from the library catalog. The authors’ recommendation is to make sure users can easily access e-book catalog records through the Web in order to best facilitate patrons’ use of e-books.Despite the conclusions that were drawn, there were several limitations of this study. Though the sample size was large enough and all HSLS users were included, the response rate was very low. Bias could be an issue as well: non-response bias as well as an overestimation of the number of HSLS e-book users could be contributing factors to the low response rate. In addition to the small sample size and possible bias, the lack of completed responses (11% was also a concern. Finally, respondents expressed confusion over how “e-books” were defined in the survey. Because of these issues, results of this survey may not be generalizable to other libraries.

  18. ORF Alignment: NC_006300 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available producens ... MBEL55E] ... Length = 156 ... Query: 159 MNISLLRIDSRLIHGQVMTSWAKAVKCEAIFAISDEVANDAI...RRELLLQIVPEHLKGYVI 218 ... MNISLLRIDSRLIHGQVMTSWAKAVKCEAIFAISDEVANDAIRRELL...LQIVPEHLKGYVI Sbjct: 1 ... MNISLLRIDSRLIHGQVMTSWAKAVKCEAIFAISDEVANDAIRRELLLQIVPEHLKGYVI 60 ... Query: 279 AINQTDL

  19. Protein (Viridiplantae): 944762 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 218 ... 980083:548 ... 3701:912 ... 3702:1661 ... cell wall-plasma membrane linker protein Arabidopsis thaliana MGSR...PTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPP...TPTPPVVTPPTPTPPVVTPPTPTPPTPIPETCPIDTLKLGACVDVLGGLIHIGLGKSHAKAECCPVLGGLLDLDAAVCLCTTIKLKLLNIDLVLPIALELLLDCGKTPPSDFKCPA

  20. Protein (Viridiplantae): 746637 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 218 ... 38832:274 ... 38833:414 ... 564608:414 predicted protein Micromonas pusilla CCMP1545 MAQLPSYEVDDGEDSMPGAPGEGPMTDSMQGPPVEVPTSDSM...PGAPGEVPTMDSMHGPPVEVPTMDSMHGAPVEVPMMDSMPGAPVEVPTMDSMQGPPVEVPTMDSMQGAPGEGPMTDSMHGAPGEGPTMDSMNSGNPTKCVVPDWCSTYPPEMQKSKPECQCPDDSHP

  1. Dicty_cDB: VHG777 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Achlya ambisexualis heat shock protein... 218 2e-55 U39047_1( U39047 |pid:none) Achlya ambisexualis heat...Achlya ambisexualis isolate JS855 ... 218 2e-55 AF402100_1( AF402100 |pid:none) Achlya ambisexualis isolate

  2. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 218 of 218 ... JO Fadare, AO Afolabi. Vol 1, No 2 (2004), The practice of scientific medicine in private practice: Fetal biometric parameters in obstetric screening ultrasonography, Abstract PDF. LK Obembe ... Vol 8, No 2 (2010), The role of forensic dentist following mass disaster, Abstract PDF. B Kolude, BF Adeyemi, ...

  3. Tourism and the coastal zone

    Digital Repository Service at National Institute of Oceanography (India)

    Mascarenhas, A.

    stream_size 1 stream_content_type text/plain stream_name Fish_Curry_Rice_2002_218.pdf.txt stream_source_info Fish_Curry_Rice_2002_218.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  4. Actiniarian Sea anemone fauna of India

    Digital Repository Service at National Institute of Oceanography (India)

    Parulekar, A.H.

    stream_size 11 stream_content_type text/plain stream_name Mar_Biofouling_Power_Plants_1990_218.pdf.txt stream_source_info Mar_Biofouling_Power_Plants_1990_218.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset...

  5. Gclust Server: 43713 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Cluster Sequences Related Sequences(56) 218 alpha/beta hydrolase fold 2 1.00e-99 0.0 0.0 0.0 6.67 3.23...Sequence length 218 Representative annotation alpha/beta hydrolase fold Number of Sequences 2 Homologs

  6. delta O-18 water isotope in the iLOVECLIM model (version 1.0) - Part 2: Evaluation of model results against observed delta O-18 in water samples

    NARCIS (Netherlands)

    Roche, D.M.V.A.P.; Caley, T.

    2013-01-01

    The H218O stable isotope was previously introduced in the three coupled components of the earth system model iLOVECLIM: atmosphere, ocean and vegetation. The results of a long (5000 yr) pre-industrial equilibrium simulation are presented and evaluated against measurement of H218O abundance in

  7. Bacillus cereus G9241 Makes Anthrax Toxin and Capsule like Highly Virulent B. anthracis Ames but Behaves like Attenuated Toxigenic Nonencapsulated B. anthracis Sterne in Rabbits and Mice

    Science.gov (United States)

    2011-08-01

    described above. Smooth colonies were streaked for isola1ion and screened hy PCR for loss of pBCXOI and maintenance of pBC218. ll1e pBCXOl-/pBC218...2007. Complete sequence analysis of novel plasmids from emetic and periodontal Bacillus cereus isolates reveals a common evolution- ary history among

  8. Dicty_cDB: SLF353 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e-56 EU999182_1( EU999182 |pid:none) Artemia franciscana ribosomal prot... 218 8e-56 AM048985_1( AM048985 |pid:none) Micromalthus deb...ilis partial mRNA ... 218 8e-56 EF070522_1( EF070522 |pid:none) Maconellicoccus hir

  9. Unigene BLAST: CBRC-DRER-26-0123 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-26-0123 gnl|UG|Dr#S31913617 CT727430 ZF_mu Danio rerio cDNA clone ZF_mu_218k12... 3', mRNA sequence /clone=ZF_mu_218k12 /clone_end=3' /gb=CT727430 /gi=112566309 /ug=Dr.96912 /len=668 9e-20 58% ...

  10. Open Veterinary Journal: Contact

    African Journals Online (AJOL)

    Principal Contact. Dr. Ibrahim Eldaghayes Faculty of Veterinary Medicine, University of Tripoli Faculty of Veterinary Medicine, University of Tripoli, P. O. Box 13662, Tripoli, Libya Phone: +218 21 462 8422. Fax: +218 21 462 8421. Email: ibrahim.eldaghayes@vetmed.edu.ly ...

  11. 47 CFR 95.801 - Scope.

    Science.gov (United States)

    2010-10-01

    ... 218-219 MHz Service General Provisions § 95.801 Scope. This subpart sets out the regulations governing the licensing and operation of a 218-219 MHz system. This subpart supplements part 1, subpart F of... 47 Telecommunication 5 2010-10-01 2010-10-01 false Scope. 95.801 Section 95.801 Telecommunication...

  12. RESEARCH ARTICLE A novel Alu–mediated microdeletion in the ...

    Indian Academy of Sciences (India)

    Administrator

    was a mosaicism that carried about 15 percentage for the deletion of exons 3 to 6 of. RUNX2 (Ott et al. 2010). In this study, the mother carried about 78.2% normal peripheral leukocytes and about 21.8 % peripheral leukocytes with RUNX2 deletion. The low level (21.8%) of mosaic DNA deletion was not associated with CCD.

  13. Dicty_cDB: Contig-U12668-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s / Plus Query: 13 aaaaagggacttgngagtntgntgatttngatccnaaaccnnnnnnnngnaaaantgntg 72 |||||||||||||||||||||||||...|||||||||||||||| || |||||||||||| Sbjct: 13 aaaaagggacttgngagtntgntgatttngatccnaaaccnttnntttgnaaaantgntg 72 Q...aaaggntntgnntnctggaaancnagncaaggngnttcaa 192 Query: 193 nggccccntnaaangccnatcccctt 218 |||||||||||||||||||||...||||| Sbjct: 193 nggccccntnaaangccnatcccctt 218 >Contig-U11508-1 (Contig-U11508-1Q) /CSM_Contig/Contig-U1150...us Query: 13 aaaaagggacttgngagtntgntgatttngatccnaaaccnnnnnnnngnaaaantgntg 72 ||||

  14. 78 FR 40695 - Persulfates From the People's Republic of China: Final Results of Expedited Third Sunset Review...

    Science.gov (United States)

    2013-07-08

    ..., 2013, the Department received a notice of intent to participate from a domestic interested party, FMC Corporation (``FMC''), within the deadline specified in 19 CFR 315.218(d)(1)(i), and provided information required under 19 CFR 315.218(d)(1)(ii). FMC claimed interested party status under section 771(9)(C) of the...

  15. 47 CFR 95.853 - Frequency segments.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Frequency segments. 95.853 Section 95.853... SERVICES 218-219 MHz Service Technical Standards § 95.853 Frequency segments. There are two frequency segments available for assignment to the 218-219 MHz Service in each service area. Frequency segment A is...

  16. Environmental Assessment: Construct Fuel Bowser Storage Area Install Underground Storage Tank, Security Fencing, Lighting Construct Bowser Open Storage Pavement at Grand Forks AFB, North Dakota

    Science.gov (United States)

    2004-10-01

    impacts to wildlife. These areas provide foraging habitat for small mammals , such as mice and rabbits. The area is improved and frequently maintained by...dews, tails, fantastic markings, $125; 218-253-2319 AKC Chihuahua , neutered, 18 months old, asking $200; 218-281-4454. AKC BICHON Male

  17. Dicty_cDB: VFA223 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dehydrogenase; EC=1.1.1.3... 221 1e-56 (Q0ABE6) RecName: Full=Malate dehydrogenase; EC=1.1.1.3... 221 1e-56...dehydrogenase; EC=1.1.1.3... 221 2e-56 (Q9K3J3) RecName: Full=Malate dehydrogenase; EC=1.1.1.3... 219 4e-56...dehydrogenase; EC=1.1.1.3... 218 9e-56 (A3M928) RecName: Full=Malate dehydrogenase; EC=1.1.1.3... 218 9e-56...dehydrogenase; EC=1.1.1.3... 218 1e-55 (Q0BAF9) RecName: Full=Malate dehydrogenase; EC=1.1.1.3... 218 1e-55...(Q393V1) RecName: Full=Malate dehydrogenase; EC=1.1.1.3... 218 2e-55 protein update 2009. 6.16 PSORT psg:

  18. Alpha particle emitters in medicine

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, D.R.

    1989-09-01

    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ({sup 211}At) and natural bismuth-212 ({sup 212}Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ({sup 223}Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs.

  19. α decay of the very neutron-deficient isotopes 197-199Fr

    Science.gov (United States)

    Kalaninová, Z.; Andreyev, A. N.; Antalic, S.; Heßberger, F. P.; Ackermann, D.; Andel, B.; Drummond, M. C.; Hofmann, S.; Huyse, M.; Kindler, B.; Lane, J. F. W.; Liberati, V.; Lommel, B.; Page, R. D.; Rapisarda, E.; Sandhu, K.; Šáro, Š.; Thornthwaite, A.; Van Duppen, P.

    2013-04-01

    Decay properties of the very neutron-deficient isotopes 197-199Fr were studied at the velocity filter Separator for Heavy Ion reaction Products (SHIP) at GSI in Darmstadt. The isotopes were produced in the 2n-4n evaporation channels of the fusion-evaporation reaction 60Ni+141Pr → 201Fr*. Improved α-decay properties of 199Fr were determined and the possible existence of two α-decaying states in this nucleus is discussed. For the isotope 198Fr a broad α-decay energy distribution was detected in the range of (7470-7930) keV and two α-decaying states were observed with half-lives of 1.1(7) and 15(3) ms. The new isotope 197Fr was identified based on the observation of one α-decay chain yielding Eα=7728(15) keV and T1/2=0.6-0.3+3.0 ms. The systematics of reduced α-decay widths are presented for neutron-deficient francium, radon, and astatine isotopes.

  20. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Directory of Open Access Journals (Sweden)

    Sherif S Nafee

    Full Text Available Thallium (81(217Tl, Bismuth (83(217Bi, Astatine (85(217At, Francium (87(217Fr, Actinium (89(217Ac and Protactinium (91(217Pa are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221Fr-, (221Ac- and (221Pa-α-decays.

  1. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Science.gov (United States)

    Nafee, Sherif S; Shaheen, Salem A; Al-Ramady, Amir M

    2016-01-01

    Thallium (81(217)Tl, Bismuth (83(217)Bi), Astatine (85(217)At), Francium (87(217)Fr), Actinium (89(217)Ac) and Protactinium (91(217)Pa) are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α) has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF) calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221)Fr-, (221)Ac- and (221)Pa-α-decays.

  2. On the theory of time dilation in chemical kinetics

    Science.gov (United States)

    Baig, Mirza Wasif

    2017-10-01

    The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.

  3. SPECT assay of radiolabeled monoclonal antibodies. Progress report, September 1, 1992--August 24, 1993

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1993-08-20

    The overall goal of this project is to improve the effectiveness of single photon emission computed tomography (SPECT) to image and quantify radiolabeled monoclonal antibodies. During the past year, we have made significant progress toward this goal, and this report summarizes that work. Our efforts have been mainly directed along three fronts. First, we have developed and tested new reconstruction methods including three-dimensional iterative algorithms that model non-uniform attenuation and distance-dependent detector response. Both fan beam and parallel beam collimator geometries have been modeled and novel ways of improving the efficiency of the computationally intensive methods have been introduced. Second, an ultra-high resolution, small field-of-view pinhole collimator has been constructed and evaluated. Reconstructed spatial resolution of 1 to 3 mm (FWHM) has been achieved in phantom scans with a useful field-of-view of 9 to 10 cm. Finally, we have investigated the ability of SPECT to image and quantify astatine-211 distributions. Reconstructed images of phantom data demonstrated quantitative accuracy to within 10% with proper attenuation and scatter compensation.

  4. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    Science.gov (United States)

    Marsh, B. A.; Andel, B.; Andreyev, A. N.; Antalic, S.; Atanasov, D.; Barzakh, A. E.; Bastin, B.; Borgmann, Ch.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Dehairs, M.; Derkx, X.; De Witte, H.; Fedorov, D. V.; Fedosseev, V. N.; Focker, G. J.; Fink, D. A.; Flanagan, K. T.; Franchoo, S.; Ghys, L.; Huyse, M.; Imai, N.; Kalaninova, Z.; Köster, U.; Kreim, S.; Kesteloot, N.; Kudryavtsev, Yu.; Lane, J.; Lecesne, N.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Molkanov, P. L.; Nicol, T.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Schweikhard, L.; Seliverstov, M. D.; Sels, S.; Sjödin, A. M.; Truesdale, V.; Van Beveren, C.; Van Duppen, P.; Wendt, K.; Wienholtz, F.; Wolf, R. N.; Zemlyanoy, S. G.

    2013-12-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar free ionization using the Laser Ion Source Trap, LIST (Po); isobar selective particle identification using the multi-reflection time-of-flight mass separator (MR-ToF MS) of ISOLTRAP (Au, At). These are summarized as part of an overview of the current status of the in-source resonance ionization spectroscopy setup at ISOLDE.

  5. Studies of Stable Octupole Deformations in the Radium Region

    CERN Multimedia

    2002-01-01

    The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

  6. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  7. Evaluating 99mTc Auger electrons for targeted tumor radiotherapy by computational methods.

    Science.gov (United States)

    Tavares, Adriana Alexandre S; Tavares, João Manuel R S

    2010-07-01

    Technetium-99m (99mTc) has been widely used as an imaging agent but only recently has been considered for therapeutic applications. This study aims to analyze the potential use of 99mTc Auger electrons for targeted tumor radiotherapy by evaluating the DNA damage and its probability of correct repair and by studying the cellular kinetics, following 99mTc Auger electron irradiation in comparison to iodine-131 (131I) beta minus particles and astatine-211 (211At) alpha particle irradiation. Computational models were used to estimate the yield of DNA damage (fast Monte Carlo damage algorithm), the probability of correct repair (Monte Carlo excision repair algorithm), and cell kinetic effects (virtual cell radiobiology algorithm) after irradiation with the selected particles. The results obtained with the algorithms used suggested that 99mTc CKMMX (all M-shell Coster-Kroning--CK--and super-CK transitions) electrons and Auger MXY (all M-shell Auger transitions) have a therapeutic potential comparable to high linear energy transfer 211At alpha particles and higher than 131I beta minus particles. All the other 99mTc electrons had a therapeutic potential similar to 131I beta minus particles. 99mTc CKMMX electrons and Auger MXY presented a higher probability to induce apoptosis than 131I beta minus particles and a probability similar to 211At alpha particles. Based on the results here, 99mTc CKMMX electrons and Auger MXY are useful electrons for targeted tumor radiotherapy.

  8. Radiobromination of humanized anti-HER2 monoclonal antibody trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate, a potential label for immunoPET

    Energy Technology Data Exchange (ETDEWEB)

    Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail: vladimir.tolmachev@bms.uu.se

    2005-08-01

    Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.

  9. Development and radiotherapeutic application of /sup 211/At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    Energy Technology Data Exchange (ETDEWEB)

    Adelstein, S.J.; Zalutsky, M.; Bloomer, W.

    1981-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.

  10. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  11. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  12. Hot wire production of single-wall and multi-wall carbon nanotubes

    Science.gov (United States)

    Dillon, Anne C.; Mahan, Archie H.; Alleman, Jeffrey L.

    2010-10-26

    Apparatus (210) for producing a multi-wall carbon nanotube (213) may comprise a process chamber (216), a furnace (217) operatively associated with the process chamber (216), and at least one filament (218) positioned within the process chamber (216). At least one power supply (220) operatively associated with the at least one filament (218) heats the at least one filament (218) to a process temperature. A gaseous carbon precursor material (214) operatively associated with the process chamber (216) provides carbon for forming the multi-wall carbon nanotube (213). A metal catalyst material (224) operatively associated with the process (216) catalyzes the formation of the multi-wall carbon nanotube (213).

  13. : tous les projets | Page 545 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: REFUGEES, DISPLACED PERSONS, IMMIGRATION, RESETTLEMENT, SOCIAL INTEGRATION, HUMANITARIAN ASSISTANCE. Région: North and Central America, South America, Colombia, Canada. Programme: Gouvernance et justice. Financement total : CA$ 218,745.00. Les institutions de microfinance et la ...

  14. Gclust Server: 95070 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Related Sequences(218) 614 NP_054740.2 synovial sarcoma, X breakpoint 2 interacting protein ; no annotation...Representative annotation NP_054740.2 synovial sarcoma, X breakpoint 2 interacting protein ; no annotation

  15. Apparatus for converting hydrocarbon fuel into hydrogen gas and carbon dioxide

    Science.gov (United States)

    Clawson, Lawrence G.; Mitchell, William L.; Bentley, Jeffrey M.; Thijssen, Johannes H. J.

    2001-01-01

    A hydrocarbon fuel reformer (200) is disclosed suitable for producing synthesis hydrogen gas from reactions with hydrocarbons fuels, oxygen, and steam. The reformer (200) comprises first and second tubes (208,218). The first tube (208) includes a first catalyst (214) and receives a first mixture of steam and a first fuel. The second tube (218) is annularly disposed about the first tube (208) and receives a second mixture of an oxygen-containing gas and a second fuel. In one embodiment, a third tube (224) is annularly disposed about the second tube (218) and receives a first reaction reformate from the first tube (208) and a second reaction reformate from the second tube (218). A catalyst reforming zone (260) annularly disposed about the third tube (224) may be provided to subject reformate constituents to a shift reaction. In another embodiment, a fractionator is provided to distill first and second fuels from a fuel supply source.

  16. 78 FR 5820 - Final Flood Hazard Determinations

    Science.gov (United States)

    2013-01-28

    ..., Oakland, IA 51560. City of Treynor City Hall, 7 South Eyeberg Avenue, Treynor, IA 51575. City of Underwood City Hall, 218 2nd Street, Underwood, IA 51576. City of Walnut City Hall, 229 Antique City Drive...

  17. 77 FR 35424 - National Register of Historic Places; Notification of Pending Nominations and Related Actions

    Science.gov (United States)

    2012-06-13

    ... Dr., Milledgeville, 12000381 ] Montgomery County McArthur, Willie T., Farm, 165 McArthur Rd., Ailey... Company Paper Mill and Sack Factory, 218 Cleveland St., Chagrin Falls, 12000391 Franklin County Kilgour...

  18. 78 FR 49693 - Speech-to-Speech and Internet Protocol (IP) Speech-to-Speech Telecommunications Relay Services...

    Science.gov (United States)

    2013-08-15

    ... that this proposal deserves consideration, but defers its resolution until after the Commission seeks.... 104-104, 110 Stat. 56. Interpret or apply 47 U.S.C. 201, 218, 222, 225, 226, 227, 228, 254(k), 616...

  19. 76 FR 40909 - Information Collection Being Submitted for Review and Approval to the Office of Management and...

    Science.gov (United States)

    2011-07-12

    .... 56. Interpret or apply ] 47 U.S.C. 201, 218, 222, 225, 226, 228, 254(k), and 620. Total Annual Burden... complaints and their resolution; and The number of qualified applicants on waiting lists to receive equipment...

  20. 76 FR 26727 - Information Collection Being Reviewed by the Federal Communications Commission

    Science.gov (United States)

    2011-05-09

    ..., 218, 222, 225, 226, 228, 254(k), and 620. Total Annual Burden: 21,412 hours. Total Annual Cost: None... number and types of such complaints and their resolution; and The number of qualified applicants on...

  1. 76 FR 58412 - Relay Services for Deaf-Blind Individuals

    Science.gov (United States)

    2011-09-21

    ..., 218, 222, 225, 226, 228, 254(k), and 620. Total Annual Burden: 21,412 hours. Total Annual Cost: None... number and types of such complaints and their resolution; and The number of qualified applicants on...

  2. Data of evolutionary structure change: 1ACLA-2C0PB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1ACLA-2C0PB 1ACL 2C0P A B --SELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPV...PMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVSAGEARRRATLLARLVGC---NDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDG... 0 1ACL AGLU CA 218 LEU CA 292 1ACL A 1ACLA RNLNCNLNSDEEL

  3. Festivals, cultural intertextuality, and the Gospel of John's rhetoric of ...

    African Journals Online (AJOL)

    Test

    2011-06-07

    218. Meijer, F. & Nijf, O. ., 1992, Trade, transport, and society in the ancient world: A sourcebook, Routledge, London. Millar, F., 1977, The Emperor in the Roman World, Duckworth, London. Mitchell, S., 1990, 'Festivals, games, ...

  4. Sex-Role Orientation and Fear of Success: Clarifying an Unclear Relationship.

    Science.gov (United States)

    Major, Brenda

    1979-01-01

    This study examines the relationship of sex-role orientation, among 218 female undergraduates, as measured by the Bem Sex-Role Inventory (BSRI), fear of success, and achievement motivation and performance. (Author/EB)

  5. Schildberg Construction Company, Inc. - Clean Water Act Public Notice

    Science.gov (United States)

    The EPA is providing notice of a proposed Administrative Penalty Assessment against the Schildberg Construction Company, Inc. for alleged violations at its locations at 1605 218th Avenue, Osceola, IA 50213 and 34466 Elkhorn Trail, Graham, MO 64455.

  6. Gibbon Packing, LLC - Clean Water Act Public Notice

    Science.gov (United States)

    The EPA is providing notice of a proposed Administrative Penalty Assessment against Gibbon Packing, LLC, for alleged violations at the facility located in 218 East Highway 30, P.O. Box 730, Gibbon, NE 68840 (“facility”).

  7. The relationships between behavioral addictions and the five-factor model of personality

    National Research Council Canada - National Science Library

    Andreassen, Cecilie Schou; Griffiths, Mark D; Gjertsen, Siri Renate; Krossbakken, Elfrid; Kvam, Siri; Pallesen, Ståle

    2013-01-01

    ..., and related these to the main dimensions of the five-factor model of personality. Methods In this study, 218 university students completed questionnaires assessing seven different behavioral addictions (i.e...

  8. Parental psychopathology moderates the influence of parental divorce on lifetime alcohol use disorders among Israeli adults

    National Research Council Canada - National Science Library

    Thompson, Jr, Ronald G; Shmulewitz, Dvora; Meyers, Jacquelyn L; Stohl, Malki; Aharonovich, Efrat; Spivak, Baruch; Weizman, Abraham; Frisch, Amos; Grant, Bridget F; Hasin, Deborah S

    2014-01-01

    .... Logistic regression models were used to examine main and additive interaction effects of parental divorce and psychopathology on lifetime DSM-IV AUD, adjusting for age, gender, and ethnicity. Parental divorce (OR=2.18, p≤0.001...

  9. 77 FR 71683 - Initiation of Five-Year (“Sunset”) Review

    Science.gov (United States)

    2012-12-03

    ...-201-820 731-TA-747 Mexico Fresh Tomatoes (3rd Sally Gannon, (202) 482- Review). 0162. Filing... 351.218 (c). Dated: November 14, 2012. Christian Marsh, Deputy Assistant Secretary for Antidumping and...

  10. 77 FR 45589 - Initiation of Five-Year (“Sunset”) Review and Correction

    Science.gov (United States)

    2012-08-01

    ...). A-201-835....... 731-TA-1106 Mexico......... Lemon Juice (1st Sally Gannon, (202) 482-0162 Review... 351.218 (c). Dated: July 19, 2012. Christian Marsh, Deputy Assistant Secretary for Antidumping and...

  11. All projects related to Canada | Page 25 | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: REFUGEES, DISPLACED PERSONS, IMMIGRATION, RESETTLEMENT, SOCIAL INTEGRATION, HUMANITARIAN ASSISTANCE. Region: North and Central America, South America, Colombia, Ecuador, Canada. Program: Governance and Justice. Total Funding: CA$ 218,745.00. Effective and Sustainable Health ...

  12. MicroRNA-133 mediates cardiac diseases: Mechanisms and clinical implications

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Yi; Liang, Yan [Guangdong Key Laboratory for Research and Development of Natural Drugs, Guangdong Medical University, Zhanjiang 524023, Guangdong (China); Zhang, Jin-fang [Department of Orthopaedics and Traumatology, The Chinese University of Hong Kong, Prince of Wales Hospital, Shatin, Hong Kong (China); Fu, Wei-ming, E-mail: fuweiming76@smu.edu.cn [School of Pharmaceutical Sciences, Southern Medical University, Guangzhou 510515 (China)

    2017-05-15

    MicroRNAs (miRNAs) belong to the family of small non-coding RNAs that mediate gene expression by post-transcriptional regulation. Increasing evidence have demonstrated that miR-133 is enriched in muscle tissues and myogenic cells, and its aberrant expression could induce the occurrence and development of cardiac disorders, such as cardiac hypertrophy, heart failure, etc. In this review, we summarized the regulatory roles of miR-133 in cardiac disorders and the underlying mechanisms, which suggest that miR-133 may be a potential diagnostic and therapeutic tool for cardiac disorders. - Highlights: • miR-218 is frequently downregulated in multiple cancers. • miR-218 plays pivotal roles in carcinogenesis. • miR-218 mediates proliferation, apoptosis, metastasis, invasion, etc. • miR-218 mediates tumorigenesis and metastasis via multiple pathways.

  13. TE Scattering From Bubbles In RAM

    National Research Council Canada - National Science Library

    Cochran, John

    1999-01-01

    ... (00) to 450 and at a frequency range from 2-18 GHz, TE polarization. The results from the absolute RCS measurement of the various sized RAM bubbles are discussed in terms of a frequency dependent increase in RCS...

  14. Journal of Sustainable Development Law and Policy (The) - Vol 5 ...

    African Journals Online (AJOL)

    Achieving Excellence in the Legal Profession in a Globalized World: Imperatives for Developing Economies · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. F Eimunjeze, 198-218 ...

  15. Choctaw National Wildlife Refuge Natural Community and Rare Plant Survey

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Choctaw National Wildlife Refuge (CNWR) administers approximately 4,218 acres along theTombigbee River in Choctaw County, Alabama (Figure 1). The Refuge contains a...

  16. Warm water deuterium fractionation in IRAS 16293-2422

    DEFF Research Database (Denmark)

    Persson, Magnus Vilhelm; Jørgensen, Jes Kristian; van Dishoeck, E. F.

    2013-01-01

    Millimeter/submillimeter Array (ALMA) as well as the 31,3 - 22,0 of H218O at 203.40752 GHz and the 31,2 - 22,1 transition of HDO at 225.89672 GHz from the Submillimeter Array (SMA) are presented. Results: The 692 GHz H218O line is seen toward both components of the binary protostar. Toward one...... of the components, "source B", the line is seen in absorption toward the continuum, slightly red-shifted from the systemic velocity, whereas emission is seen off-source at the systemic velocity. Toward the other component, "source A", the two HDO and H218O lines are detected as well with the SMA. From the H218O...

  17. 49 CFR 572.36 - Test conditions and instrumentation.

    Science.gov (United States)

    2010-10-01

    ... A for assembly into 78051-218, revision T. (g) The thorax and knee impactor accelerometers shall...—Class 60 (5) Thorax and thorax pendulum acceleration—Class 180 (6) Thorax deflection—Class 180 (7) Knee...

  18. 76 FR 7150 - Notice of Final Results of Expedited Sunset Review of the Antidumping Duty Order: Glycine From...

    Science.gov (United States)

    2011-02-09

    ... specified in 19 CFR 351.218(d)(1)(I). See Letter from David M. Schwartz, to Secretary Gary Locke, titled... from David M. Schwartz, to Secretary Gary Locke, titled ``Sunset Review of the Antidumping Order on...

  19. Mineviku varjud / Eerik Purje

    Index Scriptorium Estoniae

    Purje, Eerik, 1927-

    2007-01-01

    rets. rmt.: Soviet deportations in Estonia: impact and legacy : articles and life histories / tlk. Alliki Arro, Madli Puhvel, Lilian Puust; toim. Kristi Kukk, Toivo Raun; eessõna Toivo Raun. Tartu : Tartu Ülikooli Kirjastus, 2007. 218 lk.

  20. The Westray chronicles: a case study in corporate crime

    National Research Council Canada - National Science Library

    McCormick, Christopher

    1999-01-01

    ..., and Corporate Crime John McMullan and Sherman Hinze 183 Chapter Ten: Unsettled Accounts after Westray Susan Dodd 218 Endnotes 250 References 273 List of IllustrationsLIST OF ILLUSTRATIONS Westray ...

  1. Empirická krajina v románové krajinné vizi. Reprezentace prostoru v Balzakových Šuanech

    Czech Academy of Sciences Publication Activity Database

    Hrbata, Zdeněk

    2012-01-01

    Roč. 22, č. 45 (2012), s. 218-241 ISSN 0862-8440 Institutional support: RVO:68378068 Keywords : historical novel * narrative situation * mimetic landscape * semiotic area Subject RIV: AJ - Letters, Mass-media, Audiovision

  2. AcEST: BP918906 [AcEST

    Lifescience Database Archive (English)

    Full Text Available LVKLMDRSGPVIDQLSNEVASETLHACCP 390 Query: 217 LLRQQKYFEICFAWIQQVADLVVS---DGMDFSENVKKELLLSLQE-RVATSMIADSSGT 50...ANELLHTVAH 218 W+ W + ++ DM+SA++EVLST D +LV+LM R+GPV DQL++ A+E LH Sbjct: 331 WTSWTNAMDAFSVGDMDSAFSEVLSTGDDFL

  3. Homophobia in a University Community: Attitudes and Experiences of Heterosexual Freshmen.

    Science.gov (United States)

    D'Augelli, Anthony R.; Rose, Melissa L.

    1990-01-01

    Examined attitudes toward homosexuals in college freshmen (n=218). Found widespread hostile attitudes about homosexuals. Results indicated men knew fewer homosexual men, were more homophobic, and made more derogatory remarks than did women. (Author/ABL)

  4. Hysterectomy - laparoscopic - discharge

    Science.gov (United States)

    ... a shower the day after surgery. If tape strips were used to close your skin, they should ... cancer Endometriosis Hysterectomy Uterine fibroids Patient Instructions Hysterectomy - abdominal - discharge Hysterectomy - vaginal - discharge Review Date 2/18/ ...

  5. Membrane Vesicles and Lactamase in Erwinia herbicola Essam A ...

    African Journals Online (AJOL)

    yakoub@AHMED

    lactamase inhibitor combination. Journal of the American Veterinary Medical. Association 218: 1893-1896. Medeiros AA (1997) -Lactamases: quality and resistance. Clinical Microbiology & Infection 4: S2-S9. Minami S, Yotsuji A, Inoue M ...

  6. Genotoxicity of cadmium chloride in the marine gastropod Nerita chamaeleon using comet assay and alkaline unwinding assay

    Digital Repository Service at National Institute of Oceanography (India)

    Sarkar, A.; Bhagat, J.; Ingole, B.S.; Rao, P.V.S.S.D.P.; Markad, V.L.

    virginica Gmelin (Bivalvia: Ostreidae). Aquat Toxicol 74:218-228. Strong EE, Olivier G, Winston PF, Philippe B. 2007. Global diversity of gastropods (Gastropoda; Mollusca) in freshwater. Hydrobiologia 5:95-149. Stronkhorst J, Ariese F, Hattum VB, Postma...

  7. 76 FR 12108 - Environmental Impacts Statements; Notice of Availability

    Science.gov (United States)

    2011-03-04

    ... Period Ends: 04/04/2011, Contact: Kim Martin 801- 342-5100. EIS No. 20110059, Final EIS, USACE, 00... Duffy 218-365-2097. EIS No. 20110062, Draft EIS, USACE, LA, New Orleans To Venice (NOV), Louisiana...

  8. 76 FR 66961 - National Register of Historic Places; Notification of Pending Nominations and Related Actions

    Science.gov (United States)

    2011-10-28

    ... nominated properties under the National Register criteria for evaluation. Comments may be forwarded by... Carroll County Armour Creameries Poultry House, 218 5th Ave. S., Coon Rapids, 11000815 MAINE Androscoggin...

  9. Schildberg Construction Company, Inc.

    Science.gov (United States)

    The EPA is providing notice of a proposed Administrative Penalty Assessment against the Schildberg Construction Company, Inc. for alleged violations at its locations at 1605 218th Avenue, Osceola, IA 50213 and 34466 Elkhorn Trail, Graham, MO 64455.

  10. Trapping and Fieldwork Report on the Mammals of Santee National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Introduction and Purpose My 1981 Wofford College Interim Project (independent Project #218) at Santee National Wildlife Refuge was proposed to give me practical f i...

  11. 75 FR 28019 - Resmethrin; Notice of Receipt of Requests to Voluntarily Cancel Certain Pesticide Registrations

    Science.gov (United States)

    2010-05-19

    ..., recreational, and residential areas to control flying and crawling insects. All remaining resmethrin end use... reproduction 2.1.7 Hershberger (rat) 2.1.8 Female Pubertal (rat) 2.1.9 Male pubertal (rat) 2.1.10...

  12. Fulltext PDF

    Indian Academy of Sciences (India)

    2013-04-04

    Email, rkochhar2000@yahoo.com). 1. Introduction. European access to India ...... malaria. 12. Zoology. Zoology was a late starter in British India, because animals had no commercial value. Academic studies could not take. 218.

  13. The impact of cell phone use on the intensity and liking of a bout of treadmill exercise

    National Research Council Canada - National Science Library

    Rebold, Michael J; Lepp, Andrew; Sanders, Gabriel J; Barkley, Jacob E

    2015-01-01

    ... (texting, talking, listening to music) on planned exercise. Forty-four young adults (n = 33 females, 21.8 ± 1.3 years) each participated in four, separate, 30-minute exercise conditions on a treadmill in a random order...

  14. Regional Seismic Arrays and Nuclear Test Ban Verification

    Science.gov (United States)

    1990-12-01

    Leary, Y.-G. Li, and D. V. Manov .. 717 Borehole Seismometer, A Fiber Optical, by P. C. Leary, D. V. Manov , and Y. G. Li ........... 218 Bostock, M. G...1297 Leary, P. C., D. V. Manov , and Y. G. Li-A Fiber Optical Borehole Seismometer ............ 218 Leary, P. C. and...Y.-G. Li-Fault Zone Trapped Seismic Waves ............................ 1245 Leary, P. C. Y.-G. Li, and D. V. Manov -A Microprocessor-Based Borehole

  15. Dicty_cDB: SLD857 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 56 SLE791 (SLE791Q) /CSM/SL/SLE7-D/SLE791Q.Seq.d/ 218 4e-56 SLD503 (SLD503Q) /CSM/SL/SLD5-A/SLD503Q.Seq.d/ 2...( AU052545 ) Dictyostelium discoideum slug cDNA, clone SLD503. 218 9e-53 1 ( AU039585 ) Dictyostelium discoi

  16. The Effects of Internal Tides on Acoustic Propagation in the Philippine Sea

    Science.gov (United States)

    2013-09-01

    seismic field in the seabed and sound propagation in the water column (Worcester 2013). This thesis focuses on the data collected during the 2009...midpoint. Equations 2.17 and 2.18 were used to implement the model in Matlab . (2.17) (2.18) Of note, the model is a data driven model that was...experiment in order to conduct a statistical analysis of the eigenrays. The Matlab findpeaks function was used on the SNR data to isolate receptions

  17. Validation of Delft3D as a Coastal Surge and Inundation Prediction System

    Science.gov (United States)

    2016-04-07

    FIGURE 2.1-8: HURRICANE IKE ESTIMATED INUNDATION DEPTH (FT.). IMAGE COURTESY OF HARRIS COUNTY FLOOD CONTROL DISTRICT...NOS stations. Figure 2.1-8: Hurricane Ike estimated inundation depth (ft.). Image courtesy of Harris County Flood Control District. (a) 23...System (CSIPS) based on Delft3D for operational use by the US Navy. Baseline studies using re-analysis winds during Hurricanes Ike and Irene as well

  18. Antithrombin III for critically ill patients

    DEFF Research Database (Denmark)

    Allingstrup, Mikkel; Wetterslev, Jørn; Ravn, Frederikke B

    2016-01-01

    organ failure (MOF) was a MD of -1.24 (95% Cl -2.18 to -0.29, I2 statistic = 48%, random-effects model, 3 trials, 156 participants, very low quality of evidence) and for patients with an Acute Physiology and Chronic Health Evaluation score (APACHE) at II and III the MD was -2.18 (95% Cl -4.36 to -0...

  19. Page 1 276 RAMANAND JHA AND SURYA KANT MISHRA If r > ro ...

    Indian Academy of Sciences (India)

    If r > ro, then r and ro must be interchanged in (2.18) and (2.19). Thus using (2.5) and (2.9), we can obtain Laplace transform of the formal solution given by -. 30, , s: ro– ; V6, 6-2mº, s, ro (2.20). 3. PULSE PROPAGATION MODES. Now we will evaluate (2.18) by the method of residues. The integrand is a single-valued ...

  20. Proving and Improving Wave Models in the Arctic Ocean and its MIZ

    Science.gov (United States)

    2015-09-30

    scale, the Greenland Sea Odden which is important for deep convection. The increased open water area present in the autumn Arctic Ocean , particularly...263(5144), 218–221, doi:10.1126/science.263.5144.218. Hunkins, K. (1966), Ekman drift currents in the Arctic Ocean , Deep Sea Res., 13(4), 607–620...1 DISTRIBUTION STATEMENT A. Approved for public release; distribution is unlimited. Proving and Improving Wave Models in the Arctic Ocean

  1. Imaging of photoassimilates transport in plant tissues by positron emission tomography

    Directory of Open Access Journals (Sweden)

    Partelová Denisa

    2017-06-01

    Full Text Available The current findings show that positron emission tomography (PET, primarily developed for medical diagnostic imaging, can be applied in plant studies to analyze the transport and allocation of wide range of compounds labelled with positronemitting radioisotopes. This work is focused on PET analysis of the uptake and transport of 2-deoxy-2-fluoro[18F]-D-glucose (2-[18F]FDG, as a model of photoassimilates, in tissues of giant reed (Arundo donax L. var. versicolor as a potential energy crop. The absorption of 2-[18F]FDG and its subsequent transport in plant tissues were evaluated in both acropetal and basipetal direction as well. Visualization and quantification of the uptake and transport of 2-[18F]FDG in plants immersed with the root system into a 2-[18F]FDG solution revealed a significant accumulation of 18F radioactivity in the roots. The transport rate in plants was increased in the order of plant exposure through: stem > mechanically damaged root system > intact root system. PET analysis in basipetal direction, when the plant was immersed into the 2-[18F]FDG solution with the cut area of the leaf of whole plant, showed minimal translocation of 2-[18F]FDG into the other plant parts. The PET results were verified by measuring the accumulated radioactivity of 18F by direct gamma-spectrometry.

  2. Measurements of the ion fraction and mobility of alpha and beta decay products in liquid xenon using EXO-200

    CERN Document Server

    Albert, J B; Barbeau, P S; Beck, D; Belov, V; Breidenbach, M; Brunner, T; Burenkov, A; Cao, G F; Chambers, C; Cleveland, B; Coon, M; Craycraft, A; Daniels, T; Danilov, M; Daugherty, S J; Davis, C G; Davis, J; Delaquis, S; Der Mesrobian-Kabakian, A; DeVoe, R; Didberidze, T; Dolgolenko, A; Dolinski, M J; Dunford, M; Fairbank, W; Farine, J; Feldmeier, W; Fierlinger, P; Fudenberg, D; Gornea, R; Graham, K; Gratta, G; Hall, C; Hughes, M; Jewell, M J; Jiang, X S; Johnson, A; Johnson, T N; Johnston, S; Karelin, A; Kaufman, L J; Killick, R; Koffas, T; Kravitz, S; Kuchenkov, A; Kumar, K S; Leonard, D S; Licciardi, C; Lin, Y H; Ling, J; MacLellan, R; Marino, M G; Mong, B; Moore, D; Nelson, R; O'Sullivan, K; Odian, A; Ostrovskiy, I; Piepke, A; Pocar, A; Prescott, C Y; Robinson, A; Rowson, P C; Russell, J J; Schubert, A; Sinclair, D; Smith, E; Stekhanov, V; Tarka, M; Tolba, T; Tsang, R; Twelker, K; Vuilleumier, J -L; Waite, A; Walton, J; Walton, T; Weber, M; Wen, L J; Wichoski, U; Wright, J D; Wood, J; Yang, L; Yen, Y -R; Zeldovich, O Ya

    2015-01-01

    Alpha decays in the EXO-200 detector are used to measure the fraction of charged $^{218}\\mathrm{Po}$ and $^{214}\\mathrm{Bi}$ daughters created from alpha and beta decays, respectively. $^{222}\\mathrm{Rn}$ alpha decays in liquid xenon (LXe) are found to produce $^{218}\\mathrm{Po}^{+}$ ions $50.3 \\pm 3.0\\%$ of the time, while the remainder of the $^{218}\\mathrm{Po}$ atoms are neutral. The fraction of $^{214}\\mathrm{Bi}^{+}$ from $^{214}\\mathrm{Pb}$ beta decays in LXe is found to be $76.4 \\pm 5.7\\%$, inferred from the relative rates of $^{218}\\mathrm{Po}$ and $^{214}\\mathrm{Po}$ alpha decays in the LXe. The average velocity of $^{218}\\mathrm{Po}$ ions is observed to decrease for longer drift times. Initially the ions have a mobility of $0.390 \\pm 0.006~\\mathrm{cm}^2/(\\mathrm{kV}~\\mathrm{s})$, and at long drift times the mobility is $0.219 \\pm 0.004~\\mathrm{cm}^2/(\\mathrm{kV}~\\mathrm{s})$. Time constants associated with the change in mobility during drift of the $^{218}\\mathrm{Po}^{+}$ ions are found to be propor...

  3. Optimizing MIBG therapy of neuroendocrine tumors: preclinical evidence of dose maximization and synergy

    Energy Technology Data Exchange (ETDEWEB)

    Mairs, Rob J. [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)], E-mail: r.mairs@beatson.gla.ac.uk; Boyd, Marie [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)

    2008-08-15

    [{sup 131}I]meta-Iodobenzylguanidine ([{sup 131}I]MIBG) has been used for the therapy of tumors of neuroectodermal origin since the 1980s. Its role in the management of these malignancies remains controversial because of the large variation in response rates. Appreciation of the mode of conveyance of [{sup 131}I]MIBG via the noradrenaline transporter into malignant cells and of factors that influence the activity of the uptake mechanism has indicated various ways in which the effectiveness of this type of targeted radiotherapy may be improved. Experimental observations indicate that radiolabeling of MIBG to high specific activity reduced the amount of cold competitor, thereby increasing tumor dose and minimizing pressor effects. We observed supra-additive tumor cell kill and inhibition of tumor growth following combined topotecan and [{sup 131}I]MIBG treatment. The improved efficacy is related to topotecan's increased disruption of DNA repair. Radiation damage to targeted tumors may also be enhanced by the use of the {alpha}-particle emitter [{sup 211}At]astatine rather than {sup 131}I as radiolabel. Furthermore, recent experimental findings indicate that [{sup 123}I]MIBG may have therapeutic potential over and above its utility as an imaging agent. It has recently been demonstrated that potent cytotoxic bystander effects were induced by the intracellular concentration of [{sup 131}I]MIBG, [{sup 123}I]MIBG or meta-[{sup 211}At]astatobenzylguanidine. Identification of the nature of bystander factors could be exploited to maximize the specificity and potency of MIBG-targeted radiotherapy. By employing a range of strategies, there are good prospects for the improvement of the [{sup 131}I]MIBG therapy of neuroectodermal tumors.

  4. Immuno-vectorization of radioelements emitters of alpha particles: a new therapy in cancerology; Immunovectorisation de radioelements emetteurs de particules alpha: une nouvelle voie therapeutique en cancerologie

    Energy Technology Data Exchange (ETDEWEB)

    Bourgeois, M

    2007-05-15

    The radio-immunotherapy is an anti cancerous therapy which consists in vectorising with immuno-specific agents very radio toxic radioelements on tumors or in their environment to destroy them. The first part of this report presents the different characteristics of antibodies as well as their means of production under monoclonal shapes specifically steered against a tumoral antigen of interest. The second part of this report replaces the importance of the immunological vectors in the context of the nuclear medicine. It is notably described that the different methods which allow to radio-label the vector, as well as the different ways of optimization which were envisaged to improve the targeting of radioelements on a tumor. These different developments allow to define the potential place of the alpha radio-immunotherapy in treatments and so re-place the interest of the experimental part. If the radio-immunotherapy, using beta emitters isotopes as the {sup 131}iodine or the{sup 90}yttrium, is today current in anti cancerous therapy, it finds limits because of the disintegration characteristics of the isotopes it uses. Indeed, compared with alpha particles, the beta particles deposit less energy by unit of length in the crossed material.The experimental part of this report aims at studying the feasibility of the coupling between an immunological vector and an alpha emitter isotope.The different tests led on the bismuth 213, the bismuth 212, the lead 212 and the astatine 211 demonstrated that the fixation of these radionuclides was possible. This research theme is strengthened by the construction in Nantes of a cyclotron with high energy ( A.R.R.O.N.A.X.) and the optimization of the obtained promising results should allow a therapeutic use in oncology of the alpha radio-immunotherapy. (N.C.)

  5. Locoregional therapy with α-emitting trastuzumab against peritoneal metastasis of human epidermal growth factor receptor 2-positive gastric cancer in mice.

    Science.gov (United States)

    Li, Huizi Keiko; Morokoshi, Yukie; Nagatsu, Kotaro; Kamada, Tadashi; Hasegawa, Sumitaka

    2017-08-01

    Peritoneal metastasis of gastric cancer (PMGC) is incurable and thus has an extremely poor prognosis. We have found, however, that locoregionally administered trastuzumab armed with astatine-211 ((211) At-trastuzumab) is effective against human epidermal growth factor receptor 2 (HER2)-positive PMGC in a xenograft mouse model. We first observed that (211) At-trastuzumab can specifically bind and effectively kill NCI-N87 (N87) cells, which are HER2-positive human metastatic GC cells, both in vitro and in s.c. tumors. We established a PMGC mouse model using N87 xenografts stably expressing luciferase to test α-particle radioimmunotherapy with (211) At-trastuzumab against PMGC. Biodistribution analysis in this PMGC mouse model revealed that the i.p. administration of (211) At-trastuzumab (1 MBq) was a more efficient means of delivery of (211) At into metastatic tumors than i.v. injection; the maximum tumor uptake with i.p. administration was over 60% injected dose per gram of tissue (%ID/g) compared to approximately 18%ID/g with i.v. injection. Surprisingly, a single i.p. injection of (211) At-trastuzumab (1 MBq) was sufficient to completely eradicate intraperitoneally disseminated HER2-positive GC xenografts in two of six treated mice by inducing DNA double-strand breaks, and to drastically reduce the tumor burden in another three mice. No bodyweight loss, leukocytopenia, or significant biochemical changes in liver or kidney function were observed in the treatment group. Accordingly, locoregionally administered (211) At-trastuzumab significantly prolonged the survival time of HER2-positive PMGC mice compared with control treatments. Our results provide a proof-of-concept demonstration that locoregional therapy with (211) At-trastuzumab may offer a new treatment option for HER2-positive PMGC. © 2017 The Authors. Cancer Science published by John Wiley & Sons Australia, Ltd on behalf of Japanese Cancer Association.

  6. Cyclic nucleotide dependent dephosphorylation of regulator of G-protein signaling 18 in human platelets.

    LENUS (Irish Health Repository)

    Gegenbauer, Kristina

    2013-11-01

    Regulator of G-protein signaling 18 (RGS18) is a GTPase-activating protein that turns off Gq signaling in platelets. RGS18 is regulated by binding to the adaptor protein 14-3-3 via phosphorylated serine residues S49 and S218 on RGS18. In this study we confirm that thrombin, thromboxane A2, or ADP stimulate the interaction of RGS18 and 14-3-3 by increasing the phosphorylation of S49. Cyclic AMP- and cyclic GMP-dependent kinases (PKA, PKG) inhibit the interaction of RGS18 and 14-3-3 by phosphorylating S216. To understand the effect of S216 phosphorylation we studied the phosphorylation kinetics of S49, S216, and S218 using Phos-tag gels and phosphorylation site-specific antibodies in transfected cells and in platelets. Cyclic nucleotide-induced detachment of 14-3-3 from RGS18 coincides initially with double phosphorylation of S216 and S218. This is followed by dephosphorylation of S49 and S218. Dephosphorylation of S49 and S218 might be mediated by protein phosphatase 1 (PP1) which is linked to RGS18 by the regulatory subunit PPP1R9B (spinophilin). We conclude that PKA and PKG induced S216 phosphorylation triggers the dephosphorylation of the 14-3-3 binding sites of RGS18 in platelets.

  7. The effect of D,L-β-aminobutyric acid on the growth and development of Fusarium oxysporum f. sp. tulipae (Apt.

    Directory of Open Access Journals (Sweden)

    Anna Jarecka

    2012-12-01

    Full Text Available The effect of D,L-β-aminobutyric acid (BABA on the growth and development of the root system and the development of fusariosis on tulip bulbs cv. Apeldoorn infected by Fusarium oxysporum f. sp. tulipae (F.ox.t. 218 was studied. The length and fresh weight of roots, the development of fusariosis on bulbs and the linear growth of mycelium of F.ox.t. 218 on PDA medium were measured. Preventively used BABA at a concentration of 100, 250 and 300 µg·cm-3 for soaking uncooled and cooled tulip bulbs greatly inhibited the development of fusariosis on the root system; the length and fresh weight of roots were similar to those of the bulbs not inoculated with F.ox.t. 218. At a concentration of 100 µg·cm-3;, BABA used for soaking bulbs limited the development of fusariosis on scales in about 50% and the concentration of 200 µg·cm-3 totally inhibited the disease symptoms induced by F.ox.t. 218. At a concentration of 100 - 1000 µg·cm-3, BABA did not inhibit the mycelium growth of F.ox.t. 17 and F.xo.t. 218 on PDA medium. This study suggests that BABA protects tulip roots and bulb scales against F. oxysporum f. sp. tulipae by inducing resistance in these organs and has no direct influence on the pathogen.

  8. VizieR Online Data Catalog: Massive star forming molecular clumps Tkin (Tang+, 2017)

    Science.gov (United States)

    Tang, X. D.; Henkel, C.; Menten, K. M.; Zheng, X. W.; Esimbek, J.; Zhou, J. J.; Yeh, C. C.; Konig, C.; Yuan, Y.; He, Y. X.; Li, D. L.

    2016-10-01

    We have selected 30 massive clumps of the Galactic disk at various stages of high-mass star formation and with strong NH3 emission from the ATLASGAL survey (see Table 1). Our observations were carried out in 2015 April, July, and October with the 15m James Clerk Maxwell Telescope telescope (JCMT) on Mauna Kea. The beam size is ~23" and the main-beam efficiency is {eta}mb=Ta*/Tmb~=0.7 at 218GHz. The para-H2CO JKAKC =303-202, 322-221, and 321-220 transitions have rest frequencies of 218.222, 218.475, and 218.760GHz, respectively, which are measured simultaneously by employing the ACSIS digital autocorrelation spectrometer with the special backend configuration RxAH2CO250x3 allowing for three windows, each with a bandwidth of 250MHz. This provides a velocity resolution of 0.084km/s for para-H2CO (303-202 and 322-221) and 0.042km/s for para-H2CO (321-220); CH3OH (422-312) at 218.440GHz is also observed together with para-H2CO (322-221). (6 data files).

  9. Comparing DNA enrichment of proliferating cells following administration of different stable isotopes of heavy water.

    Science.gov (United States)

    Farthing, Don E; Buxbaum, Nataliya P; Lucas, Philip J; Maglakelidze, Natella; Oliver, Brittany; Wang, Jiun; Hu, Kevin; Castro, Ehydel; Bare, Catherine V; Gress, Ronald E

    2017-06-22

    Deuterated water (2H2O) is a label commonly used for safe quantitative measurement of deuterium enrichment into DNA of proliferating cells. More recently, it has been used for labeling proteins and other biomolecules. Our in vitro - in vivo research reports important stable isotopic labeling enrichment differences into the DNA nucleosides and their isotopologues (e.g. deoxyadenosine (dA) M + 1, dA M + 2, dA M + 3), as well as tumor cell proliferation effects for various forms of commercially available stable heavy water (2H2O, H218O, and 2H218O). Using an in vitro mouse thymus tumor cell line, we determined that H218O provides superior DNA labeling enrichment quantitation, as measured by GC-positive chemical ionization (PCI)-MS/MS. In addition, at higher but physiologically relevant doses, both 2H218O and 2H2O down modulated mouse thymus tumor cell proliferation, whereas H218O water had no observable effects on cell proliferation. The in vivo labeling studies, where normal mouse bone marrow cells (i.e. high turnover) were evaluated post labeling, demonstrated DNA enrichments concordant with measurements from the in vitro studies. Our research also reports a headspace-GC-NCI-MS method, which rapidly and quantitatively measures stable heavy water levels in total body water.

  10. The Atacama Cosmology Telescope: cross correlation with Planck maps

    Energy Technology Data Exchange (ETDEWEB)

    Louis, Thibaut; Calabrese, Erminia; Dunkley, Joanna; Næss, Sigurd [Department of Astrophysics, Oxford University, Oxford OX1 3RH (United Kingdom); Addison, Graeme E.; Hincks, Adam D. [Department of Physics and Astronomy, University of British Columbia, Vancouver, BC V6T 1Z4 (Canada); Hasselfield, Matthew; Hlozek, Renée [Department of Astrophysical Sciences, Peyton Hall, Princeton University, Princeton, NJ 08544 (United States); Bond, J. Richard; Hajian, Amir [Canadian Institute for Theoretical Astrophysics, University of Toronto, Toronto, ON M5S 3H8 (Canada); Das, Sudeep [Argonne National Laboratory, 9700 S. Cass Ave., Lemont, IL 60439 (United States); Devlin, Mark J. [Department of Physics and Astronomy, University of Pennsylvania, 209 South 33rd Street, Philadelphia, PA 19104, U.S.A (United States); Dünner, Rolando; Infante, Leopoldo [Departamento de Astronomía y Astrofísica, Facultad de Física, Pontificia Universidad Católica de Chile, Casilla 306, Santiago 22 (Chile); Gralla, Megan; Marriage, Tobias A. [Dept. of Physics and Astronomy, The Johns Hopkins University, 3400 N. Charles St., Baltimore, MD 21218-2686 (United States); Huffenberger, Kevin [Department of Physics, Florida State University, Keen Physics Building, 77 Chieftan Way, Tallahassee, Florida (United States); Kosowsky, Arthur [Department of Physics and Astronomy, University of Pittsburgh, Pittsburgh, PA, 15260 (United States); Moodley, Kavilan [Astrophysics and Cosmology Research Unit, School of Mathematical Sciences, University of KwaZulu-Natal, Durban, 4041 (South Africa); Niemack, Michael D., E-mail: Thibaut.Louis@astro.ox.ac.uk [Joseph Henry Laboratories of Physics, Jadwin Hall, Princeton University, Princeton, NJ 08544 (United States); and others

    2014-07-01

    We present the temperature power spectrum of the Cosmic Microwave Background obtained by cross-correlating maps from the Atacama Cosmology Telescope (ACT) at 148 and 218 GHz with maps from the Planck satellite at 143 and 217 GHz, in two overlapping regions covering 592 square degrees. We find excellent agreement between the two datasets at both frequencies, quantified using the variance of the residuals between the ACT power spectra and the ACT × Planck cross-spectra. We use these cross-correlations to measure the calibration of the ACT data at 148 and 218 GHz relative to Planck, to 0.7% and 2% precision respectively. We find no evidence for anisotropy in the calibration parameter. We compare the Planck 353 GHz power spectrum with the measured amplitudes of dust and cosmic infrared background (CIB) of ACT data at 148 and 218 GHz. We also compare planet and point source measurements from the two experiments.

  11. The tryptophan hydroxylase 1 (TPH1) gene, schizophrenia susceptibility, and suicidal behavior: a multi-centre case-control study and meta-analysis

    DEFF Research Database (Denmark)

    Saetre, Peter; Lundmark, Per; Wang, August

    2010-01-01

    .07-1.29). Association studies on suicide attempts are however conflicting (heterogeneity index I(2) = 0.54) and do not support the A218C/A779C polymorphisms being a susceptibility locus for suicidal behavior among individuals diagnosed with a psychiatric disorder (OR = 0.96 [0.80-1.16]). We conclude that the TPH1 A218....../A779 locus increases the susceptibility of schizophrenia in Caucasian and Asian populations. In addition, the data at hand suggest that the locus contributes to the liability of psychiatric disorders characterized by elevated suicidal rates, rather than affecting suicidal behavior of individuals...... associated with schizophrenia. The minor allele (A) of this polymorphism (A218C) is also more frequent in patients who have attempted suicide and individuals who died by suicide, than in healthy control individuals. In an attempt to replicate previous findings, five single nucleotide polymorphisms (SNPs...

  12. Contributions of conserved residues at the gating interface of glycine receptors

    DEFF Research Database (Denmark)

    Pless, Stephan Alexander; Leung, Ada W Y; Galpin, Jason D

    2011-01-01

    and the in vivo nonsense suppression method to incorporate unnatural amino acids to probe the electrostatic and hydrophobic contributions of five highly conserved side chains near the interface, Glu-53, Phe-145, Asp-148, Phe-187, and Arg-218. Our results suggest a salt bridge between Asp-148 in loop 7 and Arg-218...... for channel gating and is lined by a number of charged and aromatic side chains that are highly conserved among different pLGICs. However, little is known about specific interactions between these residues that are likely to be important for gating in α1 GlyRs. Here we use the introduction of cysteine pairs......Rs is not crucial for normal channel function. These findings help decipher the GlyR gating pathway and show that distinct residue interaction patterns exist in different pLGICs. Furthermore, a salt bridge between Asp-148 and Arg-218 would provide a possible mechanistic explanation for the pathophysiologically...

  13. An integrated meta-analysis of two variants in HOXA1/HOXB1 and their effect on the risk of autism spectrum disorders.

    Directory of Open Access Journals (Sweden)

    Ran-Ran Song

    Full Text Available BACKGROUND: HOXA1 and HOXB1 have been strongly posed as candidate genes for autism spectrum disorders (ASD given their important role in the development of hindbrain. The A218G (rs10951154 in HOXA1 and the insertion variant in HOXB1 (nINS/INS, rs72338773 were of special interest for ASD but with inconclusive results. Thus, we conducted a meta-analysis integrating case-control and transmission/disequilibrium test (TDT studies to clearly discern the effect of these two variants in ASD. METHODS AND FINDINGS: Multiple electronic databases were searched to identify studies assessing the A218G and/or nINS/INS variant in ASD. Data from case-control and TDT studies were analyzed in an allelic model using the Catmap software. A total of 10 and 7 reports were found to be eligible for meta-analyses of A218G and nINS/INS variant, respectively. In overall meta-analysis, the pooled OR for the 218G allele and the INS allele was 0.97 (95% CI = 0.76-1.25, P(heterogeneity = 0.029 and 1.14 (95% CI = 0.97-1.33, P(heterogeneity = 0.269, respectively. No significant association was also identified between these two variants and ASD risk in stratified analysis. Further, cumulative meta-analysis in chronologic order showed the inclination toward null-significant association for both variants with continual adding studies. Additionally, although the between-study heterogeneity regarding the A218G is not explained by study design, ethnicity, and sample size, the sensitive analysis indicated the stability of the result. CONCLUSIONS: This meta-analysis suggests the HOXA1 A218G and HOXB1 nINS/INS variants may not contribute significantly to ASD risk.

  14. Enhanced Subcortical Spreading Depression in Familial Hemiplegic Migraine Type 1 Mutant Mice

    OpenAIRE

    Eikermann-Haerter, Katharina; Yuzawa, Izumi; Qin, Tao; Wang, Yumei; Baek, Kwangyeol; Kim, Young Ro; Hoffmann, Ulrike; Dilekoz, Ergin; Waeber, Christian; Ferrari, Michel D.; van den Maagdenberg, Arn M. J. M.; Moskowitz, Michael A; Ayata, Cenk

    2011-01-01

    Familial hemiplegic migraine type 1, a monogenic migraine variant with aura, is linked to gain-of-function mutations in the CACNA1A gene encoding CaV2.1 channels. The S218L mutation causes severe channel dysfunction, and paroxysmal migraine attacks can be accompanied by seizures, coma, and hemiplegia; patients expressing the R192Q mutation exhibit hemiplegia only. Familial hemiplegic migraine knock-in mice expressing the S218L or R192Q mutation are highly susceptible to cortical spreading dep...

  15. Gclust Server: 96142 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 96142 Glv_gvip218=narB Cluster Sequences Related Sequences(208) 692 nitrate reducta...se 1 1.00e-35 0.0 0.0 4.0 0.0 0.0 0.0 Show 96142 Cluster ID 96142 Sequence ID Glv_gvip218=narB Link to cluster sequences Clus...tative annotation nitrate reductase Number of Sequences 1 Homologs 1 Clustering t...r of Sequences for each species Glv: 1 Species not appearing in this cluster ATH: 0 OSA: 0 PoTR: 0 PPT: 0 CR

  16. Oral Metagenomic Biomarkers in Rheumatoid Arthritis

    Science.gov (United States)

    2016-09-01

    subgingival plaque samples are to be collected, and  sequencing  performed for the 16S RNA microbiome analysis as well as  whole   genome  shotgun  sequencing ...system and University of Florida. No sequencing data has been collected to date. 15. SUBJECT TERMS Enrollment, data collection 16. SECURITY...subjects 2-18 Drs. Bubb/Nascimento Dr. Bubb Subtask 2. Collection of oral DNA samples 2-18 Dr. Nascimento Subtask 3. Deep sequencing and 16S RNA

  17. Regional Use of Social Networking Tools

    Science.gov (United States)

    2014-12-01

    4 2.1.7 Tumblr 4 2.1.8 Instagram 4 2.2 Local Social Networking Services 5 3 Regional Preferences for Social Networking Tools 6 4 African Region...YouTube 280 million Twitter 255 million LinkedIn n/a Pinterest n/a Tumblr 300 million Instagram 200 million The active-user base numbers...so this percentage may decline in the future. 2.1.8 Instagram Instagram , acquired by Facebook in 2012, is a mobile social networking service that

  18. 1109.doc

    Indian Academy of Sciences (India)

    Yield 288 mg; 85%), M. P. 136-138 °C, [α]D -21.8 (c 1.0, CHCl3); 1H NMR (300 MHz, CDCl3): 7.38-7.56 (m, 2H), 6.63-6.98 (m, 2H), 4.49 (t, J H-H, H-P = 9.8 Hz, 1H), 4.01 (m, 4H), 3.59 (dd, J H-P = 21.8 Hz, J H-H = 7.7 Hz, 1H), 1.13 (t, J H-H = 6.8 ...

  19. Quantitative Single-Particle Digital Autoradiography with α-Particle Emitters for Targeted Radionuclide Therapy using the iQID Camera

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Brian W.; Frost, Sophia; Frayo, Shani; Kenoyer, Aimee L.; Santos, E. B.; Jones, Jon C.; Green, Damian J.; Hamlin, Donald K.; Wilbur, D. Scott; Fisher, Darrell R.; Orozco, Johnnie J.; Press, Oliver W.; Pagel, John M.; Sandmaier, B. M.

    2015-07-01

    Abstract Alpha emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50–80 μm) causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with alpha emitters may inactivate targeted cells with minimal radiation damage to surrounding tissues. For accurate dosimetry in alpha-RIT, tools are needed to visualize and quantify the radioactivity distribution and absorbed dose to targeted and non-targeted cells, especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, iQID (ionizing-radiation Quantum Imaging Detector), for use in alpha-RIT experiments. Methods: The iQID camera is a scintillator-based radiation detection technology that images and identifies charged-particle and gamma-ray/X-ray emissions spatially and temporally on an event-by-event basis. It employs recent advances in CCD/CMOS cameras and computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, we evaluated this system’s characteristics for alpha particle imaging including measurements of spatial resolution and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 (211At) activity distributions in cryosections of murine and canine tissue samples. Results: The highest spatial resolution was measured at ~20 μm full width at half maximum (FWHM) and the alpha particle background was measured at a rate of (2.6 ± 0.5) × 10–4 cpm/cm2 (40 mm diameter detector area). Simultaneous imaging of multiple tissue sections was performed using a large-area iQID configuration (ø 11.5 cm

  20. Quantitative single-particle digital autoradiography with α-particle emitters for targeted radionuclide therapy using the iQID camera

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Brian W., E-mail: brian.miller@pnnl.gov [Pacific Northwest National Laboratory, Richland, Washington 99354 and College of Optical Sciences, The University of Arizona, Tucson, Arizona 85719 (United States); Frost, Sofia H. L.; Frayo, Shani L.; Kenoyer, Aimee L.; Santos, Erlinda; Jones, Jon C.; Orozco, Johnnie J. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 (United States); Green, Damian J.; Press, Oliver W.; Pagel, John M.; Sandmaier, Brenda M. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 and Department of Medicine, University of Washington, Seattle, Washington 98195 (United States); Hamlin, Donald K.; Wilbur, D. Scott [Department of Radiation Oncology, University of Washington, Seattle, Washington 98195 (United States); Fisher, Darrell R. [Dade Moeller Health Group, Richland, Washington 99354 (United States)

    2015-07-15

    Purpose: Alpha-emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50–80 μm), causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with α emitters may thus inactivate targeted cells with minimal radiation damage to surrounding tissues. Tools are needed to visualize and quantify the radioactivity distribution and absorbed doses to targeted and nontargeted cells for accurate dosimetry of all treatment regimens utilizing α particles, including RIT and others (e.g., Ra-223), especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, the ionizing-radiation quantum imaging detector (iQID) camera, for use in α-RIT experiments. Methods: The iQID camera is a scintillator-based radiation detection system that images and identifies charged-particle and gamma-ray/x-ray emissions spatially and temporally on an event-by-event basis. It employs CCD-CMOS cameras and high-performance computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, the authors evaluated its characteristics for α-particle imaging, including measurements of intrinsic detector spatial resolutions and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 ({sup 211}At) activity distributions in cryosections of murine and canine tissue samples. Results: The highest spatial resolution was measured at ∼20 μm full width at half maximum and the α-particle background was measured at a rate as low as (2.6 ± 0.5) × 10{sup −4} cpm/cm{sup 2} (40 mm diameter detector area

  1. α-Imaging Confirmed Efficient Targeting of CD₄₅-Positive Cells After ²¹¹At-Radioimmunotherapy for Hematopoietic Cell Transplantation

    Energy Technology Data Exchange (ETDEWEB)

    Frost, Sophia; Miller, Brian W.; Back, Tom; Santos, E. B.; Hamlin, Donald K.; Knoblaugh, E.; Frayo, Shani; Kenoyer, Aimee L.; Storb, Rainer; Press, O. W.; Wilbur, D. Scott; Pagel, John M.; Sandmaier, B. M.

    2015-09-03

    Alpha-radioimmunotherapy (α-RIT) targeting CD45 may substitute for total body irradiation in hematopoietic cell transplantation (HCT) preparative regimens for lymphoma. Our goal was to optimize the anti-CD45 monoclonal antibody (MAb; CA12.10C12) protein dose for astatine-²¹¹(²¹¹At)-RIT, extending the analysis to include intra-organ ²¹¹At activity distribution and α-imaging-based small-scale dosimetry, along with imunohistochemical staining. Methods: Eight normal dogs were injected with either 0.75 (n=5) or 1.00 mg/kg (n=3) of ²¹¹At-B10-CA12.10C12 (11.5–27.6 MBq/kg). Two were euthanized and necropsied 19–22 hours postinjection (p.i.), and six received autologous HCT three days after ²¹¹At-RIT, following lymph node and bone marrow biopsies at 2–4 and/or 19 hours p.i. Blood was sampled to study toxicity and clearance; CD45 targeting was evaluated by flow cytometry. ²¹¹At localization and small scale dosimetry were assessed using two α-imaging : α-camera and iQID. Results: Uptake of ²¹¹At was highest in spleen (0.31–0.61 %IA/g), lymph nodes (0.02–0.16 %IA/g), liver (0.11–0.12 %IA/g), and marrow (0.06–0.08 %IA/g). Lymphocytes in blood and marrow were efficiently targeted using either MAb dose. Lymph nodes remained unsaturated, but displayed targeted ²¹¹At localization in T lymphocyte-rich areas. Absorbed doses to blood, marrow, and lymph nodes were estimated at 3.9, 3.0, and 4.2 Gy/210 MBq, respectively. All transplanted dogs experienced transient hepatic toxicity. Liver enzyme levels were temporarily elevated in 5 of 6 dogs; 1 treated with 1.00 mg MAb/kg developed ascites and was euthanized 136 days after HCT. Conclusion: ²¹¹At-anti-CD45 RIT with 0.75 mg MAb/kg efficiently targeted blood and marrow without severe toxicity. Dosimetry calculations and observed radiation-induced effects indicated that sufficient ²¹¹At-B10-CA12.10C12 localization was achieved for efficient conditioning for HCT.

  2. The role of alpha therapy for local and systemic treatment of cancer

    Energy Technology Data Exchange (ETDEWEB)

    Allen, B.J. [St George Hospital, Kogarah, NSW (Australia)

    1998-03-01

    Major problems in the management of cancer relate to the inability to control some primary lesions, e.g. glioblastoma multiforme (GBM), and the inability to deal with metastatic cancer arising from malignant cancers such as melanoma, breast and other cancers. Binary alpha therapy using neutron capture in boron-10 offers the potential for improved prognosis for high grade brain tumours such as GBM and melanoma metastases to the brain. Metastatic cancer proceeds through a number of quite separate stages in the development of lethal disease, i e. cells in transit, preangiogenic lesions, subclinical and clinical lesions. Early stages offer the potential for control if targeted alpha therapy is applied. However, the dose must be localised to the cancer cell and this requirement rules out beta-emitting radionuclides, which are more suited for clinical lesions. Alpha-emitting radionuclides are the most appropriate toxins, as their efficacy depends on the linear energy transfer (LET) and range of the alpha particles. After matching the cancer stage, radiolabel and carrier, we find that {sup 149}Tb is the radionuclide of choice for systemic therapy in all aspects except production. The production of {sup 149}Tb in {mu}Ci (kBq) quantities has been achieved using the heavy ion reaction at the ANU tandem accelerator at Canberra and in multi-mCi (MBq) quantities using the spallation reaction in combination with on-line isotope separation technology of ISOLDE at CERN. Terbium is ideally suited for chelation to monoclonal antibodies to produce stable radio-immunoconjugates (RIC). Astatine-211 is a halide and has potential for the elimination of early stage melanoma metastases as At-MTB. However, the availability of the alpha generators {sup 228}Th-{sup 212}Bi and {sup 225}Ac-{sup 213}Bi facilitates the use of Bi-RIC in clinical trials for acute myeloid leukaemia and cystic glioma. Alpha therapy has the potential to control refractory cancers when treated at the minimum residual

  3. Systematics of Alpha-Radioactivity

    Energy Technology Data Exchange (ETDEWEB)

    Perlman, I.; Ghiorso, A.; Seaborg, G.T.

    1949-09-12

    Correlations of alpha-decay energies in terms of mass number and atomic number have been made for all of the alpha-emitting species now numbering over 100. For each element isotopes show increase in alpha-energy with decrease in mass number except in the region of 126 neutrons where there is an explainable reversal. This reversal has the effect of creating a region of relatively low alpha-energy and long half-life at low mass numbers for such elements as astatine, emanation, francium, and possibly higher elements as had been noted already for bismuth and polonium. Methods and examples of using alpha-decay data to define the energy surface in the heavy element region are discussed. The regularities in alpha-decay are used for predictions of nuclear properties including prediction of the beta-stable nuclides among the heavy elements. The half-life vs. energy correlations show that the even-even nuclides conform well with existing alpha-decay theory, but all nuclear types with odd nucleons show prohibited decay. The reason for this prohibition is not found in spin changes in the alpha-emission but in the assembly of the components of the alpha particle, and this theory is discussed further in terms of observations made on nuclides having two or more alpha-groups. Using most of the even-even nuclei to define 'normal nuclear radius' calculations are now able to show the shrinkage in the regions of lead and of 126 neutrons to amount to about 10%. The much greater change in 'effective radius' for bismuth isotopes can be dissociated into the effects of odd nucleons superimposed on the actual decrease in nuclear radius. The simple expression r = 1.48 A{sup 1/3} {center_dot} 10{sup -13} cm seems to fit the data for the even-even nuclei outside of the region of 126 neutrons better than more complex functions.

  4. The Analysis of Organizational Diagnosis on Based Six Box Model in Universities

    Science.gov (United States)

    Hamid, Rahimi; Siadat, Sayyed Ali; Reza, Hoveida; Arash, Shahin; Ali, Nasrabadi Hasan; Azizollah, Arbabisarjou

    2011-01-01

    Purpose: The analysis of organizational diagnosis on based six box model at universities. Research method: Research method was descriptive-survey. Statistical population consisted of 1544 faculty members of universities which through random strafed sampling method 218 persons were chosen as the sample. Research Instrument were organizational…

  5. Ki-67 Expression in Human Tumors Measured by Flow Cytometry

    Science.gov (United States)

    1990-01-01

    warm at room temperature for 30 min. Slides were placed in PBS for 5 min. cytospin spots were covered with normal horse serum (1:100 in 2% bovine serum...MIonoclonal antibody to 5-bromno- and -5- iodo -deoxN uridine: aI new reczivnt for detection of DNA replication. Science 218:474. i Libeshaw JA. Lister TA

  6. Domain Modeling: NP_055315.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_055315.2 chrX X-RAY CRYSTAL STRUCTURE OF THE POLY(A)-BINDING PROTEIN IN COMPLEX ...WITH POLYADENYLATE RNA c1cvjh_ chrX/NP_055315.2/NP_055315.2_holo_32-218.pdb psi-blast 33D,35G,37E,60F,62K,63

  7. Domain Modeling: NP_085116.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_085116.2 chr5 Solution structure of the tandem four zf-C2H2 domain repeats of mu...rine GLI-Kruppel family member HKR3 c2dlqa_ chr5/NP_085116.2/NP_085116.2_holo_209-322.pdb blast 216C,218E,21

  8. Social Support for Divorced Fathers' Parenting: Testing a Stress-Buffering Model

    Science.gov (United States)

    DeGarmo, David S.; Patras, Joshua; Eap, Sopagna

    2008-01-01

    A stress-buffering hypothesis for parenting was tested in a county-representative sample of 218 divorced fathers. Social support for parenting (emergency and nonemergency child care, practical support, financial support) was hypothesized to moderate effects of stress (role overload, coparental conflict, and daily hassles) on fathers' quality…

  9. The Development and Use of an Evaluation Mechanism for the Assessment of Software Configuration Management Tools

    Science.gov (United States)

    1993-12-01

    Revisions ............................... 2-7 2-4. Generic Change Control Process ....................................... 2-10 2-5. Computer Software Development Cycle...EUNCTIONALALLOCATED DEVELOPMENTAL CONFIGURATION PRODUCT BASELINE BASELINE BASELINE Figure 2-5. Computer Software Development Cycle (Berlack, 1992:47) 2-18 In

  10. A preterm lifeline

    DEFF Research Database (Denmark)

    Brødsgaard, Anne; Zimmermann, Renathe; Petersen, Mette

    2015-01-01

    PURPOSE: To present an Early Discharge Programme model for preterm infants based on family-centred care, and to describe its impact on the infants and families. DESIGN AND METHODS: Methods included longitudinal growth assessments of 218 premature infants and a qualitative synthesis of two focus...

  11. Author Details

    African Journals Online (AJOL)

    Uzoma, EF. Vol 1, No 3 (2010) - Articles Challenges and Implications of Genesis 2:18 – 24 on Same-Sex Marriage for the Contemporary Society Abstract PDF. ISSN: 2006-5442. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners ...

  12. Author Details

    African Journals Online (AJOL)

    Okoye, MK. Vol 1, No 3 (2010) - Articles Challenges and Implications of Genesis 2:18 – 24 on Same-Sex Marriage for the Contemporary Society Abstract PDF. ISSN: 2006-5442. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners ...

  13. Racial Differences in Adolescent Self-Report: A Comparative Validity Study Using Homogeneous MMPI Content Measures.

    Science.gov (United States)

    Wrobel, Nancy Howells; Lachar, David

    1995-01-01

    Minnesota Multiphasic Personality Inventories (MMPIs) were administered to an urban mixed-race sample of 218 adolescent psychiatric patients. Wiggins scale elevations for African Americans and whites were compared, and the validity of the scales was assessed through comparison with parent observations. Implications for the MMPI-Adolescent content…

  14. Albendazole Microparticles Prepared by Spray Drying Technique ...

    African Journals Online (AJOL)

    The spray-dried particles were characterized for particle shape, and dissolution rate as well as by differential scanning calorimetry(DSC) and Fourier .... Thermal analysis. The DSC thermogram of pure ABZ (Fig. 2 A) shows an endothermic peak at 218 ºC with a shoulder at 198 oC due to drug melting [15], while KL exhibits a ...

  15. EFL Learners' Vocabulary Consolidation Strategy Use and Corresponding Performance on Vocabulary Tests

    Science.gov (United States)

    Lai, Ying-Chun

    2016-01-01

    This study describes English as a Foreign Language (EFL) learners' use of vocabulary consolidation strategies and explores the connection between strategy use and vocabulary learning outcomes. This study included 218 participants who were students from five freshman English classes at a university in Taiwan. Students' self-reports on their use of…

  16. Positron emission tomography/computed tomography for optimized colon cancer staging and follow up

    DEFF Research Database (Denmark)

    Engelmann, Bodil Elisabeth; Loft, Annika; Kjær, Andreas

    2014-01-01

    OBJECTIVES: Optimal management of colon cancer (CC) requires detailed assessment of extent of disease. This study prospectively investigates the diagnostic accuracy of 2-deoxy-2-[18F]fluoro-D-glucose positron emission tomography/computed tomography (PET/CT) for staging and detection of recurrence...

  17. Resistance patterns of plasmodium falciparum malaria to ...

    African Journals Online (AJOL)

    Resistance patterns of plasmodium falciparum malaria to chloroquine in Kampala, Uganda. ... Sixty three (65.6%) patients showed clinical improvement, 29 (30.2%) deteriorated and four (4.2%) had no change. Adequate parasitogical response was seen in 71 (74 %), moderate in four (4.2%) and poor in 21 (21.8%) patients.

  18. Book Review Pivotal Love Relationships By Richard Alapack (2007 ...

    African Journals Online (AJOL)

    Love's Pivotal Relationships: The Chum, First Love, Outlaw and the Intimate Partner. Milton Keynes, UK/Bloomington, Indiana: AuthorHouse Press. Paperback (218 pages). ISBN: 978-1-434-31904-3. Hardcover (232 pages). ISBN: 978-1-434-32452-8. Indo-Pacific Journal of Phenomenology, Volume 8, Edition 1 May 2008 ...

  19. Teaching People to Manage Constraints: Effects on Creative Problem-Solving

    Science.gov (United States)

    Peterson, David R.; Barrett, Jamie D.; Hester, Kimberly S.; Robledo, Issac C.; Hougen, Dean F.; Day, Eric A.; Mumford, Michael D.

    2013-01-01

    Constraints often inhibit creative problem-solving. This study examined the impact of training strategies for managing constraints on creative problem-solving. Undergraduates, 218 in all, were asked to work through 1 to 4 self-paced instructional programs focused on constraint management strategies. The quality, originality, and elegance of…

  20. Drug: D09670 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available nt of anemia, and bone anabolic agent for the treatment of cancer-related bone lo...8; 65-84; 71-83; 85-90; 158-218; 264-322, Dimer: 123; 126) Peptide Red cell maturation agent for the treatme