
Sample records for astatine 217

  1. Radiochemistry of astatine

    Energy Technology Data Exchange (ETDEWEB)

    Ruth, T J; Dombsky, M; D' Auria, J M; Ward, T E


    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs. (DLC)

  2. Discovery of the astatine, radon, francium, and radium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail:


    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  3. Discovery of the astatine, radon, francium, and radium isotopes

    CERN Document Server

    Fry, C


    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Discovery of the astatine, radon, francium, and radium isotopes (United States)

    Fry, C.; Thoennessen, M.


    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  5. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Energy Technology Data Exchange (ETDEWEB)

    Uusitalo, J.; Jakobsson, U. [Department of Physics, University of Jyvaeskylae (Finland); Collaboration: RITU-Gamma Gollaboration


    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  6. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line (United States)

    Uusitalo, J.; Jakobsson, U.


    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  7. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A


    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  8. Measurement of the first ionization potential of astatine by laser ionization spectroscopy. (United States)

    Rothe, S; Andreyev, A N; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yuri; Köster, U; Lane, J F W; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt, K D A


    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine.

  9. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Jakobsson, U., E-mail:; Cederwall, B. [KTH, The Division of Nuclear Physics, AlbaNova University Center, SE-10691 Stockholm (Sweden); Uusitalo, J.; Auranen, K.; Badran, H.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; Herzáň, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J. [University of Jyvaskyla, Department of Physics, P.O. Box 35, FI-40014 University of Jyvaskyla (Finland); and others


    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2{sup +} state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2{sup +} state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2{sup +} state and the spherical 9/2{sup −} ground state in {sup 203}Fr and {sup 205}Fr.

  10. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei (United States)

    Jakobsson, U.; Uusitalo, J.; Auranen, K.; Badran, H.; Cederwall, B.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; HerzáÅ, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J.; Scholey, C.; Sorri, J.; Stolze, S.


    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2+ state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2+ state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2+ state and the spherical 9/2- ground state in 203Fr and 205Fr.

  11. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Directory of Open Access Journals (Sweden)

    Sherif S Nafee

    Full Text Available Thallium (81(217Tl, Bismuth (83(217Bi, Astatine (85(217At, Francium (87(217Fr, Actinium (89(217Ac and Protactinium (91(217Pa are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221Fr-, (221Ac- and (221Pa-α-decays.

  12. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei. (United States)

    Nafee, Sherif S; Shaheen, Salem A; Al-Ramady, Amir M


    Thallium (81(217)Tl, Bismuth (83(217)Bi), Astatine (85(217)At), Francium (87(217)Fr), Actinium (89(217)Ac) and Protactinium (91(217)Pa) are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α) has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF) calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221)Fr-, (221)Ac- and (221)Pa-α-decays.

  13. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom


    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...

  14. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    NARCIS (Netherlands)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Koester, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjoedin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical

  15. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach


    Maiti, Moumita; Lahiri, Susanta


    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  16. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per


    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even sing...... of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies....

  17. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag


    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  18. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail:; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)


    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  19. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  20. Adsorption of the astatine species on a gold surface: A relativistic density functional theory study (United States)

    Demidov, Yuriy; Zaitsevskii, Andréi


    We report first-principle based studies of the adsorption interaction of astatine species on a gold surface. These studies are aimed primarily at the support and interpretation of gas chromatographic experiments with superheavy elements, tennessine (Ts, Z = 117), a heavier homologue of At, and possibly its pseudo-homologue nihonium (Nh, Z = 113). We use gold clusters with up to 69 atoms to simulate the adsorption sites and estimate the desorption energies of At & AtOH from a stable gold (1 1 1) surface. To describe the electronic structure of At -Aun and AtOH -Aun complexes, we combine accurate shape-consistent relativistic pseudopotentials and non-collinear two-component relativistic density functional theory. The predicted desorption energies of At and AtOH on gold are 130 ± 10 kJ/mol and 90 ± 10 kJ/mol, respectively. These results confirm the validity of the estimates derived from chromatographic data (147 ± 15 kJ/mol for At, and 100-10+20 kJ/mol for AtOH).


    Energy Technology Data Exchange (ETDEWEB)



    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  2. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian


    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  3. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  4. 20 CFR 217.16 - Filing date. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Filing date. 217.16 Section 217.16 Employees... LUMP SUM Filing An Application § 217.16 Filing date. An application filed in a manner and form acceptable to the Board is officially filed with the Board on the earliest of the following dates: (a) On the...

  5. 29 CFR 780.217 - Forestry activities. (United States)


    ... 29 Labor 3 2010-07-01 2010-07-01 false Forestry activities. 780.217 Section 780.217 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR STATEMENTS OF GENERAL... as It Relates to Specific Situations Hatchery Operations § 780.217 Forestry activities. Operations in...

  6. 14 CFR 217.7 - Certification. (United States)


    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Certification. 217.7 Section 217.7 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC... NONSCHEDULED SERVICES § 217.7 Certification. The certification for BTS Form 41 Schedule T-100(f) shall be...

  7. 48 CFR 252.217-7006 - Title. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Title. 252.217-7006... Clauses 252.217-7006 Title. As prescribed in 217.7104(a), use the following clause: Title (DEC 1991) (a) Unless otherwise provided, title to all materials and equipment to be incorporated in a vessel in the...

  8. 49 CFR 229.217 - Fuel tank. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Fuel tank. 229.217 Section 229.217 Transportation... TRANSPORTATION RAILROAD LOCOMOTIVE SAFETY STANDARDS Locomotive Crashworthiness Design Requirements § 229.217 Fuel tank. (a) External fuel tanks. Locomotives equipped with external fuel tanks shall, at a minimum...

  9. 48 CFR 252.217-7010 - Performance. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Performance. 252.217-7010... Clauses 252.217-7010 Performance. As prescribed in 217.7104(a), use the following clause: Performance (JUL..., scrap or other ship's material of the Government resulting from performance of the work as items of...

  10. 49 CFR 238.217 - Side structure. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Side structure. 238.217 Section 238.217 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Equipment § 238.217 Side structure. Each passenger car shall comply with the following: (a) Side posts and...

  11. 40 CFR 21.7 - [Reserved (United States)


    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false 21.7 Section 21.7 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL SMALL BUSINESS § 21.7 Comment: Applications for a statement resulting from a requirement to control pollution from non-point sources as identified in section...

  12. 22 CFR 217.23 - New construction. (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false New construction. 217.23 Section 217.23 Foreign... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Accessibility § 217.23 New construction. (a) Design and construction. Each facility or part of a facility constructed by, on behalf of, or for the use of a recipient...

  13. Nuclear Data Sheets for A=217

    Energy Technology Data Exchange (ETDEWEB)

    Kondev, F. G.; McCutchan, E. A.; Singh, B.; Banerjee, K.; Bhattacharya, S.; Chakraborty, A.; Garg, S.; Jovancevic, N.; Kumar, S.; Rathi, S. K.; Roy, T.; Lee, J.; Shearman, R.


    The evaluated spectroscopic data are presented for 12 known nuclides with A=217 (Tl, Pb, Bi, Po, At, Rn, Fr, Ra, Ac, Th, Pa, U). For Tl-217, Pb-217, Pa-217, and U-217 nuclei, only information on the ground state is available. Levels in Bi-217 are known only from isomer decay following fragmentation reaction and those in At-217 and Rn-217 only from the a decay of Fr-221 and Ra-221, respectively. High spin levels in Ra-217 are mainly from 1987SuZY and 2011MuZZ which are a lab report and thesis, respectively. Due to differences between these studies, further experimental study is needed to firmly establish the level scheme.This evaluation was carried out as part of a joint IAEA-ICTP workshop for Nuclear Structure and Decay Data, organized and hosted by the IAEA, Vienna and ICTP, Trieste, Aug 22 to Sept 2 2016. The evaluation work was coordinated by E.A. McCutchan (BNL). This work supersedes the previous previous A=217 evaluation (2003Ak06) by Y.A. Akovali.

  14. 14 CFR 145.217 - Contract maintenance. (United States)


    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Contract maintenance. 145.217 Section 145...) SCHOOLS AND OTHER CERTIFICATED AGENCIES REPAIR STATIONS Operating Rules § 145.217 Contract maintenance. (a) A certificated repair station may contract a maintenance function pertaining to an article to an...

  15. 22 CFR 217.61 - Procedures. (United States)


    ... applicable to title VI of the Civil Rights Act of 1964 apply to this part. These procedures are found in... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Procedures. 217.61 Section 217.61 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR...

  16. 48 CFR 1252.217-77 - Title. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Title. 1252.217-77 Section... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1252.217-77 Title. As prescribed at (TAR) 48 CFR 1217.7001(b) and (c), insert the following clause: Title (OCT 1994) (a) Unless otherwise...

  17. 48 CFR 1252.217-72 - Performance. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Performance. 1252.217-72... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1252.217-72 Performance. As prescribed at (TAR) 48 CFR 1217.7001(b) and (c), insert the following clause: Performance (OCT 1994) (a) Upon...

  18. 27 CFR 24.217 - Vinegar stock. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Vinegar stock. 24.217... OF THE TREASURY LIQUORS WINE Production of Other Than Standard Wine § 24.217 Vinegar stock. Vinegar stock may be produced on bonded wine premises with the addition of any quantity of water desired to meet...

  19. 40 CFR 86.217-94 - [Reserved (United States)


    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false 86.217-94 Section 86.217-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty Passenger...

  20. 48 CFR 217.170 - General. (United States)


    ... order quantity procurement in excess of $20 million in any one year (see 217.174(a)(1)); (iii) Employ an... quantity procurement in excess of $20 million in any one year (see 217.174(a)(2)); or (v) Include a... (Acquisition, Technology, and Logistics) (OUSD(AT&L)DPAP), and to the Deputy Under Secretary of Defense...

  1. 36 CFR 21.7 - Health examinations. (United States)


    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Health examinations. 21.7... SPRINGS NATIONAL PARK; BATHHOUSE REGULATIONS § 21.7 Health examinations. No employee who comes in direct... health examination, or remain in such employment without undergoing periodic health examinations, as...

  2. 31 CFR 800.217 - Hold. (United States)


    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Hold. 800.217 Section 800.217 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF INVESTMENT SECURITY, DEPARTMENT OF THE TREASURY REGULATIONS PERTAINING TO MERGERS, ACQUISITIONS, AND TAKEOVERS BY...

  3. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)


    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  4. 14 CFR 217.1 - Definitions. (United States)


    ... REGULATIONS REPORTING TRAFFIC STATISTICS BY FOREIGN AIR CARRIERS IN CIVILIAN SCHEDULED, CHARTER, AND... carriers; and an infant who does not occupy a seat. (This definition is for 14 CFR part 217 traffic...) Persons injured in aircraft accidents, and physicians, nurses, and others attending such persons; (6) Any...

  5. 14 CFR 120.217 - Tests required. (United States)


    ... or to obtain necessary emergency medical care. (c) Random alcohol testing. (1) Except as provided in... AND OPERATORS FOR COMPENSATION OR HIRE: CERTIFICATION AND OPERATIONS DRUG AND ALCOHOL TESTING PROGRAM Alcohol Testing Program Requirements § 120.217 Tests required. (a) Pre-employment alcohol testing. As an...

  6. 25 CFR 217.6 - Method of casting votes. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Method of casting votes. 217.6 Section 217.6 Indians.... § 217.6 Method of casting votes. Within 30 days after an issue and any analysis provided for in §§ 217.4... superintendent in writing of the number of votes cast for and against the proposed or alternative solutions. If...

  7. 49 CFR 199.217 - On-duty use. (United States)


    ... 49 Transportation 3 2010-10-01 2010-10-01 false On-duty use. 199.217 Section 199.217 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... Prevention Program § 199.217 On-duty use. Each operator shall prohibit a covered employee from using alcohol...

  8. 48 CFR 217.7404-2 - Price ceiling. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Price ceiling. 217.7404-2 Section 217.7404-2 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM... Contract Actions 217.7404-2 Price ceiling. UCAs shall include a not-to-exceed price. ...

  9. 22 CFR 217.9 - Administrative requirements for small recipients. (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Administrative requirements for small recipients. 217.9 Section 217.9 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NONDISCRIMINATION ON... recipient with fewer than fifteen employees, or any class of such recipients, to comply with §§ 217.7 and...

  10. 48 CFR 217.7103-4 - Emergency work. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Emergency work. 217.7103-4 Section 217.7103-4 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM... Repair and Alteration of Vessels 217.7103-4 Emergency work. (a) The contracting officer, without...

  11. 12 CFR 741.217 - Truth in savings. (United States)


    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Truth in savings. 741.217 Section 741.217 Banks and Banking NATIONAL CREDIT UNION ADMINISTRATION REGULATIONS AFFECTING CREDIT UNIONS REQUIREMENTS FOR... Also Apply to Federally Insured State-Chartered Credit Unions § 741.217 Truth in savings. Any credit...

  12. 49 CFR 234.217 - Flashing light units. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Flashing light units. 234.217 Section 234.217..., Inspection, and Testing Maintenance Standards § 234.217 Flashing light units. (a) Each flashing light unit.... (b) Each flashing light unit shall be maintained to prevent dust and moisture from entering the...

  13. 48 CFR 252.217-7001 - Surge option. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Surge option. 252.217-7001... Clauses 252.217-7001 Surge option. As prescribed in 217.208-70(b), use the following clause: Surge Option... established by negotiation as provided in this clause. (b) Schedule. (1) When the Production Surge Plan (DI...

  14. The Emerging Role of Zfp217 in Adipogenesis

    Directory of Open Access Journals (Sweden)

    Hong Xiang


    Full Text Available Zinc finger protein 217 (Zfp217, a member of the krüppel-type zinc finger protein family, plays diverse roles in cell differentiation and development of mammals. Despite extensive research on the functions of Zfp217 in cancer, pluripotency and reprogramming, its physiological roles in adipogenesis remain unknown. Our previous RNA sequencing data suggest the involvement of Zfp217 in adipogenesis. In this study, the potential function of Zfp217 in adipogenesis was investigated through bioinformatics analysis and a series of experiments. The expression of Zfp217 was found to be gradually upregulated during the adipogenic differentiation in C3H10T1/2 cells, which was consistent with that of the adipogenic marker gene Pparg2. Furthermore, there was a positive, significant relationship between Zfp217 expression and adipocyte differentiation. It was also observed that Zfp217 could not only trigger proliferative defect in C3H10T1/2 cells, but also interact with Ezh2 and suppress the downstream target genes of Ezh2. Besides, three microRNAs (miR-503-5p, miR-135a-5p and miR-19a-3p which target Zfp217 were found to suppress the process of adipogenesis. This is the first report showing that Zfp217 has the capacity to regulate adipogenesis.

  15. 29 CFR 1952.217 - Changes to approved plans. (United States)


    ... 29 Labor 9 2010-07-01 2010-07-01 false Changes to approved plans. 1952.217 Section 1952.217 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... plans. (a) Legislation. (1) On March 29, 1994, the Assistant Secretary approved Maryland's revised...

  16. 48 CFR 3052.217-96 - Title (USCG). (United States)


    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Title (USCG). 3052.217-96... of Provisions and Clauses 3052.217-96 Title (USCG). As prescribed in USCG guidance at (HSAR) 48 CFR 3017.9000(a) and (b), insert the following clause: Title (DEC 2003) (a) Unless otherwise provided...

  17. 48 CFR 217.7506 - Spare parts breakout program. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Spare parts breakout... Acquisition of Replenishment Parts 217.7506 Spare parts breakout program. See PGI 217.7506 and DoD 4140.1-R, DoD Supply Chain Materiel Management Regulation, Chapter 8, Section C8.3, for spare parts breakout...

  18. 20 CFR 217.10 - Application filed after death. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Application filed after death. 217.10 Section... APPLICATION FOR ANNUITY OR LUMP SUM Applications § 217.10 Application filed after death. (a) A survivor... expenses dies before applying for the lump-sum death payment under part 234 of this chapter. The...

  19. 20 CFR 217.17 - Who may sign an application. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Who may sign an application. 217.17 Section... APPLICATION FOR ANNUITY OR LUMP SUM Filing An Application § 217.17 Who may sign an application. An application... (able to handle his or her own affairs), and physically able to sign the application, must sign in his...

  20. 40 CFR 98.217 - Records that must be retained. (United States)


    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Records that must be retained. 98.217... (CONTINUED) MANDATORY GREENHOUSE GAS REPORTING Miscellaneous Uses of Carbonate § 98.217 Records that must be retained. In addition to the records required by § 98.3(g), you must retain the records specified in...

  1. 22 CFR 217.42 - Admissions and recruitment. (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Admissions and recruitment. 217.42 Section 217... Admissions and recruitment. (a) General. Qualified handicapped persons may not, on the basis of handicap, be denied admission or be subjected to discrimination in admission or recruitment by a recipient to which...

  2. 31 CFR 0.217 - Personal financial interests. (United States)


    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Personal financial interests. 0.217... TREASURY EMPLOYEE RULES OF CONDUCT Rules of Conduct § 0.217 Personal financial interests. (a) Employees may... affect the integrity of an employee's service. ...

  3. 49 CFR 1542.217 - Law enforcement personnel. (United States)


    ... 49 Transportation 9 2010-10-01 2010-10-01 false Law enforcement personnel. 1542.217 Section 1542... ADMINISTRATION, DEPARTMENT OF HOMELAND SECURITY CIVIL AVIATION SECURITY AIRPORT SECURITY Operations § 1542.217 Law enforcement personnel. (a) Each airport operator must ensure that law enforcement personnel used...

  4. 30 CFR 217.301 - Lease account reconciliations. (United States)


    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Lease account reconciliations. 217.301 Section... MANAGEMENT AUDITS AND INSPECTIONS Geothermal Resources § 217.301 Lease account reconciliations. Specific lease account reconciliations will be performed with priority being given to reconciling those lease...

  5. 30 CFR 217.51 - Lease account reconciliation. (United States)


    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Lease account reconciliation. 217.51 Section... MANAGEMENT AUDITS AND INSPECTIONS Oil and Gas, General § 217.51 Lease account reconciliation. Specific lease account reconciliations shall be performed with priority being given to reconciling those lease accounts...

  6. An automated flow system incorporating in-line acid dissolution of bismuth metal from a cyclotron irradiated target assembly for use in the isolation of astatine-211

    Energy Technology Data Exchange (ETDEWEB)

    O’Hara, Matthew J.; Krzysko, Anthony J.; Niver, Cynthia M.; Morrison, Samuel S.; Owsley, Stanley L.; Hamlin, Donald K.; Dorman, Eric F.; Scott Wilbur, D.


    Astatine-211 (211At) is a promising cyclotron-produced radionuclide being investigated for use in targeted alpha therapy of blood borne and metastatic cancers, as well as treatment of tumor remnants after surgical resections. The isolation of trace quantities of 211At, produced within several grams of a Bi metal cyclotron target, involves a complex, multi-step procedure: (1) Bi metal dissolution in strong HNO3, (2) distillation of the HNO3 to yield Bi salts containing 211At, (3) dissolution of the salts in strong HCl, (4) solvent extraction of 211At from bismuth salts with diisopropyl ether (DIPE), and (5) back-extraction of 211At from DIPE into NaOH, leading to a purified 211At product. Step (1) has been addressed first to begin the process of automating the onerous 211At isolation process. A computer-controlled Bi target dissolution system has been designed. The system performs in-line dissolution of Bi metal from the target assembly using an enclosed target dissolution block, routing the resulting solubilized 211At/Bi mixture to the subsequent process step. The primary parameters involved in Bi metal solubilization (HNO3 concentration and influent flow rate) were optimized prior to evaluation of the system performance on replicate cyclotron irradiated targets. The results indicate that the system performs reproducibly, having nearly quantitative release of 211At from irradiated targets, with cumulative 211At recoveries that follow a sigmoidal function. The predictable nature of the 211At release profile allows the user to tune the system to meet target processing requirements.

  7. Reagents for astatination of biomolecules. 2. Conjugation of anionic boron cage pendant groups to a protein provides a method for direct labeling that is stable to in vivo deastatination. (United States)

    Wilbur, D Scott; Chyan, Ming-Kuan; Hamlin, Donald K; Vessella, Robert L; Wedge, Timothy J; Hawthorne, M Frederick


    Cancer-targeting biomolecules labeled with 211At must be stable to in vivo deastatination, as control of the 211At distribution is critical due to the highly toxic nature of alpha-particle emission. Unfortunately, no astatinated aryl conjugates have shown in vivo stability toward deastatination when (relatively) rapidly metabolized proteins, such as monoclonal antibody Fab' fragments, are labeled. As a means of increasing the in vivo stability of 211At-labeled proteins, we have been investigating antibody conjugates of boron cage moieties. In this investigation, protein-reactive derivatives containing a nido-carborane (2), a bis-nido-carborane derivative (Venus Flytrap Complex, 3), and four 2-nonahydro-closo-decaborate(2-) derivatives (4-7) were prepared and conjugated with an antibody Fab' fragment such that subsequent astatination and in vivo tissue distributions could be obtained. To aid in determination of stability toward in vivo deastatination, the Fab'-borane conjugates were also labeled with 125I, and that material was coinjected with the 211At-labeled Fab'. For comparison, direct labeling of the Fab' with 125I and 211At was conducted. Direct labeling with Na[125I]I and Chloramine-T gave an 89% radiochemical yield. However, direct labeling of the Fab' with Na[211At]At and Chloramine-T resulted in a yield of Studies to optimize the closo-decaborate(2-) conjugates for protein labeling are underway.

  8. Isomeric decay spectroscopy of the Bi217 isotope (United States)

    Gottardo, A.; Valiente-Dobón, J. J.; Benzoni, G.; Lunardi, S.; Gadea, A.; Algora, A.; Al-Dahan, N.; de Angelis, G.; Ayyad, Y.; Bazzacco, D.; Benlliure, J.; Boutachkov, P.; Bowry, M.; Bracco, A.; Bruce, A. M.; Bunce, M.; Camera, F.; Casarejos, E.; Cortes, M. L.; Crespi, F. C. L.; Corsi, A.; Denis Bacelar, A. M.; Deo, A. Y.; Domingo-Pardo, C.; Doncel, M.; Engert, T.; Eppinger, K.; Farrelly, G. F.; Farinon, F.; Farnea, E.; Geissel, H.; Gerl, J.; Goel, N.; Górska, M.; Grebosz, J.; Gregor, E.; Habermann, T.; Hoischen, R.; Janik, R.; John, P. R.; Klupp, S.; Kojouharov, I.; Kurz, N.; Lenzi, S. M.; Leoni, S.; Mandal, S.; Menegazzo, R.; Mengoni, D.; Million, B.; Modamio, V.; Morales, A. I.; Napoli, D. R.; Naqvi, F.; Nicolini, R.; Nociforo, C.; Pfützner, M.; Pietri, S.; Podolyák, Zs.; Prochazka, A.; Prokopowicz, W.; Recchia, F.; Regan, P. H.; Reed, M. W.; Rudolph, D.; Sahin, E.; Schaffner, H.; Sharma, A.; Sitar, B.; Siwal, D.; Steiger, K.; Strmen, P.; Swan, T. P. D.; Szarka, I.; Ur, C. A.; Walker, P. M.; Weick, H.; Wieland, O.; Wollersheim, H.-J.


    The structure of the neutron-rich bismuth isotope Bi217 has been studied for the first time. The fragmentation of a primary U238 beam at the FRS-RISING setup at GSI was exploited to perform γ-decay spectroscopy, since μs isomeric states were expected in this nucleus. Gamma rays following the decay of a t1/2=3 μs isomer were observed, allowing one to establish the low-lying structure of Bi217. The level energies and the reduced electric quadrupole transition probability B (E2) from the isomeric state are compared to large-scale shell-model calculations.

  9. Identification of genes directly regulated by the oncogene ZNF217using ChIP-chip assays.

    Energy Technology Data Exchange (ETDEWEB)

    Krig, S.R.; Jin, V.X.; Bieda, M.C.; O' geen, H.; Yaswen, P.; Green, R.; Farnham, P.J.


    It has been proposed that ZNF217, which is amplified at 20q13 in various tumors, plays a key role during neoplastic transformation. ZNF217 has been purified in complexes that contain repressor proteins such as CtBP2, suggesting that it acts as a transcriptional repressor. However, the function of ZNF217 has not been well characterized due to a lack of known target genes. Using a global chromatin immunoprecipitation (ChIP)-chip approach, we identified thousands of ZNF217 binding sites in three tumor cell lines (MCF7, SW480, and Ntera2). Further analysis of ZNF217 in Ntera2 cells showed that many promoters are bound by ZNF217 and CtBP2 and that a subset of these promoters are activated upon removal of ZNF217. Thus, our in vivo studies corroborate the in vitro biochemical analyses of ZNF217-containing complexes and support the hypothesis that ZNF217 functions as a transcriptional repressor. Gene ontology analysis showed that ZNF217 targets in Ntera2 cells are involved in organ development, suggesting that one function of ZNF217 may be to repress differentiation. Accordingly we show that differentiation of Ntera2 cells with retinoic acid led to down-regulation of ZNF217. Our identification of thousands of ZNF217 target genes will enable further studies of the consequences of aberrant expression of ZNF217 during neoplastic transformation.

  10. 27 CFR 9.217 - Happy Canyon of Santa Barbara. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Happy Canyon of Santa... Areas § 9.217 Happy Canyon of Santa Barbara. (a) Name. The name of the viticultural area described in this section is “Happy Canyon of Santa Barbara”. For purposes of part 4 of this chapter, “Happy Canyon...

  11. 36 CFR 2.17 - Aircraft and air delivery. (United States)


    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Aircraft and air delivery. 2... RESOURCE PROTECTION, PUBLIC USE AND RECREATION § 2.17 Aircraft and air delivery. (a) The following are prohibited: (1) Operating or using aircraft on lands or waters other than at locations designated pursuant to...

  12. 31 CFR 31.217 - Confidentiality of information. (United States)


    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Confidentiality of information. 31... RELIEF PROGRAM Conflicts of Interest § 31.217 Confidentiality of information. (a) Nonpublic information... shall take appropriate measures to ensure the confidentiality of nonpublic information and to prevent...

  13. 37 CFR 2.17 - Recognition for representation. (United States)


    ... or in good standing with the Canadian Intellectual Property Office, but not registered as a patent..., DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES Representation by Attorneys Or Other Authorized Persons § 2.17 Recognition for representation. (a) Authority to practice in trademark cases. Only an...

  14. 8 CFR 217.7 - Electronic data transmission requirement. (United States)


    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Electronic data transmission requirement... VISA WAIVER PROGRAM § 217.7 Electronic data transmission requirement. (a) An alien who applies for... manifest data relative to that alien passenger in accordance with 19 CFR 4.7b or 19 CFR 122.49a. Upon...

  15. 20 CFR 702.217 - Penalty for false statement, misrepresentation. (United States)


    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Penalty for false statement... PROCEDURE Claims Procedures Notice § 702.217 Penalty for false statement, misrepresentation. (a) Any..., or his dependents pursuant to section 9, 33 U.S.C. 909, if the injury results in death, shall be...

  16. 14 CFR 217.5 - Data collected (data elements). (United States)


    .... This code represents the industry designator as described in the appendix to § 217.10 of this part. A common private industry source of these industry designator codes is the Official Airline Guides (OAG... reporting the data. The carrier code is assigned by DOT. The Office of Airline Information (OAI'S) will...

  17. Zinc finger gene 217 (ZNF217) Promoted Ovarian Hyperstimulation Syndrome (OHSS) through Regulating E2 Synthesis and Inhibiting Thrombospondin-1 (TSP-1). (United States)

    Zhai, Junyu; Liu, Jiansheng; Cheng, Xiaoyue; Li, Shang; Hong, Yan; Sun, Kang; Chen, Zi-Jiang; Du, Yanzhi; Li, Weiping


    Zinc finger gene 217 (ZNF217) is a candidate gene of polycystic ovary syndrome (PCOS) which is vulnerable to ovarian hyperstimulation syndrome (OHSS). However, the relationship between ZNF217 and OHSS is largely unknown. Our study demonstrated that ZNF217 was mainly distributed in the granulosa cells of rat ovary. Significantly higher expression of ovarian ZNF217 was detected in OHSS rats, being consistent with serum 17β-estradiol concentration and ovarian aromatase. Moreover, OHSS rats also showed decreased ovarian TSP-1 mRNA, an acknowledged VEGF signaling suppressor. The same changes were detected in human granulosa cells and follicular fluid. Thus, the increased ZNF217 and decreased TSP-1 may participate in OHSS onset. In vitro experiment revealed that ZNF217 positively regulated E2 synthesis through promoting cAMP response element binding protein (CREB) and thereby CYP19A1 in KGN cells. Furthermore, ZNF217 negatively regulated TSP-1 in KGN cells while TSP-1 promoted claudin1 and inhibited nitric oxide (NO) in HUVECs and HAECs. Both of claudin1 and NO are responsible for the regulation of vascular permeability (VP). Therefore, we demonstrated that ZNF217 contributed to OHSS onset through promoting E2 synthesis and the increase of VP. Moreover, the increased ZNF217 and decreased TSP-1 provided new targets for the prevention or treatment of OHSS in the future.

  18. Dust Plasma Analogue for Interstellar 217.5 nm Extinction

    Directory of Open Access Journals (Sweden)

    Stefanović, I.


    Full Text Available The new ultraviolet (UV extinction measurements of carbonaceous nanoparticles in the range from 140 nm to 260 nm are presented. The plasma polymerized hydrocarbon nanoparticles were already proposed as a new astro analogue, which describe the infrared (IR extinction spectra in an excellent way. We use the same particles to find the possible carrier of the "mysterious" UV 217.5 nm extinction "bump" of interstellar media (ISM.

  19. 14 CFR 21.7 - Continued airworthiness and safety improvements for transport category airplanes. (United States)


    ... improvements for transport category airplanes. 21.7 Section 21.7 Aeronautics and Space FEDERAL AVIATION... § 21.7 Continued airworthiness and safety improvements for transport category airplanes. (a) On or... subchapter. (b) For new transport category airplanes manufactured under the authority of the FAA, the holder...

  20. 20 CFR 725.217 - Determination of dependency; surviving divorced spouse. (United States)


    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Determination of dependency; surviving divorced spouse. 725.217 Section 725.217 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION... Benefits) § 725.217 Determination of dependency; surviving divorced spouse. An individual who is the miner...

  1. ZNF217 is associated with poor prognosis and enhances proliferation and metastasis in ovarian cancer. (United States)

    Li, Jing; Song, Lanlin; Qiu, Yuwen; Yin, Ailan; Zhong, Mei


    ZNF217 is an alternatively spliced Kruppel-like transcription factor that has recently been implicated to play a role in human carcinogenesis. Here, we used immunohistochemistry (IHC) to show that ZNF217 protein is overexpressed in nearly 60% of ovarian tumor samples. The disease-free survival time was shorter in patients with positive ZNF217 expression than in ZNF217-negative patients (P=0.042). Fluorescence in situ hybridization (FISH) analysis showed ZNF217 genomic amplification in the poorly differentiated tumors, suggesting that ZNF217 is associated with the progression of ovarian cancer. Invasion was enhanced in HO-8910 cells stably transfected with constructs carrying full-length ZNF217 relative to cells transfected with the empty vector. To confirm our findings in vivo, we performed a tumorigenicity assay in nude mice inoculated with the HO-8910 overexpressing ZNF217 cells. As expected, tumors grown in the ZNF217 group were more invasive and prone to metastasis than those formed control groups. Based on these clinical and laboratory observations, we conclude that ZNF217 may contribute to ovarian cancer invasion and metastasis, and associated with worse clinical outcomes.

  2. Cigarette smoke mediates epigenetic repression of miR-217 during esophageal adenocarcinogenesis. (United States)

    Xi, S; Inchauste, S; Guo, H; Shan, J; Xiao, Z; Xu, H; Miettenen, M; Zhang, M R; Hong, J A; Raiji, M T; Altorki, N K; Casson, A G; Beer, D G; Robles, A I; Bowman, E D; Harris, C C; Steinberg, S M; Schrump, D S


    Although microRNAs (miRs) have been implicated in the pathogenesis of various human malignancies, limited information is available regarding mechanisms by which these noncoding RNAs contribute to initiation and progression of tobacco-induced esophageal cancers. In this study, array and quantitative reverse transcriptase-PCR techniques were used to examine miR expression in immortalized esophageal epithelia (IEE) and esophageal adenocarcinoma (EAC) cells cultured in normal media with or without cigarette smoke condensate (CSC). Under relevant exposure conditions, CSC significantly decreased miR-217 expression in these cells. Endogenous levels of miR-217 expression in cultured EAC cells (EACC)/primary EACs were significantly lower than those observed in IEE/ paired normal esophageal tissues. RNA crosslink immunoprecipitation, quantitative reverse transcriptase-PCR (qRT-PCR) and immunoblot experiments demonstrated direct interaction of miR-217 with kallikrein 7 (KLK7), encoding a putative oncogene not previously implicated in EAC. Repression of miR-217 correlated with increased levels of KLK7 in primary EACs, particularly those from smokers. Chromatin and methylated DNA immunoprecipitation experiments demonstrated that CSC-mediated repression of miR-217 coincided with DNMT3b-dependent hypermethylation and decreased occupancy of nuclear factor 1 within the miR-217 genomic locus. Deoxyazacytidine induced miR-217 expression and downregulated KLK7 in EACC; deoxyazacytidine also attenuated CSC-mediated miR-217 repression and upregulation of KLK7 in IEE and EACC. Overexpression of miR-217 significantly decreased, whereas overexpression of KLK7 increased proliferation, invasion and tumorigenicity of EACC. Collectively, these data demonstrate that epigenetic repression of miR-217 contributes to the pathogenesis of EAC via upregulation of KLK7 and suggest that restoration of miR-217 expression may be a novel treatment strategy for these malignancies.

  3. miR-217 suppresses proliferation and promotes apoptosis in cardiac myxoma by targeting Interleukin-6. (United States)

    Zhang, Jing; Wang, Cui; Xu, Huimin


    Cardiac myxoma (CM) is a prevalent primary cardiac tumor. miR-217 plays a vital role in tumorigenesis of various cancers, however, its role and underlying molecular mechanism in human CM remain poorly understood. Here, we reported that the expression of miR-217 was downregulated in CM tissues and inversely correlated with the expression of Interleukin-6 (IL-6) mRNA. Gain-of-function analysis indicated that overexpression of miR-217 inhibited the proliferation and promoted the apoptosis of the primary CM cells. Bioinformatics analysis showed that IL-6 was a direct target gene of miR-217, which is confirmed by the dual luciferase assays. Moreover, downregulation of IL-6 by small interference RNA (siRNA) mimicked the tumor-suppressive effects of miR-217 in CM. Furthermore, rescue experiments pointed out that restoration of IL-6 expression abrogated the anti-proliferative and pro-apoptotic effect induced by miR-217 overexpression in CM cells. Taken together, we validated that miR-217 could act as a tumor suppressor in CM by directly targeting 3'UTR of IL-6 gene, indicating that manipulation of miR-217 may be a potential therapeutic strategy for CM patients. Copyright © 2017 Elsevier Inc. All rights reserved.

  4. 48 CFR 217.175 - Multiyear contracts for electricity from renewable energy sources. (United States)


    ... electricity from renewable energy sources. 217.175 Section 217.175 Federal Acquisition Regulations System... renewable energy sources. (a) The head of the contracting activity may enter into a contract for a period not to exceed 10 years for the purchase of electricity from sources of renewable energy, as that term...

  5. 33 CFR 148.217 - How can a State be designated as an adjacent coastal State? (United States)


    ... concerning the risk of damage to the coastal environment of the State; and (4) Explain why the State believes the risk of damage to its coastal environment is equal to or greater than the risk to a State... an adjacent coastal State? 148.217 Section 148.217 Navigation and Navigable Waters COAST GUARD...

  6. 14 CFR 91.217 - Data correspondence between automatically reported pressure altitude data and the pilot's... (United States)


    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Data correspondence between automatically reported pressure altitude data and the pilot's altitude reference. 91.217 Section 91.217 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR TRAFFIC AND GENERAL...

  7. MiR-217 is down-regulated in psoriasis and promotes keratinocyte differentiation via targeting GRHL2

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Haigang; Hou, Liyue; Liu, Jingjing; Li, Zhiming, E-mail:


    MiR-217 is a well-known tumor suppressor, and its down-regulation has been shown in a wide range of solid and leukaemic cancers. However, the biological role of miR-217 in psoriasis pathogenesis, especially in keratinocyte hyperproliferation and differentiation, is not clearly understood. In this study, we found the expression of miR-217 was markedly down-regulated in psoriasis keratinocytes of psoriatic patients. In addition, overexpression of miR-217 inhibited the proliferation and promoted the differentiation of primary human keratinocytes. On the contrary, inhibition of endogenous miR-217 increased cell proliferation and delayed differentiation. Furthermore, Grainyhead-like 2 (GRHL2) was identified as a direct target of miR-217 by luciferase reporter assay. The expression of miR-217 and GRHL2 was inversely correlated in both transfected keratinocytes and in psoriasis lesional skin. Moreover, knocking down GRHL2 expression by siRNA enhanced keratinocyte differentiation. Taken together, our results demonstrate a role for miR-217 in the regulation of keratinocyte differentiation, partially through the regulation of GRHL2. - Highlights: • miR-217 is down-regulated in psoriasis skin lesions. • miR-217 inhibits the proliferation and promotes differentiation of keratinocytes. • GRHL2 is a novel target of miR-217 in keratinocytes. • GRHL2 is up-regulated and inversely correlated with miR-217 in psoriasis skin lesions.

  8. Learning the local Bayesian network structure around the ZNF217 oncogene in breast tumours. (United States)

    Prestat, Emmanuel; de Morais, Sérgio Rodrigues; Vendrell, Julie A; Thollet, Aurélie; Gautier, Christian; Cohen, Pascale A; Aussem, Alex


    In this study, we discuss and apply a novel and efficient algorithm for learning a local Bayesian network model in the vicinity of the ZNF217 oncogene from breast cancer microarray data without having to decide in advance which genes have to be included in the learning process. ZNF217 is a candidate oncogene located at 20q13, a chromosomal region frequently amplified in breast and ovarian cancer, and correlated with shorter patient survival in these cancers. To properly address the difficulties in managing complex gene interactions given our limited sample, statistical significance of edge strengths was evaluated using bootstrapping and the less reliable edges were pruned to increase the network robustness. We found that 13 out of the 35 genes associated with deregulated ZNF217 expression in breast tumours have been previously associated with survival and/or prognosis in cancers. Identifying genes involved in lipid metabolism opens new fields of investigation to decipher the molecular mechanisms driven by the ZNF217 oncogene. Moreover, nine of the 13 genes have already been identified as putative ZNF217 targets by independent biological studies. We therefore suggest that the algorithms for inferring local BNs are valuable data mining tools for unraveling complex mechanisms of biological pathways from expression data. The source code is available at∼aaussem/Software.html. Copyright © 2012 Elsevier Ltd. All rights reserved.

  9. Characterization and antimicrobial activity of bacteriocin 217 produced by natural isolate Lactobacillus paracasei subsp. paracasei BGBUK2-16. (United States)

    Lozo, Jelena; Vukasinovic, Maja; Strahinic, Ivana; Topisirovic, Ljubisa


    The strain Lactobacillus paracasei subsp. paracasei BGBUK2-16. which was isolated from traditionally homemade white-pickled cheese, produces bacteriocin 217 (Bac217; approximately 7 kDa). The onset of Bac217 biosynthesis was observed in the logarithmic phase of growth, and the production plateau was reached after 9 or 12 h of incubation at 37 and 30 degrees C, respectively, when culture entered the early stationary phase. Biochemical characterization showed that Bac217 retained antimicrobial activity within the range of pH 3 to 12 or after treatment at 100 degrees C for 15 min. Bac217 antimicrobial activity also remained unchanged after storage at 4 degrees C for 6 months or -20 degrees C for up to 12 months. However, Bac217 activity was completely lost after treatment with different proteolytic enzymes. BGBUK2-16 contains only one plasmid about 80 kb in size. Plasmid curing indicated that genes coding for Bac217 synthesis and immunity seem to be located on this plasmid. Bac217 exhibited antimicrobial activity against some pathogenic bacteria, such as Staphylococcus aureus and Bacillus cereus. Interestingly, Bac217 showed activity against Salmonella sp. and Pseudomonas aeruginosa ATCC27853. The inhibitory effect of BGBUK2-16 on the growth of S. aureus in mixed culture was observed. S. aureus treatment with Bac217 led to a considerable decrease (CFU/ml) within a short period of time. The mode of Bac217 action on S. aureus was identified as bactericidal. It should be noted that the strain BGBUK2-16 was shown to be resistant to bacteriocin nisin, which is otherwise widely used as a food additive for fermented dairy products.

  10. Yeast Interacting Proteins Database: YHR114W, YDL217C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available y (0) YDL217C TIM22 Component of the mitochondrial Tim54p-Tim22p complex involved in insertion of polytopi...rey gene name TIM22 Prey description Component of the mitochondrial Tim54p-Tim22p complex involved in insertion of polytopic

  11. 20 CFR 217.7 - Claim filed with the Social Security Administration. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Claim filed with the Social Security... RETIREMENT ACT APPLICATION FOR ANNUITY OR LUMP SUM Applications § 217.7 Claim filed with the Social Security... social security application was filed. (3) The applicant asks the Board in a written statement to...

  12. 14 CFR 302.217 - Exceptions to administrative law judge's initial or recommended decision. (United States)


    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Exceptions to administrative law judge's..., DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) PROCEDURAL REGULATIONS RULES OF PRACTICE IN PROCEEDINGS... Disposition of Applications § 302.217 Exceptions to administrative law judge's initial or recommended decision...

  13. 31 CFR 535.217 - Blocking of property of the former Shah of Iran and of certain other Iranian nationals. (United States)


    ... in the control of the estate of Mohammad Reza Pahlavi, the former Shah of Iran, or any close relative... Shah of Iran and of certain other Iranian nationals. 535.217 Section 535.217 Money and Finance... former Shah of Iran and of certain other Iranian nationals. (a) For the purpose of protecting the rights...

  14. The MicroRNA-217 Functions as a Potential Tumor Suppressor in Gastric Cancer by Targeting GPC5.

    Directory of Open Access Journals (Sweden)

    Hui Wang

    Full Text Available Gastric cancer (GC is one of the most common malignancies worldwide. Emerging evidence has shown that aberrant expression of microRNAs (miRNAs plays important roles in cancer progression. However, little is known about the potential role of miR-217 in GC. In this study, we investigated the role of miR-217 on GC cell proliferation and invasion. The expression of miR-217 was down-regulated in GC cells and human GC tissues. Enforced expression of miR-217 inhibited GC cells proliferation and invasion. Moreover, Glypican-5 (GPC5, a new ocncogene, was identified as the potential target of miR-217. In addition, overexpression of miR-217 impaired GPC5-induced promotion of proliferation and invasion in GC cells. In conclusion, these findings revealed that miR-217 functioned as a tumor suppressor and inhibited the proliferation and invasion of GC cells by targeting GPC5, which might consequently serve as a therapeutic target for GC patients.

  15. miR-217 inhibits triple-negative breast cancer cell growth, migration, and invasion through targeting KLF5.

    Directory of Open Access Journals (Sweden)

    Wenhui Zhou

    Full Text Available Triple negative breast cancer (TNBC is one of the most aggressive breast cancers without effective targeted therapies. Numerous studies have implied that KLF5 plays an important roles in TNBC. How is KLF5 regulated by microRNAs has not been well studied. Here, we demonstrated that miR-217 down-regulates the expression of KLF5 and KLF5's downstream target gene FGF-BP and Cyclin D1 in TNBC cell lines HCC1806 and HCC1937. Consequently, miR-217 suppresses TNBC cell growth, migration, and invasion. MiR-217 suppresses TNBC, at least partially, through down-regulating the KLF5 expression. These results suggest that the miR-217-KLF5 axis might serve as a potential target for treatment of TNBC.

  16. Panel 2.17: private commercial sector partnerships for health action in crises. (United States)

    Sundnes, Knut Ole; Sannerkvist, Milan; Hedger, Philip; Woodworth, Brent; Hyre, Anne; Cuddyre, Terrence; Waldman, Ronald


    This is a summary of the presentations and discussion of Panel 2.17, Private Commercial Sector Partnerships for Health Action in Crises of the Conference, Health Aspects of the Tsunami Disaster in Asia, convened by the World Health Organization (WHO) in Phuket, Thailand, 04-06 May 2005. The topics discussed included issues related to private sector partnerships for health action in crises as pertain to the responses to the damage created by the Tsunami. It is presented in the following sections: (1) key questions; (2) issues and challenges; (3) lessons learned; (4) what was done well?; (5) what could have been done better?; and (6) conclusions and recommendations.

  17. EFSA CEF Panel (EFSA Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids), 2013. Scientific Opinion on Flavouring Group Evaluation 217, Revision 1 (FGE.217Rev1). Consideration of genotoxic potential for α,β-Unsaturated ketones and precursors from chemical subgroup 4.1 of FGE, .19: Lactones

    DEFF Research Database (Denmark)

    Beltoft, Vibe Meister; Binderup, Mona-Lise; Lund, Pia

    The Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids of the European Food Safety Authority was requested to evaluate the genotoxic potential of 12 flavouring substances from subgroup 4.1 of FGE.19 in the Flavouring Group Evaluation 217 (FGE.217). In FGE.217, 6-methylcouma...

  18. HL-217, a new topical anti-angiogenic agent, inhibits retinal vascular leakage and pathogenic subretinal neovascularization in Vldlr{sup −/−} mice

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Junghyun; Kim, Chan-Sik; Jo, Kyuhyung [Korean Medicine Based Herbal Drug Development Group, Herbal Medicine Research Division, Korea Institute of Oriental Medicine, Daejeon (Korea, Republic of); Cho, Yun-Seok; Kim, Hyun-Gyu; Lee, Geun-Hyeog [Research and Development Center, Hanlim Pharm. Co. Ltd., 1656-10, Seocho-dong, Seocho-gu, Seoul (Korea, Republic of); Lee, Yun Mi; Sohn, Eunjin [Korean Medicine Based Herbal Drug Development Group, Herbal Medicine Research Division, Korea Institute of Oriental Medicine, Daejeon (Korea, Republic of); Kim, Jin Sook, E-mail: [Korean Medicine Based Herbal Drug Development Group, Herbal Medicine Research Division, Korea Institute of Oriental Medicine, Daejeon (Korea, Republic of)


    Highlights: • HL-217 is a new synthetic topical anti-angiogenic agent. • HL-217 attenuated subretinal neovascularization in Vldlr{sup −/−} mice. • HL-217 blocked the binding of PDGF-BB to PDGFRβ. - Abstract: HL-217 is a new synthetic angiogenesis inhibitor. Platelet derived growth factor (PDGF) is a vasoactive factor and has been implicated in proliferative retinopathies. In this study, we examined the mechanism of action and efficacy of topical application of HL-217 on subretinal neovascularization in very low-density lipoprotein receptor knockout (Vldlr{sup −/−}) mice. In three-week-old male Vldlr{sup −/−} mice, HL-217 (1.5 or 3 mg/ml) was administered twice per day for 4 weeks by topical eye drop instillation. Neovascular areas were then measured. We used a protein array to evaluate the expression levels of angiogenic factors. The inhibitory effect of HL-217 on the PDGF-BB/PDGFRβ interaction was evaluated in vitro. The neovascular area in the Vldlr{sup −/−} mice was significantly reduced by HL-217. Additionally, HL-217 decreased the expression levels of PDGF-BB protein and VEGF mRNA. Moreover, HL-217 dose-dependently inhibited the PDGF-BB/PDGFRβ interaction (IC{sub 50} = 38.9 ± 0.7 μM). These results suggest that HL-217 is a potent inhibitor of PDGF-BB. HL-217, when applied topically, is an effective inhibitor of subretinal neovascularization due to its ability to inhibit the pro-angiogenic effects of PDGF-BB.

  19. Quem é a vítima menor de 14 anos tutelada pelo art. 217-A?


    Shinmi, Marina Vatanabe


    Resumo: A lei 12.015/09 foi responsável por diversas alterações no Título VI, do Código Penal, agora denominado "Crimes contra a dignidade sexual". Partindo da análise do Código de 1940, se faz necessário o estudo da figura da violência presumida para adentrar no cerne dessa contenda, o novo tipo penal autônomo "estupro de vulnerável", criado pelo art. 217-A. Observa-se que tanto na doutrina quanto na jurisprudência a vulnerabilidade dos menores de 14 anos é relativizada. O ponto nevrálgico d...

  20. Health and relationships with leisure time activities in Swedish children aged 2-17 years. (United States)

    Berntsson, Leeni T; Ringsberg, Karin C


    Three cross-sectional time series studies, randomised and stratified for age and gender, were performed on children aged 2-17, studying their health and well-being. The studies were performed in the Nordic countries in 1984, 1996 and 2011. Long-term illness (LTI) and psychosomatic complaints (PSC) increased during the period. Data were collected from mailed questionnaires. Data of 1461 Swedish children from 2011 were used and compared with data from 1984 and 1996. Relationships between the health indicators (the absence of LTI, 13 diagnoses, the absence of PSC, six symptoms, six items of well-being) and 12 activities were analysed. A total of 83.2% of the children were healthy and 16.8% had at least one LTI, boys 19.1% and girls 14.5%. PSC increased from 18.6% in 1996 to 23.1% in 2011. The distribution was higher in girls. Girls were more active than boys during leisure time. 'Reading books', 'visiting friends', 'listening to music' and 'activity in organisations' were related to an absence of PSC, LTI and well-being. 'Surfing/blogging on the Internet' was negatively related to LTI, PSC and well-being. Multiple regression showed that that 'visits or is visited by friends' was related with a low probability for LTI and also with a high probability for well-being. In the logistic regression analyses, the following variables were seen as promoting health most: 'visits or is visited by friends' and 'is active in organizations' for children aged 2-17 years, especially for boys and well-being. The health of Swedish children declined between 1984 and 2011. Positive relationships were found between some activities and health as well as other activities related to ill health. The results suggest an increased focus on the activities that have positive relationships with health in order to promote health among children. © 2013 Nordic College of Caring Science.

  1. MicroRNA-217 suppresses homocysteine-induced proliferation and migration of vascular smooth muscle cells via N-methyl-D-aspartic acid receptor inhibition. (United States)

    Duan, Hongyan; Li, Yongqiang; Yan, Lijie; Yang, Haitao; Wu, Jintao; Qian, Peng; Li, Bing; Wang, Shanling


    Hyperhomocysteine has become a critical risk for atherosclerosis and can stimulate proliferation and migration of vascular smooth muscle cells (VSMCs). N-methyl-D-aspartic acid receptor (NMDAR) is a receptor of homocysteine and mediates the effects of homocysteine on VSMCs. Bioinformatics analysis has shown NMDAR is a potential target of microRNA-217 (miR-217), which exerts multiple functions in cancer tumorigenesis and carotid plaque progression. In this study, we sought to investigate the role of miR-217 in VSMCs phenotype transition under homocysteine exposure and elucidate its effect on atherosclerotic plaque formation. After treating with several doses of homocysteine (0-8 × 10(-4)  mol/L) for 24 hours, the expression of miR-217 in HA-VSMCs and rat aortic VSMCs was not altered. Intriguingly, the expression of NMDAR mRNA and protein was reduced by homocysteine in a dose-dependent manner. Transfection of miR-217 mimic significantly inhibited the proliferation and migration of VSMCs with homocysteine treatment, while transfection of miR-217 inhibitor promoted VSMCs migration. Moreover, miR-217 mimic down-regulated while miR-217 inhibitor up-regulated NMDAR protein expression but not NMDAR mRNA expression. Through luciferase reporter assay, we showed that miR-217 could directly bind to the 3'-UTR of NMDAR. MiR-217 mimic transfection also released the inhibition of cAMP-response element-binding protein (CREB)-PGC-1α signalling induced by homocysteine. Additionally, restoration of PGC-1α expression via AdPGC-1α infection markedly suppressed VSMCs proliferation through the degradation of NADPH oxidase (NOX1) and reduction of reactive oxygen species (ROS). Collectively, our study identified the role of miR-217 in regulating VSMCs proliferation and migration, which might serve as a target for atherosclerosis therapy. © 2016 John Wiley & Sons Australia, Ltd.

  2. 19 CFR 351.217 - Reviews to implement results of subsidies enforcement proceeding under section 751(g) of the Act. (United States)


    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Reviews to implement results of subsidies... Countervailing Duty Procedures § 351.217 Reviews to implement results of subsidies enforcement proceeding under... ongoing countervailing duty proceeding the results of certain subsidy-related disputes under the WTO...

  3. 5 CFR 792.217 - Are part-time Federal employees eligible for the child care subsidy program? (United States)


    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Are part-time Federal employees eligible... the Child Care Subsidy Program Legislation and to Whom Does It Apply? § 792.217 Are part-time Federal employees eligible for the child care subsidy program? Federal employees who work part-time are eligible for...

  4. miR-216 and miR-217 expression is reduced in transgenic mouse models of pancreatic adenocarcinoma, knockout of miR-216/miR-217 host gene is embryonic lethal. (United States)

    Azevedo-Pouly, Ana Clara P; Sutaria, Dhruvitkumar S; Jiang, Jinmai; Elgamal, Ola A; Amari, Foued; Allard, David; Grippo, Paul J; Coppola, Vincenzo; Schmittgen, Thomas D


    Mice harboring a G12D activating Kras mutation are among the most heavily studied models in the field of pancreatic adenocarcinoma (PDAC) research. miRNAs are differentially expressed in PDAC from patients and mouse models of PDAC. To better understand the relationship that Kras activation has on miRNA expression, we profiled the expression of 629 miRNAs in RNA isolated from the pancreas of control, young, and old P48(+/Cre);LSL-KRAS(G12D) as well as PDX-1-Cre;LSL-KRAS(G12D) mice. One hundred of the differentially expressed miRNAs had increased expression in the advanced disease (old) P48(+/Cre);LSL-KRAS(G12D) compared to wild-type mice. Interestingly, the expression of three miRNAs, miR-216a, miR-216b, and miR-217, located within a ∼30-kbp region on 11qA3.3, decreased with age (and phenotype severity) in these mice. miR-216/-217 expression was also evaluated in another acinar-specific ELa-Kras(G12D) mouse model and was downregulated as well. As miR-216/-217 are acinar enriched, reduced in human PDAC and target KRAS, we hypothesized that they may maintain acinar differentiation or represent tumor suppressive miRNAs. To test this hypothesis, we deleted a 27.9-kbp region of 11qA3.3 containing the miR-216/-217 host gene in the mouse's germ line. We report that germ line deletion of this cluster is embryonic lethal in the mouse. We estimate that lethality occurs shortly after E9.5. qPCR analysis of the miR-216b and miR-217 expression in the heterozygous animals showed no difference in expression, suggesting haplosufficiency by some type of compensatory mechanism. We present the differential miRNA expression in Kras(G12D) transgenic mice and report lethality from deletion of the miR-216/-217 host gene in the mouse's germ line.

  5. [Physician Assisted Suicide - Survey on § 217 StGB in Germany]. (United States)

    Zenz, Julia; Rissing-van Saan, Ruth; Zenz, Michael


    Background In late 2015, Germany passed a law (§ 217 StGB) prohibiting persons from aiding others in committing suicide on a regular, repetitive basis. Despite intensive societal debate and surveys about assisted dying, the present study was the first to examine attitudes towards the new legal regulation among professionals. Methods In early 2016, all participants of a congress on palliative care received a one-page anonymous questionnaire to complete until the end of the conference. The questionnaire consisted of questions regarding assisted suicide and the new law. The participants were asked to express their agreement or disagreement on a 4 to 5-point Likert scale. Results 457 questionnaires (48 %) were completed, 138 from physicians, 318 from nurses, 1 non specified. More than 80 % knew about the new law. Only half of the respondents supported it. 54 % felt that the law did not sufficiently differentiate between an illegal form of assisted suicide and a form exempt from prosecution. For more than 40 % the new law made no sense. Conclusion Professionals engaged in terminal care were reluctant to support a criminal liability of "business-like" physician-assisted suicide and suspected greater uncertainty among professionals in end of life care. © Georg Thieme Verlag KG Stuttgart · New York.

  6. RANS based CFD methodology for a real scale 217-pin wire-wrapped fuel assembly of KAERI PGSFR

    Energy Technology Data Exchange (ETDEWEB)

    Jeong, Jae-Ho, E-mail: [Korea Atomic Energy Research Institute, 989-111 Daedeok-daero, Yuseoung-gu, Daejeon (Korea, Republic of); Song, Min-Seop [Department of Nuclear Engineering, Seoul National University, 559 Gwanak-ro, Gwanak-gu, Seoul (Korea, Republic of); Lee, Kwi-Lim [Korea Atomic Energy Research Institute, 989-111 Daedeok-daero, Yuseoung-gu, Daejeon (Korea, Republic of)


    Highlights: • This paper presents a suitable way for a practical RANS based CFD methodology which is applicable to real scale 217-pin wire-wrapped fuel assembly of KAERI PGSFR. • A key point of differentiation of the RANS based CFD methodology in this study is adapting an innovative grid generation method using a fortran based in-house code with a GGI function in a general-purpose commercial CFD code, CFX. • The RANS based CFD methodology is implemented with high resolution scheme and SST turbulence model in the 7-pin 37-pin, and 127-pin wire-wrapped fuel assembly of PNC and JNC. Furthermore, the RANS based CFD methodology can be successfully extended to the real scale 217-pin wire-wrapped fuel bundles of KAERI PGSFR. • Three-dimensional thermal-hydraulic characteristics have been also investigated briefly. - Abstract: This paper presents a suitable way for a practical RANS (Reynolds Averaged Navier-Stokes simulation) based CFD (Computational Fluid Dynamics) methodology which is applicable to real scale 217-pin wire-wrapped fuel assembly of KAERI (Korea Atomic Energy Research Institute) PGSFR (Prototype Gen-IV Sodium-cooled Fast Reactor). The main purpose of the current study is to support license issue for the KAERI PGSFR core safety and to elucidate thermal-hydraulic characteristics in a 217-pin wire-wrapped fuel assembly of KAERI PGSFR. A key point of differentiation of the RANS based CFD methodology in this study is adapting an innovative grid generation method using a fortran based in-house code with a GGI (General Grid Interface) function in a general-purpose commercial CFD code, CFX. The innovative grid generation method with GGI function can achieve to simulate a real wire shape with minimizing cell skewness. The RANS based CFD methodology is implemented with high resolution scheme in convection term and SST (Shear Stress Transport) turbulence model in the 7-pin 37-pin, and 127-pin wire-wrapped fuel assembly of PNC (Power reactor and Nuclear fuel

  7. A computer program to generate equations of motion matrices, L217 (EOM). Volume 1: Engineering and usage (United States)

    Kroll, R. I.; Clemmons, R. E.


    The equations of motion program L217 formulates the matrix coefficients for a set of second order linear differential equations that describe the motion of an airplane relative to its level equilibrium flight condition. Aerodynamic data from FLEXSTAB or Doublet Lattice (L216) programs can be used to derive the equations for quasi-steady or full unsteady aerodynamics. The data manipulation and the matrix coefficient formulation are described.

  8. Bloodstream infection following 217 consecutive systemic-enteric drained pancreas transplants

    Directory of Open Access Journals (Sweden)

    Mark Walter


    Full Text Available Abstract Background Combined kidney pancreas transplantation (PTx evolved as excellent treatment for diabetic nephropathy. Infections remain common and serious complications. Methods 217 consecutive enteric drained PTxs performed from 1997 to 2004 were retrospectively analyzed with regard to bloodstream infection. Immunosuppression consisted of antithymocyteglobuline induction, tacrolimus, mycophenolic acid and steroids for the majority of cases. Standard perioperative antimicrobial prophylaxis consisted of pipercillin/tazobactam in combination with ciprofloxacin and fluconazole. Results One year patient, pancreas and kidney graft survival were 96.4%, 88.5% and 94.8%, surgical complication rate was 35%, rejection rate 30% and rate of infection 59%. In total 46 sepsis episodes were diagnosed in 35 patients (16% with a median onset on day 12 (range 1–45 post transplant. Sepsis source was intraabdominal infection (IAI (n = 21, a contaminated central venous line (n = 10, wound infection (n = 5, urinary tract infection (n = 2 and graft transmitted (n = 2. Nine patients (4% experienced multiple episodes of sepsis. Overall 65 pathogens (IAI sepsis 39, line sepsis 15, others 11 were isolated from blood. Gram positive cocci accounted for 50 isolates (77%: Coagulase negative staphylococci (n = 28, i.e. 43% (nine multi-resistant, Staphylococcus aureus (n = 11, i.e. 17% (four multi-resistant, enterococci (n = 9, i.e. 14% (one E. faecium. Gram negative rods were cultured in twelve cases (18%. Patients with blood borne infection had a two year pancreas graft survival of 76.5% versus 89.4% for those without sepsis (p = 0.036, patient survival was not affected. Conclusion Sepsis remains a serious complication after PTx with significantly reduced pancreas graft, but not patient survival. The most common source is IAI.

  9. Host MicroRNA-217 Promotes White Spot Syndrome Virus Infection by Targeting Tube in the Chinese Mitten Crab (Eriocheir sinensis

    Directory of Open Access Journals (Sweden)

    Ying Huang


    Full Text Available MicroRNAs (miRNAs, a group of small molecule non-encoding RNAs, are key post-transcriptional regulators of gene expression that are implicated in many biological processes. In the current study, miR-217 from Eriocheir sinensis was selected for studying its roles during host–virus interaction. Overexpression or silencing of miR-217 led to considerable effects on white spot syndrome virus (WSSV replication, implying that miR-217 played a positive role in WSSV infection. In insect High Five cells, miR-217 significantly inhibited Tube gene expression by binding to the 3′-untranslated region of the Tube. Overexpression of miR-217 in crab led to downregulation of tube expression. Knockdown of Tube in vivo led to significant enhancement of WSSV infection and inhibited the expression of five antimicrobial peptide (AMP genes (Anti-lipopolysaccharide factor ALF1, ALF2, ALF3; Crustin Crus1, Crus2 in WSSV-challenged crabs. Overexpression of miR-217 also led to downregulation of these AMP genes in WSSV-challenged crabs. Our results showed that host miRNA played positive roles in virus infection by regulation of host tube gene, which is the key component of Toll signaling pathway.

  10. The eukaryotic translation elongation factor eEF1A2 induces neoplastic properties and mediates tumorigenic effects of ZNF217 in precursor cells of human ovarian carcinomas

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Yu; Wong, Nicholas; Guan, Yinghui; Salamanca, Clara M.; Cheng, Jung Chien; Lee, Jonathan M.; Gray, Joe W.; Auersperg, Nelly


    Ovarian epithelial carcinomas (OEC) frequently exhibit amplifications at the 20q13 locus which is the site of several oncogenes, including the eukaryotic elongation factor EEF1A2 and the transcription factor ZNF217. We reported previously that overexpressed ZNF217 induces neoplastic characteristics in precursor cells of OEC. Unexpectedly, ZNF217, which is a transcriptional repressor, enhanced expression of eEF1A2. In this study, array comparative genomic hybridization, single nucleotide polymorphism and Affymetrix analysis of ZNF217-overexpressing cell lines confirmed consistently increased expression of eEF1A2 but not of other oncogenes, and revealed early changes in EEF1A2 gene copy numbers and increased expression at crisis during immortalization. We defined the influence of eEF1A2 overexpression on immortalized ovarian surface epithelial cells, and investigated interrelationships between effects of ZNF217 and eEF1A2 on cellular phenotypes. Lentivirally induced eEF1A2 overexpression caused delayed crisis, apoptosis resistance and increases in serum-independence, saturation densities, and anchorage independence. siRNA to eEF1A2 reversed apoptosis resistance and reduced anchorage independence in eEF1A2-overexpressing lines. Remarkably, siRNA to eEF1A2 was equally efficient in inhibiting both anchorage independence and resistance to apoptosis conferred by ZNF217 overexpression. Our data define neoplastic properties that are caused by eEF1A2 in nontumorigenic ovarian cancer precursor cells, and suggest that eEF1A2 plays a role in mediating ZNF217-induced neoplastic progression.

  11. Efficacy and safety of a 21/7-active combined oral contraceptive with continuous low-dose ethinyl estradiol. (United States)

    Kroll, Robin; Ackerman, Ronald; Feldman, Robert; Howard, Brandon; Weiss, Herman; Hsieh, Jennifer; Ricciotti, Nancy


    Substituting low-dose ethinyl estradiol (EE) for the hormone-free interval in combined oral contraceptives (COCs) may enhance ovarian suppression and improve tolerability. This noncomparative phase 3 study evaluated the efficacy and safety of a 21/7-active COC regimen including 21days of desogestrel (DSG)/EE followed by 7days of EE. This multicenter, open-label, phase 3, single-arm study enrolled sexually active women aged 18-40years at risk for pregnancy. Women received up to 1year, or 13 consecutive 28-day cycles, of DSG 150mcg/EE 20mcg for 21days and EE 10mcg alone for 7days. Participants kept diaries to record compliance, bleeding/spotting and other contraceptive use. Efficacy was measured using the Pearl Index (PI) and life-table approach. Safety and tolerability were assessed primarily through reported adverse events (AEs). A total of 2858 women enrolled and 1680 completed the study. Forty-six pregnancies in 2401 women aged 18-35years occurred after COC initiation and up to 7days after last DSG/EE or EE-only tablet was taken. When cycles in which another contraceptive method was used were excluded, the PI was 2.68 [95% confidence interval (CI), 1.96-3.57]. The cumulative pregnancy rate after 1year of treatment was 2.47% (95% CI, 1.85-3.29) for all users aged 18-35years. When only cycles during which women considered compliant were included, the PI was 2.00 (95% CI, 1.39-2.80). AEs were similar to those seen with other oral contraceptives. This 21/7-active DSG/EE COC with 7days of low-dose EE was efficacious and well tolerated for pregnancy prevention. This phase 3 open-label study demonstrated that a 21/7-active COC regimen including 21days of DSG 150mcg/EE 20mcg and 7days of EE 10mcg was efficacious and well tolerated for pregnancy prevention. Copyright © 2016 Elsevier Inc. All rights reserved.

  12. [Usefulness of stratigraphy and computerized tomography in the initial staging of osteosarcoma of the extremities. Retrospective study of 217 cases]. (United States)

    Pelotti, P; Ciminari, R; Bacci, G; Avella, M; Briccoli, A


    The value of stratigraphy and pulmonary CT in the initial work-up of osteosarcoma of the extremities is assessed with reference to 217 patients encountered in the Bone Tumour Centre of Rizzoli Orthopaedic Institute in May 1983-May 1986. Stratigraphy revealed lung metastases not identified by standard radiography in 4 patients (1.8%), while CT revealed metastases not identified by either standard X-rays or stratigraphy in a further 6 cases (2.7%). It is concluded that the increase in the percentage of cures (about 30%) reported in the last 10 years in osteosarcoma cases given adjuvant chemotherapy cannot be explained by any difference in initial selection due to the use of these techniques that were not adopted in the historical series.

  13. Swedish parents' activities together with their children and children's health: a study of children aged 2-17 years. (United States)

    Berntsson, Leeni T; Ringsberg, Karin C


    Nordic children's health has declined. Studies show that parents' engagement in children's leisure-time activities might provide beneficial health outcomes for children. The aim of the present study was to examine the association between Swedish parents' activities together with their children, the parents' experiences of time pressure and their children's health. Data of 1461 Swedish children aged 2-17 years old that were collected in the NordChild study of 2011 were used. We analyzed physical health, diseases and disabilities, psychosomatic health and well-being, and the parents' experiences of time pressure; and we calculated the associations between parental activity together with the child and health indicators. Activities that were significantly and positively associated with children's health at ages 2-17 years of age were: playing and playing games; going to the cinema, theatre, and sporting events; reading books; playing musical instruments/singing; sports activities; watching TV/video/DVD. Playing video games or computer games, driving child to activities and going for walks were significantly and positively associated at age groups 7-12 years and 13-17 years. Activities that were negatively associated with health were: surfing/blogging on the Internet, going shopping and doing homework. Parents who were not experiencing time pressures had a higher level of activity together with their children. The parental experience of time pressure was associated with work time, with less homework activity and more symptoms in children. The family and home are important settings for the development of children's health we found eight parental activities together with their children that promoted the children's health parents' working time and their time pressure experiences affected their activities with their children there is a need for an increased focus on parental activities that are positively associated with children's health. © 2014 the Nordic Societies of

  14. Activity and expression of acetylcholinesterase in PC12 cells exposed to intermittent 1.8 GHz 217-GSM mobile phone signal. (United States)

    Valbonesi, Paola; Franzellitti, Silvia; Bersani, Ferdinando; Contin, Andrea; Fabbri, Elena


    Due to its role in learning, memory and in many neurodegenerative diseases, acetylcholinesterase (AChE) represents an interesting endpoint to assess possible targets of exposure to radiofrequency electromagnetic fields (RF-EMF) generated by mobile phones. We investigated possible alterations of enzymatic activity, gene and protein expression of AChE in neuronal-like cells exposed to a 1.8 GHz Global System for Mobile Communication (GSM) modulated signal (217-GSM). Rat PC12 cells were exposed for 24 h to 1.8 GHz 217-GSM signal. Specific adsorption rate (SAR) was 2 W/kg. AChE enzyme activity was assessed spectrophotometrically by Ellman's method, mRNA expression level was evaluated by real time polymerase chain reaction, and protein expression was assessed by Western blotting. AChE enzymatic activity increased of 1.4-fold in PC12 cells exposed to 217-GSM signal for 24 h, whilst AChE transcriptional or translational pathways were not affected. Our results provide the first evidence of effects on AChE activity after in vitro exposure of mammalian cells to the RF-EMF generated by GSM mobile phones, at the SAR value 2 W/kg. The obtained evidence promotes further investigations on AChE as a possible target of RF-EMF and confirm the ability of 1.8 GHz 217-GSM signal to induce biological effects in different mammalian cells.

  15. Activation of Na+-K+-ATPase with DRm217 attenuates oxidative stress-induced myocardial cell injury via closing Na+-K+-ATPase/Src/Ros amplifier. (United States)

    Yan, Xiaofei; Xun, Meng; Dou, Xiaojuan; Wu, Litao; Zhang, Fujun; Zheng, Jin


    Reduced Na+-K+-ATPase activity has close relationship with cardiomyocyte death. Reactive oxygen species (ROS) also plays an important role in cardiac cell damage. It has been proved that Na+-K+-ATPase and ROS form a feed-forward amplifier. The aim of this study was to explore whether DRm217, a proved Na+/K+-ATPase's DR-region specific monoclonal antibody and direct activator, could disrupt Na+-K+-ATPase/ROS amplifier and protect cardiac cells from ROS-induced injury. We found that DRm217 protected myocardial cells against hydrogen peroxide (H2O2)-induced cardiac cell injury and mitochondrial dysfunction. DRm217 also alleviated the effect of H2O2 on inhibition of Na+-K+-ATPase activity, Na+-K+-ATPase cell surface expression, and Src phosphorylation. H2O2-treatment increased intracellular ROS, mitochondrial ROS and induced intracellular Ca2+, mitochondrial Ca2+ overload. DRm217 closed Na+-K+-ATPase/ROS amplifier, alleviated Ca2+ accumulation and finally inhibited ROS and mitochondrial ROS generation. These novel results may help us to understand the important role of the Na+-K+-ATPase in oxidative stress and oxidative stress-related disease.

  16. Regulatory Assistance, Stakeholder Outreach, and Coastal and Marine Spatial Planning Activities In Support Marine and Hydrokinetic Energy Deployment: Task 2.1.7 Permitting and Planning Fiscal Year 2012 Year-End Report

    Energy Technology Data Exchange (ETDEWEB)

    Geerlofs, Simon H. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hanna, Luke A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Judd, Chaeli R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Blake, Kara M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)


    This fiscal year 2012 year-end report summarizes activities carried out under DOE Water Power task 2.1.7, Permitting and Planning. Activities under Task 2.1.7 address the concerns of a wide range of stakeholders with an interest in the development of the MHK industry, including regulatory and resource management agencies, tribes, NGOs, and industry.

  17. The Planck-ATCA Co-eval Observations project: analysis of radio source properties between 5 and 217 GHz (United States)

    Massardi, Marcella; Bonaldi, Anna; Bonavera, Laura; De Zotti, Gianfranco; Lopez-Caniego, Marcos; Galluzzi, Vincenzo


    The Planck-ATCA Co-eval Observations (PACO) project has yielded observations of 464 sources with the Australia Telescope Compact Array (ATCA) between 4.5 and 40 GHz. The main purpose of the project was to investigate the spectral properties of mm-selected radio sources at frequencies below and overlapping with the ESA's Planck satellite frequency bands, minimizing the variability effects by observing almost simultaneously with the first two Planck all-sky surveys. In this paper we present the whole catalogue of observations in total intensity. By comparing PACO with the various measures of Planck Catalog of Compact Sources (PCCS) flux densities we found the best consistency with the PCCS `detection pipeline' photometry (DETFLUX) that we used to investigate the spectral properties of sources from 5 to 217 GHz. Of our sources, 91 per cent have remarkably smooth spectrum, well described by a double power-law over the full range. This suggests a single emitting region, at variance with the notion that `flat' spectra result from the superposition of the emissions from different compact regions, self-absorbed up to different frequencies. Most of the objects show a spectral steepening above ≃30 GHz, consistent with synchrotron emission becoming optically thin. Thus, the classical dichotomy between flat-spectrum/compact and steep-spectrum/extended radio sources, well established at cm wavelengths, breaks down at mm wavelengths. The mm-wave spectra do not show indications of the spectral break expected as the effect of `electron ageing', suggesting young source ages.

  18. Status of the 7 MeV/u, 217 MHz Injector Linac for the Heidelberg Cancer Therapy Facility

    CERN Document Server

    Schlitt, B; Hutter, G; Klos, F; Lu, Y; Minaev, S A; Mühle, C; Ratzinger, U; Schlitt, B; Tiede, R; Vinzenz, W; Will, C; Zurkan, O


    A clinical synchrotron facility for cancer therapy using energetic proton and ion beams (C, He and O) is under construction and will be installed at the Radiologische Universitätsklinik in Heidelberg, Germany, starting in 2005. The status of the ECR ion source systems, the beam line components of the low energy beam transport lines, the 400 keV/u RFQ and the 20 MV IH-cavity as well as the linac rf system will be reported. Two prototype magnets of the linac quadrupole magnets have been built at GSI and have been tested successfully. A test bench for the 1.4 MW, 217 MHz cavity amplifier built by industry has been installed at GSI including a 120 kW driver amplifier which will be used also for high power tests of the RFQ. A test bench for the RFQ using proton beams is presently being set up at the IAP. RF tuning of the 1:2 scaled IH-DTL model as well as Microwave Studio simulations of the model and the power cavity have been also performed at the IAP [1].

  19. Investigating the effects of 217 Hz frequency of cell phone on learning and spatial memory in rats

    Directory of Open Access Journals (Sweden)

    Kohzad S


    Full Text Available Background: Extremely low frequency (0-300 Hz fields from power lines, electronic equipment and medical devices, have been reported to produce various biological effects. Global system for mobile (GSM is most largely used in everybody's life. This system utilizes a low frequency band as well as a high frequency range of electromagnetic field. This study investigated the effects of 217 Hz electromagnetic field (the modulating signal in GSM on spatial learning and memory in rat.Methods: Twenty four male Wistar rat (200- 250 g were randomly divided in to three groups as: test, sham and control. Using a Helmholtz coil system, the test group was exposed to a uniform pulsed EMF of 200 µT (micro Tesla intensity for 4 h/day for 21 days (2 time in a day. This procedure was repeated for the sham group but with no field. All groups were trained prior to the day 21 on the 15th day for five days four trial per day in Morris Water-Maze system. Then the probe test was carried out for 60 seconds with no platform.Results: The ANOVA test revealed that no significant differences were found between control and exposed rats in all day of learning acquisition. Also, in probe test for investigating the memory, no significant differences observed. (P≤0.05 is accepted for significant level.Conclusion: This finding is in consistent with previous studies and indicates low frequency band of electromagnetic fields (EMF (200 µT intensity in cell phone may not have any effect on the learning acquisition and spatial memory in rat.

  20. Silencing of long noncoding RNA MALAT1 by miR-101 and miR-217 inhibits proliferation, migration, and invasion of esophageal squamous cell carcinoma cells. (United States)

    Wang, Xinyu; Li, Meng; Wang, Zhiqiong; Han, Sichong; Tang, Xiaohu; Ge, Yunxia; Zhou, Liqing; Zhou, Changchun; Yuan, Qipeng; Yang, Ming


    MALAT1, a highly conserved long noncoding RNA, is deregulated in several types of cancers. However, its role in esophageal squamous cell carcinoma (ESCC) and its posttranscriptional regulation remain poorly understood. In this study we provide first evidences that a posttranscriptional regulation mechanism of MALAT1 by miR-101 and miR-217 exists in ESCC cells. This posttranscriptional silencing of MALAT1 could significantly suppress the proliferation of ESCC cells through the arrest of G2/M cell cycle, which may be due to MALAT1-mediated up-regulation of p21 and p27 expression and the inhibition of B-MYB expression. Moreover, we also found the abilities of migration and invasion of ESCC cells were inhibited after overexpression of miR-101, miR-217, or MALAT1 siRNA. This might be attributed to the deregulation of downstream genes of MALAT1, such as MIA2, HNF4G, ROBO1, CCT4, and CTHRC1. A significant negative correlation exists between miR-101 or miR-217 and MALAT1 in 42 pairs of ESCC tissue samples and adjacent normal tissues. Mice xenograft data also support the tumor suppressor role of both miRNAs in ESCCs. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.

  1. Hypoxia-inducible factors regulate pluripotency factor expression by ZNF217- and ALKBH5-mediated modulation of RNA methylation in breast cancer cells. (United States)

    Zhang, Chuanzhao; Zhi, Wanqing Iris; Lu, Haiquan; Samanta, Debangshu; Chen, Ivan; Gabrielson, Edward; Semenza, Gregg L


    Exposure of breast cancer cells to hypoxia increases the percentage of breast cancer stem cells (BCSCs), which are required for tumor initiation and metastasis, and this response is dependent on the activity of hypoxia-inducible factors (HIFs). We previously reported that exposure of breast cancer cells to hypoxia induces the ALKBH5-mediated demethylation of N6-methyladenosine (m6A) in NANOG mRNA leading to increased expression of NANOG, which is a pluripotency factor that promotes BCSC specification. Here we report that exposure of breast cancer cells to hypoxia also induces ZNF217-dependent inhibition of m6A methylation of mRNAs encoding NANOG and KLF4, which is another pluripotency factor that mediates BCSC specification. Although hypoxia induced the BCSC phenotype in all breast-cancer cell lines analyzed, it did so through variable induction of pluripotency factors and ALKBH5 or ZNF217. However, in every breast cancer line, the hypoxic induction of pluripotency factor and ALKBH5 or ZNF217 expression was HIF-dependent. Immunohistochemistry revealed that expression of HIF-1α and ALKBH5 was concordant in all human breast cancer biopsies analyzed. ALKBH5 knockdown in MDA-MB-231 breast cancer cells significantly decreased metastasis from breast to lungs in immunodeficient mice. Thus, HIFs stimulate pluripotency factor expression and BCSC specification by negative regulation of RNA methylation.

  2. pages 217 - 225.pmd

    African Journals Online (AJOL)


    Sudharsanam ... samples, suggesting its use in hospitals for preliminary assessment of indoor air quality and determine pathogenic microorganisms due to particle ..... and Government Owned Hospitals in Benin City,. Nigeria. World J Med Sci ...

  3. 211–217

    Indian Academy of Sciences (India)


    5300 Bonn 1, FRG. Lakshmi Saripalli Joint Astronomy Programme, Department of Physics, Indian. Institute of Science, Bangalore 560012 and Radio Astronomy Centre, Tata Institute of. Fundamental Research, PO Box 1234, Bangalore 560012.

  4. pages 217 - 225.pmd

    African Journals Online (AJOL)


    Microorganisms were identified using standard microbiological procedures. Results: Microbial ... ascertain the influence of seasonal changes on airborne microbial loads. ... tropical climate comprising of the following seasons, namely winter ...

  5. The Effect of 217 Hz Magnetic Field of Cell Phone with Different Intensities on Apoptosis of Normal and Cancerous Cells Treated with Chemotherapy Drug

    Directory of Open Access Journals (Sweden)

    Mahsa Mansourian


    Full Text Available Background: According to the increasing development of home and business electronic equipment in today's world, the biological effects of ELF magnetic fields have been studied at two molecular-cellular and animal- human levels. Considering the therapeutic viewpoint of this study regarding the effects of low-frequency fields of mobile phone, the effect of acute exposure to this field on chemotherapy will be studied.Materials and Methods: In this experimental study, based on measurement of the intensity of the magnetic fields from mobile phones in another research, flux densities of magnetic field of 159.44, 93.25 and 120µ tesla with frequency of 217Hz was generated in magnetic field generator system, and the apoptosis level in K562 cancer cells and healthy cells of lymphocytes was assessed after exposure to field using flow cytometry method. This evaluation method was also performed for the cells treated with bleomycin after exposure to this field.Results: 217 Hz magnetic field exposure significantly increases the rate of apoptosis percentage (p > 0.05 in K562 cancer cells and in two intensities of 120 and 159.44µ tesla compared to the control group, but such effect is not observed in lymphocyte cells. Bleomycin-induced apoptosis percentage following exposure to the mentioned magnetic field shows no significant difference compared to the group of treatment with drug and without field exposure. This lack of significant difference is observed between the groups of drug after field exposure and field alone as well as between groups exposed to field and groups treated with bleomycin.Conclusion: Study results showed that 217 Hz magnetic field of mobile phone can induce apoptosis on cancer cells, but it has no effect on healthy cells. Thus, in order to use mobile phone as an effective factor in their treatment, some studies should be conducted at animal-human level.

  6. Effectiveness of live attenuated influenza vaccine and inactivated influenza vaccine in children 2-17 years of age in 2013-2014 in the United States. (United States)

    Caspard, Herve; Gaglani, Manjusha; Clipper, Lydia; Belongia, Edward A; McLean, Huong Q; Griffin, Marie R; Talbot, H Keipp; Poehling, Katherine A; Peters, Timothy R; Veney, Naomi; Ambrose, Christopher S


    A postmarketing observational study was initiated to evaluate quadrivalent live attenuated influenza vaccine (LAIV) effectiveness in children aged 2-17 years in the United States. Children and adolescents aged 2-17 years seeking outpatient care for febrile acute respiratory illness Vaccination status was documented from medical records or immunization registries. Children who received ≥1 dose of influenza vaccine ≥14 days before study visit were considered vaccinated. Vaccine effectiveness (VE) was estimated as 100×(1-adjusted odds ratio), where the odds of interest are the odds of vaccine exposure among influenza cases and test-negative controls. In total, 1033 children and adolescents were included in the analysis. Influenza was detected in 14% (145/1033) of all children, with 74% (108/145) of the influenza cases due to A/H1N1pdm09 strains, 21% (31) to influenza B, and 4% (6) to influenza H3N2. LAIV did not show significant effectiveness against A/H1N1pdm09 (VE 13% [95% CI: -55 to 51]) but was effective against B/Yamagata strains (82% [95% CI: 12-96]). Inactivated influenza vaccine was effective against A/H1N1pdm09 (74% [95% CI: 50-86]) and B/Yamagata (70% [95% CI: 18-89]). LAIV provided significant protection against B/Yamagata influenza but not against A/H1N1pdm09 in children aged 2-17 years in 2013-2014, resulting in a proposed change of the 2015-2016 formulation with a new and more heat-stable A/H1N1pdm09 LAIV strain. Copyright © 2015 Elsevier Ltd. All rights reserved.

  7. ExoMol molecular line lists XIX: high-accuracy computed hot line lists for H218O and H217O (United States)

    Polyansky, Oleg L.; Kyuberis, Aleksandra A.; Lodi, Lorenzo; Tennyson, Jonathan; Yurchenko, Sergei N.; Ovsyannikov, Roman I.; Zobov, Nikolai F.


    Hot line lists for two isotopologues of water, H218O and H217O, are presented. The calculations employ newly constructed potential energy surfaces (PES), which take advantage of a novel method for using the large set of experimental energy levels for H216O to give high-quality predictions for H218O and H217O. This procedure greatly extends the energy range for which a PES can be accurately determined, allowing an accurate prediction of higher lying energy levels than are currently known from direct laboratory measurements. This PES is combined with a high-accuracy, ab initio dipole moment surface of water in the computation of all energy levels, transition frequencies and associated Einstein A coefficients for states with rotational excitation up to J = 50 and energies up to 30 000 cm-1. The resulting HotWat78 line lists complement the well-used BT2 H216O line list. Full line lists are made available online as Supporting Information and at

  8. Increased Antimicrobial Resistance in a Novel CMY-54 AmpC-Type Enzyme with a GluLeu(217-218) Insertion in the Ω-Loop. (United States)

    Pérez-Llarena, Francisco José; Vázquez-Ucha, Juan Carlos; Kerff, Frédéric; Zamorano, Laura; Miró, Elisenda; Cabral, María Póvoa; Fleites, Ana; Lantero, Marta; Martínez-Martínez, Luis; Oliver, Antonio; Galleni, Moreno; Navarro, Ferrán; Beceiro, Alejandro; Bou, Germán


    During a Spanish surveillance study, a natural variant of a CMY-type β-lactamase related to CMY-2 with a GluLeu(217-218) insertion in the Ω-loop (designated CMY-54) was found to increase the minimum inhibitory concentractions to β-lactams in a clinical strain of Escherichia coli. The aim of this study was to characterize CMY-54 by genetic, microbiological, and biochemical analysis. The blaCMY-54 gene is encoded by a plasmid of around 100 kb that hybridizes with K and FIB probes. The genetic context of blaCMY-54 and blaCMY-2 genes was found to be very similar. E. coli expressing CMY-54 under isogenic conditions showed a clear fourfold to eightfold increase in MICs to penicillins, cefotaxime, ceftazidime, and aztreonam compared with CMY-2. The catalytic efficiencies of pure CMY-2 and CMY-54 proteins correlated with their microbiological parameters. CMY-2 protein was more resistant to thermal denaturation than CMY-54, indicating than the Ω-loop of CMY-54 may be wider and more relaxed and probably enables better accommodation of these antimicrobials. Otherwise, the higher stabilization of CMY-2 may induce a slight reduction of the dynamics of this enzyme and primarily affect the hydrolysis of some of the bulkiest antibiotics. In summary, the GluLeu(217-218) insertion observed in CMY-54 compared to CMY-2 produces a β-lactamase with a distinctive catalytic efficacy for β-lactam antimicrobials likely caused by an increased flexibility slightly affecting the active site shape, highlighting the relevance of single mutations on the hydrolytic spectrum in class C β-lactamases.

  9. 217 000-year-old DNA sequences of green sulfur bacteria in Mediterranean sapropels and their implications for the reconstruction of the paleoenvironment. (United States)

    Coolen, Marco J L; Overmann, Jörg


    Deep-sea sediments of the eastern Mediterranean harbour a series of dark, organic carbon-rich layers, so-called sapropels. Within these layers, the carotenoid isorenieratene was detected. Since it is specific for the obligately anaerobic phototrophic green sulfur bacteria, the presence of isorenieratene may suggest that extended water column anoxia occurred in the ancient Mediterranean Sea during periods of sapropel formation. Only three carotenoids (isorenieratene, beta-isorenieratene and chlorobactene) are typical for green sulfur bacteria and thus do not permit to differentiate between the approximately 80 known phylotypes. In order to reconstruct the paleoecological conditions in more detail, we searched for fossil 16S rRNA gene sequences of green sulfur bacteria employing ancient DNA methodology. 540 bp-long fossil sequences could indeed be amplified from up to 217 000-year-old sapropels. In addition, such sequences were also recovered from carbon-lean intermediate sediment layers deposited during times of an entirely oxic water column. Unexpectedly, however, all the recovered 16S rRNA gene sequences grouped with freshwater or brackish, rather than truly marine, types of green sulfur bacteria. It is therefore feasible that the molecular remains of green sulfur bacteria originated from populations which thrived in adjacent freshwater or estuarine coastal environments rather than from an indigenous pelagic population.

  10. In-Source Laser Spectroscopy with the Laser Ion Source and Trap: First Direct Study of the Ground-State Properties of ^{217,219}Po

    Directory of Open Access Journals (Sweden)

    D. A. Fink


    Full Text Available A Laser Ion Source and Trap (LIST for a thick-target, isotope-separation on-line facility has been implemented at CERN ISOLDE for the production of pure, laser-ionized, radioactive ion beams. It offers two modes of operation, either as an ion guide, which performs similarly to the standard ISOLDE resonance ionization laser ion source (RILIS, or as a more selective ion source, where surface-ionized ions from the hot ion-source cavity are repelled by an electrode, while laser ionization is done within a radio-frequency quadrupole ion guide. The first physics application of the LIST enables the suppression of francium contamination in ion beams of neutron-rich polonium isotopes at ISOLDE by more than 1000 with a reduction in laser-ionization efficiency of only 20. Resonance ionization spectroscopy is performed directly inside the LIST device, allowing the study of the hyperfine structure and isotope shift of ^{217}Po for the first time. Nuclear decay spectroscopy of ^{219}Po is performed for the first time, revealing its half-life, α-to-β-decay branching ratio, and α-particle energy. This experiment demonstrates the applicability of the LIST at radioactive ion-beam facilities for the production and study of pure beams of exotic isotopes.

  11. IUPAC critical evaluation of the rotational-vibrational spectra of water vapor. Part IV. Energy levels and transition wavenumbers for D216O, D217O, and D218O (United States)

    Tennyson, Jonathan; Bernath, Peter F.; Brown, Linda R.; Campargue, Alain; Császár, Attila G.; Daumont, Ludovic; Gamache, Robert R.; Hodges, Joseph T.; Naumenko, Olga V.; Polyansky, Oleg L.; Rothman, Laurence S.; Vandaele, Ann Carine; Zobov, Nikolai F.; Dénes, Nóra; Fazliev, Alexander Z.; Furtenbacher, Tibor; Gordon, Iouli E.; Hu, Shui-Ming; Szidarovszky, Tamás; Vasilenko, Irina A.


    This paper is the fourth of a series of papers reporting critically evaluated rotational-vibrational line positions, transition intensities, pressure dependences, and energy levels, with associated critically reviewed assignments and uncertainties, for all the main isotopologues of water. This paper presents energy level and transition data for the following doubly and triply substituted isotopologues of water: D216O, D217O, and D218O. The MARVEL (Measured Active Rotational-Vibrational Energy Levels) procedure is used to determine the levels, the lines, and their self-consistent uncertainties for the spectral regions 0-14 016, 0-7969, and 0-9108 cm-1 for D216O, D217O, and D218O, respectively. For D216O, D217O, and D218O, 53 534, 600, and 12 167 lines are considered, respectively, from spectra recorded in absorption at room temperature and in emission at elevated temperatures. The number of validated energy levels is 12 269, 338, and 3351 for D216O, D217O, and D218O, respectively. The energy levels have been checked against the ones determined, with an average accuracy of about 0.03 cm-1, from variational rovibrational computations employing exact kinetic energy operators and an accurate potential energy surface. Furthermore, the rovibrational labels of the energy levels have been validated by an analysis of the computed wavefunctions using the rigid-rotor decomposition (RRD) scheme. The extensive list of MARVEL lines and levels obtained is deposited in the Supplementary Material of this paper, in a distributed information system applied to water, W@DIS, and on the official MARVEL website, where they can easily be retrieved.

  12. Central PresbyLASIK for Hyperopia and Presbyopia Using Micro-monovision With the Technolas 217P Platform and SUPRACOR Algorithm. (United States)

    Saib, Naïma; Abrieu-Lacaille, Mélanie; Berguiga, Marouen; Rambaud, Camille; Froussart-Maille, Françoise; Rigal-Sastourne, Jean-Claude


    To analyze the refractive outcomes and satisfaction of presbyopic hyperopes treated with central presbyopicLASIK (presbyLASIK) with induced micro-monovision. This retrospective study included 74 eyes of 37 patients treated with central presbyLASIK with micro-monovision using the Technolas 217P excimer laser (Technolas Perfect Vision GmbH, Munich, Germany) between June 2011 and March 2014. Study parameters included uncorrected distance visual acuity (UDVA) and uncorrected near visual acuity (UNVA), aberrometry, the central steep zone, and patient satisfaction. Median age was 54.3±4 years (range: 46 to 63 years). Mean postoperative spherical equivalent refraction was 0.00±0.58 diopters (D) for dominant eyes and -0.51±0.54 D for non-dominant eyes. Mean binocular UDVA was 0.01±0.10 logMAR (Snellen 20/20) at 6 months and -0.01±0.05 logMAR (Snellen 20/19) at 1 year postoperatively. Mean binocular UNVA was 0.18±0.14 logMAR (Parinaud 2) (Jaeger 1) at 6 months and 0.18±0.12 logMAR (Parinaud 2) (Jaeger 1) at 1 year postoperatively. At 6 months, 79.31% of patients achieved 20/25 and could read Parinaud 2 (Jaeger 1) binocularly. At 1 year, 84.21% of patients achieved 20/25 and could read Parinaud 2 (Jaeger 1) binocularly. The mean central steep zone was 2.35±1.00 D. There were significantly more negative spherical aberration and vertical coma in the central 5 mm postoperatively (P<.05). The re-treatment rate was 6.75%. Eighty-three percent of these patients did not need any glasses for distance and near vision. This procedure may improve functional near, intermediate, and distance vision in presbyopic patients with low and moderate hyperopia. Copyright 2015, SLACK Incorporated.

  13. 217 Résumé

    African Journals Online (AJOL)


    Fehdi Chemseddine¹*, Boudoukha Abderrahmane², Rouabhia Abdelkader¹ et Salameh Elias³. 1Centre Universitaire de Tébessa, Institut des Sciences de la Terre,. Route de Constantine, Tébessa 12002, Algérie. ²Université de Batna, Département d'Hydraulique, Batna 05000, Algérie. ³University of Jordan, Department of ...

  14. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott


    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  15. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)


    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  16. Suppression of ovarian activity with a low-dose 21/7-day regimen oral contraceptive containing ethinylestradiol 20 mcg/drospirenone 3 mg in Japanese and Caucasian women. (United States)

    Anzai, Yuzuru; Heger-Mahn, Doris; Schellschmidt, Ilka; Marr, Joachim


    Two studies assessed the effect of a low-estrogen-dose 21/7-day oral contraceptive containing ethinylestradiol and drospirenone (EE 20 mcg/drsp 3 mg) on ovarian activity in Japanese and Caucasian women. Study 1 was conducted in Japanese women (20-35 years), and Study 2 was conducted in Caucasian women (18-35 years). All women received EE 20 mcg/drsp 3 mg in a 21-day active pill regimen. The primary endpoint was the proportion of women with ovulation inhibition (Hoogland score day regimen provides comparable ovarian suppression in Japanese and Caucasian women, with normal ovarian function resuming shortly after treatment end in both populations. Copyright © 2012 Elsevier Inc. All rights reserved.

  17. Molecular dynamics simulation and free energy landscape methods in probing L215H, L217R and L225M βI-tubulin mutations causing paclitaxel resistance in cancer cells. (United States)

    Tripathi, Shubhandra; Srivastava, Gaurava; Sharma, Ashok


    Drug resistance poses a threatening challenge for mankind, as the development of resistance to already well-established drugs causes serious therapeutic problems. Resistance to paclitaxel (Ptxl), a complex diterpenoid working as microtubule stabilizer, is one such issue in cancer treatment. Microtubule stabilizer drugs, stabilises microtubules upon binding to β-tubulin subunit of tubulin heterodimer thus causing mitotic arrest leading to death of cancer cell. Leucine point mutations viz. L215H, L217R, and L225M were reported for Ptxl resistance in various cancers. In the current study, molecular mechanism of these resistance causing mutations was explored using molecular docking, molecular dynamics (MD) simulation, binding energy estimation (MMPBSA), free energy decomposition, principle component analysis (PCA) and free energy landscape (FEL) methods. A total of five systems including unbound βI-tubulin (Apo), docked wild+Ptxl, L215H+Ptxl, L217R+Ptxl and L225M+Ptxl were prepared, and 50 ns MD simulation was performed for each system. Binding energy estimation indicated that leucine mutation reduces the binding affinity of Ptxl in mutant types (MTs) as compared to wild type (WT). Further, in contrast to WT Ptxl interactions with the M-loop (PHE270-VAL286), S6-S7 loop and H9-H10 were significantly altered in MTs. Results showed that in MTs, Ptxl had weak interaction with M-loop residues, while having strong affinity with S6-S7 loop and H6-H7 loop. Moreover, PCA and FEL analysis revealed that M-loop flexible region (THR274-LEU284) was strongly bound with Ptxl in WT preventing its flexible movement and the causing factor for microtubule stabilization. In MTs due to poor interaction with Ptxl, M-loop flexible region retains its flexibility, therefore unable to stabilize microtubule. This study will give an insight into the importance of M-loop flexible region interaction with Ptxl for microtubule stabilization. In addition, it clearly provides the molecular basis of

  18. Potential for Cell-Transplant Therapy with Human Neuronal Precursors to Treat Neuropathic Pain in Models of PNS and CNS Injury: Comparison of hNT2.17 and hNT2.19 Cell Lines

    Directory of Open Access Journals (Sweden)

    Mary J. Eaton


    Full Text Available Effective treatment of sensory neuropathies in peripheral neuropathies and spinal cord injury (SCI is one of the most difficult problems in modern clinical practice. Cell therapy to release antinociceptive agents near the injured spinal cord is a logical next step in the development of treatment modalities. But few clinical trials, especially for chronic pain, have tested the potential of transplant of cells to treat chronic pain. Cell lines derived from the human neuronal NT2 cell line parentage, the hNT2.17 and hNT2.19 lines, which synthesize and release the neurotransmitters gamma-aminobutyric acid (GABA and serotonin (5HT, respectively, have been used to evaluate the potential of cell-based release of antinociceptive agents near the lumbar dorsal (horn spinal sensory cell centers to relieve neuropathic pain after PNS (partial nerve and diabetes-related injury and CNS (spinal cord injury damage in rat models. Both cell lines transplants potently and permanently reverse behavioral hypersensitivity without inducing tumors or other complications after grafting. Functioning as cellular minipumps for antinociception, human neuronal precursors, like these NT2-derived cell lines, would likely provide a useful adjuvant or replacement for current pharmacological treatments for neuropathic pain.

  19. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)


    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  20. 76 FR 16526 - Airworthiness Directives; Pratt & Whitney JT8D-209, -217, -217A, -217C, and -219 Series Turbofan... (United States)


    ... within 500 hours TIS since (1.130 N.m). last inspection. Less than 10 LB-IN (1.130 N.m) but One to six... TIS since (1.130 N.m). last inspection. Less than 10 LB-IN (1.130 N.m) but One to six Repeat torque... This AD (n) Whenever a refurbished or used blade is intermixed with new blades in a rotor, use the...

  1. 75 FR 38052 - Airworthiness Directives; Pratt & Whitney JT8D-209, -217, -217A, -217C, and -219 Series Turbofan... (United States)


    ... (1.130 N.m) One to six....... Repeat torque but greater than or equal to inspection within 5 LB-IN (0... TIS since last inspection. Less than 10 LB-IN (1.130 N.m) One to six....... Repeat torque but greater... This AD (n) Whenever a refurbished or used blade is intermixed with new blades in a rotor, use the...

  2. Sialidosis type I carrying V217M/G243R mutations in lysosomal sialidase: an autopsy study demonstrating terminal sialic acid in lysosomal lamellar inclusions and cerebellar dysplasia. (United States)

    Uchihara, Toshiki; Ohashi, Ken-ichi; Kitagawa, Masanobu; Kurata, Morito; Nakamura, Ayako; Hirokawa, Katsuiku; Kasuga, Tsutomu; Kobayashi, Takayoshi


    Autopsy findings of a patient, with sialidosis type I phenotype carrying V217M/G243R mutations in the lysosomal sialidase gene and biochemically defined isolated sialidase deficiency, who died of intractable lymphoma at the age of 32 years, are described. Perikaryal expansion of cytoplasm was evident, mostly in motor neurons (in the anterior horn and the brain stem), dorsal root ganglia, cerebellar dentate neurons and some neurons in the thalamus and nucleus basalis of Meynert. The stored material was lamellar in lysosomes and exhibited a specific affinity to wheat germ agglutinin at light and electron microscopy, which indicates the accumulation of terminal sialic acid at the non-reducing end of the sugar chain in this pathological structure. Neuronal loss in these nuclei, however, was not frequent in spite of frequent and massive cytoplasmic expansion. Neocortex exhibited a mild spongiosis with some swelling of neurons, which contained lipofuscin-like granules and small amount of lamellar structures in lysosomes. This contrast suggests a discrepancy between the storage process and vulnerability of neurons, both variable according to areas examined. In the cerebellar vermis, dysplastic features, such as abnormal layering of Purkinje cells, thinning and rarefaction of the granule cell layer, incomplete formation of synapse and disordered proliferation of Bergmann's glia, were focally accentuated, suggesting some developmental abnormality not secondary to the storage process. This is the first autopsy demonstration of sialic acid in the lamellar materials and of a developmental abnormality in isolated sialidase deficiency. Additional studies are needed to clarify how this molecular abnormality leads to these morphological and clinical manifestations.

  3. Novel deletion and a new missense mutation (Glu 217 Lys) at the catalytic site in two adenosine deaminase alleles of a patient with neonatal onset adenosine deaminase severe combined immunodeficiency

    Energy Technology Data Exchange (ETDEWEB)

    Hirschhorn, R.; Nicknam, M.N.; Eng, F.; Yang, D.R.; Borkowsky, W. (New York Univ. Medical School of Medicine, NY (United States))


    Mutations at the adenosine deaminase (ADA) locus result in a spectrum of disorders, encompassing a fulminant neonatal onset severe combined immunodeficiency (SCID) and childhood onset immunodeficiency, as well as apparently normal immune function. The extent of accumulation of the toxic metabolite, deoxyATP, correlates directly with severity of disease. The authors have now determined the mutations on both alleles of a child with fulminant, neonatal onset ADA SCID and accumulation of extremely high concentrations of deoxyATP. The genotype was consistent with the severely affected phenotype. One allele carried a large deletion that arose by non-homologous recombination and included the first five exons and promoter region. The second allele carried a missense mutation (G[sup 649]A) resulting in replacement of Glu[sup 217], an amino acid involved in the catalytic site, by Lys and predicting a major alteration in charge. Expression of the mutant cDNA on Cos cells confirmed that the mutation abolished enzyme activity. The authors have previously reported that a missense mutation at the preceding codon is similarly associated with neonatal onset ADA SCID and accumulation of extremely high deoxyATP. These findings suggest that genotype-phenotype correlations may be apparent for ADA SCID, despite the role that random variation in exposure to environmental pathogens may play in the initial phenotype. Such genotype-phenotype correlations may be important to consider in evaluating results of ongoing trials of [open quotes]gene[close quotes] and enzyme replacement therapy. 50 refs., 5 figs., 2 tabs.

  4. Comparative, open-label prospective study on the quality of life and sexual function of women affected by endometriosis-associated pelvic pain on 2 mg dienogest/30 µg ethinyl estradiol continuous or 21/7 regimen oral contraceptive. (United States)

    Caruso, S; Iraci, M; Cianci, S; Fava, V; Casella, E; Cianci, A


    To evaluate the effects of a continuous regimen combined oral contraceptive (COC) containing 2 mg dienogest and 30 µg ethinyl estradiol (DNG/EE) compared to a 21/7 regimen on the quality of life (QoL) and sexual function in women affected by endometriosis-associated pelvic pain. Sixty-three women constituted the Study group treated with DNG/EE COC continuous regimen; 33 women were given DNG/EE COC in a 21/7 regimen. To define the endometriosis-associated pelvic pain, the Visual Analogic Scale was used. The Short Form-36, Female Sexual Function Index (FSFI) and the Female Sexual Distress Scale (FSDS) were used to assess QoL, sexual function and sexual distress, respectively. The study included two follow-ups. At 3 and 6 months of treatment there was an improvement in pain of the Study group (p sexual activity and their QoL that was better than the DNG/EE 21/7 conventional regimen.

  5. 22 CFR 217.4 - Discrimination prohibited. (United States)


    ... the identical result or level of achievement for handicapped and nonhandicapped persons, but must... reach the same level of achievement, in the most integrated setting appropriate to the person's needs... have the purpose or effect of defeating or substantially impairing accomplishment of the objectives of...

  6. 27 CFR 555.217 - Lighting. (United States)


    ... “National Electrical Code,” (National Fire Protection Association, NFPA 70-81), for the conditions present... also meet the standards prescribed by the National Electrical Code. (c) Copies of invoices, work orders or similar documents which indicate the lighting complies with the National Electrical Code must be...

  7. 22 CFR 217.3 - Definitions. (United States)


    ... attitudes of others towards such impairment; or (C) has none of the impairments defined in paragraph (i)(2..., performing manual tasks, walking, seeing, hearing, speaking, breathing, learning, and working. (iii) Has a...

  8. 14 CFR 217.10 - Instructions. (United States)


    ... carriers are encouraged to use ADP equipment to reduce the manual effort of preparing Schedule T-100(f...; the aircraft type code is 8161; the 816 indicates a Boeing 747-100, and the 1 in the units position...

  9. Publications | Page 217 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Within an exceptionally uncertain and dynamic vulnerability context this thesis advances proposals from the findings towards revising and developing the livelihoods inquiry. ''Resiliency perspective'' comprises people''s ability to mitigate the effects of adversity; their ability to thrive in a... CNDD-FDD in Burundi : the path from ...

  10. 22 CFR 217.13 - Employment criteria. (United States)


    ... test score or other selection criterion, as used by the recipient, is shown to be job-related for the position in question, and (2) alternative job-related tests or criteria that do not screen out or tend to..., the test results accurately reflect the applicant's or employee's job skills, aptitude, or whatever...

  11. Publications | Page 217 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Absence of dry season Plasmodium parasitaemia, but high rates of reported acute respiratory infection and diarrhoea in preschool-aged children in Kaédi, southern Mauritania (open access). As a ''hot spot'' for climate change, the epidemiology of malaria in the River Gorgol valley, southern Mauritania, requires particular ...

  12. 8 CFR 217.2 - Eligibility. (United States)


    ..., Japan, Latvia, Liechtenstein, Lithuania, Luxembourg, Malta, Monaco, the Netherlands, New Zealand, Norway... for return passage for charter flights, and military travel orders which include military dependents for return to duty stations outside the United States on U.S. military flights. A period of validity...

  13. 48 CFR 217.7802 - Policy. (United States)


    ... determination of the Under Secretary of Defense for Acquisition, Technology, and Logistics, that it is necessary... considered include— (i) Satisfying customer requirements; (ii) Schedule; (iii) Cost effectiveness (taking... acquisition for analysis. Follow the reporting requirements in Subpart 204.6. ...

  14. 22 CFR 217.47 - Nonacademic services. (United States)


    ... or that operates or sponsors intercollegiate, club, or intramural athletics shall provide to... placement services to its students shall provide these services without discrimination on the basis of... permit discrimination otherwise prohibited by this subpart. ...

  15. Publications | Page 217 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Lessons from the old Green Revolution for the new: Social, environmental and nutritional issues for agricultural change in Africa (restricted access) ... Using surveys covering seven West African economic capitals in the early 2000s, this paper describes the labour market integration of youth with regard to their level of formal ...

  16. 22 CFR 217.11 - Discrimination prohibited. (United States)


    ...) Specific activities. The provisions of this subpart apply to: (1) Recruitment, advertising, and the... absence to pursue training; (8) Employer sponsored activities, including those that are social or...

  17. 22 CFR 217.44 - Academic adjustments. (United States)


    ... handicapped students other rules, such as the prohibition of tape recorders in classrooms or of dog guides in... effective methods of making orally delivered materials available to students with hearing impairments...

  18. 49 CFR 107.217 - Notice. (United States)


    ... State or political subdivision determines that compliance with paragraph (a) of this section would be... not impracticable, or that notice should be published in the Federal Register. Late-filed comments are...

  19. 49 CFR 397.217 - Waiver processing. (United States)


    ... designation of the State, political subdivision thereof, or Indian tribe for which the determination is sought... State, political subdivision thereof, or Indian tribe has been determined by a court of competent... served by publishing a notice in the Federal Register. ...

  20. 48 CFR 252.217-7009 - Default. (United States)


    ... arises from causes beyond the control and without the fault or negligence of the Contractor. Examples of such causes include acts of God or of the public enemy, acts of the Government in either its sovereign or contractual capacity, fires, floods, epidemics, quarantine restrictions, strikes, freight...

  1. Incidence of live-attenuated influenza vaccine administration beyond expiry date in children and adolescents aged 2-17 years in the UK: a population-based cohort study. (United States)

    Caspard, Herve; Wise, Robert P; Steffey, Amy; Brody, Robert S


    To estimate the proportion of live-attenuated influenza vaccine (LAIV) doses administered beyond expiry date in children and adolescents during influenza seasons 2013-2014 and 2014-2015 in the UK. This was a retrospective cohort study. Two cohorts of children and adolescents who received LAIV from 1 September 2013 to 31 March 2014 and from 1 September 2014 to 31 March 2015 and aged 2-17 years at time of LAIV administration were identified from the Clinical Practice Research Datalink (CPRD). More than 500 primary care practices in the UK. Proportions of vaccine doses administered beyond expiry date were assessed among 47 396 and 67 099 LAIV recipients with a documented vaccine lot identifier in influenza seasons 2013-2014 and 2014-2015, respectively. None. Administrations of expired LAIV were ascertained by comparison of vaccination dates in CPRD records with expiration dates in AstraZeneca/MedImmune lot distribution data. Overall, 245 LAIV recipients, 80 in 2013-2014 and 165 in 2014-2015, received a dose after its expiration date, yielding proportion estimates of 1.7 per 1000 doses (95% CI 1.3 to 2.1) in season 2013-2014 and 2.5 per 1000 (95% CI 2.1 to 2.8) in season 2014-2015. This proportion increased above 1.0% after December during each season. Most (84% in influenza season 2013-2014 and 59% in influenza season 2014-2015) received an expired dose <30 days after its expiration date. The proportion was higher in London (relative risk 1.93 (95% CI 1.25 to 2.99)) and when the number of LAIV recipients registered in the practice was lower than the median number per practice (relative risk 2.69 (95% CI 1.99 to 3.62)). Administration of expired LAIV doses occurs infrequently. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  2. 49 CFR 571.217 - Standard No. 217; Bus emergency exits and window retention and release. (United States)


    ... interior, to occupants having corrected visual acuity of 20/40 (Snellen ratio) seated in the adjacent seat... “Emergency Exit,” as appropriate, in letters at least 5 centimeters high, of a color that contrasts with its... instructions shall be in letters at least 1 centimeter high and of a color that contrasts with its background...

  3. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.


    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  4. Dicty_cDB: CHM217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence....rsmsxlre_008717.z1.scf cDNA Library of Salvia miltiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence.

  5. 29 CFR 1910.217 - Mechanical power presses. (United States)


    ... this section. (5) Excluded machines. Press brakes, hydraulic and pneumatic power presses, bulldozers..., or loosening and falling or release of mechanical energy (i.e. broken springs). (2) Brakes. Friction... pneumatic system of the press. A means of air lubrication shall be provided when needed. (11) Hydraulic...

  6. Dicty_cDB: CHH217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |CD169096.1 MM1-0024G-M078-E11-U.B MM1-0024 Schistosoma mansoni cDNA clone MM1-0024G-M078-E11.B, mRNA...|CD169707.1 MM1-0024T-M086-B01-U.B MM1-0024 Schistosoma mansoni cDNA clone MM1-0024T-M086-B01.B, mRNA...|CD169077.1 MM1-0024G-M078-D02-U.B MM1-0024 Schistosoma mansoni cDNA clone MM1-0024G-M078-D02.B, mRNA...|CD169818.1 MM1-0024T-M087-D03-U.B MM1-0024 Schistosoma mansoni cDNA clone MM1-0024T-M087-D03.B, mRNA...|CD168683.1 MM1-0023U-M091-D09-U.B MM1-0023 Schistosoma mansoni cDNA clone MM1-0023U-M091-D09.B, mRNA

  7. 1935 15' Quad #217 Aerial Photo Mosaic Index - AZ (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  8. Dicty_cDB: CHD217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Chardonnay Vitis vinifera cDNA clone VVB158G03 5, mRNA sequence. 64 4e-07 2 CA813481 |CA813481.1 CA48LN10IF-E8 Caberne...B341828 |CB341828.2 CA32EN0002_IIIbF_E01 Cabernet Sauvignon Leaf - CA32EN Vitis v

  9. All projects related to | Page 217 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Program: Maternal and Child Health. Total Funding: CA$ 391,650.00. Understanding Southern Influence in Cyberspace Security and Governance: Toward a Global Network of Southern-based Cyber Scholars. Project. The securitization of cyberspace - that is, making it a matter of national security - is perhaps the most ...

  10. 12038_2016_9610_Article_print 205..217

    Indian Academy of Sciences (India)


    May 13, 2016 ... structure and function of the Golgi apparatus (Sigma, St. Louis, MO, USA 2003). First, cells were harvested and allowed to settle in a 35×10 mm Petri dish. Loflo medium containing BFA at a concentration of 5 μM was added. Cells were incubated for 60 min. Fluorescence from GFP and. FM®1-43 (AX4) was ...

  11. 50 CFR 216.217 - Requirements for monitoring and reporting. (United States)


    ... During Offshore Structure Removal Operations on the Outer Continental Shelf in the U.S. Gulf of Mexico... Requirements For All Explosive Severance Scenarios.1 Blasting Category Configuration (Charge wt/ placement...) Post Post Det Aerial Survey (Yes/No) Waiting Period (min) BML Shelf ( 200 m) A2 (856 ft) 90 N/A N/A 30...

  12. Dicty_cDB: SHH217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 Dictyostelium discoideum H6 gene mRNA. 131 4e-31 2 BI863585 |BI863585.1 kx46a06.y1 Parastrongyloides... trichosuri FL pAMP1 v1 Chiapelli McCarter Parastrongyloides trichosuri cDNA 5' similar... to SW:EF2_CAEEL P29691 ELONGATION FACTOR 2 ;, mRNA sequence. 66 3e-19 4 BI863575 |BI863575.1 kx45h07.y1 Parastrongyloides... trichosuri FL pAMP1 v1 Chiapelli McCarter Parastrongyloides tricho...ngyloides trichosuri FL pAMP1 v1 Chiapelli McCarter Parastrongyloides trichosuri cD

  13. 78 FR 217 - Shared Responsibility for Employers Regarding Health Coverage (United States)


    ..., incapacity (including disability), layoff, jury duty, military duty or leave of absence (29 CFR 2530.200b-2(a... negative impact on employees who are on longer paid leaves, such as maternity or paternity leave. In..., holiday, illness, incapacity (including disability), layoff, jury duty, military duty or leave of absence...

  14. Dicty_cDB: VHO217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ld acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_05ca09, mRNA sequence. 56 CR_CEa01K07, mRNA sequence. 56 8e-04 1 CB293061 |CB293061.1 UCRCS01_05ca09_g1 Washington Navel orange co

  15. Page 1 Auclear Methylation of Resacetophenone 217 requires C, 65 ...

    Indian Academy of Sciences (India)

    2 g of co-methoxy resacetophenone. 3: 7-Dimethoxy-8-methylflavone from the above ketone.-An intimate mixture of the ketone (1.g.), sodium benzoate (1.5 g) and benzoic anhydride. (4.g.) was heated in an oil-bath at 200 for 4 hours under a pressure of about. 40 mm. of mercury. The residue was treated with a large excess ...

  16. 48 CFR 1252.217-76 - Liability and insurance. (United States)


    ... required by the Contracting Officer, the Contractor shall execute a formal assignment or transfer of the... of and shall not affect the pricing structure of the contract, and are additional to the compensation...

  17. 48 CFR 3052.217-95 - Liability and insurance (USCG). (United States)


    ... Contractor shall execute a formal assignment or transfer of the claim, demand, or cause of action. (5) No... of and shall not affect the pricing structure of the contract, and are additional to the compensation...

  18. JCSC_128_2_217-226_SI_a.doc

    Indian Academy of Sciences (India)

    Absorption spectrum was measured by using JASCO V-550 UV/VIS Spectrophotometer and Fluorescence spectrum was measured by using Hitachi F-2500 Fluorescence Spectrophotometer. X-ray data for the compound were collected at room temperature using a Bruker Apex II KY CCD diffractometer with graphite ...

  19. Dicty_cDB: VSD217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kyg*liles sl*iqiqtlqlyqiqhhqlqshhllqlkifqyypl*lylevimvmvvvvplmql*vvvvq llplqi*tlq*qlhqfihrlivmvqf*tq...kyg*li lessl*iqiqtlqlyqiqhhqlqshhllqlkifqyypl*lylevimvmvvvvplmql*vv vvqllplqi*tlq*qlhqfihrlivmvqf*tq*iih**tqkiiik**kl

  20. 48 CFR 217.208-70 - Additional clauses. (United States)


    ... stocks, or acquisitions made under DoD cooperative logistics support arrangements. (b) When a surge... represents in paragraph (a) of the clause to ensure adequate quantities are available to meet item...

  1. 48 CFR 217.172 - Multiyear contracts for supplies. (United States)


    ... funds appropriated for a subsequent fiscal year (including an economic order quantity of such long-lead... Secretary of Defense for Acquisition, Technology, and Logistics (10 U.S.C. 2306b(i)(6)). (8) The Secretary... contract negotiated priced options for varying the quantities of end items to be procured over the life of...

  2. 5 CFR 532.217 - Appropriated fund survey jobs. (United States)


    ... Air Conditioning Mechanic 10 Rigger 10 Trailer Truck Driver 8 Tool Crib Attendant 6 Painter (Finish) 9... Laundry Worker 1 Food Service Worker 2 Cook 8 (e) A lead agency must obtain prior approval of OPM to add a...

  3. 48 CFR 217.171 - Multiyear contracts for services. (United States)


    ..., vehicles, and other highly complex military equipment. (iii) Specialized training requiring high quality instructor skills (e.g., training for pilots and aircrew members or foreign language training). (iv) Base..., with due consideration given to such factors as the location, specialized nature, and obsolescence of...

  4. Dicty_cDB: AFI217 [Dicty_cDB

    Lifescience Database Archive (English)



    African Journals Online (AJOL)

    Fr. Ikenga

    Abstract. The Rule of law is the most important concept in public law and indeed, in every democratic society. The concept considers every citizen as equal before the law. It sanctifies the priority of the law – common good, over personal, sectional and group concerns. In this way, the law is enabled to provide a common ...

  6. 1935 15' Quad #217 Aerial Photo Mosaic Index - NM (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  7. 34 CFR 685.217 - Teacher loan forgiveness program. (United States)


    ... borrower— (A) Demonstrated knowledge and teaching skills in reading, writing, mathematics, and other areas... students; or (ii) At an eligible elementary or secondary school or educational service agency as a highly... serving low-income students. (2) If the school or educational service agency at which the borrower is...

  8. Dicty_cDB: SSG217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available musculus dopamine receptor 2, ... 37 0.26 X53278_1( X53278 |pid:none) R.norvegicus mRNA for D2 dopamine rece...rece... 37 0.26 ( P61168 ) RecName: Full=D(2) dopamine receptor; AltName: Full=Dop... 37 0.26 AF293964_1(...AF293964_1( AF293964 |pid:none) Canis familiaris dopamine D2 recep... 37 0.34 protein update 2009. 6.12 PSORT

  9. Publications | Page 217 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... qui est une des conséquences du... Forêts communautaires dans le Bassin Arachidier : quelles stratégies locales pour une gestion réussie?; mémoire de fin d'études (restricted access). Les forêts communautaires (jachères, bas-fonds et ressources pastorales) jouent un rôle important dans la vie des populations rurales.

  10. Dicty_cDB: CHS217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available chromosome 13. 42 1.2 3 DQ067598 |DQ067598.1 Cocksfoot streak virus isolate UK-1-04 GHCP630B HC-Pro protein...partial cds. 46 1.6 1 DQ067597 |DQ067597.1 Cocksfoot streak virus isolate UK-1-04 GHCP630A HC-Pro protein...partial cds. 46 1.6 1 DQ067593 |DQ067593.1 Cocksfoot streak virus isolate UK-1-04 GHCP619C HC-Pro protein...partial cds. 46 1.6 1 DQ067592 |DQ067592.1 Cocksfoot streak virus isolate UK-1-04 GHCP619B HC-Pro protein...partial cds. 46 1.6 1 DQ067591 |DQ067591.1 Cocksfoot streak virus isolate UK-1-04 GHCP619A HC-Pro protein

  11. 29 CFR 778.217 - Reimbursement for expenses. (United States)


    ... approximate amount expended by an employee, who is traveling “over the road” on his employer's business, for... expenses, such as taxicab fares, incurred while traveling on the employer's business. (4) “Supper money”, a... normally incurs expenses in traveling to and from work, buying lunch, paying rent, and the like. If the...

  12. 7 CFR 2.17 - Under Secretary for Rural Development. (United States)


    ... government finance; income development strategies; housing; social services and utilization; adjustments to..., as amended by the Resource Conservation and Recovery Act, as further amended by the Hazardous and... assets and programs related to watershed facilities, resource and conservation facilities, and water and...

  13. Anonimi, “Ges al meu grat non sui joglar” (BdT 461.126, “Per zo no·m voil desconortar” (BdT 461.193, “Va, cobla: al Juge de Galur” (BdT 461.246, “Seigner Juge, ben aug dir a la gen” (BdT 461.217, “Ges per li diz non er bons prez sabuz” (BdT 461.133

    Directory of Open Access Journals (Sweden)

    Giuseppe Noto


    Full Text Available My paper provides a new critical edition, with critical apparatus, comment and translation of a set of anonymous ‘coblas’, copied as a sequence in the anthology present at ff. 55-66 in chansonnier P: BdT 461.126; BdT 461.193; BdT 461.246; BdT 461.217; BdT 461.133 (all of which are unica. I will examine in particular the attributions suggested so far for one or more of these ‘coblas’ (a name that has frequently been put forward is that of Paolo Lanfranchi da Pistoia, author of the sonnet in ‘cobla’ form copied in P immediately preceding the poems discussed here and address the hypothesis put forward by several scholars (and upheld with convincing evidence by Stefano Asperti that the sequence under consideration points to the strong presence of a Tuscan tradition in chansonnier P, clearly contributing, among other things, to outline a “fundamental coherence” (Asperti between some aspects of Dante’s literary culture and this particular songbook.

  14. Modeling relationships among 217 fires using remote sensing of burn severity in southern pine forests (United States)

    Sparkle L. Malone; Leda N. Kobziar; Christina L. Staudhammer; Amr Abd-Elrahman


    Pine flatwoods forests in the southeastern US have experienced severe wildfires over the past few decades, often attributed to fuel load build-up. These forest communities are fire dependent and require regular burning for ecosystem maintenance and health. Although prescribed fire has been used to reduce wildfire risk and maintain ecosystem integrity, managers are...

  15. 48 CFR 3052.217-92 - Inspection and manner of doing work (USCG). (United States)


    ... shall be in accordance with the best commercial marine practices and the rules and requirements of all... unless otherwise specifically provided in the contract, all operational practices of the Contractor and... Government may inspect and test all material and workmanship at any time during the Contractor's performance...

  16. 48 CFR 252.217-7005 - Inspection and manner of doing work. (United States)


    ... with the best commercial marine practices and the rules and requirements of the American Bureau of... provided in the job order, all operational practices of the Contractor and all workmanship, material... workmanship. The solicitation shall prescribe the Navy standard whenever applicable. (c) The Government may...

  17. Supplement to J. Genet. 84, 217–222 (2005), V. Rodrigues ...

    Indian Academy of Sciences (India)


    191,. 93-95. (1967). 9. CAMPOS-ORTEGA, J.A., V. NEUHOFF and P. GLEES. Ultrastructural analysis of individual layers in the lateral geniculate body of the monkey. Z. Zellforsch. 87, 82-100. (1968). 10. CAMPOS-ORTEGA, J.A., P. GLEES and M. BLANK. Die absteigenden Verbindungen der Sehrinde des Halbaffen Galago.

  18. 20 CFR 217.8 - When one application satisfies the filing requirement for other benefits. (United States)


    ... employee died. (g) A child's annuity or child's full-time student annuity if the child of the employee was... divorce. (m) A divorced spouse annuity if the spouse claimant has remarried the employee during the six... effective date of the final decree of divorce and would also be entitled to a divorced spouse annuity not...

  19. 217 L'entourage d'un Fait d'expression Comme Guide a la ...

    African Journals Online (AJOL)

    Ike Odimegwu

    premier plan comme élément identificateur, C'est lui qui donne l'information la plus abondante et la plus exacte des .... froments d'informations relatifs au contexte du texte se réunissent pour construire un sens ... traduction a pour conséquences des fausses associations, des calques, insolites c'est-à-dire des traductions ...

  20. 217 An International Multi-Disciplinary Journal, Ethiopia Vol. 4 (1 ...

    African Journals Online (AJOL)


    the U.S nuclear and conventional forces for its security. France and the UK also possessed their own nuclear weapons, and most Western Europe countries based their defense around man conscript armies. What was then still call the EEC could only be a civilian power because of NATO and the. US security guarantee.

  1. Crisis Management: United States Reflagging of Kuwaiti Tankers (1987 - 1988) Politics 217 (United States)


    Secretary of State Murphy had a poignant exchange with Mr. Torricelli , (D) of New Jersey: MR TORRICELLI . Are you convinced that American destroyers...potential aggression’in the Gulf, the Silkworm missile being the most notable recent change. MR. TORRICELLI . The reason I am raising the question is, it...bitter than drinking poison, and Speaker of the Parliament Rafsanjani blamed Iran’s decision on the willingness of the United States to exercise Its

  2. Working Paper - 217 - Capital Account Policies, IMF Programs and Growth in Developing Regions


    Zorobabel Bicaba; Zuzana Brixiova; Mthuli Ncube


    This paper examines capital account policy choices in an innovative model with adaptive learning under uncertainty. In the model, countries’ past experiences and IMF programs influence policymakers’ beliefs about impact of capital account liberalization on growth, taking into account constraints imposed by the ‘Mundell’s trilemma’. The model, calibrated to data for Africa, Latin America and developing Asia, is consistent with capital account policies during 1980 – 2010, including the delayed ...

  3. : tous les projets | Page 217 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'établissement d'un réseau de politique étrangère à Ottawa aidera à combler certaines lacunes, à renforcer le milieu de la politique étrangère dans la région de la capitale nationale et à intégrer de jeunes professionnels aux travaux en cours. Date de début : 1 mars 2012. End Date: 28 février 2015. Sujet: FOREIGN ...

  4. 77 FR 217 - Medicare and Medicaid Programs: Hospital Outpatient Prospective Payment; Ambulatory Surgical... (United States)


    ... RIN 0938-AQ26 Medicare and Medicaid Programs: Hospital Outpatient Prospective Payment; Ambulatory Surgical Center Payment; Hospital Value-Based Purchasing Program; Physician Self-Referral; and Patient... (CMS), HHS. ACTION: Correction of final rule with comment period. SUMMARY: This document corrects...

  5. SU-D-217A-03: Nuclear Medicine Uniformity Assessment Using 2D Noise Power Spectrum. (United States)

    Nelson, J; Christianson, O; Harkness, B; Madsen, M; Mah, E; Thomas, S; Zaidi, H; Samei, E


    Nuclear medicine quality control programs require daily evaluation for the presence of potential non-uniformities by commonly utilizing a traditional pixel value-based assessment (Integral CFOVUniformity). While this method effectively captures regional non- uniformities in the image, it does not adequately reflect subtle periodic structures that are visually apparent and clinically unacceptable, therefore requiring the need for additional visual inspection of the image. The goal of this project was to develop a new uniformity assessment metric by targetingstructural patterns and more closely correlating with visual inspection. The new quantitative uniformity assessment metric is based on the 2D Noise Power Spectrum (NPS). A full 2D NPS was performed on each image. The NPS was thresholded to remove quantum noise and further filtered by the visual response function. A score, the Structure Noise Index (SNI), was then applied to each based on the average magnitude of the structured noise in the processed image. To verify the validity of the new metric, 50 daily uniformity images with varying degrees of visual structured and non-structured non-uniformity were scored by 5 expert nuclear medicine physicists. The correlation between the visual score and SNI were assessed. The Integral CFOV was also compared against the visual score. Our new SNI assessment metric compared to the Integral CFOV showed in increase in sensitivity from 67% to 100% in correctly identifying structured non-uniformities. The overall positive predictive value also increased from 55% to 72%. Our new uniformity metric correlates much more closely with visual assessment of structured non- uniform NM images than the traditional pixel-based method. Using this new metric in conjunction with the traditional pixel value-based assessment will allow a more accurate quantitative assessment of nuclear medicineuniformity. © 2012 American Association of Physicists in Medicine.

  6. 24 CFR 200.217 - Filing of previous participation certificate on prescribed form. (United States)


    ... or request to change the approved lessee operating a nursing home, assisted living, or skilled care facility; (9) With a bid to purchase a project being sold at foreclosure by HUD or by a foreclosure... organization by inheritance or court decree within 30 days after said acquisition or decree, but will not be...

  7. SU-D-217BCD-01: Corrupted DICOM Image Recovering: A Clinical Experience. (United States)

    Chen, L; Walz-Flannigan, A; Langer, S


    Colored DICOM secondary capture images generated from CT perfusion studies were corrupted if they were sent directly from a Siemens acquisition workstation to a GE viewing workstation. However, those images were properly displayed in the GE viewing workstation if they were transferred through a GE PACS first. The purpose of this work is to investigate the cause of image corruption and determine why passing through PACS corrected it. DICOM headers of corrupted and non-corrupted (sent through the PACS) images were compared with a free DICOM software tool (; the differences were highlighted. Certain header tags were found in non-corrupted images, but not in corrupted images. These tags were sequentially removed until the non- corrupted image became corrupted. Once a candidate tag was found, fresh corrupt images were modified by adding a 'repair' tag and tested. It was found that the absence of Planar Configuration (0028, 0006) is the cause of image corruption. This attribute is used in the DICOM color image to specify whether the color pixel data are sent color-by-plane or color-by- pixel and should be present if the Sample per Pixel (0028, 0002) tag has a value greater than 1. In our DICOM color images, the values of (0028, 0002) and Photometric Interpretation (0028, 0004) are 3 and RGB, respectively. Thus (0028, 0006) should equal 0 (color-by-pixel), which is used for uncompressed or lossless compressed transfer syntaxes. Adding this tag and setting the value to zero manually repaired corrupt images. Using open source DICOM tools and following the described process can be a valuable ally in the search for causes of image corruption. Comparing the headers and finding the handful of different tags rapidly led to an explanation that could be used by the vendor for a permanent fix. © 2012 American Association of Physicists in Medicine.

  8. 49 CFR 375.217 - How must I collect charges upon delivery? (United States)


    ... TRANSPORTATION OF HOUSEHOLD GOODS IN INTERSTATE COMMERCE; CONSUMER PROTECTION REGULATIONS Before Offering... service and the bill of lading. (c) Charge or credit card payments: (1) If you agree to accept payment by...

  9. 29 CFR 1603.217 - Decision of the administrative law judge. (United States)


    ... PROCEDURES FOR PREVIOUSLY EXEMPT STATE AND LOCAL GOVERNMENT EMPLOYEE COMPLAINTS OF EMPLOYMENT DISCRIMINATION... discrimination is found, and shall provide notice of appeal rights consistent with subpart C of this part. (b) The administrative law judge shall serve the decision promptly on all parties to the proceeding and...

  10. IIASA Reports, 6(2):217-407 (Completing Volume 6) (October-December 1982)



    This issue, which completes Volume 6, contains the following papers and the biographies of the contributing authors: -- V.G.Chant, "Two Global Scenarios: The Evolution of Energy Use and the Economy to 2030"; -- J.C. Stone et al., "Water Demand for Generating Electricity"; -- Z. Kos, "Stochastic Supplementary Irrigation Water Requirements in Water Resources Systems".

  11. 78 FR 66418 - Eighteenth Meeting: RTCA Special Committee 217-Aeronautical Databases Joint With EUROCAE WG-44... (United States)


    ...) 377 ``Air Traffic Management''--WG 2--Aerodrome Mapping Data Helicopter Terrain and Obstacle Data... data flow (text to support the figure agreed in Dublin) Monday Thru Thursday, Dec 2 Through Dec 5...

  12. 49 CFR 232.217 - Train brake tests conducted using yard air. (United States)


    ... air test device must be connected to the end of the train or block of cars that will be nearest to the... connected to other than the end nearest to the controlling locomotive. (c) Except as provided in this..., after which, a Class III brake test shall be performed as prescribed by § 232.211. (1) If the cars are...

  13. 18 CFR 2.17 - Price discrimination and anticompetitive effect (price squeeze issue). (United States)


    ... proceeding, the intervening customer or other interested person must support its allegation by a prima facie case. The elements of the prima facie case shall include at a minimum: (1) Specification of the filing... present their case, including prima facie showing, on price squeeze issues. (c) Within 30 days from the...

  14. Subtask 2.17 - CO2 Storage Efficiency in Deep Saline Formations

    Energy Technology Data Exchange (ETDEWEB)

    Gorecki, Charles D. [Univ. of North Dakota, Grand Forks, ND (United States); Liu, Guoxiang [Univ. of North Dakota, Grand Forks, ND (United States); Braunberger, Jason R. [Univ. of North Dakota, Grand Forks, ND (United States); Klenner, Robert C. L. [Univ. of North Dakota, Grand Forks, ND (United States); Ayash, Scott C. [Univ. of North Dakota, Grand Forks, ND (United States); Dotzenrod, Neil W. [Univ. of North Dakota, Grand Forks, ND (United States); Steadman, Edward N. [Univ. of North Dakota, Grand Forks, ND (United States); Harju, John A. [Univ. of North Dakota, Grand Forks, ND (United States)


    As the field of carbon capture and storage (CCS) continues to advance, and large-scale implementation of geologic carbon dioxide (CO2) storage progresses, it will be important to understand the potential of geologic formations to store meaningful amounts of CO2. Geologic CO2 storage in deep saline formations (DSFs) has been suggested as one of the best potential methods for reducing anthropogenic CO2 emission to the atmosphere, and as such, updated storage resource estimation methods will continue to be an important component for the widespread deployment of CCS around the world. While there have been several methodologies suggested in the literature, most of these methods are based on a volumetric calculation of the pore volume of the DSF multiplied by a storage efficiency term and do not consider the effect of site-specific dynamic factors such as injection rate, injection pattern, timing of injection, pressure interference between injection locations, and overall formation pressure buildup. These volumetric methods may be excellent for comparing the potential between particular formations or basins, but they have not been validated through real-world experience or full-formation injection simulations. Several studies have also suggested that the dynamic components of geologic storage may play the most important role in storing CO2 in DSFs but until now have not directly compared CO2 storage resource estimates made with volumetric methodologies to estimates made using dynamic CO2 storage methodologies. In this study, two DSFs, in geographically separate areas with geologically diverse properties, were evaluated with both volumetric and dynamic CO2 storage resource estimation methodologies to compare the results and determine the applicability of both approaches. In the end, it was determined that the dynamic CO2 storage resource potential is timedependent and it asymptotically approaches the volumetric CO2 storage resource potential over very long periods of time in the two systems that were evaluated. These results indicate that the volumetric assessments can be used as long as the appropriate storage efficiency terms are used and it is understood that it will take many wells over very long periods of time to fully realize the storage potential of a target formation. This subtask was funded through the Energy & Environmental Research Center (EERC)– U.S. Department of Energy (DOE) Joint Program on Research and Development for Fossil Energy-Related Resources Cooperative Agreement No. DE-FC26-08NT43291. Nonfederal funding was provided by the IEA Greenhouse Gas R&D Programme.

  15. Yeast Interacting Proteins Database: YHR171W, YBR217W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available th phosphatidylethanolamine, required steps in autophagosome formation Rows with ... of ubiquitin-activating enzymes; mediates the conjugation of Atg12p with Atg5p and Atg8p with phosphatidylethanolamine, required in autophagosome formation Rows with this bait as bait (1) Rows with this bait a

  16. Progress of Recycling in the Built Environment Final report of the RILEM Technical Committee 217-PRE

    CERN Document Server


    This report is a useful tool for countries starting to recycle aggregates or construction and demolition waste. It contains the latest developments in this field, introduces a completely new approach to the procedure of proportioning concrete mixtures with recycled aggregate, references recent publications, opinions and discrepancies in relation to the durability of recycled concrete, such as freeze-thaw standards, studies of chloride penetration and diffusion, and sulfate attacks, the use of the fine fraction <4mm, quality assurance of concrete recycled aggregate, sustainability and recycling construction waste and global impact assessment of urban renewal based on sustainable recycling strategies for construction and demolition waste. This volume will be of interest to recyclers, researchers and consumers.

  17. Yeast Interacting Proteins Database: YBR217W, YLR423C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available protein responsible for phagophore assembly site organization; regulatory subunit of an autophagy-specific...protein responsible for phagophore assembly site organization; regulatory subunit of an autophagy-specific

  18. 40 CFR 63.217 - What definitions apply to this subpart? (United States)


    ... National Emission Standards for Hazardous Air Pollutants for Polyvinyl Chloride and Copolymers Production... CFR 61.61 of this chapter, the Vinyl Chloride NESHAP; and, § 63.2, in regard to terms used in §§ 63.1...

  19. Basic webliography on health promotion and disease prevention - doi:10.5020/18061230.2009.p217

    Directory of Open Access Journals (Sweden)

    Ana Claudia Camargo Gonçalves da Silva


    Full Text Available Objectives: To introduce a basic webliography to access highly qualified evidence-based material on health promotion and disease prevention, aiming at the continuing education of health professionals. Methods: By means of Google® browser, applying the descriptors in sequence to progressively refine the search on Internet and key concepts to be learned, all previously defined by the authors themselves, we proceeded a qualitative analyses of the 20 first listed links for each searched issue and the final selection of the most scientifically relevant ones. Results: The 34 selected links are presented in 4 groups: 23 portals, 5 guides and recommendations, 4 scientific journals and 3 blogs that allow free access to health promotion and disease prevention related subjects, such as: concepts; national and international public policies; epidemiology, statistics and health indicators; diseases screening and prophylaxis; counseling for behavior change of health related habits; and interdisciplinary work. Among the selected links 10 (29% are written in English while the others are in Portuguese. Conclusions: The identification of reading materials on health promotion and disease prevention available on Internet, many in Portuguese, allowed us to select relevant scientifically qualified literature and turn it accessible to health professionals, enabling the acquisition of new knowledge or quick update.

  20. 217. Experiencia en asistencia circulatoria mecánica en nuestro centro

    Directory of Open Access Journals (Sweden)

    J. Otero


    Conclusiones: Dada la gravedad de estos pacientes, con mortalidad cercana al 100% sin asistencia, consideramos el beneficio que aporta esta técnica y la gran utilidad que representa su disponibilidad.

  1. 7 CFR 58.217 - Evaporators and/or vacuum pans. (United States)


    ..., GENERAL SPECIFICATIONS FOR APPROVED PLANTS AND STANDARDS FOR GRADES OF DAIRY PRODUCTS 1 General Specifications for Dairy Plants Approved for USDA Inspection and Grading Service 1 Equipment and Utensils § 58... water with entrained solids to the waste water system. “Cow water” shall not be used for acidified or...


    Directory of Open Access Journals (Sweden)

    Ali Ghavidel


    Full Text Available Introduction: Secondary aortoenteric fistula (SAF is an uncommon, but very important complication of abdominal aortic reconstruction. The complication often occurs months to years after aortic surgery. The clinical manifestation of the aortoenteric fistula is always upper gastrointestinal bleeding. Treatment of the disease is early surgical intervention. If operative treatment is not performed promptly, the mortality is high. Case Report: A case of secondary aortoduodenal fistula found 6 years after aortic reconstructive surgery, with the clinical presentation of upper gastrointestinal bleeding because of the increasing number of elective aortic aneurysm repairs in the aging population, it is likely that more patients with SAF will present to the clinical physicians in the future. Hence, a high index of suspicion is necessary for prompt diagnosis and treatment of this lifethreatening event. The patient treated medically and finally expiration of the patient and review of the literature currently available in Medline. Conclusion: The aim of this case report is to emphasize early diagnosis and management of all gastrointestinal bleeding in patients who have a history of aortic reconstructive surgery.

  3. The 17O hyperfine interaction in V17O(H217O)52+ and Mn(H217O)62+ determined by high field ENDOR aided by DFT calculations. (United States)

    Baute, Debbie; Goldfarb, Daniella


    The 17O hyperfine interaction of the water ligands and the V=O oxygen in the vanadyl aquo complex and of the water ligands in the Mn2+ aquo complex in a frozen solution were determined by W-band (95 GHz) electron-nuclear double resonance (ENDOR). Orientation selective ENDOR spectra of the vanadyl complex exhibited two distinct signals assigned to the vanadyl oxygen and the water ligands. The assignment of the signals was done based on the orientation of the principal axis system of the hyperfine interaction and through comparison with the hyperfine interaction predicted by DFT calculations. The latter showed good agreement with the experimental values thus providing clear evidence that the vanadyl oxygen is exchangeable. The interaction of the vanadyl oxygen, especially its anisotropic part, was significantly larger than that of the water oxygens due to a relatively large negative spin density on the oxygen p orbitals. The 17O hyperfine interaction of the water ligand in the Mn2+ complex was found to be similar to that of the water ligand in the vanadyl complex and was in good agreement with earlier single-crystal data. Here, due to the large thermal polarization, it was also possible to determine the absolute sign of the hyperfine coupling by selecting different EPR transitions.

  4. 50 CFR 226.217 - Critical habitat for the Gulf of Maine Distinct Population Segment of Atlantic Salmon (Salmo salar). (United States)


    ... space and diverse, abundant food resources to support growth and survival; waterways that allow for free... diverse food resources to support growth and survival of Atlantic salmon parr; (viii) Freshwater and... HUC 10 Name Status Economic (E), Military (M), orTribal (T) exclusions 1 0102000101 North Branch...

  5. The Planck-ATCA Co-eval Observations (PACO) project: analysis of radio source properties between 5 and 217 GHz


    Massardi, Marcella; Bonaldi, Anna; Bonavera, Laura; de Zotti, Gianfranco; Lopez-Caniego, Marcos; Galluzzi, Vincenzo


    The Planck-ATCA Co-eval Observations (PACO) project has yielded observations of 464 sources with the Australia Telescope Compact Array (ATCA) between 4.5 and 40 GHz. The main purpose of the project was to investigate the spectral properties of mm-selected radio sources at frequencies below and overlapping with the ESA's Planck satellite frequency bands, minimizing the variability effects by observing almost simultaneously with the first two Planck all-sky surveys. In this paper we present the...

  6. Expanding Off-Campus Enrollment Capacity at Berkeley: A Concept Paper. Research & Occasional Paper Series: CSHE.2.17 (United States)

    Geiser, Saul


    Like Berkeley, the UC system as a whole is quickly running out of space to accommodate the next generation of Californians who will be reaching college age by mid-century. Even with the added capacity at UC Merced, the UC system will run out of space on existing campuses in the next decade. In the normal course of events, this would trigger…

  7. In vivo emergence of Aspergillus terreus with reduced azole susceptibility and a Cyp51a M217I alteration

    DEFF Research Database (Denmark)

    Arendrup, Maiken C; Jensen, Rasmus; Grif, Katharina


    Azole resistance in Aspergillus terreus isolates was explored. Twenty related (MB) and 6 unrelated A. terreus isolates were included. CYP51A sequencing and RAPD genotyping was performed. Five MB isolates were itraconazole susceptible, whereas the minimum inhibitory concentrations (MICs) for 15 MB...... isolates were elevated (1-2 mg/L). Voriconazole and posaconazole MICs were 0.5-4 and 0.06-0.5 mg/L, respectively, for MB isolates but 0.25-0.5 and...

  8. 217. Predictores de insuficiencia renal aguda en pacientes con enfermedad aórtica sometidos a parada circulatoria

    Directory of Open Access Journals (Sweden)

    E. Sarria García


    Conclusiones: La incidencia de IRA en pacientes sometidos a PCH es elevada, presumiblemente, siendo un factor de riesgo de mortalidad. El tiempo de CEC, hematocrito bajo y diuresis durante CEC parecen ser factores pronósticos para su desarrollo, por lo que deben optimizarse las medidas preventivas.

  9. 77 FR 14584 - Eleventh Meeting: RTCA Special Committee 217, Joint With EUROCAE Working Group-44, Terrain and... (United States)


    ... for document(s) update within the current schedule. Finalize the draft for release to the FRAC process... Participation Continue to prioritize in terms of ``next document release or later''. Leadership Report on the...

  10. [Galen of Pergamum (129-216/217 AD) and his contribution to urology: part I: life, work and medical system]. (United States)

    Marx, F J


    Galen of Pergamum was, along with Hippocrates, the most influential physician and undoubtedly the most important medical scholar of classical antiquity. His anatomy and his concept of humoral pathology dominated western medicine until the sixteenth century and influenced all fields of medicine until after the seventeenth century. After referring to some biographical data the philosophical and epistemic fundamentals of Galen's"medical system" are outlined and brought into relation with the prevailing medical sects of the second century AD. The very treatises of his enormous work which are the most relevant with reference to the issue are briefly characterized.In the second part of the paper to be published in one of the next issues of this journal, Galen's significant contributions to the speciality we today define as urology are presented and analyzed. In addition pertinent case reports based on the Greek original texts will illustrate and substantiate his theoretical and clinical approach to the urology patient. Finally the significance of Galen's thinking for the present day physician will be evaluated.

  11. 75 FR 10552 - Sixth Meeting-RTCA Special Committee 217: Joint With EUROCAE WG-44 Terrain and Airport Mapping... (United States)


    ... requirements Allan Hart, SESAR WP9 Working Group Report Outs (Status) Applications Data Quality--Non-Numeric Requirements Data Quality--Numeric Requirements Guidance Materials Temporality Content Connectivity Tuesday... required)--Committee Coordination SC-186 ISRA Review and Response Planning SC-214 Requirements Review and...

  12. Performance Standards and Employee Effort: Evidence from Teacher Absences. Upjohn Institute Working Paper No. 15-217 (United States)

    Gershenson, Seth


    The 2001 No Child Left Behind Act (NCLB) increased accountability pressure in U.S. public schools by threatening to impose sanctions on Title 1 schools that failed to make adequate yearly progress (AYP) in consecutive years. Difference-in-difference estimates of the effect of failing AYP in the first year of NCLB on teacher effort in the…

  13. Derivation of Soil Screening Guidelines for Gross Alpha/Beta Radioactivity for United States Air Force Deployment Sites (United States)


    the emission of 7 alpha particles and 4 beta particles. Three radionuclides ( francium -223, astatine-215, and polonium-211) are not listed no Uranium-233 159,200 y alpha yes no Thorium-229 7,300 y alpha yes no Radium-225 14.9 d beta no no Actinium-225 10.0 d alpha no no Francium

  14. δ37Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.


    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine.

  15. δ³⁷Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.


    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine. This thesis presents the first chlorine

  16. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.


    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  17. WE-C-217BCD-03: Restricted Data Set Reconstruction Based on Respiration Quality to Improve Prospectively Gated in Vivo Micro-CT of Mice. (United States)

    Burk, L; Lee, Y; Lu, J; Zhou, O


    Micro-CT is commonly employed for lung imaging of mice; prospective gating allows for in-vivo imaging of free-breathing subjects. While this technique is successfully executed for healthy animals, results are less consistent for some disease models whose symptoms include irregular or unstable respiration. The purpose of this work is to repair the quality of high-blur images that arise from respiration instability using a retrospective method of motion reduction which identifies the individual x-ray projection images contributing most to the motion blur. Reconstructions were performed after the exclusion of these projections (the so-called restricted set). Sixteen mice were imaged using field emission cone beam micro-CT and prospective gating with a bellows-type respiration sensor. The scanner was operated in step-and-shoot mode; 400 projection images were acquired per scan. An algorithm was developed to analyze the respiration trace file and segment the individual breath corresponding to each projection image. We tested three different criteria to define a bad breath shape (correlation, mean breath height, or mode breath height), and restricted data set reconstructions were performed using each of these criteria to exclude projections corresponding to bad breaths. Each restricted set was compared against the full unrestricted data set image; the slope perpendicular to the diaphragm was used as a quantitative assessment of motion blur. All image sets saw a reduction in motion blur with at least one restriction technique. In 22 of 27 images, improvement was measured regardless of the removal criterion. Five percent total projection removal is optimal; a more aggressive correction increases the likelihood of under-sampling artifacts. Removing a subset of bad projections from otherwise complete image sets measurably decreases motion blur in respiratory-gated imaging. An approach based on breath height generally provides the best results. The technique is applicable to a variety of imaging modalities. © 2012 American Association of Physicists in Medicine.

  18. The crystal structure of franckeite, Pb21.7Sn9.3Fe4.0Sb8.1S56.9

    DEFF Research Database (Denmark)

    Makovicky, Emil; Petricek, Vaclav; Dusek, Michal


    The layer-like crystal structure of franckeite from the mine of San José, Bolivia, exhibits a pronounced one-dimensional transversal wave-like modulation and a non-commensurate layer match in two dimensions. It consists of alternating pseudohexagonal (H) layers and pseudotetragonal (Q) slabs...... and H stacking directions, and the divergence between modulation wave-front and these stacking directions are typical for the composite structures of franckeite and cylindrite. Because of the increased rigidity of the Q component, franckeite usually forms masses of curved crystals rather than...... cylindrical aggregates. The existence of this family depends critically on the radius ratios of the cations involved, especially those involving (Pb2+, Sn2+) and Sn4+. Their replacement by a Pb2+:Bi3+ combination leads to misfit layer structures of a very different type, typified by cannizzarite....

  19. SU-F-J-217: Accurate Dose Volume Parameters Calculation for Revealing Rectum Dose-Toxicity Effect Using Deformable Registration in Cervical Cancer Brachytherapy: A Pilot Study

    Energy Technology Data Exchange (ETDEWEB)

    Zhen, X; Chen, H; Liao, Y; Zhou, L [Southern Medical University, Guangzhou, Guangdong (China); Hrycushko, B; Albuquerque, K; Gu, X [UT Southwestern Medical Center, Dallas, TX (United States)


    Purpose: To study the feasibility of employing deformable registration methods for accurate rectum dose volume parameters calculation and their potentials in revealing rectum dose-toxicity between complication and non-complication cervical cancer patients with brachytherapy treatment. Method and Materials: Data from 60 patients treated with BT including planning images, treatment plans, and follow-up clinical exam were retrospectively collected. Among them, 12 patients complained about hematochezia were further examined with colonoscopy and scored as Grade 1–3 complication (CP). Meanwhile, another 12 non-complication (NCP) patients were selected as a reference group. To seek for potential gains in rectum toxicity prediction when fractional anatomical deformations are account for, the rectum dose volume parameters D0.1/1/2cc of the selected patients were retrospectively computed by three different approaches: the simple “worstcase scenario” (WS) addition method, an intensity-based deformable image registration (DIR) algorithm-Demons, and a more accurate, recent developed local topology preserved non-rigid point matching algorithm (TOP). Statistical significance of the differences between rectum doses of the CP group and the NCP group were tested by a two-tailed t-test and results were considered to be statistically significant if p < 0.05. Results: For the D0.1cc, no statistical differences are found between the CP and NCP group in all three methods. For the D1cc, dose difference is not detected by the WS method, however, statistical differences between the two groups are observed by both Demons and TOP, and more evident in TOP. For the D2cc, the CP and NCP cases are statistically significance of the difference for all three methods but more pronounced with TOP. Conclusion: In this study, we calculated the rectum D0.1/1/2cc by simple WS addition and two DIR methods and seek for gains in rectum toxicity prediction. The results favor the claim that accurate dose deformation and summation tend to be more sensitive in unveiling the dose-toxicity relationship. This work is supported in part by grant from VARIAN MEDICAL SYSTEMS INC, the National Natural Science Foundation of China (no 81428019 and no 81301940), the Guangdong Natural Science Foundation (2015A030313302)and the 2015 Pearl River S&T Nova Program of Guangzhou (201506010096).

  20. SU-D-217A-05: Auto-Registration of Cardiac PET/CT Images with a 3D Weighted Gradient Correlation Algorithm. (United States)

    Ai, H; Pan, T


    To design a novel 3D automatic registration algorithm for cardiac PET/CT registration using gradient information and to evaluate the performance of the algorithm with clinical PET/CT datasets. The 512×512×47 CT images are at first resized to 128×128×47 to match the matrix size of PET. In order to maximize the gradient information at boundaries in CT, a conventional fuzzy c-means clustering algorithm (number of cluster = 7) is implemented to suppress signals from tissues that do not contribute much useful information for the registration purpose (fat, lung, and bones). The 3D Image gradient map, consisting of all three orthogonal components, is derived from the PET images and the post- clustering CT images. The mis-registration is modeled as 3D rigid body translation in this study, though it can be extended to include rotations as well. The details of the gradient-based objective function are described in the support document. Optimal registration is determined by searching for the maximum of the objective function over a range of potential translation positions (e.g. 8.2×8.2×2.8cm). This process is repeated at a higher matrix size (512×512×47) to refine the result of registration. We applied this auto registration technique on 55 patient data sets of cardiac PET/CT images. The CT images were average-CT images, and the PET images were without attenuation correction. 54 out of the 55 cases produced satisfactory registration. The proposed weighted gradient correlation algorithm is a viable solution for auto registration of cardiac PET/CT images. More work is needed to further improve the robustness of thealgorithm. © 2012 American Association of Physicists in Medicine.

  1. 26 CFR 1.217-2 - Deduction for moving expenses paid or incurred in taxable years beginning after December 31, 1969. (United States)


    ... addition, A detours into Mexico for sightseeing. Because of the stopovers and tour into Mexico, A's travel... vehicle. Since A's excursion into Mexico is away from the usual Boston-Los Angeles route, the portion of... employment there. Thus, while a member of a railroad crew may spend most of his working time aboard a train...

  2. Melhaoui Mohammed, Peste, contagion et martyre. Histoire du fléau en Occident médiéval, Paris, Publisud, 2005, 217 p.

    Directory of Open Access Journals (Sweden)

    Stéphane Barry


    Full Text Available En France, à l’exception des études du médecin, historien et démographe Jean-Noël Biraben (1975-1976, peu de travaux existent sur la Peste noire et ses conséquences dans l’Occident musulman médiéval. On comprendra alors tout l’intérêt de l’ouvrage de Mohammed Melhaoui sur ce thème qu’il connaît bien puisqu’il lui a consacré non seulement une thèse de doctorat d’histoire, mais aussi quelques études portant notamment sur la « perception de la peste en pays chrétiens byzantins et musulman » (Co...

  3. PS2-17: Diabetes Social Support Feasibility Pilot Study: Utilizing Mobile Technology and Self-Identified Supporters to Enhance Self-Monitoring of Blood Glucose (United States)

    Robinson, Brandi; Roblin, Douglas; Hipkens, James; Vupputuri, Suma; McMahon, Kevin


    Background and Aims: Self-monitoring of blood glucose (SMBG) is associated with improved glycemic control among patients with type 2 diabetes, however, the practice of daily self-monitoring is not optimal. Telecommunications technology may improve adherence to recommended self-management practices by remotely transmitting automated reminders to motivate patients, and utilizing social networking for peer support. The purpose of this pilot study is to demonstrate the feasibility and usability of mobile technology and the potential added value of social support to improve SMBG frequency and glycemic control among adults with type 2 diabetes. Methods: Adults 25–74 years of age with type 2 DM and an average HbA1c > 8.0% were recruited from Kaiser Permanente Georgia (KPGA) and Oakhurst Medical Center (OMC, a community health clinic) to participate in a 3-month study using wireless technology. Enrollment sessions with presentations on SMBG techniques, use of the wireless technology, and motivational coaching to enhance social support were conducted in November 2009. During the subsequent 3-months, both diabetes patients and their self-selected supporters will receive text messages to their cell phones summarizing a patient’s SMBG frequency and levels. Participants and their supporters will attend a disenrollment session in February 2010 when feasibility and usability will be assessed in focus groups. Results: 6 of 161 eligible diabetes patients at KPGA and 9 of 28 eligible diabetes patients at OMC, and their self-selected supporters, consented to participate. The average age of diabetes patients was 49.3 years. 86.7% (N=13) were African-American; and 33.3% (N=5) were male. Five days after enrollment, 60% (N=9) of patients had connected their wireless transmitters and had current blood glucose data. Follow-up phone calls will be made to ensure that all participants are connected to the wireless technology within 10 days of the enrollment session. Conclusion: Integrating mobile telecommunications technology with chronic disease management may empower patients in their own self-care and ease the burden on health care providers. Our study will evaluate the potential for studying the use of wireless mobile technology in a larger randomized controlled trial and will obtain participant comments on what changes might improve participant compliance.

  4. "Poor Banished Children of Eve": Tom Murphy and the syntax of historyDOI:10.5007/2175-8026.2010n58p217

    Directory of Open Access Journals (Sweden)

    Paul Murphy


    Full Text Available This essay engages with the work of playwright Tom Murphy and suggests that Murphy synthesizes the dialectic between past and present by representing history as a process of story-telling, where hegemonic Catholic bourgeois nationalist history is contradicted by repressed discourses of class and gender.   The aim is to move beyond a reading of Irish theatre grounded in identitarian paradigms of nation and nationalism, towards an engagement with ethical issues of class and gender subordination which are as much a part of Irish cultural politics as the nation is or ever was.

  5. SU-E-J-217: Multiparametric MR Imaging of Cranial Tumors On a Dedicated 1.0T MR Simulator Prior to Stereotactic Radiosurgery

    Energy Technology Data Exchange (ETDEWEB)

    Wen, N; Glide-Hurst, C; Liu, M; Hearshen, D; Brown, S; Siddiqui, S; Chetty, I [Henry Ford Health System, Detroit, MI (United States)


    Purpose: Quantitative magnetic resonance imaging (MRI) of cranial lesions prior to stereotactic radiosurgery (SRS) may improve treatment planning and provide potential prognostic value. The practicality and logistics of acquiring advanced multiparametric MRI sequences to measure vascular and cellular properties of cerebral tumors are explored on a 1.0 Tesla MR Simulator. Methods: MR simulation was performed immediately following routine CT simulation on a 1T MR Simulator. MR sequences used were in the order they were performed: T2-Weighted Turbo Spin Echo (T2W-TSE), T2 FLAIR, Diffusion-weighted (DWI, b = 0, 800 to generate an apparent diffusion coefficient (ADC) map), 3D T1-Weighted Fast Field Echo (T1W-FFE), Dynamic Contrast Enhanced (DCE) and Post Gadolinium Contrast Enhanced 3D T1W-FFE images. T1 pre-contrast values was generated by acquiring six different flip angles. The arterial input function was derived from arterial pixels in the perfusion images selected manually. The extended Tofts model was used to generate the permeability maps. Routine MRI scans took about 30 minutes to complete; the additional scans added 12 minutes. Results: To date, seven patients with cerebral tumors have been imaged and tumor physiology characterized. For example, on a glioblastoma patient, the volume contoured on T1 Gd images, ADC map and the pharmacokinetic map (Ktrans) were 1.9, 1.4, and 1.5 cc respectively with strong spatial correlation. The mean ADC value of the entire volume was 1141 μm2/s while the value in the white matter was 811 μm2/s. The mean value of Ktrans was 0.02 min-1 in the tumor volume and 0.00 in the normal white matter. Conclusion: Our initial results suggest that multiparametric MRI sequences may provide a more quantitative evaluation of vascular and tumor properties. Implementing functional imaging during MR-SIM may be particularly beneficial in assessing tumor extent, differentiating radiation necrosis from tumor recurrence, and establishing reliable bio-markers for treatment response evaluation. The Department of Radiation Oncology at Henry Ford Health System has research agreement with Varian Medical System and Philips Health Care.

  6. O papel subestimado do interlocutor na abordagem cognitiva da metáfora DOI - 10.5752/P.2358-3428.2014v18n34p217

    Directory of Open Access Journals (Sweden)

    Ulrike Schröder


    Full Text Available Uma das maiores críticas voltadas para a Teoria da Metáfora Conceitual é que Lakoff e Johnson (2003, 1999 partem de uma constelação idealizada de interlocutores, de modo que o processo da compreensão de uma metáfora simplesmente se dá por meio da ativação de metáforas conceptuais, entrincheiradas no cérebro dos participantes (GIBBS, 2007. Procurar-se-á investigar quais as abordagens que dirigem sua atenção ao ouvinte como parte ativa por coconstruir o significado particular da expressão metafórica em dependência do contexto pragmático, social e cultural em que os interlocutores estão inseridos. A questão central é até que ponto os estudos existentes conseguem reintegrar o processo holístico da comunicação, e, para tal, distinguimos entre três linhas de pesquisa a serem aprofundadas: estudos psicolinguísticos, textual-discursivos e pragmático-interacionais.Palavras-chave: Teoria da Metáfora Conceitual. Interlocutor. Compreensão. Comunicação. Interação.

  7. The hyperfine structure in the rotational spectra of D2(17)O and HD(17)O: Confirmation of the absolute nuclear magnetic shielding scale for oxygen. (United States)

    Puzzarini, Cristina; Cazzoli, Gabriele; Harding, Michael E; Vázquez, Juana; Gauss, Jürgen


    Guided by theoretical predictions, the hyperfine structures of the rotational spectra of mono- and bideuterated-water containing (17)O have been experimentally investigated. To reach sub-Doppler resolution, required to resolve the hyperfine structure due to deuterium quadrupole coupling as well as to spin-rotation (SR) and dipolar spin-spin couplings, the Lamb-dip technique has been employed. The experimental investigation and in particular, the spectral analysis have been supported by high-level quantum-chemical computations employing coupled-cluster techniques and, for the first time, a complete experimental determination of the hyperfine parameters involved was possible. The experimentally determined (17)O spin-rotation constants of D2 (17)O and HD(17)O were used to derive the paramagnetic part of the corresponding nuclear magnetic shielding constants. Together with the computed diamagnetic contributions as well as the vibrational and temperature corrections, the latter constants have been employed to confirm the oxygen nuclear magnetic shielding scale, recently established on the basis of spin-rotation data for H2 (17)O [Puzzarini et al., J. Chem. Phys. 131, 234304 (2009)].

  8. SU-F-T-217: A Comprehensive Monte-Carlo Study of Out-Of-Field Secondary Neutron Spectra in a Scanned-Beam Proton Therapy Treatment Room

    Energy Technology Data Exchange (ETDEWEB)

    Englbrecht, F; Parodi, K [LMU Munich, Department of Medical Physics, Garching / Munich, Bavaria (Germany); Trinkl, S; Mares, V; Ruehm, W; Wielunski, M [Helmholtz Zentrum Munich, Institute of Radiation Protection, Neuherberg, Bavaria (Germany); Wilkens, J [Technical University of Munich, Department of Physics, Munich, Germany, Garching, Bavaria (Germany); Klinikum rechts der Isar, Department of Radiation Oncology, Munich (Germany); Hillbrand, M [Rinecker Proton Therapy Center, Munich, Bavaria (Germany)


    Purpose: To simulate secondary neutron radiation-fields produced at different positions during phantom irradiation inside a scanning proton therapy gantry treatment room. Further, to identify origin, energy distribution and angular emission as function of proton beam energy. Methods: GEANT4 and FLUKA Monte-Carlo codes were used to model the relevant parts of the treatment room in a gantry-equipped pencil beam scanning proton therapy facility including walls, floor, metallic gantry-components, patient table and the homogeneous PMMA target. The proton beams were modeled based on experimental beam ranges in water and spot shapes in air. Neutron energy spectra were simulated at 0°, 45°, 90° and 135° relative to the beam axis at 2m distance from isocenter, as well as 11×11 cm2 fields for 75MeV, 140MeV, 200MeV and for 118MeV with 5cm PMMA range-shifter. The total neutron energy distribution was recorded for these four positions and proton energies. Additionally, the room-components generating secondary neutrons in the room and their contributions to the total spectrum were identified and quantified. Results: FLUKA and GEANT4 simulated neutron spectra showed good general agreement in the whole energy range of 10{sup −}9 to 10{sup 2} MeV. Comparison of measured spectra with the simulated contributions of the various room components helped to limit the complexity of the room model, by identifying the dominant contributions to the secondary neutron spectrum. The iron of the bending magnet and counterweight were identified as sources of secondary evaporation-neutrons, which were lacking in simplified room models. Conclusion: Thorough Monte-Carlo simulations have been performed to complement Bonner-sphere spectrometry measurements of secondary neutrons in a clinical proton therapy treatment room. Such calculations helped disentangling the origin of secondary neutrons and their dominant contributions to measured spectra, besides providing a useful validation of widely used Monte-Carlo packages in comparison to experimental data. Cluster of Excellence of the German Research Foundation (DFG) “Munich-Centre for Advanced Photonics (MAP)”.

  9. 47 CFR 95.217 - (R/C Rule 17) May I operate my R/C station transmitter by remote control? (United States)


    ... records. See R/C Rule 24, § 95.224. (c) Remote control means operation of an R/C transmitter from any place other than the location of the R/C transmitter. Direct mechanical control or direct electrical control by wire from some point on the same premises, craft or vehicles as the R/C transmitter is not...

  10. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  11. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita


    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  12. Production cross section of At radionuclides from 7Li+natPb and 9Be+natTl reactions (United States)

    Maiti, Moumita; Lahiri, Susanta


    Earlier we reported theoretical studies on the probable production of astatine radionuclides from 6,7Li- and 9Be-induced reactions on natural lead and thallium targets, respectively. The production of astatine radionuclides were investigated experimentally with two heavy-ion-induced reactions: 9Be + natTl and 7Li + natPb. Formation cross sections of the evaporation residues, 207,208,209,210At, produced in the (HI,xn) channel, were measured by the stacked-foil technique followed by off-line γ spectrometry at low incident energies (<50 MeV). Measured excitation functions were interpreted in terms of a compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach models. Measured cross-section values are lower than the respective theoretical predictions.

  13. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    Energy Technology Data Exchange (ETDEWEB)

    Koziorowski, J


    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on {sup 211}At and {sup 124}I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[{sup 211}At]astato-2`-deoxyuridine (AUdR) and N-succinimidyl-4-[{sup 211}At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [{sup 124}I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[{sup 124}I]iodo-2`-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for

  14. Protein (Cyanobacteria): 52368 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available YP_007318423.1 1117:958 1118:14 217161:217 1173032:217 1173020:217 multimeric flavodoxin WrbA Chamaes...iphon minutus PCC 6605 MGSVAIIYFSGTGNTHLMAEAIASGVRHADTRVDLLRIEGIQIKDGRWFDEKFMESLQMADAILFGS

  15. Thermosalinograph data of the Hawaii Ocean Time-series (HOT) program in the North Pacific, 100 Miles North of Oahu, Hawaii for cruises HOT208-217 during 2009 (NCEI Accession 0069501) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  16. WE-C-217BCD-07: Best in Physics (Joint Eyiaging-Therapy) - Direct Imaging of the Uptake of Platinum Anticancer Agents Using X-Ray Stimulated Fluorescence: A Proof-Of-Concept Study. (United States)

    Kuang, Y; Pratx, G; Qian, J; Meng, B; Bazalova, M; Xing, L


    Platinum-based (Pt) chemotherapy has greatly improved the initial response rate of different cancers. However, relapse of a drug-resistant tumor occurs with a high frequency, resulting in poor long term survival. The most common phenotype of Pt chemoresistance is decreased Pt drug accumulation in the tumor region due to either decreased influx or increased efflux, which is invisible for current imaging modalities. The inability of imaging methods to directly image the Pt drug uptake has resulted in a very unfavorable scenario for early assessment of chemotherapeutic efficacy as well as for personalized treatment planning. In this study, we investigated the feasibility of imaging the uptake and retention of Pt drugs using x-ray stimulated fluorescence CT (XSF-CT). Pt is a high atomic number element, and it emits XSF photons when excited by ionizing photons. Therefore, the alteration of spatial distribution and concentration of Pt drugs in the cancer region could be monitored with XSF-CT. In this study, a polychromatic X-ray source was used to stimulate emission of XSF photons from the Pt drugs. XSF-CT used a first-generation CT geometry. The data were collected using a cadmium telluride detector to sort out a set of spectra. The spectra were then used to generate sinogram. The bio distribution and concentration of each element were reconstructed with the ML-EM algorithm. The reconstructed images clearly identified the distributions of cisplatin. A good linearity between XSF intensities and the concentrations of cisplatin was also observed, suggesting that XSF-CT is capable of quantitative imaging. The X-ray dose for stimulating the XSF photon was 0.25 cGy per projection. XSF-CT has the potential to be a promising modality for monitoring the intervention processes within X-ray scanners. It would afford a powerful way to reliably modify an ineffective treatment regimen in nearly real time. This work was supported by NIH/NCI grants (CA133474, CA153587), an NSF grant (0854492) and a grant from the Friends for an Earlier Breast Cancer Test Foundation. © 2012 American Association of Physicists in Medicine.

  17. High Personal Activity and its Sociological MeasurementReview of the book:Muzykant V.L. Psychology and Sociologyin Advertising. M.: RIOR-INFRA-M, 2012. 217 p.

    Directory of Open Access Journals (Sweden)

    I B Lapshin


    Full Text Available This article is a review of the book Psychology and Sociology in Advertising, systematizing the latest developments in sociology and psychology, which can be used in designing and applying the strategy of brand building.

  18. Multibeam collection for KN217: Multibeam data collected aboard Knorr from 2014-04-07 to 2014-04-19, departing from Woods Hole, MA and returning to Woods Hole, MA (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  19. Potential for Cell-Transplant Therapy with Human Neuronal Precursors to Treat Neuropathic Pain in Models of PNS and CNS Injury: Comparison of hNT2.17 and hNT2.19 Cell Lines (United States)


    technology [207]. Any consortium would evaluate how these novel ethical issues in emerging technologies are ad- dressed under current oversight and...animal care, and euthanasia were performed in accordance with the Laboratory Animal Welfare Act, Guide for the Care and Use of Laboratory Animals (National...rat chow and water ad lib on a 12/12 hr light/dark cycle. All surgical interventions, pre- and postsurgical animal care, and euthanasia were performed

  20. Niskin bottle data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT208-217 during 2009 (NODC Accession 0069177) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  1. Toxicidad, acumulación y efectos fisiológicos del colorante premetalizado C.I. Acid Violet 66 y su base azoica C.I. Acid Red 217 en la trucha Arcoiris Salmo Gairdneri R.


    Riva Juan, Mª del Carmen


    El objetivo fundamental de esta Tesis ha sido una ampliación de conocimientos sobre toxicidad y efectos de los colorantes premetalizados en la trucha arcoiris Salmogairdneri. Se ha dedicado especial atención a la toxicocinética del colorante premetalizado (acumulación y eliminación, tanto de colorante como de cromo y base azoica, en diferentes órganos y partes del cuerpo de los animales), así como a los efectos a nivel sanguíneo y en algunas características histológicas. The main objective...

  2. Incidence of live-attenuated influenza vaccine administration beyond expiry date in children and adolescents aged 2-17 years in the UK: a population-based cohort study

    National Research Council Canada - National Science Library

    Herve Caspard; Robert P Wise; Amy Steffey; Robert S Brody


    Objectives To estimate the proportion of live-attenuated influenza vaccine (LAIV) doses administered beyond expiry date in children and adolescents during influenza seasons 2013-2014 and 2014-2015 in the UK...

  3. 217 YAP Is Ready to Rac and Rho: Elucidation of a Novel YAP-Driven Network That Potentiates Brain Cancer Cell Dispersal and Confers Poor Survival in Patients. (United States)

    Shah, Sagar R; Tippens, Nathaniel; Park, JinSeok; Mohyeldin, Ahmed; Vela, Guillermo; Martinez-Gutierrez, Juan Carlos; Margolis, Seth S; Schmidt, Susanne; Levchenko, Andre; Quinones-Hinojosa, Alfredo


    Molecular pathways linking cell polarization and migration to extracellular cues regulate many pathological processes, including progression of aggressive and infiltrative cancers. Glioblastoma (GBM), the most common and lethal form of primary brain cancer, is characterized by its pronounced ability to disseminate into the intricate microenvironment of the human brain, confounding surgical excision and radiotherapy, leading to a median patient survival of 14 months. Progression results from defects in molecular pathways linking cell migration and invasion into surrounding tissue. However, the molecular engines are not known. Using patient-derived GBM tissues and cells, we profiled the expression of network moieties via Western blotting, quantitative real-time polymerase chain reaction and performed live cell time-lapse microscopy, bioinformatics analyses, in vivo intracranial GBM experiments using genetic and pharmacological inhibitors to delineate a prodispersal mechanism for management and treatment of GBMs. Yes-associated protein (YAP), a transcriptional coactivator, is overexpressed and hyperactive in 78% of GBMs and 50% of metastatic tumors to the brain (P < .05). Our studies demonstrate that YAP activates a Rho-GTPase switch to potentiate migratory speed by interacting with canonical pathways through direct transcriptional control. In addition, YAP mediates a proinvasive genetic network by direct posttranslational regulation. By coupling the regulation of migration and invasion, YAP drives tumor cell dispersal in vitro and in vivo (P < .05). Hyperactivation of this YAP-driven network in GBM confers poor patient outcome in clinical biopsies and The Cancer Genome Atlas (P < .05), suggesting a new signature in clinical prognosis of this aggressive and infiltrative cancer. Targeting this network using a proprietary pharmacological inhibitor attenuates tumor dispersal and growth (P < .05). YAP can critically control cellular locomotion through direct interaction with canonical molecular pathways controlling invasion and migration. Understanding the molecular underpinnings of this network is vital to the development of imperative prognostic and treatment approaches for cancer such as the new proprietary pharmacological inhibitor presented in this study.

  4. CTD data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT208-217 during 2009 (NODC Accession 0068957) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  5. Safety and immunogenicity of vaccination with MART-1 (26-35, 27L), gp100 (209-217, 210M), and tyrosinase (368-376, 370D) in adjuvant with PF-3512676 and GM-CSF in metastatic melanoma. (United States)

    Tarhini, Ahmad A; Leng, Siyang; Moschos, Stergios J; Yin, Yan; Sander, Cindy; Lin, Yan; Gooding, William E; Kirkwood, John M


    The effectivenes of cancer vaccines in inducing CD8(+) T-cell responses remains a challenge, resulting in a need for testing more potent adjuvants. Our objective was to determine the safety and immunogenicity of vaccination against melanoma-related antigens employing MART-1, gp100, and tysosinase paptides combined with the TLR9 agonist PF-3512676 and local granulocyte macrophage-colony stimulating factor in oil emulsion. Using continuous monitoring of safety and a 2-stage design for immunologic efficacy, 20 immune response evaluable patients were targetted. Vaccinations were given subcutaneously on days 1 and 15 per cycle (1cycle=28 d) for up to 13 cycles. Interferon-γ enzyme-linked immunosorbent spot was used as the primary assay measuring the frequency of peripheral antigen-specific CD8(+) T cells at days 50 and 90 compared with baseline (target ≥ 9/20 immunologic responses). Clinical responses were measured by Response Evaluation Criteria In Solid Tumors every 8 weeks. Twenty-two (including 20 immune response evaluable) melanoma patients were enrolled. All had American Joint Committe on Cancer stage IV (5M1a, 6M1b, 11M1c) and most had previously received therapy. Eight had previously treated brain metastases. An average of 3.5 cycles of vaccination per patient was administered. Clinical response data were available for 21 patients. There were 2 partial response and 8 stable disease lasting 2-7 months. One patient with ongoing partial response continued on treatment. At a median follow-up of 7.39 months (range, 3.22-20.47 mo), median progression-free survival was 1.9 months (90% confidence interval, 1.84-3.68) and median overall survival was 13.4 months (90% confidence interval,11.3-∞). No regimen-related grade 3/4/5 toxicities were observed. There were 9/20 patients with positive enzyme-linked immunosorbent spot at day 50 and/or day 90. Our adjuvant regimen combining PF-3512676 and granulocyte macrophage-colony stimulating factor was safe and is worthy of further testing with these or alternative peptides, potentially in combination with antibodies that target immunoregulatory checkpoints.

  6. Substituição parcial do milho e farelo de soja por sorgo e farelo de caroço de algodão extrusado em rações de frangos de corte - DOI: 10.4025/actascianimsci.v29i2.217 Partial substitution of the corn and soybean for sorghum and expander cottonseed meal in broilers’ rations - DOI: 10.4025/actascianimsci.v29i2.217

    Directory of Open Access Journals (Sweden)

    Jorge Vitor Ludke


    Full Text Available O experimento teve como objetivo avaliar a utilização do sorgo (50% e do farelo de caroço de algodão extrusado (0; 13,33; 26,66 e 39,99% em substituição ao milho e à proteína do farelo de soja em rações de frangos de corte. Foi conduzido um experimento utilizando 300 pintos de corte, machos, distribuídos em um delineamento inteiramente casualizado com cinco tratamentos e cinco repetições de 12 aves por parcela. As variáveis analisadas foram consumo de ração (CR, ganho de peso (GP, conversão alimentar (CA e características de carcaça. Para CR e GP, não houve diferenças estatísticas (p > 0,05 entre o tratamento controle e o segundo tratamento com exceção para CA no período de 22 a 42 dias. Com o resultado para GP houve diferenças significativas (p 0,05 para todos os parâmetros avaliados. Tanto o sorgo quanto o farelo de caroço de algodão extrusado em substituição ao milho e o farelo de soja é possível até 13,31%, melhorando a conversão alimentar.Partial substitution of the corn and soybean for sorghum and expander cottonseed meal in broilers’ rations. The experiment aimed to evaluate the use of sorghum (50% and the expander cottonseed meal (0; 13.33; 26.66; 39.99% in substitution to the corn and the protein of the soybean meal in broilers’ rations. An experiment was carried out using 300 male broiler chicks, distributed in a randomized arrangement with five treatments and five repetitions of 12 birds per parcel. The analyzed variables were ration consumption (RC, weight gain (WG, feed conversion (FC and characteristics of carcass. RC and WG did not present any statistical differences (p > 0.05 between the controlled treatment and the second treatment, except for FC during the period of 22 to 42 days. As for WG, significant statistical differences were found (p 0.05 for all the evaluated parameters. Both sorghum and the expander cottonseed meal in substitution to the corn and the soybean meal are possible, up to 13.31%, to improve the feed conversion.

  7. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena


    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...

  8. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)


  9. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)


  10. NCBI nr-aa BLAST: CBRC-MDOM-11-0019 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-11-0019 ref|ZP_01036200.1| hypothetical protein ROS217_04295 [Roseovarius... sp. 217] gb|EAQ25283.1| hypothetical protein ROS217_04295 [Roseovarius sp. 217] ZP_01036200.1 3.2 28% ...

  11. NCBI nr-aa BLAST: CBRC-PABE-26-1117 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PABE-26-1117 ref|ZP_01033920.1| hypothetical protein ROS217_18782 [Roseovarius... sp. 217] gb|EAQ26601.1| hypothetical protein ROS217_18782 [Roseovarius sp. 217] ZP_01033920.1 2.5 28% ...

  12. NCBI nr-aa BLAST: CBRC-ACAR-01-0852 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0852 ref|ZP_01035335.1| hypothetical protein ROS217_14576 [Roseovarius... sp. 217] gb|EAQ26410.1| hypothetical protein ROS217_14576 [Roseovarius sp. 217] ZP_01035335.1 0.003 28% ...

  13. ORF Alignment: NC_005363 [GENIUS II[Archive

    Lifescience Database Archive (English)


  14. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC217 (Link to dictyBase) - - - Contig-U15331-1 VFC217P (Link... to Original site) VFC217F 363 VFC217Z 478 VFC217P 841 - - Show VFC217 Library VF (Link to library) Clone ID VFC217 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15331-1 Original site URL http://dict...6.0 %: nuclear 4.0 %: cytoskeletal 4.0 %: vacuolar 4.0 %: peroxisomal 4.0 %: endoplasmic reticulum >> predict

  15. Gclust Server: 27462 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available HSA_7656955 Cluster Sequences - 217 NP_056537.1 dopamine receptor D1 interacting protein ; no annotation...length 217 Representative annotation NP_056537.1 dopamine receptor D1 interacting protein ; no annotation

  16. NCBI nr-aa BLAST: CBRC-AGAM-07-0041 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available tive (ubiA-2) [Flavobacterium sp. MED217] gb|EAQ50082.1| 4-hydroxybenzoate octaprenyltransferase , putative (ubiA-2) [Leeuwenhoekiella blandensis MED217] ZP_01060587.1 2e-31 33% ...

  17. ORF Alignment: NC_006055 [GENIUS II[Archive

    Lifescience Database Archive (English)


  18. Presentation of child sexual abuse cases to Queen Elizabeth ...

    African Journals Online (AJOL)

    Results. Between January 2005 and February 2007, 217 children presented with alleged CSA. This is an average of 3 more per month since the previous year. The results of the physical examination in 60% (130/217) of the cases showed signs of trauma. 63% (137/217) of the cases presented within 72 hours of defilement.

  19. Book Review: Controversy and consensus in nuclear beta decay 1911-1934 by Carsten Jensen. Finn Aaserud, Helge Kragh, Erik Rüdinger, Roger H. Stuewer (Eds.), Burkhaüser-Verlag, Basel, 2000, xv+217 pp., US 79.95, ISBN 3-7643-5319-9 (United States)

    Brown, Laurie M.

    This book is the doctoral dissertation of Carsten Jensen, researched at the University of Copenhagen under the supervision of Erik Rüdinger, who was the director of the Niels Bohr Institute until Finn Aaserud succeeded him in 1989. A few months after receiving his Ph.D. in 1990, Jensen passed away. The two mentioned directors, together with Helge Kragh and Roger H. Stuewer, edited Jensen's dissertation and ten years later brought it to publication. Some newer historical references have been added, quotations were translated or paraphrased, some photographs included but-according to the editors-they made "few changes of substance." Jensen taught in a Danish Gymnasium while writing his dissertation, which is a rather complete study of a central episode in early nuclear physics. It is well worth the efforts of the distinguished corps of editors to make it available to historians of science.

  20. Safety assessment of poloxamers 101, 105, 108, 122, 123, 124, 181, 182, 183, 184, 185, 188, 212, 215, 217, 231, 234, 235, 237, 238, 282, 284, 288, 331, 333, 334, 335, 338, 401, 402, 403, and 407, poloxamer 105 benzoate, and poloxamer 182 dibenzoate as used in cosmetics. (United States)

    Singh-Joy, Subhashni D; McLain, Valerie C


    Poloxamers are polyoxyethlyene, polyoxypropylene block polymers. The impurities of commercial grade Poloxamer 188, as an example, include low-molecular-weight substances (aldehydes and both formic and acetic acids), as well as 1,4-dioxane and residual ethylene oxide and propylene oxide. Most Poloxamers function in cosmetics as surfactants, emulsifying agents, cleansing agents, and/or solubilizing agents, and are used in 141 cosmetic products at concentrations from 0.005% to 20%. Poloxamers injected intravenously in animals are rapidly excreted in the urine, with some accumulation in lung, liver, brain, and kidney tissue. In humans, the plasma concentration of Poloxamer 188 (given intravenously) reached a maximum at 1 h, then reached a steady state. Poloxamers generally were ineffective in wound healing, but were effective in reducing postsurgical adhesions in several test systems. Poloxamers can cause hypercholesterolemia and hypertriglyceridemia in animals, but overall, they are relatively nontoxic to animals, with LD(50) values reported from 5 to 34.6 g/kg. Short-term intravenous doses up to 4 g/kg of Poloxamer 108 produced no change in body weights, but did result in diffuse hepatocellular vacuolization, renal tubular dilation in kidneys, and dose-dependent vacuolization of epithelial cells in the proximal convoluted tubules. A short-term inhalation toxicity study of Poloxamer 101 at 97 mg/m(3) identified slight alveolitis after 2 weeks of exposure, which subsided in the 2-week postexposure observation period. A short-term dermal toxicity study of Poloxamer 184 in rabbits at doses up to 1000 mg/kg produced slight erythema and slight intradermal inflammatory response on histological examination, but no dose-dependent body weight, hematology, blood chemistry, or organ weight changes. A 6-month feeding study in rats and dogs of Poloxamer 188 at exposures up to 5% in the diet produced no adverse effects. Likewise, Poloxamer 331 (tested up to 0.5 g/kg day(-1)), Poloxamer 235 (tested up to 1.0 g/kg day(-1)), and Poloxamer 338 (at 0.2 or 1.0 g/kg day(-1)) produced no adverse effects in dogs. Poloxamer 338 (at 5.0 g/kg day(-1)) produced slight transient diarrhea in dogs. Poloxamer 188 at levels up to 7.5% in diet given to rats in a 2-year feeding study produced diarrhea at 5% and 7.5% levels, a small decrease in growth at the 7.5% level, but no change in survival. Doses up to 0.5 mg/kg day(-1) for 2 years using rats produced yellow discoloration of the serum, high serum alkaline phosphatase activity, and elevated serum glutamicpyruvic transaminase and glutamic-oxalacetic transaminase activities. Poloxamers are minimal ocular irritants, but are not dermal irritants or sensitizers in animals. Data on reproductive and developmental toxicity of Poloxamers were not found. An Ames test did not identify any mutagenic activity of Poloxamer 407, with or without metabolic activation. Several studies have suggested anticarcinogenic effects of Poloxamers. Poloxamers appear to increase the sensitivity to anticancer drugs of multidrug-resistant cancer cells. In clinical testing, Poloxamer 188 increased the hydration of feces when used in combination with a bulk laxative treatment. Compared to controls, one study of angioplasty patients receiving Poloxamer 188 found a reduced myocardial infarct size and a reduced incidence of reinfarction, with no evidence of toxicity, but two other studies found no effect. Poloxamer 188 given to patients suffering from sickle cell disease had decreased pain and decreased hospitilization, compared to controls. Clinical tests of dermal irritation and sensitization were uniformly negative. The Cosmetic Ingredient Review (CIR) Expert Panel stressed that the cosmetic industry should continue to use the necessary purification procedures to keep the levels below established limits for ethylene oxide, propylene oxide, and 1,4-dioxane. The Panel did note the absence of reproductive and developmental toxicity data, but, based on molecular weight and solubility, there should be little skin penetration and any penetration of the skin should be slow. Also, the available data demonstrate that Poloxamers that are introduced into the body via routes other than dermal exposure have a rapid clearance from the body, suggesting that there would be no risk of reproductive and/or developmental toxicity. Overall, the available data do not suggest any concern about carcinogenesis. Although there are gaps in knowledge about product use, the overall information available on the types of products in which these ingredients are used, and at what concentration, indicates a pattern of use. Based on these safety test data and the information that the manufacturing process can be controlled to limit unwanted impurities, the Panel concluded that these Poloxamers are safe as used.


    Directory of Open Access Journals (Sweden)

    Ali BAYRAM


    Full Text Available In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 10, 50 and 259 mm/min. Strength properties of dual-phase steels were investigated depending on annealing temperature, ratio of martensite and loading rate.

  2. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V


    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  3. Nuclear and in-source laser spectroscopy with the ISAC yield station

    Energy Technology Data Exchange (ETDEWEB)

    Kunz, Peter, E-mail:; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning [TRIUMF, 4004 Wesbrook Mall, Vancouver, British Columbia V6T 2A3 (Canada); Andreoiu, Corina; Wong, Fiona [Department of Chemistry, Simon Fraser University, Burnaby, British Columbia V5A 1S6 (Canada)


    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10{sup 11} ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of {sup 46}K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  4. Nuclear and in-source laser spectroscopy with the ISAC yield station. (United States)

    Kunz, Peter; Andreoiu, Corina; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning; Wong, Fiona


    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10(11) ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of (46)K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  5. Radiopharmaceutical chemistry of targeted radiotherapeutics, part 4: Strategies for211At labeling at high activities and radiation doses of211At α-particles. (United States)

    Pozzi, Oscar R; Zalutsky, Michael R


    Alpha particles are radiation of high energy and short range, properties that can lead to radiolysis-mediated complications in labeling chemistry at the high radioactivity levels required for clinical application. In previous papers in this series, we have shown that radiation dose has a profound effect on the astatine species that are present in the labeling reaction and their suitability for the synthesis of N-succinimidyl 3-[ 211 At]astatobenzoate. The purpose of this study was to evaluate the effects of adding N-chlorosuccinimide (NCS) to the methanol solution used for initial isolation of 211 At after distillation, a process referred to as 211 At stabilization, on 211 At chemistry after exposure to high radiation doses. High performance liquid chromatography was used to evaluate the distribution of 211 At species present in methanol in the 500-65,000Gy radiation dose range and the synthesis of SAB from N-succinimidyl 3-(tri-n-butylstannyl)benzoate in the 500-120,000Gy radiation dose range using different 211 At timeactivity combinations under conditions with/without 211 At stabilization. In the absence of NCS stabilization, a reduced form of astatine, At(2), increased with increasing radiation dose, accounting for about half the total activity by about 15,000Gy, while with stabilization, At(2) accounted for 60,000Gy. SAB yields without stabilization rapidly declined with increasing dose, falling to ~20% at about 5000Gy while with stabilization, yields >80% were obtained with 211 At solutions stored for more than 23h and receiving radiation doses >100,000Gy. Adding NCS to the methanol solution used for initial isolation of 211 At is a promising strategy for countering the deleterious effects of radiolysis on 211 At chemistry. This strategy could facilitate the ability to perform 211 At labeling at sites remote from its production and at the high activity levels required for clinical applications. Copyright © 2016 Elsevier Inc. All rights reserved.

  6. Balloon Dilation of Sinus Ostia in the Department of Defense: Diagnoses, Actual Indications, and Outcomes (United States)


    3.7%, 8/217), sinus barotrauma (3.2%, 7/217), headache (1.8%, 4/217), nasal airway obstruction (1.4%, 3/217), and allergic rhinitis (0.5%, 1/ /k07304 1.pdf 7. Wang F, Song Y, Zhang X, Tan G. Sinus balloon catheter dilation in pediatric chronic rhinosinusitis resistant to medical...Endoscopic Techniques in Pediatric Sinus Surgery. Otolaryngol Head Neck Surg 2014; 151 (5):852-60. 16. Batra PS, Ryan MW, Sindwani R, Marple BF

  7. ORF Alignment: NC_006085 [GENIUS II[Archive

    Lifescience Database Archive (English)


  8. Regulatory Assistance, Stakeholder Outreach, and Coastal and Marine Spatial Planning Activities in Support of Marine and Hydrokinetic Energy Deployment

    Energy Technology Data Exchange (ETDEWEB)

    Geerlofs, Simon H. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Copping, Andrea E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Van Cleve, Frances B. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Blake, Kara M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hanna, Luke A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)


    This fiscal year 2011 progress report summarizes activities carried out under DOE Water Power Task 2.1.7, Permitting and Planning. Activities under Task 2.1.7 address the concerns of a wide range of stakeholders with an interest in the development of the marine and hydrokinetic (MHK) energy industry, including regulatory and resource management agencies, tribes, nongovernmental organizations, and industry.

  9. NCBI nr-aa BLAST: CBRC-AGAM-07-0045 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-AGAM-07-0045 ref|ZP_01061096.1| copper/silver efflux P-type ATPase [Flavobacte...rium sp. MED217] gb|EAQ49147.1| copper/silver efflux P-type ATPase [Leeuwenhoekiella blandensis MED217] ZP_01061096.1 1e-128 60% ...

  10. Resonance Capture in Unbalanced Dual-Spin Spacecraft (United States)


    York, 1989. 22. Wittenburg, Jens. "Beitrige zur dynamik von gyrostaten." In Convegno Inter- nazaionale sul Tema: Metodi Valutativi Nella Fisica ...Matematica, Roma, 15-19 dicembre 1972, Problemi Attuali di Scienza e di Cultura , Quaderno N. 217, pages 217-354. Accademia Nazionale dei Lincei, 1975. 23

  11. 48 CFR 3017.9000 - Clauses (USCG). (United States)


    ... will involve, or is reasonably expected to involve, increased costs, such facts and the reasons for the... (HSAR) 48 CFR 3052.217-95(b)(6) and (c)(1) consistent with contract size, inflation, and other..., inflation, and other circumstances. (c) The clause at (HSAR) 48 CFR 3052.217-100, Guarantee, shall be used...

  12. Planck 2015 results: VII. High Frequency Instrument data processing: Time-ordered information and beams

    DEFF Research Database (Denmark)

    Adam, R.; Ade, P. A R; Aghanim, N.


    The Planck High Frequency Instrument (HFI) has observed the full sky at six frequencies (100, 143, 217, 353, 545, and 857 GHz) in intensity and at four frequencies in linear polarization (100, 143, 217, and 353 GHz). In order to obtain sky maps, the time-ordered information (TOI) containing the d...

  13. Mrp2 is essential for estradiol-17 beta(beta-D-glucuronide)-induced cholestasis in rats

    NARCIS (Netherlands)

    Huang, LY; Smit, JW; Meijer, DKF; Vore, M

    The present study evaluates the roles of the multidrug resistance-1 P-glycoprotein, Mdr1a/1b, the bile salt export pump (Bsep), and the multidrug resistance-associated protein-2 (Mrp2) in mediating cholestasis induced by estradiol-17 beta(beta-D-glucuronide) (E(2)17G). Administration of [H-3]E(2)17G

  14. NCBI nr-aa BLAST: CBRC-TTRU-01-0165 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0165 ref|XP_710009.1| CTA217 antisense protein [Candida albicans SC531...4] gb|EAK90732.1| CTA217 antisense protein [Candida albicans SC5314] XP_710009.1 2e-04 36% ...

  15. Effect of rootstock on 'Forelle' pear ( Pyrus communis L.) growth and ...

    African Journals Online (AJOL)

    PD), 'Old Home' × 'Farmingdale' (OHxF) 217, BU2/33, BP3, OHxF40 and BP1 averaged >100.0 cm2, with the smallest trees on Quince C51 (QC51). Trees on PD, OHxF217, BP1 and OHxF40 yielded >30.0 kg tree−1, whereas trees on Quince A ...

  16. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 27; Issue 3. Issue front cover thumbnail. Volume 27, Issue 3. June 2004, pages 217-322. pp 217-220 Synthesis. Synthesis of BaTiO3 powder from barium titanyl oxalate (BTO) precursor employing microwave heating technique · Y S Malghe A V Gurjar S R Dharwadkar.

  17. Benthic harpacticoid copepod community of Saphala salt marsh along the west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Ingole, B.S; Ansari, Z.A; Parulekar, A

    stream_size 4 stream_content_type text/plain stream_name Indian_J_Mar_Sci_19_217.pdf.txt stream_source_info Indian_J_Mar_Sci_19_217.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  18. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 217 of 217 ... Vol 10, No 2 (2013), Urachal Adenocarcinoma, Abstract PDF. S Nguku, N Twahirwa, P Mburugu, K Rukaria, J Etabale, F Githae, M Tharao. Vol 4 (2009), Ureteric injuries following laparoscopic hysterectomy: A report of three cases, Abstract PDF. RB Parkar, Y Patel, A Chudasama,. Vol 11, No 1 (2014) ...

  19. GETDB: 103857 [GETDB

    Lifescience Database Archive (English)

    Full Text Available (SG) ubiquitous epi, fb, gut no specific pattern - - comment1:A, comment2:17C5 - ...GFP no specific pattern Lethality - Also known as - Original Comments comment1:A, comment2:17C5 Disc (Image)

  20. Biochemical composition of zooplankton from the northern Arabian Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Bhat, K.L.; Sreepada, R.A; Ansari, Z.A

    stream_size 7 stream_content_type text/plain stream_name Pak_J_Mar_Sci_2_17.pdf.txt stream_source_info Pak_J_Mar_Sci_2_17.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  1. 77 FR 61593 - North American Natural Resources, Inc. Complainant v. PJM Interconnection, L.L.C, American... (United States)


    ... interconnection costs as Network Upgrades and allocate those costs to AEP and its customers, failed to update AEP's Regional Transmission System Expansion (RTEP) and wrongfully foisted the costs of the Network... sections 1.7A.02, 1.3A, 1.17A, 1.26, 212.4, 217.3, 205, 206 and 217 of PJM's Open Access Transmission...

  2. NCBI nr-aa BLAST: CBRC-DSIM-01-0068 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-01-0068 ref|ZP_01038050.1| Nitric oxide reductase large subunit, cytochrome b [Rose...ovarius sp. 217] gb|EAQ23442.1| Nitric oxide reductase large subunit, cytochrome b [Roseovarius sp. 217] ZP_01038050.1 2.6 29% ...

  3. NCBI nr-aa BLAST: CBRC-SARA-01-0832 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0832 ref|ZP_01035526.1| exopolysaccharide biosynthesis domain protein [Rose...ovarius sp. 217] gb|EAQ25691.1| exopolysaccharide biosynthesis domain protein [Roseovarius sp. 217] ZP_01035526.1 1.0 26% ...

  4. NCBI nr-aa BLAST: CBRC-SARA-01-0489 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0489 ref|ZP_01035526.1| exopolysaccharide biosynthesis domain protein [Rose...ovarius sp. 217] gb|EAQ25691.1| exopolysaccharide biosynthesis domain protein [Roseovarius sp. 217] ZP_01035526.1 1.0 26% ...

  5. NCBI nr-aa BLAST: CBRC-TTRU-01-0513 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0513 ref|ZP_01059110.1| transporter, NRAMP family protein [Leeuwenhoek...iella blandensis MED217] gb|EAQ50942.1| transporter, NRAMP family protein [Leeuwenhoekiella blandensis MED217] ZP_01059110.1 0.15 26% ...

  6. AcEST: BP915861 [AcEST

    Lifescience Database Archive (English)

    Full Text Available LAO Cell division protein ftsZ OS=Leeuwenhoek... 33 7.0 tr|B2VQY7|B2VQY7_PYRTR Predicted protein OS=Pyrenoph...NKTDS 168 >tr|A3XI85|A3XI85_9FLAO Cell division protein ftsZ OS=Leeuwenhoekiella blandensis MED217 GN=MED217

  7. AcEST: BP913978 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 34 5.0 tr|A3XJS4|A3XJS4_9FLAO Pseudouridine synthase OS=Leeuwenhoekiell... 33 6.5...udouridine synthase OS=Leeuwenhoekiella blandensis MED217 GN=MED217_04192 PE=3 SV=1 Length = 265 Score = 33.

  8. NCBI nr-aa BLAST: CBRC-TTRU-01-1191 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1191 ref|ZP_01059110.1| transporter, NRAMP family protein [Leeuwenhoek...iella blandensis MED217] gb|EAQ50942.1| transporter, NRAMP family protein [Leeuwenhoekiella blandensis MED217] ZP_01059110.1 0.81 28% ...

  9. NCBI nr-aa BLAST: CBRC-TTRU-01-0751 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0751 ref|ZP_01059110.1| transporter, NRAMP family protein [Leeuwenhoek...iella blandensis MED217] gb|EAQ50942.1| transporter, NRAMP family protein [Leeuwenhoekiella blandensis MED217] ZP_01059110.1 0.086 28% ...

  10. AcEST: BP915836 [AcEST

    Lifescience Database Archive (English)

    Full Text Available udouridine synthase OS=Leeuwenhoekiell... 33 5.8 tr|A8L3M4|A8L3M4_FRASN Acyltransferase 3 OS=Frankia sp. (st...9FLAO Pseudouridine synthase OS=Leeuwenhoekiella blandensis MED217 GN=MED217_04192 PE=3 SV=1 Length = 265 Sc

  11. NCBI nr-aa BLAST: CBRC-TTRU-01-1149 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1149 ref|ZP_01061727.1| putative transmembrane ion channel [Leeuwenhoe...kiella blandensis MED217] gb|EAQ48690.1| putative transmembrane ion channel [Leeuwenhoekiella blandensis MED217] ZP_01061727.1 0.025 32% ...

  12. Parameters. US Army War College Quarterly. Volume 25. Number 1. Spring 1995, (United States)


    Massacre de notre Infanterie 1914-1918 (Paris: Albin Michel, 1921), pp. 10, 13-14, 217-18. 16. Ibid., pp. 217-18. 17. Shelford Bidwell and Dominick...rather the way that college sports teams are suspended for improper recruiting activities or that scientific research teams are subjected to rigorous

  13. Alpha particle emitters in medicine

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, D.R.


    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ({sup 211}At) and natural bismuth-212 ({sup 212}Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ({sup 223}Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs.

  14. α decay of the very neutron-deficient isotopes 197-199Fr (United States)

    Kalaninová, Z.; Andreyev, A. N.; Antalic, S.; Heßberger, F. P.; Ackermann, D.; Andel, B.; Drummond, M. C.; Hofmann, S.; Huyse, M.; Kindler, B.; Lane, J. F. W.; Liberati, V.; Lommel, B.; Page, R. D.; Rapisarda, E.; Sandhu, K.; Šáro, Š.; Thornthwaite, A.; Van Duppen, P.


    Decay properties of the very neutron-deficient isotopes 197-199Fr were studied at the velocity filter Separator for Heavy Ion reaction Products (SHIP) at GSI in Darmstadt. The isotopes were produced in the 2n-4n evaporation channels of the fusion-evaporation reaction 60Ni+141Pr → 201Fr*. Improved α-decay properties of 199Fr were determined and the possible existence of two α-decaying states in this nucleus is discussed. For the isotope 198Fr a broad α-decay energy distribution was detected in the range of (7470-7930) keV and two α-decaying states were observed with half-lives of 1.1(7) and 15(3) ms. The new isotope 197Fr was identified based on the observation of one α-decay chain yielding Eα=7728(15) keV and T1/2=0.6-0.3+3.0 ms. The systematics of reduced α-decay widths are presented for neutron-deficient francium, radon, and astatine isotopes.

  15. On the theory of time dilation in chemical kinetics (United States)

    Baig, Mirza Wasif


    The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.

  16. SPECT assay of radiolabeled monoclonal antibodies. Progress report, September 1, 1992--August 24, 1993

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.


    The overall goal of this project is to improve the effectiveness of single photon emission computed tomography (SPECT) to image and quantify radiolabeled monoclonal antibodies. During the past year, we have made significant progress toward this goal, and this report summarizes that work. Our efforts have been mainly directed along three fronts. First, we have developed and tested new reconstruction methods including three-dimensional iterative algorithms that model non-uniform attenuation and distance-dependent detector response. Both fan beam and parallel beam collimator geometries have been modeled and novel ways of improving the efficiency of the computationally intensive methods have been introduced. Second, an ultra-high resolution, small field-of-view pinhole collimator has been constructed and evaluated. Reconstructed spatial resolution of 1 to 3 mm (FWHM) has been achieved in phantom scans with a useful field-of-view of 9 to 10 cm. Finally, we have investigated the ability of SPECT to image and quantify astatine-211 distributions. Reconstructed images of phantom data demonstrated quantitative accuracy to within 10% with proper attenuation and scatter compensation.

  17. New developments of the in-source spectroscopy method at RILIS/ISOLDE (United States)

    Marsh, B. A.; Andel, B.; Andreyev, A. N.; Antalic, S.; Atanasov, D.; Barzakh, A. E.; Bastin, B.; Borgmann, Ch.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Dehairs, M.; Derkx, X.; De Witte, H.; Fedorov, D. V.; Fedosseev, V. N.; Focker, G. J.; Fink, D. A.; Flanagan, K. T.; Franchoo, S.; Ghys, L.; Huyse, M.; Imai, N.; Kalaninova, Z.; Köster, U.; Kreim, S.; Kesteloot, N.; Kudryavtsev, Yu.; Lane, J.; Lecesne, N.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Molkanov, P. L.; Nicol, T.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Schweikhard, L.; Seliverstov, M. D.; Sels, S.; Sjödin, A. M.; Truesdale, V.; Van Beveren, C.; Van Duppen, P.; Wendt, K.; Wienholtz, F.; Wolf, R. N.; Zemlyanoy, S. G.


    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar free ionization using the Laser Ion Source Trap, LIST (Po); isobar selective particle identification using the multi-reflection time-of-flight mass separator (MR-ToF MS) of ISOLTRAP (Au, At). These are summarized as part of an overview of the current status of the in-source resonance ionization spectroscopy setup at ISOLDE.

  18. Studies of Stable Octupole Deformations in the Radium Region

    CERN Multimedia


    The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

  19. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré


    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  20. Evaluating 99mTc Auger electrons for targeted tumor radiotherapy by computational methods. (United States)

    Tavares, Adriana Alexandre S; Tavares, João Manuel R S


    Technetium-99m (99mTc) has been widely used as an imaging agent but only recently has been considered for therapeutic applications. This study aims to analyze the potential use of 99mTc Auger electrons for targeted tumor radiotherapy by evaluating the DNA damage and its probability of correct repair and by studying the cellular kinetics, following 99mTc Auger electron irradiation in comparison to iodine-131 (131I) beta minus particles and astatine-211 (211At) alpha particle irradiation. Computational models were used to estimate the yield of DNA damage (fast Monte Carlo damage algorithm), the probability of correct repair (Monte Carlo excision repair algorithm), and cell kinetic effects (virtual cell radiobiology algorithm) after irradiation with the selected particles. The results obtained with the algorithms used suggested that 99mTc CKMMX (all M-shell Coster-Kroning--CK--and super-CK transitions) electrons and Auger MXY (all M-shell Auger transitions) have a therapeutic potential comparable to high linear energy transfer 211At alpha particles and higher than 131I beta minus particles. All the other 99mTc electrons had a therapeutic potential similar to 131I beta minus particles. 99mTc CKMMX electrons and Auger MXY presented a higher probability to induce apoptosis than 131I beta minus particles and a probability similar to 211At alpha particles. Based on the results here, 99mTc CKMMX electrons and Auger MXY are useful electrons for targeted tumor radiotherapy.

  1. Radiobromination of humanized anti-HER2 monoclonal antibody trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate, a potential label for immunoPET

    Energy Technology Data Exchange (ETDEWEB)

    Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail:


    Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.

  2. Development and radiotherapeutic application of /sup 211/At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    Energy Technology Data Exchange (ETDEWEB)

    Adelstein, S.J.; Zalutsky, M.; Bloomer, W.


    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.

  3. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics


    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  4. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  5. Two genes required for meiotic recombination in Drosophila are expressed from a dicistronic message. (United States)

    Liu, H; Jang, J K; Graham, J; Nycz, K; McKim, K S


    We have isolated two alleles of a previously unidentified meiotic recombination gene, mei-217. Genetic analysis of these mutants shows that mei-217 is a typical "precondition" gene. The phenotypes of the mutants are meiosis specific. The strongest allele has <10% of the normal level of crossing over, and the residual events are distributed abnormally. We have used double mutant analysis to position mei-217 in the meiotic recombination pathway. In general, mutations causing defects in the initiation of meiotic recombination are epistatic to mutations in mei-41 and spnB. These two mutations, however, are epistatic to mei-217, suggesting that recombination is initiated normally in mei-217 mutants. It is likely that mei-217 mutants are able to make Holliday junction intermediates but are defective in the production of crossovers. These phenotypes are most similar to mutants of the mei-218 gene. This is striking because mei-217 and mei-218 are part of the same transcription unit and are most likely produced from a dicistronic message.

  6. Adjunctive levetiracetam in children, adolescents, and adults with primary generalized seizures: Open-label, noncomparative, multicenter, long-term follow-up study.

    LENUS (Irish Health Repository)

    Delanty, Norman


    Purpose: To evaluate the long-term efficacy and tolerability of adjunctive levetiracetam (LEV) in patients with uncontrolled idiopathic generalized epilepsy (IGE). Methods: This phase III, open-label, long-term, follow-up study (N167; NCT00150748) enrolled patients (4 to <65 years) with primary generalized seizures (tonic-clonic, myoclonic, absence). Patients received adjunctive LEV at individualized doses (1,000-4,000 mg\\/day; 20-80 mg\\/kg\\/day for children\\/adolescents weighing <50 kg). Efficacy results are reported for all seizure types [intention-to-treat (ITT) population, N = 217] and subpopulations with tonic-clonic (n = 152), myoclonic (n = 121), and\\/or absence (n = 70) seizures at baseline. Key Findings: One hundred twenty-five (57.6%) of 217 patients were still receiving treatment at the end of the study. Mean (standard deviation, SD) LEV dose was 2,917.5 (562.9) mg\\/day. Median (Q1-Q3) exposure to LEV was 2.1 (1.5-2.8) years, and the maximum duration was 4.6 years. Most patients were taking one (124\\/217, 57.1%) or >\\/=2 (92\\/217, 42.4%) concomitant antiepileptic drugs (AEDs). Seizure freedom of >\\/=6 months (all seizure types; primary efficacy end point) was achieved by 122 (56.2%) of 217 patients, and 49 (22.6%) of 217 patients had complete seizure freedom. Seizure freedom of >\\/=6 months from tonic-clonic, myoclonic, and absence seizures was achieved by 95 (62.5%) of 152, 75 (62.0%) of 121, and 44 (62.9%) of 70 patients, respectively. Mean (SD) maximum seizure freedom duration was 371.7 (352.4) days. At least one treatment-emergent adverse event (TEAE) was reported by 165 (76%) of 217 patients; most TEAEs were mild\\/moderate in severity, with no indication of an increased incidence over time. Seventeen (7.8%) of 217 patients discontinued medication because of TEAEs. The most common psychiatric TEAEs were depression (16\\/217, 7.4%), insomnia (9\\/217, 4.1%), nervousness (8\\/217, 3.7%), and anxiety (7\\/217, 3.2%). Significance: Adjunctive

  7. EST Table: CN211768 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CN211768 rzhswab0_001664 10/09/28 88 %/215 aa ref|NP_001040385.1| pelota-like [Bombyx mori] gb|ABF51295.1| pelota-like protein [Bombyx mori] 10/09/01 70 %/217 aa FBpp0253329|DwilGK241...|gene:AGAP008269 10/09/10 65 %/217 aa gnl|Amel|GB10750-PA 10/09/10 65 %/217 aa gi|91095145|ref|XP_967126.1| PREDICTED: similar to pelota [Tribolium castaneum] FS917768 L12 ...

  8. Teadlasena poliitikas - võimalused ja piirid = Als Wissenschaftler in der Politik - Chancen und Grenzen / Eiki Berg

    Index Scriptorium Estoniae

    Berg, Eiki, 1970-


    Autori hinnangul lasub teadlasel poliitikas suurem vastutus kui mistahes valdkonna esindajal, sest teaduslikult argumenteeritud poliitilised otsused on teadmiste jõu ja poliitilise võimu sümbioos. Vt. ka kommentaare lk. 217-222,467-472

  9. 78 FR 3882 - Endangered Species; File No. 13543 (United States)


    ... South Carolina Department of Natural Resources, 217 Ft. Johnson Rd., Charleston, SC 29412, has requested... be appropriate. FOR FURTHER INFORMATION CONTACT: Amy Hapeman or Kristy Beard, (301) 427-8401...

  10. Drug: D03328 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D03328 Drug Carperitide (genetical recombination) (JAN); Carperitide (USAN/INN); Ha...l organs 21 Cardiovascular agents 217 Vasodilators 2179 Others D03328 Carperitide (genetical recombination)

  11. Index-2015

    Indian Academy of Sciences (India)

    IAS Admin

    ) (FT). Annona muricata L. (6) (FT). Answers (1) 73 (CR). Antibiotic (8) 711 (GA). Arduino microcontroller (5) 458 (CR). Aspirin (12) 1136 (GA). Assignment of stereochemical configuration by comparison of acid ionization con stants (3) 217 (GA).

  12. Cognitive Behaviour Therapy in the Management of Eating Disorder ...

    African Journals Online (AJOL)

    , SD = 4.56; t = 2.17, p < .05). The modified Cognitive Behaviour Therapy employed in the study may be helpful in reversing this trend. Keywords: Eating disorders, Anorexia nervosa, Bulimia nervosa, Obesity, Cognitive Behaviour therapy ...

  13. 77 FR 25166 - EPA-New England Region I; Massachusetts Marine Sanitation Device Standard; Receipt of Petition (United States)


    ...) of Public Law 92-500 as amended by Public Law 95-217 and Public Law 100-4, that adequate facilities..., including soft- shell clams, surf clams, blue mussels, oysters, ocean quahogs, and the state's only...

  14. About Military Sexual Trauma

    Medline Plus

    Full Text Available ... 2,403 views 5:31 Investigator Insights: Using Service Connected Disability Hearings as Gateway to Pain Management ... VA Community Care Network - Duration: 2:17. Veterans Health Administration ...

  15. Drug: D00251 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 217.2853 D00251.gif Antihypertensive; Enzyme inhibitor [angiotensin-converting] Therapeutic category: 2144 ...category of drugs in Japan [BR:br08301] 2 Agents affecting individual organs 21 Cardiovascular agents 214 Antihypertensive

  16. Growdon Gate/Road Relocation and Property Acquisition Environmental Assessment. Volume 1 (United States)


    Metropolitan San Antonio Interstate AQCR 217, which consists of the counties of Atascosa, Bandera , Bexar, Comal, Dimmitt, Edwards, Frio, Gillespie... Bandera , Bexar, Comal, Guadalupe, Kendall, Medina, and Wilson Counties (Bexar County 2010). The installation generates economic activity in the region

  17. Reference: IDRSZMFER1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available tial involvement of the IDRS cis-element in the developmental and environmental regulation of the AtFer1 ferritin gene from Arabidopsis. Planta. 217: 709-716 (2003) PubMed: 12728319 ...

  18. Neuropsychiatric manifestations in patients with systemic lupus erythematosus: A study from Iran

    Directory of Open Access Journals (Sweden)

    Fatemeh Hajighaemi


    Conclusions: We identified NPSLE manifestations in 21.7% of patients; headache and CVD were the most frequent neurological manifestations. Continued studies into the pathogenesis of neurological involvement in patients with SLE are warranted.

  19. Hopelessness and suicidal behavior among Chinese, Thai and Korean college students and predictive effects of the World Health Organization's WHOQOL-BREF

    National Research Council Canada - National Science Library

    Kay, Noy; Li, Kaigang; Xiao, Xia; Nokkaew, Nattiporn; Park, Bock-Hee


    ...-BREF instrument among college students (n=1,217) in China, Thailand, and Korea. Results showed 3.7% Thai, 10% Chinese, and 13.2% Korean students exhibited suicidal behavior in the past 12 months...

  20. Synthesis and characterization of NiFe2O4 electrocatalyst for the hydrogen evolution reaction in alkaline water electrolysis using different polymer binders

    Czech Academy of Sciences Publication Activity Database

    Chanda, D.; Hnát, J.; Paidar, M.; Schauer, Jan; Bouzek, K.


    Roč. 285, 1 July (2015), s. 217-226 ISSN 0378-7753 Institutional support: RVO:61389013 Keywords : alkaline water electrolysis * spinel oxides * polymer binder Subject RIV: CG - Electrochemistry Impact factor: 6.333, year: 2015

  1. AcEST: BP918906 [AcEST

    Lifescience Database Archive (English)


  2. 77 FR 64409 - Designation of Taiwan for the Visa Waiver Program (United States)


    ... regulatory philosophy and principles set forth in Executive Orders 12866 and 13563. DHS does not consider..., 1187; 8 CFR part 2. 0 2. In Sec. 217.2 the definition of the term ``Designated country'' in paragraph...

  3. Field Plot and Observation Points for Dinosaur National Monument Vegetation Mapping Project (United States)

    National Park Service, Department of the Interior — This point file displays the 727 vegetation plots and 217 observation points visited in 2002, 2003 and 2004 as part of the vegetation mapping project. Plots and...

  4. Effectiveness of Technolas torsional eye tracking system on visual outcomes after photorefractive keratectomy

    Directory of Open Access Journals (Sweden)

    Hamid Gharaee


    Conclusion: Our study findings suggest that applying ‘Technolas 217z’ eye tracker system (Bausch and Lomb Advanced results in a more regular anterior surface of cornea. Therefore, we recommend it for surface laser refractive surgery.

  5. BIOMASS, SPECIES IDENTIFICATION, TAXONOMIC CODE, SPECIES IDENTIFICATION - LIFE STAGE and species abundance tows data collected in the Gulf of Alaska on the ALPHA HELIX and WECOMA cruises HX201, HX203 and others as part of the NEP project from 1997-10-10 to 2004-10-07 (NODC Accession 0113896) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113896 includes tows and biological data collected aboard the ALPHA HELIX and WECOMA during cruises HX201, HX203, HX205, HX208, HX211, HX215, HX217,...

  6. BIOMASS, SPECIES IDENTIFICATION, SPECIES IDENTIFICATION - LIFE STAGE, TAXONOMIC CODE and species abundance tows data collected in the Gulf of Alaska on the ALPHA HELIX and WECOMA cruises HX201, HX203 and others as part of the NEP project from 1997-10-14 to 2004-10-08 (NODC Accession 0113956) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113956 includes tows and biological data collected aboard the ALPHA HELIX and WECOMA during cruises HX201, HX203, HX205, HX208, HX211, HX215, HX217,...

  7. Drug: D10347 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 85'-90', 157'-217', 263'-321'; glycosylation sites (N) :Asn23, Asn46, Asn-193) Peptide Treatment of that involve loss of skeletal muscle mass, strength, integrity Myostatin inhibi

  8. Download this PDF file

    African Journals Online (AJOL)


    carbon nanotube and layered double hydroxide as a drug delivery system especially in ... Material and Methods: Transmission and field emission scanning electron ..... Handbook: Pages217–234; Inorganic Nanostructures for Drug Delivery.

  9. 75 FR 28019 - Resmethrin; Notice of Receipt of Requests to Voluntarily Cancel Certain Pesticide Registrations (United States)


    ..., recreational, and residential areas to control flying and crawling insects. All remaining resmethrin end use... reproduction 2.1.7 Hershberger (rat) 2.1.8 Female Pubertal (rat) 2.1.9 Male pubertal (rat) 2.1.10...

  10. Human factors issues in motorcoach emergency egress (United States)


    FMVSS 217, Bus Emergency Exits and Window Retention and Release specifies a series of dimensional and physical requirements : for emergency exits. The intent of NHTSA is to minimize the likelihood of occupants being ejected from the bus and to pro...

  11. Hastings Center (United States)

    ... of the Affordable Care Act. I see this debate as having ended—as of this writing—in a draw. After months of repeal efforts, Republicans in the House barely passed in early May, with a 217- ...

  12. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Meenakshi Bhat. Articles written in Journal of Biosciences. Volume 40 Issue 2 June 2015 pp 217-220 Perspectives. Social and cultural issues in genetic counselling · Meenakshi Bhat · More Details Fulltext PDF ...

  13. 32 CFR 536.2 - Claims authorities. (United States)


    ... this part). The Westfall Act, 28 U.S.C. 2679, an integral part of the FTCA, provides absolute immunity... Reserve Officers Training Corps (ROTC) cadets, respectively, (see DA Pam 27-162, paragraph 2-17d(2)). (4...

  14. Data of evolutionary structure change: 1CKDA-2G4ND [Confc[Archive

    Lifescience Database Archive (English)


  15. The Effects of Internal Tides on Acoustic Propagation in the Philippine Sea (United States)


    seismic field in the seabed and sound propagation in the water column (Worcester 2013). This thesis focuses on the data collected during the 2009...midpoint. Equations 2.17 and 2.18 were used to implement the model in Matlab . (2.17) (2.18) Of note, the model is a data driven model that was...experiment in order to conduct a statistical analysis of the eigenrays. The Matlab findpeaks function was used on the SNR data to isolate receptions

  16. Support Net for Frontline Providers (United States)


    With a multidisciplinary team that included an external evaluator (Dr. Robert Durham), and an extended research team (Drs. Alan Peterson and Bret...21.7%) indicated being single. The sample of providers included 13 clinical psychologists (21.7%), 17 counselors or psychotherapists (28.3%), three...a sample of service members from Iraq and Afghanistan. Military Medicine, 172, 359–363. Figley, C. R. (2002). Compassion fatigue: Psychotherapists

  17. Earth observation scientific workflows in a distributed computing environment

    CSIR Research Space (South Africa)

    Van Zyl, TL


    Full Text Available infrastructure a reality, pages 217?250, 2003. URL A. Gibson, M. Gamble, K...

  18. Drug: D07560 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D07560 Drug Adrenalone hydrochloride; Stryphnasal (TN) C9H11NO3. HCl 217.0506 217.6...ICAL PREPARATIONS A01AD Other agents for local oral treatment A01AD06 Adrenalone D07560 Adrenalone hydr...ER HEMOSTATICS B02BC Local hemostatics B02BC05 Adrenalone D07560 Adrenalone hydrochloride CAS: 62-13-5 PubCh

  19. Advanced Computational Methods for Optimization of Non Periodic Inspection Intervals for Aging Infrastructure (United States)


    Research (AFOSR)/ IOA Arlington, Virginia 22203 Air Force Research Laboratory Air Force Materiel Command a. REPORT Unclassified b. ABSTRACT...0 −′] −1 ′⁄ (2-16) as: = + 1 ′ ( −′ − 0 −′) . (2-17) Differential dtc can be calculated as: d...Approved for public release: distribution unlimited. 10 Substituting tc of eq. (2-17) and dtc of eq. (2-18) into eq. (2-19), the probability is

  20. Laser Hazards Bibliography - October 1984, (United States)


    complications of photocoagulations by argon laser. Discussion of a case, Bull Soc Ophth France’, 75(4): 368-373 (1975) (French). 217. Haut, J., Bernard , J...induced glaucoma in rabbits, J Med Liban, 27(5): 567-574 (1974). 244. Kidwell , T. P., Priebe, L. A., and Welsh, A. J., The measurement of ocular...I 217. Kidwell , T. P., Priebe, L. A., and Welch, A. 3., The measurement of ocular transmittance and irradiation distribution in argon laser

  1. AcEST: BP917913 [AcEST

    Lifescience Database Archive (English)

    Full Text Available M88|A3XM88_9FLAO Acetyltransferase OS=Leeuwenhoekiella bla... 33 5.4 tr|Q9U0Z7|Q9U0Z7_LEIMA Hypothetical tra...88|A3XM88_9FLAO Acetyltransferase OS=Leeuwenhoekiella blandensis MED217 GN=MED217_07986 PE=4 SV=1 Length = 1

  2. Optimizing MIBG therapy of neuroendocrine tumors: preclinical evidence of dose maximization and synergy

    Energy Technology Data Exchange (ETDEWEB)

    Mairs, Rob J. [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)], E-mail:; Boyd, Marie [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)


    [{sup 131}I]meta-Iodobenzylguanidine ([{sup 131}I]MIBG) has been used for the therapy of tumors of neuroectodermal origin since the 1980s. Its role in the management of these malignancies remains controversial because of the large variation in response rates. Appreciation of the mode of conveyance of [{sup 131}I]MIBG via the noradrenaline transporter into malignant cells and of factors that influence the activity of the uptake mechanism has indicated various ways in which the effectiveness of this type of targeted radiotherapy may be improved. Experimental observations indicate that radiolabeling of MIBG to high specific activity reduced the amount of cold competitor, thereby increasing tumor dose and minimizing pressor effects. We observed supra-additive tumor cell kill and inhibition of tumor growth following combined topotecan and [{sup 131}I]MIBG treatment. The improved efficacy is related to topotecan's increased disruption of DNA repair. Radiation damage to targeted tumors may also be enhanced by the use of the {alpha}-particle emitter [{sup 211}At]astatine rather than {sup 131}I as radiolabel. Furthermore, recent experimental findings indicate that [{sup 123}I]MIBG may have therapeutic potential over and above its utility as an imaging agent. It has recently been demonstrated that potent cytotoxic bystander effects were induced by the intracellular concentration of [{sup 131}I]MIBG, [{sup 123}I]MIBG or meta-[{sup 211}At]astatobenzylguanidine. Identification of the nature of bystander factors could be exploited to maximize the specificity and potency of MIBG-targeted radiotherapy. By employing a range of strategies, there are good prospects for the improvement of the [{sup 131}I]MIBG therapy of neuroectodermal tumors.

  3. Immuno-vectorization of radioelements emitters of alpha particles: a new therapy in cancerology; Immunovectorisation de radioelements emetteurs de particules alpha: une nouvelle voie therapeutique en cancerologie

    Energy Technology Data Exchange (ETDEWEB)

    Bourgeois, M


    The radio-immunotherapy is an anti cancerous therapy which consists in vectorising with immuno-specific agents very radio toxic radioelements on tumors or in their environment to destroy them. The first part of this report presents the different characteristics of antibodies as well as their means of production under monoclonal shapes specifically steered against a tumoral antigen of interest. The second part of this report replaces the importance of the immunological vectors in the context of the nuclear medicine. It is notably described that the different methods which allow to radio-label the vector, as well as the different ways of optimization which were envisaged to improve the targeting of radioelements on a tumor. These different developments allow to define the potential place of the alpha radio-immunotherapy in treatments and so re-place the interest of the experimental part. If the radio-immunotherapy, using beta emitters isotopes as the {sup 131}iodine or the{sup 90}yttrium, is today current in anti cancerous therapy, it finds limits because of the disintegration characteristics of the isotopes it uses. Indeed, compared with alpha particles, the beta particles deposit less energy by unit of length in the crossed material.The experimental part of this report aims at studying the feasibility of the coupling between an immunological vector and an alpha emitter isotope.The different tests led on the bismuth 213, the bismuth 212, the lead 212 and the astatine 211 demonstrated that the fixation of these radionuclides was possible. This research theme is strengthened by the construction in Nantes of a cyclotron with high energy ( A.R.R.O.N.A.X.) and the optimization of the obtained promising results should allow a therapeutic use in oncology of the alpha radio-immunotherapy. (N.C.)

  4. Locoregional therapy with α-emitting trastuzumab against peritoneal metastasis of human epidermal growth factor receptor 2-positive gastric cancer in mice. (United States)

    Li, Huizi Keiko; Morokoshi, Yukie; Nagatsu, Kotaro; Kamada, Tadashi; Hasegawa, Sumitaka


    Peritoneal metastasis of gastric cancer (PMGC) is incurable and thus has an extremely poor prognosis. We have found, however, that locoregionally administered trastuzumab armed with astatine-211 ((211) At-trastuzumab) is effective against human epidermal growth factor receptor 2 (HER2)-positive PMGC in a xenograft mouse model. We first observed that (211) At-trastuzumab can specifically bind and effectively kill NCI-N87 (N87) cells, which are HER2-positive human metastatic GC cells, both in vitro and in s.c. tumors. We established a PMGC mouse model using N87 xenografts stably expressing luciferase to test α-particle radioimmunotherapy with (211) At-trastuzumab against PMGC. Biodistribution analysis in this PMGC mouse model revealed that the i.p. administration of (211) At-trastuzumab (1 MBq) was a more efficient means of delivery of (211) At into metastatic tumors than i.v. injection; the maximum tumor uptake with i.p. administration was over 60% injected dose per gram of tissue (%ID/g) compared to approximately 18%ID/g with i.v. injection. Surprisingly, a single i.p. injection of (211) At-trastuzumab (1 MBq) was sufficient to completely eradicate intraperitoneally disseminated HER2-positive GC xenografts in two of six treated mice by inducing DNA double-strand breaks, and to drastically reduce the tumor burden in another three mice. No bodyweight loss, leukocytopenia, or significant biochemical changes in liver or kidney function were observed in the treatment group. Accordingly, locoregionally administered (211) At-trastuzumab significantly prolonged the survival time of HER2-positive PMGC mice compared with control treatments. Our results provide a proof-of-concept demonstration that locoregional therapy with (211) At-trastuzumab may offer a new treatment option for HER2-positive PMGC. © 2017 The Authors. Cancer Science published by John Wiley & Sons Australia, Ltd on behalf of Japanese Cancer Association.

  5. Does rarity mean imparity? Biological characteristics of osteosarcoma cells originating from the spine. (United States)

    Zhou, Zhenhua; Li, Yan; Yan, Xu; Wang, Xudong; Yang, Cheng; Wei, Haifeng; Yang, Xinghai; Xiao, Jianru


    Osteosarcoma is one of the most common malignancies in bones and is often found in limbs. Until now, it is not clear why osteosarcoma is rare in the spine. On the other hand, previous biological characteristics study about osteosarcoma of spine was also rare because of its low incidence. To explore the biology of spinal osteosarcoma, a stable osteosarcoma cell line derived from spine is necessary. A novel osteosarcoma cell line named NEO217 was established from spinal osteosarcoma tissues obtained from a Chinese male patient. We performed a series of experiments to investigate the biological properties of NEO217, including cell morphology, the kinetics of cell growth, biomarkers and tumorigenicity. The cell line NEO217 was passaged in vitro for more than 50 generations. Ultramicroscopic structural features of these cells were consistent with the pleomorphism characteristic of cancer cells. The average cell doubling time was 26 h. The chromosomal morphology was that of a human karyotype, with the number of chromosomes more than 80. NEO217 cells and available osteosarcoma cell lines such as MG-63 and MNNG/HOS were all CD29+CD59+ phenotype as detected by flow cytometry. Inoculation of NEO217 cells to immunodeficient mice led to tumor formation. The biological and molecular properties of NEO217 cell line are not exactly the same as some human osteosarcoma cell lines derived from the extremities. We have established a novel osteosarcoma cell line NEO217 derived from the spine, which will provide a useful model for biological or therapeutical studies of spinal osteosarcoma.

  6. Biochemical control of CARM1 enzymatic activity by phosphorylation. (United States)

    Feng, Qin; He, Bin; Jung, Sung-Yun; Song, Yongcheng; Qin, Jun; Tsai, Sophia Y; Tsai, Ming-Jer; O'Malley, Bert W


    Coactivator-associated arginine methyltransferase 1 (CARM1) is a dual functional coregulator that facilitates transcription initiation by methylation of Arg(17) and Arg(26) of histone H3 and also dictates the subsequent coactivator complex disassembly by methylation of the steroid receptor coactivator family coactivators and p300/cAMP-response element-binding protein-binding protein. However, the regulation of CARM1 enzymatic activity and substrate specificity remains largely unknown. In this study, we report that CARM1 function is regulated by phosphorylation at Ser(217), a residue completely conserved in the type I protein arginine methyltransferase (PRMT) family of enzymes. Comparative analysis of the published CARM1 crystal structures reveals that the hydroxyl group of Ser(217) forms a strong hydrogen bond with the carbonyl oxygen atom of Tyr(154) to lock the cofactor S-adenosylmethionine inside the binding cavity. Phosphorylation of Ser(217) disrupts this hydrogen bond and subsequently abolishes S-adenosylmethionine binding and its methyltransferase activity. Importantly, Tyr(154) is also conserved in the type I PRMT family of enzymes, suggesting a general role of this hydrogen bond in maintaining the holo structure of the type I PRMT catalytic domain. Moreover, we found that phosphorylation at Ser(217) also promoted CARM1 cytoplasmic localization and that this translocation occurred mainly during mitosis. We propose that phosphorylation at Ser(217) serves as a molecular switch for controlling CARM1 enzymatic activity during the cell cycle.

  7. Control system for detection of the illegal use of naturally occurring steroids in calves. (United States)

    Arts, C J; van Baak, M J; den Hartog, J M


    Within the scope of the National Plan for Hormone Control in The Netherlands, a study was performed to develop a system for control of the illegal use of three naturally occurring hormones [oestradiol-17 beta (E2-17 beta), testosterone (T), progesterone (P)] for fattening purposes in animal production. Using a specific high-performance liquid chromatographic-radioimmunoassay method, reference values were established for concentrations of E2-17 beta, T and P and some of their metabolites in blood plasma and urine from untreated male and female veal calves. E2-17 beta levels of both male and female calves were less than 0.01 microgram/l in blood plasma and less than 0.2 microgram/l in urine. For male veal calves levels of T and epitestosterone (epiT) in blood plasma and urine varied widely. The P levels were less than 0.1-0.3 micrograms/l in blood plasma and less than 0.6-10 micrograms/l in urine from both male and female calves. To investigate the effect of anabolic treatment on the hormone levels in plasma and excreta, male veal calves were injected, subcutaneously into the dewlap, with a solution containing 20 mg of E2-17 beta benzoate and 200 mg of T propionate in 5 ml of arachis oil. Only the levels of E2-17 beta and E2-17 alpha in blood plasma and excreta were elevated until about one week after injection, compared with the untreated control calves and the reference values. T and epiT levels were similar in plasma and excreta from both untreated and treated animals.

  8. Statistics of the fractional polarization of extragalactic dusty sources in Planck HFI maps (United States)

    Bonavera, L.; González-Nuevo, J.; De Marco, B.; Argüeso, F.; Toffolatti, L.


    We estimate the average fractional polarization at 143, 217 and 353 GHz of a sample of 4697 extragalactic dusty sources by applying stacking technique. The sample is selected from the second version of the Planck Catalogue of Compact Sources at 857 GHz, avoiding the region inside the Planck Galactic mask (fsky ˜ 60 per cent). We recover values for the mean fractional polarization at 217 and 353 GHz of (3.10 ± 0.75) per cent and (3.65 ± 0.66) per cent, respectively, whereas at 143 GHz we give a tentative value of (3.52 ± 2.48) per cent. We discuss the possible origin of the measured polarization, comparing our new estimates with those previously obtained from a sample of radio sources. We test different distribution functions and we conclude that the fractional polarization of dusty sources is well described by a log-normal distribution, as determined in the radio band studies. For this distribution we estimate μ217GHz = 0.3 ± 0.5 [that would correspond to a median fractional polarization of Πmed = (1.3 ± 0.7) per cent] and μ353GHz = 0.7 ± 0.4 (Πmed = (2.0 ± 0.8) per cent), σ217GHz = 1.3 ± 0.2 and σ353GHz = 1.1 ± 0.2. With these values we estimate the source number counts in polarization and the contribution given by these sources to the Cosmic Microwave Background B-mode angular power spectrum at 217, 353, 600 and 800 GHz. We conclude that extragalactic dusty sources might be an important contaminant for the primordial B-mode at frequencies >217 GHz.

  9. Presentation of child sexual abuse cases to Queen Elizabeth Central Hospital following the establishment of an HIV post-exposure prophylaxis programme. (United States)

    Chesshyre, Emily L D; Molyneux, Elizabeth M


    To review the presentation and management of child sexual abuse cases presenting to Queen Elizabeth Central Hospital (QECH), Blantyre, since the introduction of an HIV postexposure prophylaxis programme. Demographic and medical data was collected from all children presenting to Queen Elizabeth Central Hospital, Blantyre, Malawi between January 2005 and February 2007 with alleged child sexual abuse (CSA). Between January 2005 and February 2007, 217 children presented with alleged CSA. This an average of 3 more per month since the previous year, a 57 percent increase. Physical examination showed signs of trauma 60% (130/217) of cases. 63% (137/217) of the cases presented within 72 hours of defilement. Overall in 42% (92/217) of children a one month course of HIV PEP was indicated and given. In 58% (125/217) HIV PEP was not indicated in view of normal examination, presentation too late (>72 hrs after abuse), multiple abuse episodes in the last 6 months, HIV test positive or HIV test refused. In 66% (144/217) of assessed children antibiotic treatment was given for the prevention and/ or treatment of sexually transmitted infections (STIs). The introduction of an HIV PEP programme for victims of CSA has lead to increased numbers presenting and being treated. In conclusion it is likely that a significant number of children have been prevented from acquiring HIV and other STIs following CSA. The key area where our service needs to be improved is in establishing documented follow up of all cases to monitor medication compliance, side effects and rates of HIV seroconversion following CSA.

  10. Differences between users and non-users of emergency contraception after a recognized unprotected intercourse

    DEFF Research Database (Denmark)

    Sørensen, M B; Pedersen, B L; Nyrnberg, L E


    Knowledge of emergency contraception is crucial but might not transform into use. Factors influencing decision-making related to use of emergency contraception after an unprotected intercourse and the characteristics of users of emergency contraception (EC) were assessed. In an abortion clinic...... setting, 217 women referred for termination of pregnancy were asked to fill in a questionnaire. Of the 217 women, 139 (64%) were aware of pregnancy risk but only 9 (4%) had used EC after the unprotected intercourse. 42% were estimated to have sufficient knowledge to use hormonal emergency contraception...

  11. Statistics of the fractional polarisation of extragalactic dusty sources in Planck HFI maps


    Bonavera, L.; Gonzalez-Nuevo, J.; De Marco, B.; Argüeso, F.; Toffolatti, L.


    We estimate the average fractional polarisation at 143, 217 and 353 GHz of a sample of 4697 extragalactic dusty sources by applying stacking technique. The sample is selected from the second version of the Planck Catalogue of Compact Sources at 857 GHz, avoiding the region inside the Planck Galactic mask (fsky ~ 60 per cent). We recover values for the mean fractional polarisation at 217 and 353 GHz of (3.10 \\pm 0.75) per cent and (3.65 \\pm 0.66) per cent, respectively, whereas at 143 GHz we g...

  12. Four marine-derived fungi for bioremediation of raw textile mill effluents

    Digital Repository Service at National Institute of Oceanography (India)

    Verma, A.K.; Raghukumar, C.; Verma, P.; Shouche, Y.S.; Naik, C.G.

    stream_size 62026 stream_content_type text/plain stream_name Biodegradation_21_217a.pdf.txt stream_source_info Biodegradation_21_217a.pdf.txt Content-Encoding UTF-8 Content-Type text/plain; charset=UTF-8 1 Author... of both the effluents in the presence of culture supernatants from basidiomycetes than the ascomycetes. Culture supernatants from laccase-hyper-producing isolate #2a and commercial laccase preparation of Tremetes versicolor, at varying concentrations...

  13. Molecular Basis of Enhanced Activity in Factor VIIa-Trypsin Variants Conveys Insights into Tissue Factor-mediated Allosteric Regulation of Factor VIIa Activity

    DEFF Research Database (Denmark)

    Sorensen, Anders B.; Madsen, Jesper Jonasson; Svensson, L. Anders


    -ray crystallography, we show that the introduced 170 loop from trypsin directly interacts with the FVIIa active site, stabilizing segment 215-217 and activation loop 3, leading to enhanced activity. Molecular dynamics simulations and novel fluorescence quenching studies support that segment 215-217 conformation...... is pivotal to the enhanced activity of the FVIIa variants. We speculate that the allosteric regulation of FVIIa activity by TF binding follows a similar path in conjunction with protease domain N terminus insertion, suggesting a more complete molecular basis of TF-mediated allosteric enhancement of FVIIa...

  14. Diagnostic value of a coagglutination procedure using monoclonal antibodies to Bacteroides gingivalis. (United States)

    Shklair, I L; Simonson, L G; Bial, J J


    A specific monoclonal antibody against Bacteroides gingivalis was bound to particles coated with protein A and evaluated for use in a coagglutination test. B. gingivalis was the only organism tested which gave a specific positive reaction with the CoA reagent. Subgingival plaque samples were collected from 217 patients diagnosed as having periodontitis. Organisms that gave biochemical reactions which indicated they were B. gingivalis were isolated from eleven of the 217 gingival pockets. These eleven strains were the only organisms which gave a positive reaction using the CoA test.

  15. Indice botánico



    Achiote: 91, 94, 198 Aguaje: 156 Aji: 59, 74, 171 Alamo: 171 Algodón: 94, 110, 124 Aliso: 52 Alnus acuminata: ver aliso Aloes: 171 Altramuce: 44 Arachis hypogaea: ver maní Arracacha esculenta: 69 Arveja: 74 Asaí: ver palmera Bactris gasipaes: 141 Balsa palo de: 180 Befaría ledifolia: 64 Bertholetia excelsa: 154 Bixa orellana: ver achiote Bombax: 178 Bombonax: ver palmera Barbasco: 199 Cabeza de negro: ver Humiro Cacao: 194, 217 Café: 175, 179, 217 Camote: 62, 69, 74, 97, 182, 192 Caña de azúc...

  16. Physical Activity

    DEFF Research Database (Denmark)

    Andersen, Lars Bo; Anderssen, Sigmund Alfred; Wisløff, Ulrik


    Andersen LB, Anderssen SA, Wisløff U, Hellénius M-L, Fogelholm M, Ekelund U. (Expert Group) Nordic Nutrition Recommendations 2012. Integrating nutrition and physical activity. Chapter: Physical Activity p. 195-217.Nordic Counsil of Ministers.......Andersen LB, Anderssen SA, Wisløff U, Hellénius M-L, Fogelholm M, Ekelund U. (Expert Group) Nordic Nutrition Recommendations 2012. Integrating nutrition and physical activity. Chapter: Physical Activity p. 195-217.Nordic Counsil of Ministers....

  17. Drug: D01573 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D01573 Drug Etilefrine hydrochloride (JP16); Etilefrine hydrochloride (TN) C10H15NO...2. HCl 217.087 217.6925 D01573.gif Antihypotensive; Sympathomimetic Therapeutic category: 2119 ATC code: C01CA01 alpha1-adr...tion hsa04270(146+147+148) Vascular smooth muscle contraction hsa04970(146+147+148) Salivary secretion Therapeutic category of dr... 211 Cardiotonics 2119 Others D01573 Etilefrine hydrochloride (JP16) Anatomical T...AC STIMULANTS EXCL. CARDIAC GLYCOSIDES C01CA Adrenergic and dopaminergic agents C01CA01 Etilefrine D01573 Etilefrine hydr

  18. Luteinizing hormone secretion as affected by hypophyseal stalk transection and estradiol-17beta in ovariectomized gilts. (United States)

    Ford, J J; Berardinelli, J G; Christenson, R K; Anderson, L L


    The objectives were to determine hypothalamic regulation of pulsatile luteinizing hormone (LH) secretion in female pigs and the biphasic feedback actions of estradiol-17beta (E(2)-17beta). In the first study, the minimum effective dosage of E(2)-17beta that would induce estrus in ovariectomized gilts was determined to be 20microg/kg body weight. In the second study, ovariectomized gilts were assigned randomly on day 0 to treatments: (a) hypophyseal stalk transection (HST), (b) cranial sham-operated control (SOC), and (c) unoperated control (UOC). On day 3, gilts from each group received a single i.m. injection of either E(2)-17beta (20microg/kg body weight) or sesame oil. Blood was collected from an indwelling jugular cannula at 15min intervals for 3h before (day -2) and after treatment (day 2) from HST, SOC and UOC gilts. On day 3, blood was collected at 2h intervals for 12h after E(2)-17beta or sesame oil injection and at 4h intervals thereafter for 108h. Pulsatile LH secretion in all gilts 2 days after ovariectomy exhibited a frequency of 0.9+/-0.06peaks/h, amplitude of 1.3+/-0.13ng/ml, baseline of 0.8+/-0.07. Serum LH concentrations from SOC and UOC gilts were similar on day 2 and profiles did not differ from those on day -2. In HST gilts pulsatile LH release was abolished and mean LH concentration decreased compared with controls (0 versus 0.9+/-0. 06peaks/h and 0.77+/-0.03 versus 1.07+/-0.07ng/ml, respectively; Pgilts, and LH remained constant throughout 120h (0.7+/-0. 07ng/ml). In SOC and UOC control gilts, E(2)-17beta induced a 60% decrease (Pgilts compared with controls (228 versus 332mg, Pgilts. The third and fourth studies determined that hourly i. v. infusions of LHRH (2microg) and a second injection of E(2)-17beta 48h after the first had no effect on the positive feedback action of estrogen in UOC. However, in HST gilts that received LHRH hourly, the first injection of E(2)-17beta decreased (Pfeedback action of E(2)-17beta on LH secretion depend on

  19. Quantitative Single-Particle Digital Autoradiography with α-Particle Emitters for Targeted Radionuclide Therapy using the iQID Camera

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Brian W.; Frost, Sophia; Frayo, Shani; Kenoyer, Aimee L.; Santos, E. B.; Jones, Jon C.; Green, Damian J.; Hamlin, Donald K.; Wilbur, D. Scott; Fisher, Darrell R.; Orozco, Johnnie J.; Press, Oliver W.; Pagel, John M.; Sandmaier, B. M.


    Abstract Alpha emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50–80 μm) causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with alpha emitters may inactivate targeted cells with minimal radiation damage to surrounding tissues. For accurate dosimetry in alpha-RIT, tools are needed to visualize and quantify the radioactivity distribution and absorbed dose to targeted and non-targeted cells, especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, iQID (ionizing-radiation Quantum Imaging Detector), for use in alpha-RIT experiments. Methods: The iQID camera is a scintillator-based radiation detection technology that images and identifies charged-particle and gamma-ray/X-ray emissions spatially and temporally on an event-by-event basis. It employs recent advances in CCD/CMOS cameras and computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, we evaluated this system’s characteristics for alpha particle imaging including measurements of spatial resolution and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 (211At) activity distributions in cryosections of murine and canine tissue samples. Results: The highest spatial resolution was measured at ~20 μm full width at half maximum (FWHM) and the alpha particle background was measured at a rate of (2.6 ± 0.5) × 10–4 cpm/cm2 (40 mm diameter detector area). Simultaneous imaging of multiple tissue sections was performed using a large-area iQID configuration (ø 11.5 cm

  20. Quantitative single-particle digital autoradiography with α-particle emitters for targeted radionuclide therapy using the iQID camera

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Brian W., E-mail: [Pacific Northwest National Laboratory, Richland, Washington 99354 and College of Optical Sciences, The University of Arizona, Tucson, Arizona 85719 (United States); Frost, Sofia H. L.; Frayo, Shani L.; Kenoyer, Aimee L.; Santos, Erlinda; Jones, Jon C.; Orozco, Johnnie J. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 (United States); Green, Damian J.; Press, Oliver W.; Pagel, John M.; Sandmaier, Brenda M. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 and Department of Medicine, University of Washington, Seattle, Washington 98195 (United States); Hamlin, Donald K.; Wilbur, D. Scott [Department of Radiation Oncology, University of Washington, Seattle, Washington 98195 (United States); Fisher, Darrell R. [Dade Moeller Health Group, Richland, Washington 99354 (United States)


    Purpose: Alpha-emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50–80 μm), causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with α emitters may thus inactivate targeted cells with minimal radiation damage to surrounding tissues. Tools are needed to visualize and quantify the radioactivity distribution and absorbed doses to targeted and nontargeted cells for accurate dosimetry of all treatment regimens utilizing α particles, including RIT and others (e.g., Ra-223), especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, the ionizing-radiation quantum imaging detector (iQID) camera, for use in α-RIT experiments. Methods: The iQID camera is a scintillator-based radiation detection system that images and identifies charged-particle and gamma-ray/x-ray emissions spatially and temporally on an event-by-event basis. It employs CCD-CMOS cameras and high-performance computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, the authors evaluated its characteristics for α-particle imaging, including measurements of intrinsic detector spatial resolutions and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 ({sup 211}At) activity distributions in cryosections of murine and canine tissue samples. Results: The highest spatial resolution was measured at ∼20 μm full width at half maximum and the α-particle background was measured at a rate as low as (2.6 ± 0.5) × 10{sup −4} cpm/cm{sup 2} (40 mm diameter detector area

  1. α-Imaging Confirmed Efficient Targeting of CD₄₅-Positive Cells After ²¹¹At-Radioimmunotherapy for Hematopoietic Cell Transplantation

    Energy Technology Data Exchange (ETDEWEB)

    Frost, Sophia; Miller, Brian W.; Back, Tom; Santos, E. B.; Hamlin, Donald K.; Knoblaugh, E.; Frayo, Shani; Kenoyer, Aimee L.; Storb, Rainer; Press, O. W.; Wilbur, D. Scott; Pagel, John M.; Sandmaier, B. M.


    Alpha-radioimmunotherapy (α-RIT) targeting CD45 may substitute for total body irradiation in hematopoietic cell transplantation (HCT) preparative regimens for lymphoma. Our goal was to optimize the anti-CD45 monoclonal antibody (MAb; CA12.10C12) protein dose for astatine-²¹¹(²¹¹At)-RIT, extending the analysis to include intra-organ ²¹¹At activity distribution and α-imaging-based small-scale dosimetry, along with imunohistochemical staining. Methods: Eight normal dogs were injected with either 0.75 (n=5) or 1.00 mg/kg (n=3) of ²¹¹At-B10-CA12.10C12 (11.5–27.6 MBq/kg). Two were euthanized and necropsied 19–22 hours postinjection (p.i.), and six received autologous HCT three days after ²¹¹At-RIT, following lymph node and bone marrow biopsies at 2–4 and/or 19 hours p.i. Blood was sampled to study toxicity and clearance; CD45 targeting was evaluated by flow cytometry. ²¹¹At localization and small scale dosimetry were assessed using two α-imaging : α-camera and iQID. Results: Uptake of ²¹¹At was highest in spleen (0.31–0.61 %IA/g), lymph nodes (0.02–0.16 %IA/g), liver (0.11–0.12 %IA/g), and marrow (0.06–0.08 %IA/g). Lymphocytes in blood and marrow were efficiently targeted using either MAb dose. Lymph nodes remained unsaturated, but displayed targeted ²¹¹At localization in T lymphocyte-rich areas. Absorbed doses to blood, marrow, and lymph nodes were estimated at 3.9, 3.0, and 4.2 Gy/210 MBq, respectively. All transplanted dogs experienced transient hepatic toxicity. Liver enzyme levels were temporarily elevated in 5 of 6 dogs; 1 treated with 1.00 mg MAb/kg developed ascites and was euthanized 136 days after HCT. Conclusion: ²¹¹At-anti-CD45 RIT with 0.75 mg MAb/kg efficiently targeted blood and marrow without severe toxicity. Dosimetry calculations and observed radiation-induced effects indicated that sufficient ²¹¹At-B10-CA12.10C12 localization was achieved for efficient conditioning for HCT.

  2. The role of alpha therapy for local and systemic treatment of cancer

    Energy Technology Data Exchange (ETDEWEB)

    Allen, B.J. [St George Hospital, Kogarah, NSW (Australia)


    Major problems in the management of cancer relate to the inability to control some primary lesions, e.g. glioblastoma multiforme (GBM), and the inability to deal with metastatic cancer arising from malignant cancers such as melanoma, breast and other cancers. Binary alpha therapy using neutron capture in boron-10 offers the potential for improved prognosis for high grade brain tumours such as GBM and melanoma metastases to the brain. Metastatic cancer proceeds through a number of quite separate stages in the development of lethal disease, i e. cells in transit, preangiogenic lesions, subclinical and clinical lesions. Early stages offer the potential for control if targeted alpha therapy is applied. However, the dose must be localised to the cancer cell and this requirement rules out beta-emitting radionuclides, which are more suited for clinical lesions. Alpha-emitting radionuclides are the most appropriate toxins, as their efficacy depends on the linear energy transfer (LET) and range of the alpha particles. After matching the cancer stage, radiolabel and carrier, we find that {sup 149}Tb is the radionuclide of choice for systemic therapy in all aspects except production. The production of {sup 149}Tb in {mu}Ci (kBq) quantities has been achieved using the heavy ion reaction at the ANU tandem accelerator at Canberra and in multi-mCi (MBq) quantities using the spallation reaction in combination with on-line isotope separation technology of ISOLDE at CERN. Terbium is ideally suited for chelation to monoclonal antibodies to produce stable radio-immunoconjugates (RIC). Astatine-211 is a halide and has potential for the elimination of early stage melanoma metastases as At-MTB. However, the availability of the alpha generators {sup 228}Th-{sup 212}Bi and {sup 225}Ac-{sup 213}Bi facilitates the use of Bi-RIC in clinical trials for acute myeloid leukaemia and cystic glioma. Alpha therapy has the potential to control refractory cancers when treated at the minimum residual

  3. Systematics of Alpha-Radioactivity

    Energy Technology Data Exchange (ETDEWEB)

    Perlman, I.; Ghiorso, A.; Seaborg, G.T.


    Correlations of alpha-decay energies in terms of mass number and atomic number have been made for all of the alpha-emitting species now numbering over 100. For each element isotopes show increase in alpha-energy with decrease in mass number except in the region of 126 neutrons where there is an explainable reversal. This reversal has the effect of creating a region of relatively low alpha-energy and long half-life at low mass numbers for such elements as astatine, emanation, francium, and possibly higher elements as had been noted already for bismuth and polonium. Methods and examples of using alpha-decay data to define the energy surface in the heavy element region are discussed. The regularities in alpha-decay are used for predictions of nuclear properties including prediction of the beta-stable nuclides among the heavy elements. The half-life vs. energy correlations show that the even-even nuclides conform well with existing alpha-decay theory, but all nuclear types with odd nucleons show prohibited decay. The reason for this prohibition is not found in spin changes in the alpha-emission but in the assembly of the components of the alpha particle, and this theory is discussed further in terms of observations made on nuclides having two or more alpha-groups. Using most of the even-even nuclei to define 'normal nuclear radius' calculations are now able to show the shrinkage in the regions of lead and of 126 neutrons to amount to about 10%. The much greater change in 'effective radius' for bismuth isotopes can be dissociated into the effects of odd nucleons superimposed on the actual decrease in nuclear radius. The simple expression r = 1.48 A{sup 1/3} {center_dot} 10{sup -13} cm seems to fit the data for the even-even nuclei outside of the region of 126 neutrons better than more complex functions.

  4. The Effects of Gender and Loneliness Levels on Ways of Coping among University Students (United States)

    Cecen, A. Rezan


    The purpose of this study is to determine the effects of gender differences and levels of loneliness on ways of coping. The sample of the study is composed of 462 university students (245 male, 217 female) from different departments from the Education Faculty at Cukurova University. In this study to collect data related to loneliness as an…

  5. NJP VOLUME 41 NO 2

    African Journals Online (AJOL)



    Jan 3, 2014 ... Department of Pediatrics,. Garandawa H, Isa A, Ngamdu YB. Department of ENT Surgery,. Mustapha Z. Department of Radiology,. Tahir C. Burns and Plastic Unit,. Department of Surgery,. University of Maiduguri Teaching. Hospital. Maiduguri, Borno State, Nigeria. DOI:,17.

  6. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 217 ... Vol 6 (2010), Pediatric Burns at The Rift Valley Provincial General Hospital, Nakuru, Kenya, Abstract PDF. PR Oduor. Vol 9 (2012), Periduodenal Tuberculosis masquerading as Annular Pancreas, Abstract PDF. K Ongeti, A Pulei, P Mandela, P Kimpiatu. Vol 13, No 2 (2016), Plummer-Vinson Syndrome ...

  7. Questions

    DEFF Research Database (Denmark)

    Larsen, Steen Nepper


    Bidrag til festskrift til Jesper Hoffmeyer i anledning af hans 70 års dag i Don Favineau, Paul Cobley & Kalevi Kull (eds.): "A More Developed Sign. Interpreting the Work of Jesper Hoffmeyer". Antologien udg. som særnummer af Tartu Semiotics Library Nr. 10 og mit bidrag forefindes på p. 217-220....

  8. High and Mighty: Implicit Associations between Space and Social Status (United States)


    e.g., Piaget , 1927/1969; Tversky et al., 1991). To date, dozens of experiments across a wide range of disciplines, from psychology to anthropol- ogy...The Psychology of Learn- ing and Motivation, ed. B. H. Ross (Burlington: Academic Press), 217–248. Piaget , J. (1927/1969). The Child’s Con- ception of

  9. Schlieren Movies of the 8-Inch Diameter Rigid Parachute Model of the Cook Research Laboratory Taken During the Fourth Phase of Testing in the Langley Unitary Plan Wind Tunnel (United States)


    Canopy Model IV was tested in four different configuration series. Shroud lines were used in the first three series of tests; none were used in the fourth series. Other variables were Mach number (1.77, 2.17, 2.76), dynamic pressure (290, 250, 155 lb per sq ft), camera speed, and attitude.

  10. A Survey of Knowledge Management in Law Firms in Botswana ...

    African Journals Online (AJOL)

    This article provides an empirical assessment of knowledge management in law firms in Botswana. It employs survey research methodology and triangulation of qualitative and quantitative methods of data collection. Data were collected mainly through a questionnaire administered to the 217 lawyers in all the law firms ...

  11. Indilinga: African Journal of Indigenous Knowledge Systems - Vol 12 ...

    African Journals Online (AJOL)

    On the development of uniquely African management theory · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Geoff A Goldman, 217-230. Leadership practices among the Lamba people of Zambia: some implications for school leadership · EMAIL FULL TEXT EMAIL FULL TEXT

  12. Compaction-Based Deformable Terrain Model as an Interface for Real-Time Vehicle Dynamics Simulations (United States)


    Dimensional Terrain Surfaces," J. of Terramechanics, 47(4), pp. 209-217. [10] Bekker , M. G., 1956, Theory of land locomotion; the mechanics of...for all applications related to vehicle dynamics," Vehicle System Dynamics, 45(139-151). [18] Bekker , M. G., 1960, Off-the-road locomotion; research

  13. 78 FR 49978 - Airworthiness Directives; the Boeing Company Airplanes (United States)


    ... x $85 per $0 $340 per inspection $142,460 per hour = $340 per cycle. inspection cycle. inspection... Costs Action Labor cost Parts cost Cost per product Repair Up to 136 work-hours x $85 per $5,217 Up to... pressure chord, pressure chord radius, ] forward and aft sides of the angle stiffener, forward and aft...

  14. Regulatory ecotoxicity testing of nanomaterials – proposed modifications of OECD test guidelines based on laboratory experience with silver and titanium dioxide nanoparticles

    DEFF Research Database (Denmark)

    Hund-Rinke, Kerstin; Baun, Anders; Cupi, Denisa


    of the sediment-living worm Lumbriculus variegatus (TG 225), activity of soil microflora (TGs 216, 217), and reproduction of the invertebrates (Enchytraeus crypticus, Eisenia fetida, TGs 220, 222). Additionally, test descriptions for two further test systems (root elongation of plants in hydroponic culture; test...

  15. The effect of anxiety and depression scores of couples who ...

    African Journals Online (AJOL)

    Objective: The aim of this study was to determine the effect of anxiety and depression scores of couples who underwent Assisted Reproductive Techniques (ART) on pregnancy outcomes. Method: This study was conducted as a prospective and comparative study with 217 couples. The study data was collected by using a ...

  16. A Longitudinal Daily Diary Study of Family Assistance and Academic Achievement among Adolescents from Mexican, Chinese, and European Backgrounds (United States)

    Telzer, Eva H.; Fuligni, Andrew J.


    A longitudinal daily diary method was employed to examine the implications of family assistance for the academic achievement of 563 adolescents (53% female) from Mexican (n = 217), Chinese (n = 206), and European (n = 140) backgrounds during the high school years (mean age 14.9 years in 9th grade to 17.8 years in 12th grade). Although changes in…

  17. Re-Victimization Patterns in a National Longitudinal Sample of Children and Youth (United States)

    Finkelhor, David; Ormrod, Richard K.; Turner, Heather A.


    Objective: To understand to the degree to which a broad variety of victimizations, including child maltreatment, conventional crime, peer, and sexual victimizations, persist for children from 1 year to the next. Design: A national sample of 1467 children aged 2-17 recruited through random digit dialing and assessed via telephone interviews (with…

  18. 75 FR 60694 - Taking and Importing Marine Mammals; Naval Explosive Ordnance Disposal School Training Operations... (United States)


    ... threats in all world environments. Mine Countermeasures (MCM) detonations is one function of the U.S. Navy... National Oceanic and Atmospheric Administration 50 CFR Part 217 RIN 0648-AY64 Taking and Importing Marine... AGENCY: National Marine Fisheries Service (NMFS), National Oceanic and Atmospheric Administration (NOAA...

  19. Oedema (exudative diathesis) in Ostriches in Kenya | Ngatia | Kenya ...

    African Journals Online (AJOL)

    In 10 chicks, the oedema was subcutaneous and severe, in 5 it was only serous effusions in body cavities and in 217 it was manifested as wetness of subcutaneous tissues. Adult and juvenile ostriches originated from three farms, where they were kept as pets. Of 22 birds, 16 (72.7%) developed a general sickness and 10 ...

  20. PM Mumo Holistic Healing, An Analytical Review of Medicine-men ...

    African Journals Online (AJOL)

    PM Mumo

    on the profession to his son or other younger relative (Mbiti 1969, 167). Yet others received their calls through visions or dreams (Magesa1997,217). .... For example, Simon Kimbangu in Congo used prophetic and healing ministries to eradicate witchcraft, wicked spirits and bad medicine (Ngewa 1998, 291). Through the ...

  1. Caregivers' Suffix Frequencies and Suffix Acquisition by Language Impaired, Late Talking, and Typically Developing Children (United States)

    Warlaumont, Anne S.; Jarmulowicz, Linda


    Acquisition of regular inflectional suffixes is an integral part of grammatical development in English and delayed acquisition of certain inflectional suffixes is a hallmark of language impairment. We investigate the relationship between input frequency and grammatical suffix acquisition, analyzing 217 transcripts of mother-child (ages 1 ; 11-6 ;…

  2. Enhanced lipase production by mutation induced Aspergillus ...

    African Journals Online (AJOL)

    ... the HNO2 mutant (AHN3) and 217% higher than the UV mutant (AUV3) and 276% higher lipase activity than the parent strain. The results indicated that UV, HNO2 and NTG treatment were effective physical and chemical mutagenic agents for strain improvement of Aspergillus japonicus for enhanced lipase productivity.

  3. Distribution of phosphorus and phosphatisation along the western continental margin of India

    Digital Repository Service at National Institute of Oceanography (India)

    Rao, Ch.M.; Paropkari, A.L.; Mascarenhas, A.; Murty, P.S.N.

    Phosphate content in the bulk sediments range from 0.02 to 2.17% and on carbonate free basis it varies from 0.03 to 6.5%. The partition studies indicate that contribution from the acid resistant detrital minerals (HCl insolubles) is negligible...

  4. Relationship between Subtypes of Restricted and Repetitive Behaviors and Sleep Disturbance in Autism Spectrum Disorder (United States)

    Hundley, Rachel J.; Shui, Amy; Malow, Beth A.


    We examined the association of two types of restricted and repetitive behaviors, repetitive sensory motor (RSM) and insistence on sameness (IS), with sleep problems in children with autism spectrum disorder (ASD). Participants included 532 children (aged 2-17) who participated in the Autism Speaks Autism Treatment Network research registry.…

  5. Journal of Genetics, Volume 84, 2005

    Indian Academy of Sciences (India)

    and their host nuclear genes in four plant species. 55. Genetics of adult plant stripe rust resistance in CSP44, a ... Campos-Ortega (Special feature). 217. Journal of Genetics, Volume 84, 2005. AUTHOR ... Ghosh, Saurabh. Dissecting the correlation structure of a bivariate phenotype: common genes or shared environment?

  6. Hyperfine splitting in positronium to O({alpha}{sup 7}m{sub e}). One-photon annihilation contribution

    Energy Technology Data Exchange (ETDEWEB)

    Baker, M. [Alberta Univ., Edmonton, AB (Canada). Dept. of Physics; Marquard, P. [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany); Penin, A.A. [Alberta Univ., Edmonton, AB (Canada). Dept. of Physics; Karlsruher Institut fuer Technologie (Germany). Inst. fuer Theoretische Teilchenphysik; Piclum, J. [Technische Univ. Muenchen, Garching (Germany). Physik-Department; RWTH Aachen (Germany). Inst. fuer Theoretische Teilchenphysik und Kosmologie; Steinhauser, M. [Karlsruher Institut fuer Technologie (Germany). Inst. fuer Theoretische Teilchenphysik


    We present the complete result for the O({alpha}{sup 7}m{sub e}) one-photon annihilation contribution to the hyperfine splitting of the ground state energy levels in positronium. Numerically it increases the prediction of quantum electrodynamics by 217{+-}1 kHz.

  7. Differences in injury risk and characteristics between Dutch amateur and professional soccer players

    NARCIS (Netherlands)

    Beijsterveldt, A.M.C. van; Stubbe, J.H.; Schmikli, S.L.; Port, I.G.L. van de; Backx, F.J.G.


    Objectives: To compare the incidence and characteristics of injuries between Dutch amateur and professional male soccer players during one entire competition season. Design: A prospective two-cohort design. Methods: During the 2009-2010 season, 456 Dutch male amateur soccer players and 217

  8. Storytelling Slide Shows to Improve Diabetes and High Blood Pressure Knowledge and Self-Efficacy: Three-Year Results among Community Dwelling Older African Americans (United States)

    Bertera, Elizabeth M.


    This study combined the African American tradition of oral storytelling with the Hispanic medium of "Fotonovelas." A staggered pretest posttest control group design was used to evaluate four Storytelling Slide Shows on health that featured community members. A total of 212 participants were recruited for the intervention and 217 for the…

  9. Prevalence and correlates of aggression among psychiatric in ...

    African Journals Online (AJOL)

    The prevalence of aggression in this study was 19.5%. Of the 58 aggressive patients, 35 (21.7%) and 23 (16.8%) were male and female, respectively. Schizophrenic patients (31%) exhibited aggression more than any other diagnostic category. Most of the aggressive behavior occurred without provocation (63.3%).

  10. occurrence of some maastrichtian dinoflagellate cysts from the ...

    African Journals Online (AJOL)


    more understanding of the paleogeography of the Bida basin with respect to possible connection between the. Tethys and the south Atlantic in the Late Cretaceous and also may also help resolve more resolutely the precise age of the Patti sediments. 217. J. Ojo, Olusola, Department of Geology, University of Ilorin, Ilorin, ...

  11. Climate change and cashew (Anacardium occidentale L ...

    African Journals Online (AJOL)

    217 RESULTS ... 2Integrated Soil and Crop Management Research Unit, Laboratory of Soil Sciences, School of Science and. Technic of Crop ... This study aimed at analyzing the perceptions of cashew producers of the climate change, climate change effect on ... Benin are the most vulnerable to climate risks: drought, late and ...

  12. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 217 ... Vol 42, No 3 (2015), Emancipation and “the Great Wheel of Labour”: Enduring Liminality in Rayda Jacobs's The Slave Book (1988) and a Painting of Two Slave Women (1859) by Thomas Baines ... Vol 41, No 3 (2014), Feral Whispering: Conservation, Community and the Reach of the Literary, Abstract.

  13. partial molecular characterization of cowpea stunt isolates of ...

    African Journals Online (AJOL)


    2University of Arkansas, Department of Plant Pathology, 217 PTSC Bldg, Fayetteville, ARKANSAS (USA) 72701. ... I and differ at eight nucleotides positions, resulting in two amino acids difference. There was only one amino acid difference for the Blackeye Cowpea Mosaic Virus (BlCMV) isolates from both locations.

  14. Comparing large-scale hydrological model predictions with observed streamflow in the Pacific Northwest: effects of climate and groundwater (United States)

    Mohammad Safeeq; Guillaume S. Mauger; Gordon E. Grant; Ivan Arismendi; Alan F. Hamlet; Se-Yeun Lee


    Assessing uncertainties in hydrologic models can improve accuracy in predicting future streamflow. Here, simulated streamflows using the Variable Infiltration Capacity (VIC) model at coarse (1/16°) and fine (1/120°) spatial resolutions were evaluated against observed streamflows from 217 watersheds. In...

  15. 75 FR 9223 - Agency Forms Undergoing Paperwork Reduction Act Review (United States)


    ... increasing absenteeism among students or staff that impacted at least 824,966 students and 53,217 teachers... including the number of students and teachers impacted by the outbreak. Illness among school-aged students... of students and teachers impacted by the school dismissals. CDC will use the summary data to fully...

  16. 75 FR 14163 - Agency Forms Undergoing Paperwork Reduction Act Review (United States)


    ... dismissals nationwide including the number of students and teachers impacted by the outbreak. Illness among... rapidly increasing absenteeism among students or staff that impacted at least 824,966 students and 53,217 teachers. Although a system was put in place to track school closures in conjunction with the Department of...

  17. 78 FR 18598 - Agency Forms Undergoing Paperwork Reduction Act Review (United States)


    ... resulted in at least 1,351 school dismissals due to rapidly increasing absenteeism among students or staff. These dismissals impacted at least 824,966 students and 53,217 teachers. During that time, the U.S... requests about the overall number of school dismissals nationwide and the number of students and teachers...

  18. 77 FR 71797 - Proposed Data Collections Submitted for Public Comment and Recommendations (United States)


    ... cities resulted in at least 1,351 school dismissals due to rapidly increasing absenteeism among students or staff. These dismissals impacted at least 824,966 students and 53,217 teachers. During that time... students and teachers impacted by the school dismissals. CDC and ED recognized the importance of having a...

  19. Insectos paisas

    Directory of Open Access Journals (Sweden)

    Arturo Acero Pizarro


    Full Text Available Guía para el estudio de los macroinvertebrados acuáticos del departamento de Antioquia. Gabriel Roldán Pérez. Fondo FEN Colombia / Colciencias / Universidad de Antioquia, Bogotá, 1988, xi-217 págs.

  20. 76 FR 58077 - RTCA Program Management Committee (United States)


    .... 153-11/PMC-909, prepared by SC-217. Final Draft, New Document, Aircraft Secondary Barriers and..., Revised DO-178B, Software Considerations in Airborne Systems and Equipment Certification, RTCA Paper No... Paper No. 156-11/PMC-912, prepared by SC-205. Final Draft, New Document, Software Tool Qualification...

  1. AcEST: BP919608 [AcEST

    Lifescience Database Archive (English)

    Full Text Available richa nova PE=3 SV=1 95 4e-23 sp|O00937|ACT_HISCA Actin OS=Histriculus cavicola PE=3 SV=2 94 8e-23 sp|P53468...-VRDIKEKLC 216 Query: 504 AVADDYAAIMQ 536 VA DY A M+ Sbjct: 217 FVALDYEAAMK 227 >sp|O00937|ACT_HISCA Actin OS=Histriculus cavicola

  2. Ionic identity of pore water influences pH preference in Collembola.

    NARCIS (Netherlands)

    Salmon, S.; Ponge, J.F.; van Straalen, N.M.


    A test system described by Van Straalen and Verhoef [J Appl Ecol 34 (1997) 217] was used in order to check whether the endogeic Collembolan Heteromurus nitidus was repelled by acid pH. In each of the eight experimental runs 16 naive animals were allowed to select sectors in a circular pH gradient

  3. Predicting mobility outcome one year after stroke: a prospective cohort study.

    NARCIS (Netherlands)

    Port, I.G. van de; Kwakkel, G.; Schepers, V.P.; Lindeman, E.


    OBJECTIVE: To develop a prognostic model to predict mobility outcome one year post-stroke. DESIGN: Prospective cohort study in patients with a first-ever stroke admitted for inpatient rehabilitation. PATIENTS: A total of 217 patients with stroke (mean age 58 years) following inpatient rehabilitation

  4. Politikberatung aus den Staatswissenschaften = Riigiteadus poliitikanõustajana / Jürgen Backhaus

    Index Scriptorium Estoniae

    Backhaus, Jürgen


    Teadmistepõhine poliitika eeldab, et teadmised, millele poliitika peab tuginema, on tõepoolest ka olemas ja et on olemas keegi, kes oskab neid poliitikuile efektiivselt edastada. Sotsiaalteaduste puhul kerkib esile probleem, et vastav kommunikatsioon on üha puudulikum, leiab autor. Vt. ka kommentaare lk. 217-222,467-472

  5. Dicty_cDB: Contig-U15405-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tugueseWaterDog Canis familiar... 44 0.80 1 ( BV312740 )...s troglodyt... 44 0.80 1 ( BV495481 ) S217P61918FE2.T0 Noemie Pan troglodytes troglodyt... 44 0.80 1 ( BV436248 ) S237P6495RF5.T0 Por

  6. Academic Inbreeding in the Portuguese Academia (United States)

    Tavares, Orlanda; Cardoso, Sónia; Carvalho, Teresa; Sousa, Sofia Branco; Santiago, Rui


    This paper analyses the inbreeding phenomena in Portuguese public universities. Inbreeding is defined as the recruitment of academics by the same institution that awarded their PhDs. Focusing on 1,217 PhD-holding Portuguese academics, belonging to four public universities and to six disciplinary areas, inbreeding is analysed in order to understand…

  7. AcEST: BP912285 [AcEST

    Lifescience Database Archive (English)

    Full Text Available utative uncharacterized protein YHR217C OS... 31 4.6 sp|P08411|POLN_SFV Non-structural polyprotein OS=Semliki forest...ural polyprotein OS=Semliki forest virus PE=1 SV=2 Length = 2432 Score = 30.0 bits (66), Expect = 7.9 Identi

  8. Experiment list: SRX014770 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available on=Bone Marrow|Tissue Diagnosis=Leukemia 14403159,71.1,32.3,217 GSM468200: RAR ChIPseq NB4 24hoursATRA JM21 ...source_name=NB4 cells || agent=24 hours ATRA || antibody=RAR

  9. The effect of anxiety and depression scores of couples who ...

    African Journals Online (AJOL)

    sisted Reproductive Techniques (ART) on pregnancy outcomes. Method: This study was conducted as a prospective and comparative study with 217 couples. The study data was collected by using a semi-structured questionnaire and the Turkish version of the State-Trait Anxiety Inventory (STAI), and Beck Depression.

  10. Dissolved petroleum hydrocarbons along the oil tanker route in the southern Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Topgi, R.S.; Noronha, R.J.; Fondekar, S.P.; SenGupta, R.

    Concentrations of dissolved petroleum hydrocarbons during 3 cruises (Nos. 51, 66 and 68) of R V Gaveshani, along the oil tanker route, in the southern Bay of Bengal at 0, 10 and 20 m were 19.95 + or - 3.38, 16.78 + or - 2.53 and 13.45 + or - 2.17 mu...

  11. The Ophthalmic status manifestations of nutritional and lifestyle ...

    African Journals Online (AJOL)

    The dietary intakes of vitamin A rich food were so low that they could not be represented quantitatively. About 71.0% of the men were habitual users of alcoholic beverages and 22.0% smoked tobacco. About 21.7% of men had Bitot's spot while 4.3% had keratomalacia. The logistic regression analysis predicted that alcohol ...

  12. Neighbourhood facilities for sustainability

    CSIR Research Space (South Africa)

    Gibberd, Jeremy T


    Full Text Available . Dev. 15, pp.160–173, 2007. [5] Button, K., City management and urban environmental indicators. Ecological Economics, 40(2), pp. 217–233, 2002. [6] World Wild Life Fund, The Living Planet Report, Accessed from www.panda...

  13. Bacterial utilization of size-fractionated dissolved organic matter

    Digital Repository Service at National Institute of Oceanography (India)

    Khodse, V.B.; Bhosle, N.B.

    ), dissolved uronic acid (DURA), delta13C, bacterial abundance (BA), and bacterial production (BP). The LMW fraction was isotopically heavier (delta13C = −23.7 to −21.7ppt) than the HMW fraction (delta13C = −27.0 to −26.2ppt), and the initial TDCHO content...

  14. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... views 5:53 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 59,483 views 5: ... Medway CCG 173,217 views 27:40 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...

  15. Resonance Special Issue - World Year of Physics -RE ...

    Indian Academy of Sciences (India)

    Amit Roy. 176. Ludwig Boltzmann and Entropy. Sriram Ramaswamy. 179 The Case of Missing Solar Neutrinos with their Split Personalities. S M Chitre. 193. Dirac's Conception of the Magnetic Monopole, and its Modern Avatars. Sunil Mukhi. 203. Magnetic Resonance Imaging: Window to a Watery World. Kavita Dorai. 217.

  16. Tartu biomeditsiiniettevõtluse võimalused ja riiklikud poliitikad = Über die Möglichkeiten von Biomedizin-Unternehmen in Tartu und die staatliche Politik / Garri Raagmaa

    Index Scriptorium Estoniae

    Raagmaa, Garri, 1966-


    Teadmistepõhisest majandusest on küll palju räägitud, kuid selle sisu on jätkuvalt segane ja seetõttu ähvardab devalveeruda. Autori hinnangul on vaja enam kommunikatsiooni ning vastastikku arusaamist teadlaste, poliitikute ja ettevõtjate vahel. Vt. ka kommentaare lk. 217-222,467-472

  17. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Ed Lorenz: Father of the 'Butterfly Effect' · G Ambika · More Details Fulltext PDF. pp 206-216 General Article. Multivariable Chinese Remainder Theorem · B Sury · More Details Fulltext PDF. pp 217-234 General Article. C-II Acid and the Stereochemistry of Abietic Acid · S N Balasubrahmanyam · More Details Fulltext PDF.

  18. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 217 ... Vol 41 (2013), Applying the design process to apparel prototype development: Students' experiences of a community service-learning project, Abstract PDF. M Strydom, TJ Tselepis. Special Edition. Food and nutrition challenges in Southern Africa. Vol 2 (2017), Assessment of dietary challenges faced by ...

  19. Developing Quality Strategic Plan in Secondary Schools for Successful School Improvement (United States)

    Chukwumah, Fides Okwukweka


    The study examined the extent to which development of quality strategic plans for Anambra State secondary schools' improvement had been done by schools. The research design used was a descriptive survey. Respondents comprised 217 principals. There was no sampling since all the principals were used. Data were collected using "Schools'…

  20. Problems of Implementation of Strategic Plans for Secondary Schools' Improvement in Anambra State (United States)

    Chukwumah, Fides Okwukweka; Ezeugbor, Carol Obiageli


    This study investigated the extent of problems of strategic plans implementation for secondary schools' improvement in Anambra State, Nigeria for quality education provision. The study used a descriptive survey design paradigm. Respondents comprised 217 principals. There was no sampling. All the principals were used. Data were collected using…

  1. Extending Campus Life to the Internet: Social Media, Discrimination, and Perceptions of Racial Climate (United States)

    Tynes, Brendesha M.; Rose, Chad A.; Markoe, Suzanne L.


    Despite the fact that more college student interaction now takes place online, researchers have yet to examine the role the Internet plays in perceptions of campus racial climate. Using an online survey of a sample of 217 African American and European American college students, this study explored online factors including intergroup interaction as…

  2. Occupational Gender Stereotypes and Problem-Solving in Italian Adolescents (United States)

    Ginevra, Maria Cristina; Nota, Laura


    The first purpose of the study was to establish how Italian adolescents perceive jobs in the newly emerging economy sectors as well as more traditional jobs from gender-stereotyped and gender-segregated perspectives. The second purpose was to verify the role of problem-solving and gender in gender-role stereotyping. A total of 217 Italian high…

  3. Ischaemic heart disease in Aminu Kano Teaching Hospital, Kano ...

    African Journals Online (AJOL)

    Forty six patients were diagnosed to have IHD giving it a prevalence of 0.9% of medical conditions and 3.4% of all cardiovascular cases. There were 33 males and 13 females (M: F = 2.5:1). Twenty two patients (47.8%) had myocardial infarction, 14(30.4%) had ischemic cardiomyopathy and 10 (21.7%) had angina.

  4. Math. $0033 (1986) 307—318. '

    Indian Academy of Sciences (India)

    [7] Khandem-Maboudi A A and Pourabdollah M A, Almost periodic type function spaces on. I weighted semitopological semigroups, Far East J. Math. Sci. Special Volume (1998) part I,. 107-116. [8] Lashkarizadeh Batni M, Function algebras on weighted topological semigroups, Math. Japonica 47 (1998) 217—227.

  5. Untitled

    African Journals Online (AJOL)

    previous growth of the wood species in the trials. This enables careful thought— out plan of action of how the experiment may be carried out. Such an approach .... an apprwliate -0 1. tone: QISBIIS whizhcenbeeaslz 'Iihfgh. References. Begg, J. E., and Turner, N. C (1976) Crop. Water Deficits. Adv. Agron., 28: 161-217.

  6. heavy metal profiles in various matrices of the bonny/new calabar ...

    African Journals Online (AJOL)


    J. of Appl. Toxico. (13): 217–224. Nwilo, P. C and Badejo, O. T., 2008. Impacts and management of oil spill in Nigerian coastal environment. Proceedings of the. International Conference on the Nigerian. State, Oil Industry and the Niger Delta. 1217-1232. Obasohan, E. E., 2008. Heavy metals in the. Sediment of Ibiekuma ...

  7. Differential responses of two rubber tree clones to chilling stress ...

    African Journals Online (AJOL)

    Chilling stress is one of the most important environmental factors that limit the growth, distribution and yield of rubber tree in China. The effects of chilling stress on the grated plants of two rubber trees clones, GT1 and Wenchang217, were studied by physiological methods in controlled light chamber in order to explore the ...


    African Journals Online (AJOL)


    Filosofia Theoretica: Journal of African Philosophy, Culture and Religion. 217. Editorial. The issues concerning African studies addressed in this volume are quite diverse and original. As we continue to develop, propagate and promote a new phase of African philosophy, culture, history and religion where creative originality ...

  9. A tale of three cities: Insight into the impacts of holiday rentals in ...

    African Journals Online (AJOL)

    Greater freedom offered by rented apartments is important, though the favourable costs when compared with hotel stays was also valued. In Paris, the rented accommodation spend by tourists is estimated to be as much as €217 140 000. Côte d'Azur in rented properties generates an average accommodation expenditure of ...

  10. Predictors of Changes in Body Image Concerns of Chinese Adolescents (United States)

    Chen, Hong; Jackson, Todd


    This nine-month prospective study tested the extent to which risk factors implicated in recent accounts of body dissatisfaction predicted changes in body image concerns of adolescent boys and girls in China. A sample of 593 Chinese adolescents (217 boys, 376 girls) completed measures of weight esteem, appearance esteem and physical stature concern…

  11. Exploring the African cassava (Manihot esculenta Crantz ...

    African Journals Online (AJOL)

    Development to torpedo stage took between 55 to 65 days. Higher success was achieved with leaf lobes (21.7%) than axillary meristem (13.8%). There was a significant (p<0.01) genotype x explant interaction, indicating that ability of the cassava genotypes to undergo somatic embryogenesis was influenced by the explant.

  12. Self-Regulation Mediates the Link between Family Context and Socioemotional Competence in Turkish Preschoolers (United States)

    Gündüz, Gizem; Yagmurlu, Bilge; Harma, Mehmet


    Research Findings: In this study, we examined self-regulatory skills, namely, effortful control and executive function, in Turkish preschoolers (N = 217) and their mediating roles in the associations between parenting and children's socioemotional competence. We also investigated the role of family socioeconomic status and maternal psychological…

  13. Gclust Server: 44444 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 44444 HSA_46409332 Cluster Sequences Related Sequences(39) 217 NP_997232.1 hypothetical protein LOC284739...1.00e-99 0.0 0.0 0.0 0.0 0.0 12.5 Show 44444 Cluster ID 44444 Sequence ID HSA_46409332 Link to cluster

  14. Evaluation of toxicity of pesticides and their biodegradation products using human cells

    Czech Academy of Sciences Publication Activity Database

    Forman, S.; Novák, Jaroslav; Tykva, Richard; Káš, J.; Wimmer, Zdeněk; Ruml, T.


    Roč. 46, - (2002), s. 209-217 ISSN 0045-6535 R&D Projects: GA ČR GA203/99/1447 Institutional research plan: CEZ:AV0Z4055905 Keywords : juvenile hormone Subject RIV: CE - Biochemistry Impact factor: 1.461, year: 2002

  15. Mass distributions of a macromolecular assembly based on ...

    Indian Academy of Sciences (India)


    quaternary structures are virtually identical at a resolution of ~ 2 nm (Cejka ... low resolution crystallographic structure of Lumbricus Er ...... 1433 217–228. Vinogradov S N and Kolodziej P 1988 The molecular mass of the extracellular hemoglobin of Lumbricus terrestris deter- mined by electron microscopy; Comp. Biochem.

  16. Computable majorants of the limit load in Hencky's plasticity problems

    Czech Academy of Sciences Publication Activity Database

    Repin, S.; Sysala, Stanislav; Haslinger, Jaroslav


    Roč. 75, č. 1 (2018), s. 199-217 ISSN 0898-1221 R&D Projects: GA MŠk LQ1602 Institutional support: RVO:68145535 Keywords : computable bounds * divergence free fields * Hencky's plasticity * limit load * penalization Subject RIV: BA - General Mathematics Impact factor: 1.531, year: 2016

  17. Detrimental effect of clomipramine on hippocampus-dependent learning in an animal model of obsessive-compulsive disorder induced by sensitization with d2/d3 agonist quinpirole

    Czech Academy of Sciences Publication Activity Database

    Hatalová, Hana; Radostová, Dominika; Pištíková, Adéla; Valeš, Karel; Stuchlík, Aleš


    Roč. 317, Jan 15 (2017), s. 210-217 ISSN 0166-4328 R&D Projects: GA MZd(CZ) NV15-34524A; GA MŠk(CZ) LH14053 Institutional support: RVO:67985823 Keywords : obsessive-compulsive disorder * antipsychotics * antidepressant * animal model * quinpirole * rat Subject RIV: FH - Neurology Impact factor: 3.002, year: 2016

  18. Protective role of a methanolic extract of spinach (Spinacia oleracea L.) against Pb toxicity in wheat (Triticum aestivum L.) seedlings: beneficial effects for a plant of a nutraceutical used with animals. (United States)

    Lamhamdi, Mostafa; Bakrim, Ahmed; Bouayad, Noureddin; Aarab, Ahmed; Lafont, René


    Spinach extracts contain powerful natural antioxidants and have been used to improve the response of animal cells to various stress factors. The aim of the present study was to assess the effects of a methanolic extract of spinach (SE) used at two concentrations (21.7 and 217 ppm) on the growth, certain enzymes and antioxidant systems in wheat seedlings under lead stress. When wheat seedlings were grown for 7 days in a solution containing Pb(NO3)2 (3 mM), germination and growth were impaired, while signs of oxidative stress were observed. SE (217 ppm) pretreatment was able to protect seedlings from Pb toxicity by both reducing Pb uptake and Pb-induced oxidative stress. As a consequence, almost normal germination, elongation, biomass and α-amylase activity were restored by SE (217 ppm) pretreatment of wheat seedlings, in spite of the presence of Pb. Our results support the protective role and the antioxidant effect of SE against Pb. These results show an amazing similarity to the effects of SE in animals, which suggests that providing "nutraceuticals" to plants could improve their "health" status.

  19. Production of Ogi from germinated sorghum supplemented with ...

    African Journals Online (AJOL)

    Similarly, supplementation of Ogi with 30% (w/w) soya-flour generally resulted in increase in fat contents (approx. 130%), ash (approx. 54.9%) and fibre (approx. 217%). A panel of evaluators showed greatest preference for soya- supplemented Ogi porridge made from S. vulgare, while soya-supplemented Ogi porridge from ...

  20. Proteomic analysis of the Arabidopsis nucleolus suggests novel nucleolar functions

    DEFF Research Database (Denmark)

    Pendle, Alison F; Clark, Gillian P; Boon, Reinier


    analysis of plant (Arabidopsis thaliana) nucleoli, in which we have identified 217 proteins. This allows a direct comparison of the proteomes of an important nuclear structure between two widely divergent species: human and Arabidopsis. The comparison identified many common proteins, plant...

  1. Prevalence of concurrent use of antipsychotic drugs and herbal ...

    African Journals Online (AJOL)

    Participants were recruited randomly and intermittently until a sample size of 217 was attained. Data on the use of herbal medicines, type of antipsychotic drug, compliance with dosage regimen, duration of antipsychotic therapy, side effects of antipsychotic drugs and some socio-demographic characteristics were collected ...

  2. Analysis of Pacific Enroute Structure in Support of C-5M Super Galaxy (United States)


    optimization problem is the vehicle routing problem ( VRP ), which seeks to minimize the total cost between a single origin and several customer delivery...destinations by a fleet of vehicles (Dantzig, 1959:217-222). A special sub-set of the classic VRP is the strategic airlift problem (Toth, 2001). The

  3. Effectiveness of liquid organic-nitrogen fertilizer in enhancing ...

    African Journals Online (AJOL)



    Mar 21, 2011 ... 2Department of Forest Management, Faculty of Forestry, Universiti Putra Malaysia,43400 UPM Serdang Selangor,. Malaysia. Accepted 21 January ... Previous data showed that, uptake of P by corn increased more ..... Prentice Hall, Inc. Upper Saddle River, New Jersey, United. State of America, pp. 217-244.

  4. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. A Ghosh. Articles written in Bulletin of Materials Science. Volume 26 Issue 2 February 2003 pp 217-220 Synthesis. Effect of sillimanite beach sand composition on mullitization and properties of Al2O3–SiO2 system · H S Tripathi B Mukherjee S K Das A Ghosh G Banerjee.

  5. 76 FR 14829 - Safety Zone; 2011 Hylebos Bridge Restoration, Hylebos Waterway, Tacoma, WA (United States)


    ... Anthony P. LaBoy, USCG Sector Puget Sound Waterways Management Division, Coast Guard; telephone 206-217..., which will then become highlighted in blue. In the ``Document Type'' drop down menu select ``Proposed... assistance at the public meeting, contact Ensign Anthony P. LaBoy at the telephone number or e-mail address...

  6. 77 FR 5747 - Security Zones, Seattle's Seafair Fleet Week Moving Vessels, Puget Sound, WA (United States)


    ... Anthony P. LaBoy, Sector Puget Sound, Waterways Management Division, U.S. Coast Guard; telephone (206) 217..., which will then become highlighted in blue. In the ``Document Type'' drop down menu select ``Proposed... have questions concerning its provisions or options for compliance, please contact Ensign Anthony P. La...

  7. Economic evaluation of the successful biological control of Azolla filiculoides in South Africa

    CSIR Research Space (South Africa)

    McConnachie, AJ


    Full Text Available -user) was 2.17 ha, with an expansion rate of 1.33 ha per year. The frond-feeding weevil Stenopelmus rufinasus was released as a biological control agent at the end of 1997. Within 3 years, the weevil had reduced the weed population to the point...

  8. The Effect of Type and Concentration of Modifier in Supercritical Carbon Dioxide on Crystallization of Nanocrystalline Titania Thin Films.

    Czech Academy of Sciences Publication Activity Database

    Sajfrtová, Marie; Cerhová, Marie; Jandová, Věra; Dřínek, Vladislav; Daniš, E.; Matějová, L.


    Roč. 133 (2018), s. 211-217 ISSN 0896-8446 R&D Projects: GA ČR GA14-23274S Institutional support: RVO:67985858 Keywords : titania thin film * supercritical carbon dioxide * crystallization Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 2.991, year: 2016


    African Journals Online (AJOL)

    The most common diagnosis was simple myopic astigmatism (41.1%), then myopia, anisometropia, and compound myopic astigmatism with 21.7%, 10.6%, and 8.9%, respectively [Tables 1 and 2]. Conclusion: A good percentage of these children (females than males) have significant error which was correctable by glasses.

  10. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 217 ... JG Kabugi. Vol 8 (2011), “Non-functioning” Kidneys in Excretory Urography: Caution is the word! Abstract PDF. AA Ajape, M ... Vol 3 (2008), Breast self examination and breast cancer: Knowledge and practice among female medical students in a Kenyan university, Abstract PDF. S.M Kimani, E Muthumbi.

  11. Planck 2013 results. XVII. Gravitational lensing by large-scale structure

    DEFF Research Database (Denmark)

    Ade, P. A. R.; Aghanim, N.; Armitage-Caplan, C.


    On the arcminute angular scales probed by Planck, the cosmic microwave background (CMB) anisotropies are gently perturbed by gravitational lensing. Here we present a detailed study of this eect, detecting lensing independently in the 100, 143, and 217 GHz frequency bands with an overall significa...

  12. Deteriorated Concrete from Liner of WIPP Waste Shaft (United States)


    for US Department of Energy. Bensted, J. 1989. "Novel Cements - Sorel and Related Chemical Cements," il Cemento , Vol 86, No. 4, pp 217-228. Ben-Yair, M...Waste Isolation Pilot Plant. Massazza, F. 1985. "Concrete Resistance to Sea Water and Marine Environment," il Cemento , Vol 82, No. 1, pp 3-26. Mather

  13. Profiling Students' Capacities to Link Number and Algebra in Years 5, 6 and 7 in Nanjing, China (United States)

    Xu, Wenbin; Stephens, Max; Zhang, Qinqiong


    This study investigates how 217 students in Years 5, 6 and 7 from three schools in Nanjing, China, link number and algebra (called relational thinking in this study). It categorizes their performances in terms of five levels, and uses these levels to create profiles of algebraic thinking across Years 5, 6, and 7. The study examines the…

  14. Folklore Epistemology: How Does Traditional Folklore Contribute to Children's Thinking and Concept Development? (United States)

    Agbenyega, Joseph S.; Tamakloe, Deborah E.; Klibthong, Sunanta


    This research utilised a "stimulated recall" methodology [Calderhead, J. 1981. "Stimulated Recall: A Method for Research on Teaching." "British Journal of Educational Psychology" 51: 211-217] to explore the potential of African folklore, specifically Ghanaian folk stories in the development of children's reflective…

  15. Occurrence of indoor wood decay basidiomycetes in Europe

    Czech Academy of Sciences Publication Activity Database

    Gabriel, Jiří; Švec, Karel


    Roč. 31, č. 4 (2017), s. 212-217 ISSN 1749-4613 R&D Projects: GA ČR(CZ) GA17-05497S Institutional support: RVO:61388971 Keywords : Basidiomycetes * Fungi * Serpula lacrymans Subject RIV: EE - Microbiology, Virology Impact factor: 3.231, year: 2016

  16. Mining of expressed sequence tag libraries of cacao for ...

    Indian Academy of Sciences (India)

    leaves were used to screen a representative set of 12 accessions of cacao. [Riju A., Rajesh M. K., Sherin P. T. P. F., Chandrasekar A., Apshara S. E. and Arunachalam V. 2009 Mining of expressed sequence tag libraries of cacao for microsatellite markers using five computational tools. J. Genet. 88, 217–225]. Introduction.

  17. Movement patterns of red steenbras Petrus rupestrus tagged and ...

    African Journals Online (AJOL)

    ... fish tagged and released in the Tsitsikamma National Park, South Africa. Of 217 fish tagged, 38 were recaptured. Juveniles (700 mm FL) migrated in a north-easterly direction towards the Transkei coast. Keywords: marine protected areas, movement, tag and release, sparids

  18. 75 FR 57261 - Request for Comments on Incentivizing Humanitarian Technologies and Licensing Through the... (United States)


    ... (USPTO) is considering pro-business strategies for incentivizing the development and widespread... reexamination be offered for technologies addressing humanitarian needs? Are there other pro-business strategies... filings should be directed to the Patents Electronic Business Center (EBC) at 866-217-9197. SUPPLEMENTARY...

  19. 46 CFR 13.111 - Restricted tankerman endorsement. (United States)


    ... 46 Shipping 1 2010-10-01 2010-10-01 false Restricted tankerman endorsement. 13.111 Section 13.111... TANKERMEN General § 13.111 Restricted tankerman endorsement. (a) An applicant may apply at an REC listed in § 10.217 of this chapter for a tankerman endorsement restricted to specific cargoes, specific vessels...

  20. 1151-IJBCS-Article-Ayuba Samali

    African Journals Online (AJOL)


    2,5-Dihydroxy-4,3-di (ß-D-glucopyrano- syloxy)-trans-stilbene from. Morus bombycis Koidzumi root. Phytother. Res.,. 21(7): 605-608. Kathryn LN, Tracy W, Ashley SM, Brown. Susan ED, Graeme JMA. 2010. Hepatocellular carcinoma in patients with chronic hepatitis C virus infection without cirrhosis. World J. Gastroenterol.,.

  1. DMPD: Translational mini-review series on Toll-like receptors: recent advances inunderstanding the role of Toll-like receptors in anti-viral immunity. [Dynamic Macrophage Pathway CSML Database

    Lifescience Database Archive (English)

    Full Text Available 17223961 Translational mini-review series on Toll-like receptors: recent advances i...147(2):217-26. (.png) (.svg) (.html) (.csml) Show Translational mini-review series on Toll-like receptors: r...nity. PubmedID 17223961 Title Translational mini-review series on Toll-like receptors: recent advances inund


    NARCIS (Netherlands)



    Liposomes consisting of negatively charged phospholipids interact almost exclusively with the equatorial segment (ES) of human spermatozoa provided the cells have undergone the acrosome reaction (AR) [Arts, Kuiken, Jager and Hoekstra (1993) Eur. J. Biochem. 217, 1001-1009]. Using fluorescently

  3. Predicting site productivity of the timber tree Pterocarpus angolensis ...

    African Journals Online (AJOL)

    Indicators of productivity used at the local scale were basal area, proportional basal area and site form, which were derived from 217 forest inventory plots in Namibia and Angola. The productivity measures were modelled with abiotic site factors; biotic factors were added for the local scale. Results indicated that the most ...

  4. West African Journal of Applied Ecology

    African Journals Online (AJOL)

    Turacos were restricted to the more pristine parts of the KCA than in secondary forest, where the encounter rates were also relatively lower (0 and 2.17 individuals/h in primary and secondary forests, respectively). The relative abundance and encounter rates of turaco species also varied between the seasons of the year, ...

  5. Identifying the Challenging Factors in the Transition from Colleges of Engineering to Employment (United States)

    Baytiyeh, Hoda; Naja, Mohamad


    The transition from university to a career in engineering is a challenging process. This study examined the perceptions of engineering graduates regarding the difficulties they encountered in their transition from the university to the workplace. Lebanese practising engineers (n=217), living around the world, were surveyed to identify their…

  6. Intrinsic Remediation Engineering Evaluation/Cost Analysis for Car Care Center at Bolling Air Force Base, Washington, DC (United States)


    thicken to the southeast and dip toward the east ( Darton , 1950). The Coastal Plain sediments feather onto crystalline igneous and metamorphic Piedmont...16. Darton , N.H., 1950, Configuration of the Bedrock Surface of the District of Columbia and Vicinity, Geological Survey Professional Paper 217


    African Journals Online (AJOL)


    1Department of Pharmacology, 2Department of Herbal Medicine, Faculty of Pharmacy and Pharmaceutical Sciences, College of Health. Sciences ..... Internal Medicine. McgrawHill Co., New York, pp. 1088-1089. Vigar Z (1984). Atlas of Medical Parasitology, 2nd Edi- tion. P.G. Publishing House, Singapore, pp. 216-. 217.

  8. Microaneurysm count as a predictor of long-term progression in diabetic retinopathy in young patients with type 1 diabetes

    DEFF Research Database (Denmark)

    Rasmussen, Malin Lundberg; Broe, R; Frydkjaer-Olsen, U


    ), and incident diabetic macula edema (DME). RESULTS: We included 138 patients (138 eyes). Of these, 58 had no retinopathy and 80 had MAs only. At follow-up, rates of two-step progression of DR, progression to PDR and incident DME were 52.9, 21.7, and 10.1 %, respectively. In logistic regression models, MA count...

  9. Cross-Lagged Relationships between Career Aspirations and Goal Orientation in Early Adolescents (United States)

    Creed, Peter; Tilbury, Clare; Buys, Nick; Crawford, Meegan


    We surveyed 217 students (145 girls; average age = 14.6 years) on two occasions, twelve months apart, on measures of career aspirations (job aspirations, job expectations, educational aspirations) and goal orientation (learning, performance-prove, performance-avoid), and tested the causal relationship between goal orientation and aspirations. We…

  10. Nutritional status and laboratory parameters among internal ...

    African Journals Online (AJOL)


    Mar 19, 2015 ... Nutritional screening of geriatric patients, close follow‑up and providing earlier health care would contribute rehabilitation of chronic .... Male. 145 (50). Female. 145 (50). Admission diagnosis. Anemia. 47 (16.2). Endocrinology. 94 (32.4). Gastroenterology. 39 (13.4). Oncology. 63 (21.7). Cardiology. 13 (4.5).

  11. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 32; Issue 3. Issue front cover thumbnail. Volume 32, Issue 3. June 2009, pages 215-367. pp 215-215. Foreword · S B Krupanidhi H L Bhat · More Details Fulltext PDF. pp 217-225. Molecule-based magnets · J V Yakhmi · More Details Abstract Fulltext PDF.

  12. Attitudes Aren’t Free: Thinking Deeply about Diversity in the US Armed Forces (United States)


    Paschon, USAF (ret.) Brig Gen Terry L. Paul, USMC (ret.) Brig Gen Frederick R. Payne , USMC (ret.) Brig Gen Gary H. Pendleton, USA (ret.) Brig Gen...Medicine 174, no. 3 (2009): 217. Simon, Cecilia Capuzzi. “Bringing the War Home.” Psychotherapy Networker 31, no. 1 ( January/February 2007): 28–37

  13. Planck early results. XVIII. The power spectrum of cosmic infrared background anisotropies

    DEFF Research Database (Denmark)

    Poutanen, T.; Natoli, P.; Polenta, G.


    Using Planck maps of six regions of low Galactic dust emission with a total area of about 140 deg2, we determine the angular power spectra of cosmic infrared background (CIB) anisotropies from multipole = 200 to = 2000 at 217, 353, 545 and 857 GHz. We use 21-cm observations of Hi as a tracer of t...

  14. The outcome at 12 months of very-Iow-birth-weight infants ventilated ...

    African Journals Online (AJOL)


    Jul 7, 1995 ... neural deafness, intraventricular haemorrhage (IVH), retinopathy of ... suffer from the consequences of therapy received during the neonatal period or .... NICU and total hospitalisation for the different weight groups are shown in Table 11. MeanlPPV. 9,41. 21,7ab. (days). MeanO,therapy. 17,7. 41,3a. (days).

  15. Disasters, Victimization, and Children's Mental Health (United States)

    Becker-Blease, Kathryn A.; Turner, Heather A.; Finkelhor, David


    In a representative sample of 2,030 U.S. children aged 2-17, 13.9% report lifetime exposure to disaster, and 4.1% report experiencing a disaster in the past year. Disaster exposure was associated with some forms of victimization and adversity. Victimization was associated with depression among 2- to 9-year-old disaster survivors, and with…

  16. The stretch zone of automotive steel sheets

    Indian Academy of Sciences (India)

    This study brings new material properties which are necessary for modelling and simulation the crash behaviour of automotive sheets. ... The specimens were loaded by eccentric tension on a tensile testing machine (FP 100/1) at two crosshead-rates: 0.0217 and 2.17 mm/s. The videoextensometry technique enables us to.

  17. Dicty_cDB: SSI190 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1e-13 BT076915_1( BT076915 |pid:none) Caligus rogercresseyi clone crog-e... 77 8e-13 CR382131_1062( CR382131...7e-12 BT077060_1( BT077060 |pid:none) Caligus rogercresseyi clone crog-e... 73 9e-12 FM992689_217( FM992689

  18. Photosymbiotic Giant Clams are Transformers of Solar Flux (United States)


    3059–3066. (doi:10.1242/ jeb .009597) 31. Ainsworth TD , Hoegh-Guldberg O. 2008 Cellular processes of bleaching in the Mediterranean coral Oculina...light transfer ensures efficient resource distribution in symbiont-bearing corals. J. Exp. Biol. 217, 489–498. (doi:10.1242/ jeb . 091116) 33. Cuzzi JN

  19. AcEST: DK951868 [AcEST

    Lifescience Database Archive (English)

    Full Text Available -30 tr|Q43412|Q43412_BIDPI Calmodulin OS=Bidens pilosa PE=2 SV=1 133 5e-30 tr|A9NPT3|A9NPT3_PICSI Putative u...EKLTDEEVDEMIREADVDGDGQINYEEFV 143 Query: 217 SVMV 228 VM+ Sbjct: 144 KVMM 147 >tr|Q43412|Q43412_BIDPI Calmodulin OS=Bidens

  20. A ribosomal S-6 kinase-mediated signal to C/EBP-beta is critical for the development of liver fibrosis.

    Directory of Open Access Journals (Sweden)

    Martina Buck

    Full Text Available BACKGROUND: In response to liver injury, hepatic stellate cell (HSC activation causes excessive liver fibrosis. Here we show that activation of RSK and phosphorylation of C/EBPbeta on Thr217 in activated HSC is critical for the progression of liver fibrosis. METHODOLOGY/PRINCIPAL FINDINGS: Chronic treatment with the hepatotoxin CCl(4 induced severe liver fibrosis in C/EBPbeta(+/+ mice but not in mice expressing C/EBPbeta-Ala217, a non-phosphorylatable RSK-inhibitory transgene. C/EBPbeta-Ala217 was present within the death receptor complex II, with active caspase 8, and induced apoptosis of activated HSC. The C/EBPbeta-Ala217 peptides directly stimulated caspase 8 activation in a cell-free system. C/EBPbeta(+/+ mice with CCl(4-induced severe liver fibrosis, while continuing on CCl(4, were treated with a cell permeant RSK-inhibitory peptide for 4 or 8 weeks. The peptide inhibited RSK activation, stimulating apoptosis of HSC, preventing progression and inducing regression of liver fibrosis. We found a similar activation of RSK and phosphorylation of human C/EBPbeta on Thr266 (human phosphoacceptor in activated HSC in patients with severe liver fibrosis but not in normal livers, suggesting that this pathway may also be relevant in human liver fibrosis. CONCLUSIONS/SIGNIFICANCE: These data indicate that the RSK-C/EBPbeta phosphorylation pathway is critical for the development of liver fibrosis and suggest a potential therapeutic target.