WorldWideScience

Sample records for astatine 217

  1. Organic chemistry of astatine

    International Nuclear Information System (INIS)

    The paper surveys the investigations on the chemical behaviour of astatine in organic systems and deals with the preparation and identification of its organic compounds. A discussion is given on some of the physico-chemical properties of these compounds determined by extrapolation techniques as well as by direct measurement. The biomedical importance of 211At-labelled compounds is briefly referred to. (authors)

  2. Bibliography of astatine chemistry and biomedical applications

    International Nuclear Information System (INIS)

    An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)

  3. Astatine-211: production and availability.

    Science.gov (United States)

    Zalutsky, Michael R; Pruszynski, Marek

    2011-07-01

    The 7.2-h half life radiohalogen (211)At offers many potential advantages for targeted α-particle therapy; however, its use for this purpose is constrained by its limited availability. Astatine-211 can be produced in reasonable yield from natural bismuth targets via the (209)Bi(α,2n)(211)At nuclear reaction utilizing straightforward methods. There is some debate as to the best incident α-particle energy for maximizing 211At production while minimizing production of (210)At, which is problematic because of its 138.4-day half life α-particle emitting daughter, (210)Po. The intrinsic cost for producing (211)At is reasonably modest and comparable to that of commercially available (123)I. The major impediment to (211)At availability is attributed to the need for a medium energy α-particle beam for its production. On the other hand, there are about 30 cyclotrons in the world that have the beam characteristics required for (211)At production. PMID:22201707

  4. Recent advances in the organic chemistry of astatine

    International Nuclear Information System (INIS)

    Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211At species, 211At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs

  5. Dosimetrical considerations in astatine-211 radioimmunotherapy

    International Nuclear Information System (INIS)

    Several dosimetrical quantities have been suggested for use in alpha-particle dosimetry. To evaluate the expected biological effect when using these quantities, a Monte Carlo program was set to register the single-event distribution of both specific energy and alpha-particle track length to a cell nucleus (r=5.6 μm). Distributions were acquired for both 'bound' (simulating the effect of 211At-labelled antibodies bound to antigens on cell surfaces (r=7.0 μm)) as well as 'non-bound' (simulating 211At-labelled antibodies that have not bound to a cell) astatine-211. From these distributions, various theoretical cell survival curves were established for 3 different dosimetrical quantities, i.e. specific energy, number of alpha-particle hits and total track length. The survival curves for all quantities are presented for the corresponding mean absorbed dose in order to facilitate comparisons of the expected effects of using the 3 different quantities for both distributions of 211At decays. The theoretical survival curves presented here could, combined with experiments using 'bound' and 'non-bound' 211At in a single-cell suspension, reveal which dosimetrical quantity is most suitable for 211 At-radioimmunotherapy. (author)

  6. Discovery of the astatine, radon, francium, and radium isotopes

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  7. Extraction of astatine isotopes for development of radiopharmaceuticals using a 211Rn-211At generator

    International Nuclear Information System (INIS)

    In order to utilize a 211At isotope, a promising α-emitter for radionuclide therapy, the chemical properties of astatine isotopes are studied. We have examined wet chemistry methods through the distribution ratios of astatine in liquid-liquid extraction. The astatine isotopes have been found to be well extracted into DIPE and MIBK. We observed that the distribution ratio of astatine isotopes increases with concentrations of HCl greater than 3 M, while it decreases with the HCl concentration less than 2 M. The results will be useful for development of the 211Rn-211At generator. (author)

  8. Astatine-211-Labeled Targeted Radiotherapeutics: An Update

    International Nuclear Information System (INIS)

    The heavy halogen 211At was first proposed for use in α-particle targeted radiotherapy more than 30 years ago and continues to be one of the most promising radionuclides for this purpose. Although its 7.2-h half life is not ideal for intravenously administered whole antibodies, it is compatible with the pharmacokinetics of antibody fragments, peptides, aptamers and organic molecules. Its diverse chemistry allows its incorporation into a wide array of targeting vehicles, relying on its chemical similarity to iodine to provide a useful point of departure. On the other hand, the relatively low carbon-astatine bond strength is challenging. In common with the other α-emitters being discussed at this symposium, lack of reliable availability is one of the biggest hurdles in the use of 211At for targeted radiotherapy. However, in the case of 211At, it is not a question of production cost or availability of target material, because 211At can be produced in reasonable yield from natural bismuth targets. Rather, the difficulty is the lack of cyclotrons equipped with the medium energy α-particle beams required for its production. If the infrastructure for producing 211At is to be improved to the stage where 211At-labeled radiopharmaceuticals can have a meaningful impact, several developments must occur. First, the ability to produce clinically relevant levels of 211At that can be shipped to remote locations in chemically tractable form must be demonstrated. Approaches under consideration include compensating for radiolysis-mediated effects and the consideration of alternative chemistries. Second, strategies for compensating for heterogeneities in dose deposition must be developed, hopefully in a way that is compatible with approval for human use. And third, it is essential that more clinical trials be performed with 211At-labeled therapeutics, particularly in settings of minimum residual disease where the radiobiological advantages of α-particles can be best exploited. Our

  9. Scrutinizing "Invisible" astatine: A challenge for modern density functionals.

    Science.gov (United States)

    Sergentu, Dumitru-Claudiu; David, Grégoire; Montavon, Gilles; Maurice, Rémi; Galland, Nicolas

    2016-06-01

    The main-group 6p elements did not receive much attention in the development of recent density functionals. In many cases it is still difficult to choose among the modern ones a relevant functional for various applications. Here, we illustrate the case of astatine species (At, Z = 85) and we report the first, and quite complete, benchmark study on several properties concerning such species. Insights on geometries, transition energies and thermodynamic properties of a set of 19 astatine species, for which reference experimental or theoretical data has been reported, are obtained with relativistic (two-component) density functional theory calculations. An extensive set of widely used functionals is employed. The hybrid meta-generalized gradient approximation (meta-GGA) PW6B95 functional is overall the best choice. It is worth noting that the range-separated HSE06 functional as well as the old and very popular B3LYP and PBE0 hybrid-GGAs appear to perform quite well too. Moreover, we found that astatine chemistry in solution can accurately be predicted using implicit solvent models, provided that specific parameters are used to build At cavities. © 2016 Wiley Periodicals, Inc. PMID:27059181

  10. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  11. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates.

    Science.gov (United States)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Svedhem, Sofia; Lindegren, Sture

    2016-03-16

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single cancer cells. A promising radioactive nuclide for this type of therapy is astatine-211. Astatine-211 attached to tumor-specific antibodies as carrier molecules is a system currently under investigation for use in targeted alpha therapy. In the common radiolabeling procedure, astatine is coupled to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies. PMID:26791409

  12. Astatine-211: production, injection into monoclonal antibodies radiological effect, possible application to cancer treatment

    International Nuclear Information System (INIS)

    Methods developed in the Laboratory of Nuclear Problems, JINR, for producing astatine-211 and injecting it into monoclonal antibodies are described. The use of its diethylene triamine penta-acetic acid complex is shown to be the most effective method of injecting astatine into a biomolecules. The biological effect of the α-particles emitted from the astatine-211 is investigated using Chinese hamster fibroblasts and Ehrlich carcinoma cells. It is established that the mitotic activity depression, number of degenerating cells, number of cells with chromosome aberrations, and cellular surviving fraction depend on the concentration of the radionuclide in the medium 'in vitro'. The RBE of α-particles in comparison with 60Co γ-rays is 3. Injection of astatine-211 absorbed on tellurium particles into mice with ascitic tumors resulted in prolongation of their life or elimination of the tumors. (author). 39 refs, 7 figs

  13. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    OpenAIRE

    Rothe, S.; A. N. Andreyev; Antalic, S; Borschevsky, A.; Capponi, L.; Cocolios, T.E.; Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the io...

  14. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    Science.gov (United States)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-07-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and physical properties for use in targeted therapies for cancer. Due to the very short range of the emitted α-particles, this therapy is particularly suited to treating occult, disseminated cancers. Astatine is not intrinsically tumour-specific; therefore, it requires an appropriate tumour-specific targeting vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method that combines dry distillation of astatine-211 and a synthesis module for producing radiopharmaceuticals into a process platform. This platform will standardize production of astatinated radiopharmaceuticals, and hence, it will facilitate large clinical studies focused on this promising, but chemically challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies.

  15. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-01-01

    vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method......To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....

  16. Study of Astatine (III) reactions with O, S and N ligands in solution

    International Nuclear Information System (INIS)

    Full text of publication follows. Astatine (At, Z=85: [Xe]4f145d106s26p5) belongs to the halogen group and is located below iodine in the periodic table. One of its isotopes (211At) appears promising as a therapeutic agent in nuclear medicine (Ref.1) owing to the energy of the alpha particles emitted during the disintegration of its nucleus and its short physical half-life (7.2 h). Since there are no stable isotopes of astatine, the chemistry of this element remains poorly understood. Generally, At is supposed to behave as a halogen (Ref.2) but it has been shown recently in our group that astatine presents a metallic behaviour in aqueous solution: it notably exists as At+ and AtO+ species under the oxidation states +I and +III (Ref.3). At the present time, the number of studies dealing with the complexation properties of the cationic forms of astatine remains limited (Ref.4), owing to its low availability. In this work, we have investigated the reactions of AtO+ species with different hetero-atomic (N, S, O) model ligands. A combined approach based on experimental and theoretical studies has been used (Ref.5). On account of the difficulties of experimental investigations of astatine species, the reactivity of AtO+ was explored using a competition method founded on astatine distributions between two distinct phases. Furthermore, for each AtO+/ ligand complex, the nature of the species formed and the associated thermodynamic constants were determined by computational modeling (DFT calculations). In this framework, an original computational methodology was developed to take into account the specificities of astatine, notably the associated relativistic effects. The computed equilibrium constants have been confronted with the experimental results. This comparison demonstrates an outstanding coherence between experience and theory. Furthermore, the analysis of the results shows a key role of solvent effects on astatine chemistry. Lastly, a specific reactivity for the

  17. Some aspects of the organic, biological and inorganic chemistry of astatine

    International Nuclear Information System (INIS)

    Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments (209At, 210At, 211At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)

  18. Astatine-211 Pathway from Radiochemistry to Clinical Investigation

    International Nuclear Information System (INIS)

    Particularly in clinical settings where tumour burden is low and cancers are located in close proximity to essential normal tissue structures, α-particle emitting radionuclides can offer significant advantages for targeted radionuclide therapy. One of the first alpha emitters to be evaluated for this purpose is the 7.2-h half-life radiohalogen Astatine-211 (211At). From a commercialization-potential perspective 211At, is less appealing than the longer half-life alpha particle emitters Radium-223, Actinium-225 and Thorium-227, which have become the focus of many laboratories. However, if methods for providing a better supply of 211At could be developed, this alpha emitter would be the radionuclide of choice for many potential therapeutic applications. With regard to the production of 211At, this can be readily be accomplished by bombarding natural bismuth targets with 28−29.5 MeV alpha particles via the 209Bi(α,2n)211At reaction. The goal is to utilize an alpha particle beam energy that provides the required balance for maximizing 211At production while minimizing creation of 210At, which is problematic because of its 138.4-day half life alpha-particle emitting daughter, 210Po. For most intended clinical applications, alpha particle beam energy of about 29 MeV offers the best compromise between maximizing yield and providing 211At with sufficient radionuclidic purity for clinical use. Clinically relevant levels of 211At have been produced at several institutions using both internal and external cyclotron targets

  19. 22 CFR 217.45 - Housing.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Housing. 217.45 Section 217.45 Foreign... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Postsecondary Education § 217.45 Housing. (a) Housing provided by the recipient. A recipient that provides housing to its nonhandicapped students shall...

  20. 47 CFR 97.217 - Telemetry.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Telemetry. 97.217 Section 97.217 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES AMATEUR RADIO SERVICE Special Operations § 97.217 Telemetry. Telemetry transmitted by an amateur station on or within...

  1. 31 CFR 800.217 - Hold.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Hold. 800.217 Section 800.217 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF INVESTMENT... FOREIGN PERSONS Definitions § 800.217 Hold. The terms hold(s) and holding mean legal or...

  2. 22 CFR 217.4 - Discrimination prohibited.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Discrimination prohibited. 217.4 Section 217.4... PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE General Provisions § 217.4 Discrimination... participation in, be denied the benefits of, or otherwise be subjected to discrimination under any program...

  3. 20 CFR 405.217 - Subpoenas.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Subpoenas. 405.217 Section 405.217 Employees' Benefits SOCIAL SECURITY ADMINISTRATION ADMINISTRATIVE REVIEW PROCESS FOR ADJUDICATING INITIAL DISABILITY CLAIMS Review of Initial Determinations by a Federal Reviewing Official § 405.217 Subpoenas. (a) When it is reasonably necessary for the...

  4. 48 CFR 252.217-7010 - Performance.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Performance. 252.217-7010... Clauses 252.217-7010 Performance. As prescribed in 217.7104(a), use the following clause: Performance (JUL..., scrap or other ship's material of the Government resulting from performance of the work as items...

  5. 8 CFR 217.2 - Eligibility.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Eligibility. 217.2 Section 217.2 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS VISA WAIVER PROGRAM § 217.2 Eligibility..., Portugal, Republic of Korea, San Marino, Singapore, Slovak Republic, Slovenia, Spain, Sweden,...

  6. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  7. Dicty_cDB: SSI217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI217 (Link to dictyBase) - - - Contig-U15348-1 SSI217Z (Link... to Original site) - - SSI217Z 662 - - - - Show SSI217 Library SS (Link to library) Clone ID SSI217 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSI2-A/SSI217Q.Seq.d/ Representative seq. ID SSI21...7Z (Link to Original site) Representative DNA sequence >SSI217 (SSI217Q) /CSM/SS/SSI2-A/SSI217Q.Seq.d/ XXXXX...Frames) Frame A: ---itlepilwplssivililqrn*lisygimgfqnknfscqlmvgi*lprspttillts ivisln*pfqqlkilqeyqcnl**pmmvii

  8. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    International Nuclear Information System (INIS)

    A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)

  9. 22 CFR 217.44 - Academic adjustments.

    Science.gov (United States)

    2010-04-01

    ... PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Postsecondary Education § 217.44 Academic... recipient's education program or activity. (c) Course examinations. In its course examinations or...

  10. 48 CFR 217.204 - Contracts.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contracts. 217.204 Section... DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 217.204 Contracts. (e)(i) Notwithstanding FAR 17.204(e), the ordering period of a task order or delivery order...

  11. 25 CFR 217.5 - Management decisions.

    Science.gov (United States)

    2010-04-01

    ... Management decisions. In arriving at management decisions concerning the assets, the business committee shall... 25 Indians 1 2010-04-01 2010-04-01 false Management decisions. 217.5 Section 217.5 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS MANAGEMENT OF TRIBAL ASSETS OF...

  12. 14 CFR 145.217 - Contract maintenance.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Contract maintenance. 145.217 Section 145...) SCHOOLS AND OTHER CERTIFICATED AGENCIES REPAIR STATIONS Operating Rules § 145.217 Contract maintenance. (a) A certificated repair station may contract a maintenance function pertaining to an article to...

  13. 22 CFR 217.21 - Discrimination prohibited.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Discrimination prohibited. 217.21 Section 217... Discrimination prohibited. No qualified handicapped person shall, because a recipient's facilities within the... excluded from participation in, or otherwise be subjected to discrimination under any program or...

  14. 22 CFR 217.11 - Discrimination prohibited.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Discrimination prohibited. 217.11 Section 217... Discrimination prohibited. (a) General. (1) No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity to which this part applies. (2)...

  15. 48 CFR 217.7601 - Provisioning.

    Science.gov (United States)

    2010-10-01

    ... Provisioning Requirements 217.7601 Provisioning. (a) Follow the procedures at PGI 217.7601 for contracts with provisioning requirements. (b) For technical requirements of provisioning, see DoD 4140.1-R, DoD Supply Chain... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Provisioning....

  16. 33 CFR 117.217 - Norwalk River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Norwalk River. 117.217 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.217 Norwalk River. (a) The draw of.... to 12 p.m., on the first Saturday in December, to facilitate the running of the annual Norwalk...

  17. 40 CFR 86.217-94 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false 86.217-94 Section 86.217-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty...

  18. Labelling prospects of astatine-211 with immunoglobulins (IgG): some general considerations

    International Nuclear Information System (INIS)

    The tumour therapeutic potential of the short lived alpha emitting radiohalogen 211At has been already been well recognised in the field of radioimmuno therapy. There is no evidence as such to show that astatine itself is a tumour seeking isotope. Therefore it has to be tagged to tumour seeking compound such as a drug or a protein preferably an antibody (IgG). In this communication, the labelling parameters which are required to be investigated for obtaining a stable product which could be useful as radioimmuno therapeutic agent, are described. (author). 6 refs

  19. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron anity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photodetachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral linewidth of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in o-line tests by the clear observation of the photodetachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148 [1].

  20. Extraction of 211At-astatine from hydrochloric acid solutions by means of TOPO, TBP, and triphenylphosphine

    International Nuclear Information System (INIS)

    The extraction behaviour of astatine was studied under defined conditions from hydrochloride acid solutions (cHCl>0.1 M or 1 and 2M). Therefore other effects like adsorption, reduction or hydrolysis can be excluded. The present work describes the extraction with tri- n- octylphosphinoxide (TOPO), tri- n-butylphosphate (TBP) and tri-phenylphosphine in chloroform. (orig.)

  1. No-carrier-added astatination of N-succinimidyl-3-(tri-n-butylstannyl) benzoate (ATE) via electrophilic destannylation

    International Nuclear Information System (INIS)

    The no-carrier-added synthesis of N-succinimidyl 3-[211At]astato-benzoate from N-succinimidyl 3-(tri-n-butylstannyl)benzoate (ATE) is described. The nature of the solvent in which the 211At was isolated from the target was an important factor influencing both the radiochemical yields and the nature of the incorporated astatine activity. (orig.)

  2. 211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    211At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At- to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At- anions, but first of all because of the kinetic inertness of low spin rhodium(III) d6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh3+. The experiments related to optimization of the reaction conditions were performed with the 131I, basing on a chemical similarity of I- to At-. The experiments with 211At were then carried out under the conditions found optimal for I-. The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211At-Rh(16-S4-diol) complex

  3. 48 CFR 217.504 - Ordering procedures.

    Science.gov (United States)

    2010-10-01

    ... Acquisitions Under the Economy Act 217.504 Ordering procedures. (a) When the requesting agency is within DoD, a... obtained from the requesting agency and placed in the contract file for the Economy Act order....

  4. 49 CFR 571.217 - Standard No. 217; Bus emergency exits and window retention and release.

    Science.gov (United States)

    2010-10-01

    ... conditions specified in S6.1 of Standard No. 131 (49 CFR 571.131), meets the criteria specified in Table 1 of... Editorial Note: For Federal Register citations affecting § 571.217 see the List of CFR Sections Affected... 49 Transportation 6 2010-10-01 2010-10-01 false Standard No. 217; Bus emergency exits and...

  5. 14 CFR 217.10 - Instructions.

    Science.gov (United States)

    2010-01-01

    ... Section 217.10 of 14 CFR Part 217—Instructions to Foreign Air Carriers for Reporting Traffic Data on Form... records: 1 2 3 4 5 6 7 8 9 10 11 Sample No. 1 “CCC” 8701 “JFK” “LHR” “F” 8161 29 59 69 79 89 Sample No. 2 “CCC” 8701 “JFK” “LHR” “F” 6901 299 599 0 0 0 Sample No. 3 “CCC” 8701 “JFK” “LHR” “G” 7102 299 0 599...

  6. 30 CFR 217.200 - Audits.

    Science.gov (United States)

    2010-07-01

    ... copies of audit reports that express opinions on such compliance to the Associate Director for Minerals... INSPECTIONS Coal § 217.200 Audits. An audit of the accounts and books of operators/lessees for the purpose of determining compliance with Federal lease terms relating to Federal royalties may be required annually or...

  7. 48 CFR 1252.217-72 - Performance.

    Science.gov (United States)

    2010-10-01

    ... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1252.217-72 Performance. As prescribed at (TAR) 48 CFR 1217.7001(b) and (c), insert the following clause: Performance (OCT 1994) (a) Upon... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Performance....

  8. 7 CFR 1.217 - Witness fees and travel expenses.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Witness fees and travel expenses. 1.217 Section 1.217... Witnesses in Judicial or Administrative Proceedings § 1.217 Witness fees and travel expenses. (a) Any... produce official documents on behalf of the United States is entitled to travel expenses in...

  9. 49 CFR 199.217 - On-duty use.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false On-duty use. 199.217 Section 199.217 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... Prevention Program § 199.217 On-duty use. Each operator shall prohibit a covered employee from using...

  10. 48 CFR 252.217-7015 - Safety and health.

    Science.gov (United States)

    2010-10-01

    ... U.S.C. 651, et seq.); (b) The Safety and Health Regulations for Ship Repairing (29 CFR part 1915... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Safety and health. 252.217... Clauses 252.217-7015 Safety and health. As prescribed in 217.7104(a), use the following clause: Safety...

  11. Unexpected Behavior of the Heaviest Halogen Astatine in the Nucleophilic Substitution of Aryliodonium Salts.

    Science.gov (United States)

    Guérard, François; Lee, Yong-Sok; Baidoo, Kwamena; Gestin, Jean-François; Brechbiel, Martin W

    2016-08-22

    Aryliodonium salts have become precursors of choice for the synthesis of (18) F-labeled tracers for nuclear imaging. However, little is known on the reactivity of these compounds with heavy halides, that is, radioiodide and astatide, at the radiotracer scale. In the first comparative study of radiohalogenation of aryliodonium salts with (125) I(-) and (211) At(-) , initial experiments on a model compound highlight the higher reactivity of astatide compared to iodide, which could not be anticipated from the trends previously observed within the halogen series. Kinetic studies indicate a significant difference in activation energy (Ea =23.5 and 17.1 kcal mol(-1) with (125) I(-) and (211) At(-) , respectively). Quantum chemical calculations suggest that astatination occurs via the monomeric form of an iodonium complex whereas iodination occurs via a heterodimeric iodonium intermediate. The good to excellent regioselectivity of halogenation and high yields achieved with diversely substituted aryliodonium salts indicate that this class of compounds is a promising alternative to the stannane chemistry currently used for heavy radiohalogen labeling of tracers in nuclear medicine. PMID:27305065

  12. Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

    CERN Document Server

    Andreyev, Andrei

    2013-01-01

    Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

  13. 20 CFR 217.15 - Where to file.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Where to file. 217.15 Section 217.15... ANNUITY OR LUMP SUM Filing An Application § 217.15 Where to file. (a) Applicant in U.S. or Canada. An applicant who lives in the United States or Canada may file an application at any Board office in person...

  14. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  15. 20 CFR 217.10 - Application filed after death.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Application filed after death. 217.10 Section... APPLICATION FOR ANNUITY OR LUMP SUM Applications § 217.10 Application filed after death. (a) A survivor... expenses dies before applying for the lump-sum death payment under part 234 of this chapter....

  16. 7 CFR 800.217 - Equipment that shall be tested.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Equipment that shall be tested. 800.217 Section 800... Supervision, Monitoring, and Equipment Testing § 800.217 Equipment that shall be tested. (a) General. Testing... for which official performance requirements have been established shall be tested for accuracy....

  17. 22 CFR 217.42 - Admissions and recruitment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Admissions and recruitment. 217.42 Section 217... Admissions and recruitment. (a) General. Qualified handicapped persons may not, on the basis of handicap, be denied admission or be subjected to discrimination in admission or recruitment by a recipient to...

  18. 42 CFR 2.17 - Undercover agents and informants.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Undercover agents and informants. 2.17 Section 2.17 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL PROVISIONS... agent or informant. (b) Restriction on use of information. No information obtained by an...

  19. 48 CFR 217.7103-4 - Emergency work.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Emergency work. 217.7103-4... Repair and Alteration of Vessels 217.7103-4 Emergency work. (a) The contracting officer, without... agreement when— (i) Delay in the performance of necessary repair work would endanger a vessel, its cargo...

  20. 5 CFR 532.217 - Appropriated fund survey jobs.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Appropriated fund survey jobs. 532.217... PREVAILING RATE SYSTEMS Prevailing Rate Determinations § 532.217 Appropriated fund survey jobs. (a) A lead agency shall survey the following required jobs: Job title Job grade Janitor (Light) 1 Janitor (Heavy)...

  1. 46 CFR 199.217 - Muster list and emergency instructions.

    Science.gov (United States)

    2010-10-01

    ... § 199.217 Muster list and emergency instructions. (a) The format of each passenger vessel muster list required under § 199.80 must be approved by the OCMI. (b) The passenger vessel muster list or emergency... 46 Shipping 7 2010-10-01 2010-10-01 false Muster list and emergency instructions. 199.217...

  2. 34 CFR 668.217 - Default prevention plans.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 3 2010-07-01 2010-07-01 false Default prevention plans. 668.217 Section 668.217... Default prevention plans. (a) First year. (1) If your cohort default rate is equal to or greater than 30 percent you must establish a default prevention task force that prepares a plan to— (i) Identify...

  3. 30 CFR 217.301 - Lease account reconciliations.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Lease account reconciliations. 217.301 Section... MANAGEMENT AUDITS AND INSPECTIONS Geothermal Resources § 217.301 Lease account reconciliations. Specific lease account reconciliations will be performed with priority being given to reconciling those...

  4. 30 CFR 217.51 - Lease account reconciliation.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Lease account reconciliation. 217.51 Section... MANAGEMENT AUDITS AND INSPECTIONS Oil and Gas, General § 217.51 Lease account reconciliation. Specific lease account reconciliations shall be performed with priority being given to reconciling those lease...

  5. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  6. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  7. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    International Nuclear Information System (INIS)

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  8. Dicty_cDB: SSG217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSG217 (Link to dictyBase) - G20962 DDB0191432 Contig-U10318-1 SSG217Z (Lin ... 0.20 BC105663_1( BC105663 |pid:none) Mus musculus dopamine ... receptor 2, ... 37 0.26 X53278_1( X53278 |pid:none ... ) R.norvegicus mRNA for D2 dopamine ... rece... 37 0.26 ( P61168 ) RecName: Full=D(2) dopa ...

  9. Dicty_cDB: VFM217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qpqedivnrehsvpdnersktsvvas iiaagysvgqdaaikarqvdeehmislklkvgaeavkakaneidnnlhisesaaaikgav veranalderfqisgffksasdmisqqasnlmka...rkry*lfk*y*itttttttttttrttrtilkyrffkrtisl Homology vs CSM-cDNA Score E Sequences producing significant alignment...2.19 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N ( BJ434793 ) Dictyos...core E Sequences producing significant alignments: (bits) Value AC150647_11( AC150647 |pid:none) Medicago tr...VF (Link to library) VFM217 (Link to dictyBase) - - - Contig-U13881-1 VFM217P (Link

  10. Stability and in vivo behavior of Rh[16aneS4-diol]211At complex: A potential precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    Introduction: The heavy halogen 211At is of great interest for targeted radiotherapy because it decays by the emission of short-range, high-energy α-particles. However, many astatine compounds that have been synthesized are unstable in vivo, providing motivation for seeking other 211At labeling strategies. One relatively unexplored approach is to utilize prosthetic groups based on astatinated rhodium (III) complex stabilized with a tetrathioether macrocyclic ligand – Rh[16aneS4-diol]211At. The purpose of the current study was to evaluate the in vitro and in vivo stability of this complex in comparison to its iodine analog – Rh[16aneS4-diol]131I. Methods: Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I complexes were synthesized and purified by HPLC. The stability of both complexes was evaluated in vitro by incubation in phosphate-buffered saline (PBS) and human serum at different temperatures. The in vivo behavior of the two radiohalogenated complexes was assessed by a paired-label biodistribution study in normal Balb/c mice. Results: Both complexes were synthesized in high yield and purity. Almost no degradation was observed for Rh[16aneS4-diol]131I in PBS over a 72 h incubation. The astatinated analog exhibited good stability in PBS over 14 h. A slow decline in the percentage of intact complex was observed for both tracers in human serum. In the biodistribution study, retention of 211At in most tissues was higher than that of 131I at all time points, especially in spleen and lungs. Renal clearance of Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I predominated, with 84.1 ± 2.3% and 94.6 ± 0.9% of injected dose excreted via the urine at 4 h. Conclusions: The Rh[16aneS4-diol]211At complex might be useful for constructing prosthetic groups for the astatination of biomolecules and further studies are planned to evaluate this possibility

  11. 48 CFR 3052.217-95 - Liability and insurance (USCG).

    Science.gov (United States)

    2010-10-01

    ... CONTRACT CLAUSES Text of Provisions and Clauses 3052.217-95 Liability and insurance (USCG). As prescribed in USCG guidance at (HSAR) 48 CFR 3017.9000(a) and (b), insert the following clause: Liability and... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Liability and...

  12. 8 CFR 217.7 - Electronic data transmission requirement.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Electronic data transmission requirement... VISA WAIVER PROGRAM § 217.7 Electronic data transmission requirement. (a) An alien who applies for... manifest data relative to that alien passenger in accordance with 19 CFR 4.7b or 19 CFR 122.49a....

  13. 78 FR 8684 - Fifteenth Meeting: RTCA Special Committee 217-Aeronautical Databases Joint with EUROCAE WG-44...

    Science.gov (United States)

    2013-02-06

    ... Federal Aviation Administration Fifteenth Meeting: RTCA Special Committee 217--Aeronautical Databases Joint with EUROCAE WG-44--Aeronautical Databases AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION: Notice of RTCA Special Committee 217--Aeronautical...

  14. 78 FR 66418 - Eighteenth Meeting: RTCA Special Committee 217-Aeronautical Databases Joint With EUROCAE WG-44...

    Science.gov (United States)

    2013-11-05

    ... Federal Aviation Administration Eighteenth Meeting: RTCA Special Committee 217--Aeronautical Databases Joint With EUROCAE WG-44--Aeronautical Databases AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION: Notice of RTCA Special Committee 217--Aeronautical...

  15. 78 FR 51809 - Seventeenth Meeting: RTCA Special Committee 217-Aeronautical Databases Joint With EUROCAE WG-44...

    Science.gov (United States)

    2013-08-21

    ... Federal Aviation Administration Seventeenth Meeting: RTCA Special Committee 217--Aeronautical Databases Joint With EUROCAE WG-44--Aeronautical Databases AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION: Notice of RTCA Special Committee 217--Aeronautical...

  16. 78 FR 25134 - Sixteenth Meeting: RTCA Special Committee 217-Aeronautical Databases Joint With EUROCAE WG-44...

    Science.gov (United States)

    2013-04-29

    ... Federal Aviation Administration Sixteenth Meeting: RTCA Special Committee 217--Aeronautical Databases Joint With EUROCAE WG-44--Aeronautical Databases AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION: Notice of RTCA Special Committee 217--Aeronautical...

  17. 5 CFR 179.217 - Non-waiver of rights by payments.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Non-waiver of rights by payments. 179.217 Section 179.217 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS Salary Offset § 179.217 Non-waiver of rights by payments. An employee's...

  18. 14 CFR 21.7 - Continued airworthiness and safety improvements for transport category airplanes.

    Science.gov (United States)

    2010-01-01

    ... improvements for transport category airplanes. 21.7 Section 21.7 Aeronautics and Space FEDERAL AVIATION... § 21.7 Continued airworthiness and safety improvements for transport category airplanes. (a) On or... subchapter. (b) For new transport category airplanes manufactured under the authority of the FAA, the...

  19. 40 CFR 80.217 - How does a refiner or importer apply for the GPA standards?

    Science.gov (United States)

    2010-07-01

    ... for the GPA standards? 80.217 Section 80.217 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...-in Program § 80.217 How does a refiner or importer apply for the GPA standards? (a) To apply for the GPA standards under § 80.216, a refiner or importer must submit an application in accordance with...

  20. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D., Scott

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  1. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    International Nuclear Information System (INIS)

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET α-emitter astatine-211 (211At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 (123I), 340-fold for technetium-99m pertechnetate (99mTcO4-) and 60-fold for 211At. Cellular 211At accumulation was found to be dependent on extracellular Na+ ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and 99mTcO4- uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated 211At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and 211At were rapidly (apparent t1/2 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times (123I), 25 times (99mTcO4-) and 10 times (211At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of 123I and 211At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for 123I, 5.2 h for 211At) and preliminary dosimetric calculations indicate high tumour absorbed doses (3.5 Gy/MBqtumour for 131I and 50.3 Gy/MBqtumour for 211At). In

  2. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    Energy Technology Data Exchange (ETDEWEB)

    Petrich, T.; Helmeke, H.-J.; Meyer, G.J.; Knapp, W.H.; Poetter, E. [Department of Nuclear Medicine, Medizinische Hochschule Hannover (Germany)

    2002-07-01

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET {alpha}-emitter astatine-211 ({sup 211}At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 ({sup 123}I), 340-fold for technetium-99m pertechnetate ({sup 99m}TcO{sub 4}{sup -}) and 60-fold for {sup 211}At. Cellular {sup 211}At accumulation was found to be dependent on extracellular Na{sup +} ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and {sup 99m}TcO{sub 4}{sup -} uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated {sup 211}At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and {sup 211}At were rapidly (apparent t{sub 1/2} 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times ({sup 123}I), 25 times ({sup 99m}TcO{sub 4}{sup -}) and 10 times ({sup 211}At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of {sup 123}I and {sup 211}At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for {sup 123}I, 5.2 h for {sup 211}At) and

  3. 美国军用手册217F以外的可靠性预计方法%Reliability Prediction Methods Except Mil-HDBK 217F

    Institute of Scientific and Technical Information of China (English)

    周雷; 许新芳; 程俊

    2008-01-01

    介绍美国军用手册217F之外的可靠性预计方法-EPILD-97和NPRD-95数据库,PRISM方法以及FIDES方法等,分别讨论其适用条件和失效率模型,全面比较了包括217F在内的各种可靠性预计方法的优劣.

  4. Proton polarimeter calibration between 82 and 217 MeV

    International Nuclear Information System (INIS)

    The proton analyzing power in carbon has been measured for energies of 82-217 MeV and proton scattering angles of 5-410. The measurements were carried out using polarized protons from the elastic scattering 1H(e→,p→) reaction and the Focal Plane Polarimeter (FPP) in Hall A of Jefferson Lab. A new parameterization of the FPP p-C analyzing power was fit to the data, which is in good agreement with previous parameterizations and provides an extension to lower energies and larger angles. The main conclusions are that all polarimeters to date give consistent measurements of the carbon analyzing power, independently of the details of their construction and that measuring on a larger angular range significantly improves the polarimeter figure of merit at low energies.

  5. Proton Polarimeter Calibration between 82 and 217 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Glister, J; Lee, B; Beck, A; Brash, E; Camsonne, A; Choi, S; Dumas, J; Feuerbach, R; Gilman, R; Higinbotham, D W; Jiang, X; Jones, M K; May-Tal Beck, S; McCullough, E; Paolone, M; Piasetzky, E; Roche, J; Rousseau, Y; Sarty, A J; Sawatzky, B

    2009-07-01

    The proton analyzing power in carbon has been measured for energies of 82 to 217 MeV and proton scattering angles of 5 to 41 degrees. The measurements were carried out using polarized protons from the elastic scattering H(pol. e, pol. p) reaction and the Focal Plane Polarimeter (FPP) in Hall A of Jefferson Lab. A new parameterization of the FPP p-C analyzing power was fit to the data, which is in good agreement with previous parameterizations and provides an extension to lower energies and larger angles. The main conclusions are that all polarimeters to date give consistent measurements of the carbon analyzing power, independently of the details of their construction and that measuring on a larger angular range significantly improves the polarimeter figure of merit at low energies.

  6. Proton polarimeter calibration between 82 and 217 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Glister, J. [Department of Astronomy and Physics, Saint Mary' s University, Halifax, Nova Scotia, B3H 3C3 (Canada); Dalhousie University, Halifax, Nova Scotia, B3H 3J5 (Canada)], E-mail: jglister@jlab.org; Ron, G. [Tel Aviv University, Tel Aviv 69978 (Israel); Lee, B. [Seoul National University, Seoul 151-747 (Korea, Republic of); Beck, A. [NRCN, P.O. Box 9001, Beer-Sheva 84190 (Israel); Brash, E. [Christopher Newport University, Newport News, VA 23606 (United States); Camsonne, A. [Thomas Jefferson National Accelerator Facility, Newport News, VA 23606 (United States); Choi, S. [Seoul National University, Seoul 151-747 (Korea, Republic of); Dumas, J. [Rutgers, State University of New Jersey, Piscataway, NJ 08855 (United States); Feuerbach, R. [Thomas Jefferson National Accelerator Facility, Newport News, VA 23606 (United States); Gilman, R. [Thomas Jefferson National Accelerator Facility, Newport News, VA 23606 (United States); Rutgers, State University of New Jersey, Piscataway, NJ 08855 (United States); Higinbotham, D.W. [Thomas Jefferson National Accelerator Facility, Newport News, VA 23606 (United States); Jiang, X. [Rutgers, State University of New Jersey, Piscataway, NJ 08855 (United States); Jones, M.K. [Thomas Jefferson National Accelerator Facility, Newport News, VA 23606 (United States); May-Tal Beck, S. [NRCN, P.O. Box 9001, Beer-Sheva 84190 (Israel); McCullough, E. [Department of Astronomy and Physics, Saint Mary' s University, Halifax, Nova Scotia, B3H 3C3 (Canada); Paolone, M. [University of South Carolina, Columbia, SC 29208 (United States); Piasetzky, E. [Tel Aviv University, Tel Aviv 69978 (Israel); Roche, J. [Ohio University, Athens, OH 45701 (United States); Rousseau, Y. [Rutgers, The State University of New Jersey, Piscataway, NJ 08855 (United States); Sarty, A.J. [Department of Astronomy and Physics, Saint Mary' s University, Halifax, Nova Scotia, B3H 3C3 (Canada)] (and others)

    2009-07-21

    The proton analyzing power in carbon has been measured for energies of 82-217 MeV and proton scattering angles of 5-41{sup 0}. The measurements were carried out using polarized protons from the elastic scattering {sup 1}H(e{sup {yields}},p{sup {yields}}) reaction and the Focal Plane Polarimeter (FPP) in Hall A of Jefferson Lab. A new parameterization of the FPP p-C analyzing power was fit to the data, which is in good agreement with previous parameterizations and provides an extension to lower energies and larger angles. The main conclusions are that all polarimeters to date give consistent measurements of the carbon analyzing power, independently of the details of their construction and that measuring on a larger angular range significantly improves the polarimeter figure of merit at low energies.

  7. 48 CFR 217.175 - Multiyear contracts for electricity from renewable energy sources.

    Science.gov (United States)

    2010-10-01

    ... electricity from renewable energy sources. 217.175 Section 217.175 Federal Acquisition Regulations System... renewable energy sources. (a) The head of the contracting activity may enter into a contract for a period not to exceed 10 years for the purchase of electricity from sources of renewable energy, as that...

  8. 19 CFR 10.217 - Verification and justification of claim for preferential treatment.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Verification and justification of claim for preferential treatment. 10.217 Section 10.217 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF... justification of claim for preferential treatment. (a) Verification by Customs. A claim for...

  9. 48 CFR 217.7504 - Acquisition of parts when data is not available.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Acquisition of parts when data is not available. 217.7504 Section 217.7504 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES...

  10. 46 CFR 10.217 - Merchant mariner credential application and examination locations.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Merchant mariner credential application and examination locations. 10.217 Section 10.217 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY MERCHANT MARINE OFFICERS AND SEAMEN MERCHANT MARINER CREDENTIAL General Requirements for All Merchant Mariner...

  11. 49 CFR 40.217 - Where is other information on the role of STTs and BATs found in this regulation?

    Science.gov (United States)

    2010-10-01

    ... BATs found in this regulation? 40.217 Section 40.217 Transportation Office of the Secretary of... Personnel § 40.217 Where is other information on the role of STTs and BATs found in this regulation? You can find other information on the role and functions of STTs and BATs in the following sections of...

  12. 42 CFR 436.217 - Individuals receiving home and community-based services.

    Science.gov (United States)

    2010-10-01

    ... Children and Aged, Blind, and Disabled Individuals, Including Pregnant Women § 436.217 Individuals... furnished in a hospital, NF, or an ICF/MR; or (2) Subpart H of this subchapter, the group would...

  13. 25 CFR 217.4 - Referral of questions by the joint managers.

    Science.gov (United States)

    2010-04-01

    ... party's proposal, if any, for solution. Such referrals shall be in writing, addressed to the other joint... DISTRIBUTION CORP. § 217.4 Referral of questions by the joint managers. The business committee and the board...

  14. Durable donor engraftment after radioimmunotherapy using α-emitter astatine-211-labeled anti-CD45 antibody for conditioning in allogeneic hematopoietic cell transplantation.

    Science.gov (United States)

    Chen, Yun; Kornblit, Brian; Hamlin, Donald K; Sale, George E; Santos, Erlinda B; Wilbur, D Scott; Storer, Barry E; Storb, Rainer; Sandmaier, Brenda M

    2012-02-01

    To reduce toxicity associated with external γ-beam radiation, we investigated radioimmunotherapy with an anti-CD45 mAb labeled with the α-emitter, astatine-211 ((211)At), as a conditioning regimen in dog leukocyte antigen-identical hematopoietic cell transplantation (HCT). Dose-finding studies in 6 dogs treated with 100 to 618 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) without HCT rescue demonstrated dose-dependent myelosuppression with subsequent autologous recovery, and transient liver toxicity in dogs treated with (211)At doses less than or equal to 405 μCi/kg. Higher doses of (211)At induced clinical liver failure. Subsequently, 8 dogs were conditioned with 155 to 625 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) before HCT with dog leukocyte antigen-identical bone marrow followed by a short course of cyclosporine and mycophenolate mofetil immunosuppression. Neutropenia (1-146 cells/μL), lymphopenia (0-270 cells/μL), and thrombocytopenia (1500-6560 platelets/μL) with prompt recovery was observed. Seven dogs had long-term donor mononuclear cell chimerism (19%-58%), whereas 1 dog treated with the lowest (211)At dose (155 μCi/kg) had low donor mononuclear cell chimerism (5%). At the end of follow-up (18-53 weeks), only transient liver toxicity and no renal toxicity had been observed. In conclusion, conditioning with (211)At-labeled anti-CD45 mAb is safe and efficacious and provides a platform for future clinical trials of nonmyeloablative transplantation with radioimmunotherapy-based conditioning. PMID:22134165

  15. ZNF217 expression correlates with the biological behavior of human ovarian cancer cells

    Institute of Scientific and Technical Information of China (English)

    Lilin Hang; Min Zhang; Fanliang Meng; Mei Zhong; Jing Li 

    2014-01-01

    Objective:The aim of the study was to investigate the correlation of zinc-finger protein 217 (ZNF217) gene ex-pression with the biological behavior of human ovarian cancer HO-8910 cel s. Methods:The expression of ZNF217 in ovarian carcinoma cel lines was detected by RT-PCR and Western blot, respectively. The biological behaviors of the transfectants were investigated by MTT, in vitro Boyden chamber and in vivo invasion assay, respectively. Results:RT-PCR and Western blotting revealed that transfection of ZNF217 into the HO-8910 cel s significantly increased their proliferation along with mark-edly enhanced in vitro and in vivo invasion and metastatic abilities. MTT assay showed that the proliferation ability of pEGFP-N1-ZNF217/HO-8910 cel s was significantly higher than that of pEGFP-N1/HO-8910 cel s and HO-8910 cel s (P<0.001). The Boyden chamber assay showed that the numbers of migrating pEGFP-N1-ZNF217/HO-8910, pEGFP-N1/HO-8910 and HO-8910 cel s were (141.25 ± 13.91) cel s/200 × field, (82.50 ± 11.73) cel s/200 × field and (81.75 ± 12.12) cel s/200 × field, respectively, with a significant dif erence between them (F=29.274, P<0.001). The nude mouse experiment showed that the in vivo tumor formation ability of pEGFP-N1-ZNF217/HO-8910 cel s was significantly higher than that of pEGFP-N1/HO-8910 cel s (P<0.001). Conclusion:Based on these clinical and laboratory observations, we conclude that ZNF217 may contribute to ovarian cancer invasion and metastasis, and associated with worse clinical outcomes. We evaluated ZNF217’s role as a biomarker of ovarian carcinogenesis and tumor progression in patient samples and explored possible molecular mechanisms in promoting tumor growth and invasion.

  16. Level structure of 217Rn and 221Ra investigated in the alpha-decay 225Th → 221Ra → 217Rn

    International Nuclear Information System (INIS)

    The nuclei 221Ra and 217Rn have been investigated in the α-decay chain 225Th → 221Ra → 217Rn through γ-ray and conversion-electron studies. The short-lived 225Th nuclei (T1/2=8 min) were produced in the 226Ra(α, 5n) reaction, and γ-rays and conversion electrons were measured - between the irradiation periods - in coincidence with α-particles. In 221Ra the five lowest levels are interpreted as members of a K=5/2 parity-doublet with ΔEπ=104 keV. These levels, as well as a higher-lying Kπ=3/2+ band, are consistent with an octupole deformation of 221Ra, as expected from theoretical considerations. In 217Rn only three excited levels are observed, with a favoured α-decay to a 5/2+ excited level thus establishing positive parity for the ground state of 221Ra. (orig.)

  17. 22 CFR 217.10 - Effect of state or local law or other requirements and effect of employment opportunities.

    Science.gov (United States)

    2010-04-01

    ... requirements and effect of employment opportunities. 217.10 Section 217.10 Foreign Relations AGENCY FOR... effect of employment opportunities. (a) The obligation to comply with this part is not obviated or... obviated or alleviated because employment opportunities in any occupation or profession are or may be...

  18. 76 FR 70531 - Tenth Meeting: RTCA Special Committee 217/EUROCAE WG-44: Terrain and Airport Mapping Databases

    Science.gov (United States)

    2011-11-14

    ... Airport Mapping Databases AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation... RTCA Special Committee 217/EUROCAE WG-44: Terrain and Airport Mapping Databases: For the tenth meeting... meeting of RTCA Special Committee 217/EUROCAE WG-44: Terrain and Airport Mapping Databases. The...

  19. CULTIVAR RELEASE-BRS 217 Flora: Early-maturing soybean cultivar

    Directory of Open Access Journals (Sweden)

    Plínio Itamar de Mello de Souza

    2008-01-01

    Full Text Available The soybean (Glycine max L. Merr. cultivar BRS 217 Flora was developed by Embrapa and released forproduction in the states of Goiás, Minas Gerais, Bahia, Mato Grosso and the Distrito Federal, Brazil. It is resistant to stemcanker, frog-eye leaf spot, bacterial pustule, and partially resistant to powdery mildew.

  20. 20 CFR 217.7 - Claim filed with the Social Security Administration.

    Science.gov (United States)

    2010-04-01

    ... RETIREMENT ACT APPLICATION FOR ANNUITY OR LUMP SUM Applications § 217.7 Claim filed with the Social Security... Security Act is an application for an annuity if the conditions either in paragraphs (a)(1), (2), and (3... social security application was filed. (3) The applicant asks the Board in a written statement...

  1. 48 CFR 1252.217-73 - Inspection and manner of doing work.

    Science.gov (United States)

    2010-10-01

    ....217-73 Inspection and manner of doing work. As prescribed at (TAR) 48 CFR 1217.7001(b) and (c), insert..., American Bureau of Shipping, or Department of the Navy for the type of welding being performed... proper closing of all openings to the vessel's underwater structure upon which work has been...

  2. 20 CFR 10.217 - Is COP charged if the employee continues to work, but in a different job that pays less?

    Science.gov (United States)

    2010-04-01

    ... job with different duties with no loss in pay, then COP is not chargeable. COP must be paid and the... work, but in a different job that pays less? 10.217 Section 10.217 Employees' Benefits OFFICE OF... § 10.217 Is COP charged if the employee continues to work, but in a different job that pays less?...

  3. GATA3-driven expression of miR-503 inhibits prostate cancer progression by repressing ZNF217 expression.

    Science.gov (United States)

    Jiang, Xingkang; Chen, Yue; Du, E; Yang, Kuo; Zhang, Zhihong; Qi, Shiyong; Xu, Yong

    2016-09-01

    Although increasing evidence demonstrated that deregulation of mircoRNA-503 (miRNA-503) contributes to tumorigenesis, little is known about the biological role and intrinsic regulatory mechanisms of miR-503 in prostate cancer (PCa). In present study, we found that miR-503 was significantly downregulated in advanced PCa tissues and cell lines. Downregulation of miR-503 was strongly associated with aggressive clinical-pathological features and poor prognosis in PCa patients. Ectopic expression of miR-503 significantly inhibited tumor cells growth, cell migration and invasion in vitro and in vivo. Mechanistic studies revealed that ZNF217 was a direct target downstream target of miR-503. Knockdown of ZNF217 mimicked the tumor-suppressive effects of miR-503 overexpression on PCa invasion, whereas ZNF217 overexpression attenuated the tumor-suppressive function of miR-503. Subsequently, miR-503 further modulated the activation of ZNF217-downstream epithelial-mesenchymal transition (EMT) genes. Besides, we also found that GATA3 directly increased miR-503 expression and thus decreased ZNF217 expression, indicating the involvement of GATA3/miR-503/ZNF217 signaling in EMT process. Collectively, our results demonstrated that GATA3-driven expression of miR-503 inhibits PCa progression by repressing ZNF217 expression, and also implicated the potential application of miR-503 in PCa therapy. PMID:27267060

  4. Study on manufacture of 2:17 Sm-Co magnets by powder injection molding

    International Nuclear Information System (INIS)

    Manufacture of 2:17 Sm-Co magnets by powder injection molding was investigated. The binder of thermoplastic polymer was selected as the wax-based system including paraffin wax, stearic acid and high density polyethylene. Before mixing with paraffin wax and high density polyethylene, the powder of 5-8 μm was coated by stearic acid. The molding compacts were obtained under 200 without deficits. Solvent debinding and thermal debinding were combined to remove the binder. The basic magnetic characteristics of the specimen were of the same level as those by powder metallurgy technique, which indicated that to fabricate 2:17 Sm-Co magnets by powder injection molding was feasible. (orig.)

  5. 28-W, 217 fs solid-state Yb:CAlGdO4 regenerative amplifiers.

    Science.gov (United States)

    Caracciolo, E; Kemnitzer, M; Guandalini, A; Pirzio, F; Aus der Au, J; Agnesi, A

    2013-10-15

    A new high-performance Yb:CaAlGdO(4) (Yb:CALGO) regenerative amplifier is demonstrated. Pumped by 116 W at ≈980 nm and seeded by means of a 92 fs oscillator, it generates as much as 36 W of average output power with chirped pulses, and 28 W with 217 fs compressed pulses at 500 kHz repetition rate. This corresponds to 56 μJ of pulse energy and 258 MW peak power. The compressed pulses have a time-bandwidth product of 0.69 and could be shortened further with an improved compressor setup. PMID:24321941

  6. Production of photons associated with the psi by 217-GeV/cπ- mesons

    International Nuclear Information System (INIS)

    Dimuon production is studied in 217-GeV/cπ--hydrogen and π--beryllium collisions with a lead-glass array to detect photons associated with the psi. The psi-γ mass spectrum shows a 2.6-standard-deviation excess of events above background at approx. 3.5 GeV. This excess, if attributed to the decay chi ( approx. 3.5) → psiγ, implies that 0.70 +- 0.28 of the psi's are produced via radiative decay of one of the chi states

  7. Treatment of cultured glioma cells with the EGFR-TKI gefitinib (''Iressa'', ZD1839) increases the uptake of astatinated EGF despite the absence of gefitinib-mediated growth inhibition

    International Nuclear Information System (INIS)

    The EGFR-TKI (epidermal growth factor receptor tyrosine kinase inhibitor) gefitinib (''Iressa'', ZD1839), a reversible growth inhibitor of EGFR-expressing tumour cells, has been shown to enhance the antitumour effect of ionising radiation, and also to increase the uptake of radioiodinated EGF. Thus, combination of gefitinib treatment and radionuclide targeting is an interesting option for therapy of brain tumours that are difficult to treat with conventional methods. The aim of this study was to evaluate how pre-treatment with gefitinib affects binding of astatinated EGF (211At-EGF) to cultured glioma U343 cells, which express high levels of EGFR. The growth of U343 cells in the presence of gefitinib was investigated, and it was found that gefitinib does not significantly inhibit the growth of these cells. Nevertheless, the uptake of 211At-EGF in U343 cells was markedly increased (up to 3.5 times) in cells pre-treated with gefitinib (1 μM). This indicates that a combination of gefitinib treatment and radionuclide targeting to EGFR might be a useful therapeutic modality, even for patients who do not respond to treatment with gefitinib alone. (orig.)

  8. HL-217, a new topical anti-angiogenic agent, inhibits retinal vascular leakage and pathogenic subretinal neovascularization in Vldlr−/− mice

    International Nuclear Information System (INIS)

    Highlights: • HL-217 is a new synthetic topical anti-angiogenic agent. • HL-217 attenuated subretinal neovascularization in Vldlr−/− mice. • HL-217 blocked the binding of PDGF-BB to PDGFRβ. - Abstract: HL-217 is a new synthetic angiogenesis inhibitor. Platelet derived growth factor (PDGF) is a vasoactive factor and has been implicated in proliferative retinopathies. In this study, we examined the mechanism of action and efficacy of topical application of HL-217 on subretinal neovascularization in very low-density lipoprotein receptor knockout (Vldlr−/−) mice. In three-week-old male Vldlr−/− mice, HL-217 (1.5 or 3 mg/ml) was administered twice per day for 4 weeks by topical eye drop instillation. Neovascular areas were then measured. We used a protein array to evaluate the expression levels of angiogenic factors. The inhibitory effect of HL-217 on the PDGF-BB/PDGFRβ interaction was evaluated in vitro. The neovascular area in the Vldlr−/− mice was significantly reduced by HL-217. Additionally, HL-217 decreased the expression levels of PDGF-BB protein and VEGF mRNA. Moreover, HL-217 dose-dependently inhibited the PDGF-BB/PDGFRβ interaction (IC50 = 38.9 ± 0.7 μM). These results suggest that HL-217 is a potent inhibitor of PDGF-BB. HL-217, when applied topically, is an effective inhibitor of subretinal neovascularization due to its ability to inhibit the pro-angiogenic effects of PDGF-BB

  9. HL-217, a new topical anti-angiogenic agent, inhibits retinal vascular leakage and pathogenic subretinal neovascularization in Vldlr{sup −/−} mice

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Junghyun; Kim, Chan-Sik; Jo, Kyuhyung [Korean Medicine Based Herbal Drug Development Group, Herbal Medicine Research Division, Korea Institute of Oriental Medicine, Daejeon (Korea, Republic of); Cho, Yun-Seok; Kim, Hyun-Gyu; Lee, Geun-Hyeog [Research and Development Center, Hanlim Pharm. Co. Ltd., 1656-10, Seocho-dong, Seocho-gu, Seoul (Korea, Republic of); Lee, Yun Mi; Sohn, Eunjin [Korean Medicine Based Herbal Drug Development Group, Herbal Medicine Research Division, Korea Institute of Oriental Medicine, Daejeon (Korea, Republic of); Kim, Jin Sook, E-mail: jskim@kiom.re.kr [Korean Medicine Based Herbal Drug Development Group, Herbal Medicine Research Division, Korea Institute of Oriental Medicine, Daejeon (Korea, Republic of)

    2015-01-02

    Highlights: • HL-217 is a new synthetic topical anti-angiogenic agent. • HL-217 attenuated subretinal neovascularization in Vldlr{sup −/−} mice. • HL-217 blocked the binding of PDGF-BB to PDGFRβ. - Abstract: HL-217 is a new synthetic angiogenesis inhibitor. Platelet derived growth factor (PDGF) is a vasoactive factor and has been implicated in proliferative retinopathies. In this study, we examined the mechanism of action and efficacy of topical application of HL-217 on subretinal neovascularization in very low-density lipoprotein receptor knockout (Vldlr{sup −/−}) mice. In three-week-old male Vldlr{sup −/−} mice, HL-217 (1.5 or 3 mg/ml) was administered twice per day for 4 weeks by topical eye drop instillation. Neovascular areas were then measured. We used a protein array to evaluate the expression levels of angiogenic factors. The inhibitory effect of HL-217 on the PDGF-BB/PDGFRβ interaction was evaluated in vitro. The neovascular area in the Vldlr{sup −/−} mice was significantly reduced by HL-217. Additionally, HL-217 decreased the expression levels of PDGF-BB protein and VEGF mRNA. Moreover, HL-217 dose-dependently inhibited the PDGF-BB/PDGFRβ interaction (IC{sub 50} = 38.9 ± 0.7 μM). These results suggest that HL-217 is a potent inhibitor of PDGF-BB. HL-217, when applied topically, is an effective inhibitor of subretinal neovascularization due to its ability to inhibit the pro-angiogenic effects of PDGF-BB.

  10. Accretion-ejection connection in the young brown dwarf candidate ISO-Cha1 217

    CERN Document Server

    Whelan, E T; Bacciotti, F; Nisini, B; Bonito, R; Antoniucci, S; Stelzer, B; Biazzo, K; D'Elia, V; Ray, T P

    2014-01-01

    As the number of observed brown dwarf outflows is growing it is important to investigate how these outflows compare to the well studied jets from young stellar objects. A key point of comparison is the relationship between outflow and accretion activity and in particular the ratio between the mass outflow and accretion rates ($\\dot{M}_{out}$/$\\dot{M}_{acc}$). The brown dwarf candidate ISO-ChaI 217 was discovered by our group, as part of a spectro-astrometric study of brown dwarfs, to be driving an asymmetric outflow with the blue-shifted lobe having a position angle of $\\sim$ 20$^{\\circ}$. The aim here is to further investigate the properties of ISO-ChaI 217, the morphology and kinematics of its outflow, and to better constrain ($\\dot{M}_{out}$/$\\dot{M}_{acc}$). The outflow is spatially resolved in the $[SII]\\lambda \\lambda 6716,6731$ lines and is detected out to $\\sim$ 1\\farcs6 in the blue-shifted lobe and ~ 1" in the red-shifted lobe. The asymmetry between the two lobes is confirmed although the velocity as...

  11. 77 FR 14584 - Eleventh Meeting: RTCA Special Committee 217, Joint With EUROCAE Working Group-44, Terrain and...

    Science.gov (United States)

    2012-03-12

    ... are to report on activities that have occurred since the September meeting. For Working Groups and... Working Group--44, Terrain and Airport Mapping Databases. SUMMARY: The FAA is issuing this notice to advise the public of the Eleventh meeting of RTCA Special Committee 217, Joint with EUROCAE Working...

  12. A computer program to generate equations of motion matrices, L217 (EOM). Volume 2: Supplemental system design and maintenance document

    Science.gov (United States)

    Clemmons, R. E.; Kroll, R. I.

    1979-01-01

    The equations of motion program L217 (EOM) is described. The program formulates the matrix coefficients for a second order linear differential equation which describes the motion of an airplane relative to its level equilibrium flight condition. Aerodynamic data from FLEXSTAB or Doublet Lattice (L216) programs are used to derive the equations for quasi-steady or complete unsteady aerodynamics.

  13. Clinical feature analysis on 217 patients with subjective tinnitus%217例主观性耳鸣的临床特征分析

    Institute of Scientific and Technical Information of China (English)

    陈玲; 杨海弟; 区永康

    2011-01-01

    目的 研究分析耳鸣患者的临床特征及听力学特点,比较不同类型耳鸣的掩蔽试验效果,探索耳鸣的个性化治疗.方法 对我科门诊及住院的主观性耳鸣患者217例,常规病史调查,同时行纯音测听、耳声发射、耳鸣检测及掩蔽,分析耳鸣患者的临床特征,评估各类耳鸣掩蔽试验的情况.结果 耳鸣在人群高发年龄段为36~ 55岁,占24%.男女比例分别为48%及52%,耳鸣发生侧别以左侧最常见(42%),双侧耳鸣次之(30%),右侧耳鸣最少(28%).城市人口及脑力劳动者居多,分别占77%和68%.病程中以慢性耳鸣患者(病程>1年)最多(占46%).耳鸣高频及低频耳鸣患者掩蔽最为有效,有效率分别为71.6%及73.6%,而中频耳鸣掩蔽有效率仅有52.2%,夫特曼曲线类型与掩蔽试验阳性率明显相关,由Ⅰ型掩蔽阳性率为89%降至Ⅴ型掩蔽阳性率为11.7%.结论 耳鸣患者各项特征与掩蔽试验、耳鸣频率等有较大相关性,可作为耳鸣治疗效果的预测指标.Feldman曲线类型在耳鸣诊断和治疗方面有很大应用价值及指导意义,是预测耳鸣掩蔽是否有效的一个重要指标,也是选择耳鸣个体化治疗的一个重要参考依据.%Objective To analysis the clinical feature and audiology feature of patients with subjective tinnitus,compare masking,screening effectiveness of various kinds tinnitus,and search for the individual treatment ways for subjective tinnitus.Methods 217 patients in our hospistor were performed pure tone test,DPOAE,tinnitus determination,and tinnitus masking including pitch matching,intensity matching,Feldmann masking curve,and residual inhibition test with TinniTestTM.Results The prevalence rate is higher in female (52%).Tinnitts occur to the left side more common (42%),followed by bilateral ears (30%) and the right side (28%).The urban population ( 77% ) and mental worker ( 68% ) were primary in patients.The patients

  14. Factors Associated with Coronary Artery Disease in Young Population (Age≤40):Analysis with 217 Cases

    Institute of Scientific and Technical Information of China (English)

    Wei-xian Yang; Zheng Yang; Yong-jian Wu; Shu-bin Qiao; Yue-jin Yang; Ji-lin Chen

    2014-01-01

    Objective To investigate the relevant factors of coronary artery disease (CAD) in young people under 40 years of age. Methods The study population was 292 young patients accepting coronary angiography in Fuwai Hospital from July to December 2006, including 272 men and 20 women, with the mean age being 36.7±3.7 years. The diagnosis of CAD was made in the cases presenting ≥50%stenosis in coronary lumen in coronary angiography. Based on the diagnosis, 217 patients (204 men, 13 women) were assigned to CAD group, and 75 (68 men, 7 women) to non-CAD group. Clinical data and metabolic characteristics of the patients were collected and analyzed using t-test,χ2 test, and multinomial logistic regression with SPSS 8.0 software. Results Most study subjects were current smokers (209/292, 71.6%), and more than half had body mass index (BMI)>24 kg/m2 (230/292, 78.8%) and usually took high-fat diet (162/292, 55.5%). The proportion of heavy smokers (smoking history ≥10 years and ≥20 cigarettes per day) were significantly higher in the CAD group than in the non-CAD group [20.7%(45/217) vs. 9.3%(7/75), P=0.015)]. Heavy smoking [odds ratio (OR), 1.89;95%confidence interval (CI), 1.74-2.05], hypertension (OR, 1.56;95%CI, 1.48-1.65), alcohol (OR, 1.37;95%CI, 1.30-1.46), type 2 diabetes mellitus (OR, 1.37;95%CI, 1.25-1.50), high-fat diet (OR, 1.35;95% CI, 1.28-1.43), and BMI>24 kg/m2 (OR, 1.09;95% CI, 1.03-1.17) were factors related to CAD in the young patients (all P Conclusions Heavy smoking, hypertension, alcohol consumption, type 2 diabetes mellitus, high-fat diet and BMI>24 kg/m2 were significantly related to CAD in patients aged ≤ 40, with heavy smoking presenting the highest OR. Metabolic syndrome and inflammation were also more common in young CAD patients than in non-CAD patients.

  15. Echomorphology of cardiomyopathy: review of 217 cases from 1999 to 2010

    International Nuclear Information System (INIS)

    Objective: To study echocardiogram features of different types of cardiomyopathy presenting over a 12 year period at a single centre in Peshawar. Methods: The series comprised a retrospective review of 13,788 consecutive echocardiograms carried out at the Muhammadi Hospital International Medical Research Centre, Hayatabad, Peshawar, from January 1999 to December 2010. Patients were split into two: Group I with paediatric and adolescent cases (0-18 years) and Group II with adults (>18 years). In the adult group, women with peripartum cardiomyopathy were subdivided into two groups of 18-30 years and 30 to 44 years. Standard Echo B and M modes and Doppler parameters were recorded to ascertain the diagnoses of common primary and secondary cardiomyopathies. Patients with myocarditis with chambers dilatation and global dysfunction, and cardiopathy associated with major cardiovascular diseases were excluded. SPSS 14 was used for statistical analysis. Results: Cardiomyopathy was diagnosed in 217 (1.57%) cases. There were 144 (66%) cases of dilated cardiomyopathy with a mean age of 13+-14.8 years; 17 (8%) cases of hypertrophic cardiomyopathy with a mean age of 12+-11.5 years; and 7 (3%) cases of restrictive cardiomyopathy with a mean age of 31+-7.8 years. Primary cardiac amyloidosis was confirmed in 9 (4%) cases, and peripartum cardiomyopathy in 25 (11%) females. Rare subtypes were found in 15 (7%) cases. Conclusion: DCM was the most frequently diagnosed subtype of cardiomyopathy followed by HCM in both the adult and paediatric age groups. (author)

  16. BXERL photo-injector based on a 217 MHz normal conducting RF gun

    Institute of Scientific and Technical Information of China (English)

    LIU Sheng-Guang; HUANG Tong-Ming; XU Jin-Qiang

    2011-01-01

    The Beijing X-ray Energy Recovery Linac(BXERL)test facility is proposed in Institute of High Physics(IHEP).In this proposal,the main linac requires the injector to provide an electron beam with 5 MeV energy and 10 mA average current.An injector based on DC gun technology is the first candidate electron source for BXERL.However,the field emission in the DC gun cavity makes it much more difficult to increase the high voltage to more than 500 kV.Another technology based on a 217 MHz normal conducting RF gun is proposed as the backup injector for this test facility.We have designed this RF gun with 2D SUPERFISH code and 3D MICROWAVE STUDIO code.In this paper,we present the optimized design of the gun cavity,the gun RF parameters and the set-up of the whole injector system.The detailed beam dynamics have been done and the simulation results show that the injector can generate electron bunches with RMS normalizedemittance 1.0 πmm.mrad,bunch length 0.77 mm,beam energy 5.0 MeV and energy spread 0.60%.

  17. BXERL photo-injector based on a 217 MHz normal conducting RF gun

    Science.gov (United States)

    Liu, Sheng-Guang; Huang, Tong-Ming; Xu, Jin-Qiang

    2011-09-01

    The Beijing X-ray Energy Recovery Linac (BXERL) test facility is proposed in Institute of High Physics (IHEP). In this proposal, the main linac requires the injector to provide an electron beam with 5 MeV energy and 10 mA average current. An injector based on DC gun technology is the first candidate electron source for BXERL. However, the field emission in the DC gun cavity makes it much more difficult to increase the high voltage to more than 500 kV. Another technology based on a 217 MHz normal conducting RF gun is proposed as the backup injector for this test facility. We have designed this RF gun with 2D SUPERFISH code and 3D MICROWAVE STUDIO code. In this paper, we present the optimized design of the gun cavity, the gun RF parameters and the set-up of the whole injector system. The detailed beam dynamics have been done and the simulation results show that the injector can generate electron bunches with RMS normalized emittance 1.0 πmm·mrad, bunch length 0.77 mm, beam energy 5.0 MeV and energy spread 0.60%.

  18. A computer program to generate equations of motion matrices, L217 (EOM). Volume 1: Engineering and usage

    Science.gov (United States)

    Kroll, R. I.; Clemmons, R. E.

    1979-01-01

    The equations of motion program L217 formulates the matrix coefficients for a set of second order linear differential equations that describe the motion of an airplane relative to its level equilibrium flight condition. Aerodynamic data from FLEXSTAB or Doublet Lattice (L216) programs can be used to derive the equations for quasi-steady or full unsteady aerodynamics. The data manipulation and the matrix coefficient formulation are described.

  19. Line lists for H218O and H217O based on empirical line positions and ab initio intensities

    International Nuclear Information System (INIS)

    New line lists for isotopically substituted water are presented. Most line positions were calculated from experimentally determined energy levels, while all line intensities were computed using an ab initio dipole moment surface. Transitions for which experimental energy levels are unavailable use calculated line positions. These line lists cover the range 0.05-20 000 cm-1 and are significantly more complete and potentially more accurate than the line lists available via standard databases. All lines with intensities (scaled by isotopologue abundance) greater than 10-29 cm/molecule at 296 K are included, augmented by weaker lines originating from pure rotational transitions. The final line lists contain 39 918 lines for H218O and 27 546 for H217O and are presented in standard HITRAN format. The number of experimentally determined H218O and H217O line positions is, respectively, 32 970 (83% of the total) and 17 073 (62%) and in both cases the average estimated uncertainty is 2×10-4 cm-1. The number of ab initio line intensities with an estimated uncertainty of 1% is 16 621 (42%) for H218O and 13 159 (48%) for H217O.

  20. Bloodstream infection following 217 consecutive systemic-enteric drained pancreas transplants

    Directory of Open Access Journals (Sweden)

    Mark Walter

    2006-08-01

    Full Text Available Abstract Background Combined kidney pancreas transplantation (PTx evolved as excellent treatment for diabetic nephropathy. Infections remain common and serious complications. Methods 217 consecutive enteric drained PTxs performed from 1997 to 2004 were retrospectively analyzed with regard to bloodstream infection. Immunosuppression consisted of antithymocyteglobuline induction, tacrolimus, mycophenolic acid and steroids for the majority of cases. Standard perioperative antimicrobial prophylaxis consisted of pipercillin/tazobactam in combination with ciprofloxacin and fluconazole. Results One year patient, pancreas and kidney graft survival were 96.4%, 88.5% and 94.8%, surgical complication rate was 35%, rejection rate 30% and rate of infection 59%. In total 46 sepsis episodes were diagnosed in 35 patients (16% with a median onset on day 12 (range 1–45 post transplant. Sepsis source was intraabdominal infection (IAI (n = 21, a contaminated central venous line (n = 10, wound infection (n = 5, urinary tract infection (n = 2 and graft transmitted (n = 2. Nine patients (4% experienced multiple episodes of sepsis. Overall 65 pathogens (IAI sepsis 39, line sepsis 15, others 11 were isolated from blood. Gram positive cocci accounted for 50 isolates (77%: Coagulase negative staphylococci (n = 28, i.e. 43% (nine multi-resistant, Staphylococcus aureus (n = 11, i.e. 17% (four multi-resistant, enterococci (n = 9, i.e. 14% (one E. faecium. Gram negative rods were cultured in twelve cases (18%. Patients with blood borne infection had a two year pancreas graft survival of 76.5% versus 89.4% for those without sepsis (p = 0.036, patient survival was not affected. Conclusion Sepsis remains a serious complication after PTx with significantly reduced pancreas graft, but not patient survival. The most common source is IAI.

  1. The eukaryotic translation elongation factor eEF1A2 induces neoplastic properties and mediates tumorigenic effects of ZNF217 in precursor cells of human ovarian carcinomas

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Yu; Wong, Nicholas; Guan, Yinghui; Salamanca, Clara M.; Cheng, Jung Chien; Lee, Jonathan M.; Gray, Joe W.; Auersperg, Nelly

    2008-04-25

    Ovarian epithelial carcinomas (OEC) frequently exhibit amplifications at the 20q13 locus which is the site of several oncogenes, including the eukaryotic elongation factor EEF1A2 and the transcription factor ZNF217. We reported previously that overexpressed ZNF217 induces neoplastic characteristics in precursor cells of OEC. Unexpectedly, ZNF217, which is a transcriptional repressor, enhanced expression of eEF1A2. In this study, array comparative genomic hybridization, single nucleotide polymorphism and Affymetrix analysis of ZNF217-overexpressing cell lines confirmed consistently increased expression of eEF1A2 but not of other oncogenes, and revealed early changes in EEF1A2 gene copy numbers and increased expression at crisis during immortalization. We defined the influence of eEF1A2 overexpression on immortalized ovarian surface epithelial cells, and investigated interrelationships between effects of ZNF217 and eEF1A2 on cellular phenotypes. Lentivirally induced eEF1A2 overexpression caused delayed crisis, apoptosis resistance and increases in serum-independence, saturation densities, and anchorage independence. siRNA to eEF1A2 reversed apoptosis resistance and reduced anchorage independence in eEF1A2-overexpressing lines. Remarkably, siRNA to eEF1A2 was equally efficient in inhibiting both anchorage independence and resistance to apoptosis conferred by ZNF217 overexpression. Our data define neoplastic properties that are caused by eEF1A2 in nontumorigenic ovarian cancer precursor cells, and suggest that eEF1A2 plays a role in mediating ZNF217-induced neoplastic progression.

  2. Knockdown of lncRNA-ATB suppresses autocrine secretion of TGF-β2 by targeting ZNF217 via miR-200c in keloid fibroblasts.

    Science.gov (United States)

    Zhu, Hua-Yu; Bai, Wen-Dong; Li, Chao; Zheng, Zhao; Guan, Hao; Liu, Jia-Qi; Yang, Xue-Kang; Han, Shi-Chao; Gao, Jian-Xin; Wang, Hong-Tao; Hu, Da-Hai

    2016-01-01

    Abnormally high activation of transforming growth factor-β (TGF-β) signaling has been demonstrated to be involved in the initiation and progression of keloids. However, the functional role of long non-coding RNA (lncRNA)-activated by TGF-β (lncRNA-ATB) in keloids has not been documented. Here we investigated the role of lncRNA-ATB in the autocrine secretion of TGF-β in keloid fibroblasts (KFs) and explored the underlying molecular mechanism. Using immunohistochemistry and quantitative RT-PCR analysis, we showed that lncRNA-ATB and ZNF217, a transcriptional activator of TGF-β, were overexpressed and miR-200c, which targets ZNF217, was under-expressed in keloid tissue and keloid fibroblasts. Through gain- and loss-of-function studies, we demonstrated that knockdown of lncRNA-ATB decreased autocrine secretion of TGF-β2 and ZNF217 expression but upregulated expression of miR-200c in KFs. Stable downregulation of ZNF217 expression decreased the autocrine secretion of TGF-β2. miR-200c was endogenously associated with lncRNA-ATB, and inhibition of miR-200c overcame the decrease in ZNF217 expression in KFs. Taken together, these findings indicate that lncRNA-ATB governs the autocrine secretion of TGF-β2 in KFs, at least in part, by downregulating the expression level of ZNF217 via miR-200c, suggesting a signaling axis consisting of lncRNA-ATB/miR-200c/ZNF217/TGF-β2. These findings may provide potential biomarkers and targets for novel diagnostic and therapeutic approaches for keloids. PMID:27090737

  3. Reduction of F1 Neuronal Excitability by Exposure to 217 Hz Magnetic Fields from GSM 900 Mobile Phone

    Directory of Open Access Journals (Sweden)

    Mehri Kaviani Moghadam

    2009-01-01

    Full Text Available Objective: The aim of this study was to investigate the effects of a 217 Hz magnetic field ofmobile phone GSM 900 exposure on the bioelectric activity of F1 neuronal cells of the landsnail.Materials and Methods: According to the magnetic field measurement of the mobile phone,a range of flux intensities of magnetic fields (0.46 - 229 μT at a frequency of 217 Hz wasproduced by magnetic field coils. The bioelectrical activity of F1 nerve cells at different timeintervals was recorded, using intracellular recording under current clamp conditions in control,sham and field exposed groups.Results: Magnetic field exposure decreased the amplitude of action potential and the firingfrequency of F1 nerve cells. Furthermore, it resulted in a significant (p<0.05 increase inthe amplitude of after hyperpolarization (AHP and duration of action potential. Change inthe cell’s electrophysiological parameters was associated with a decrease in neuronal excitability.Magnetic field exposure affected also the resting membrane potential of F1 cells in abimodal fashion, including depolarization and hyperpolarization. Considering the exposurecondition, most of the alterations in the electrical activity of F1 nerve cells induced by magneticfields exposure were reversible.Conclusion: These findings suggest that 217 Hz magnetic fields of mobile phones with differentintensities affect the spontaneous bioelectrical activity of F1 nerve cells and exert inhibitoryeffects on neuronal excitability. There is evidence for the existence of an amplitudewindow and these electrophysiological alterations occur within this amplitude window. Thereversibility of the magnetic field- induced most electrophysiological alterations in the neuronalbehavior under our experimental conditions was observed.

  4. Production of D0(1863) mesons in 217 GeV/c pi-minus proton interactions

    International Nuclear Information System (INIS)

    This thesis reports on the analysis of data obtained during FNAL experiment E369. The Chicago Cyclotron Magnet Spectrometer Facility was used to perform a search for the hadronic production of charmed D mesons. A 217 Gev π- beam was incident on a liquid hydrogen target. The trigger required a slow recoil proton in coincidence with a muon. A total of 26 +- 8 neutral D mesons were observed through their K0π+π- decay mode. The distributions of Feynman X, missing mass, and momentum transfer to the recoil proton were consistent with diffractive production. Cross sections were calculated based on a diffractive model

  5. Reaction natYb+48Ca->217Th+3n: auto calibration process for DSSSD detector application (particular case)

    CERN Document Server

    Tsyganov, Yu

    2015-01-01

    The Dubna Gas-Filled Recoil Separator (DGFRS) is the mostly effective setup in use for the field of synthesis of superheavy elements. Application of DSSSD detector provides more precise energy and position detection for both implanted recoils and their alpha decays. To minimize contribution of background products the method of fctive correlation is applied at the DGFRS. To apply this method a precise calibration for 48 front strips is strongly required. Method of three peaks auto calibration is proposed with a first approximation step with 9.26 MeV 217Th peaks. Examples of alpha-decay original spectra and spectra after filtration procedures are presented.

  6. Jurisprudential Analysis on the 217th Article of Criminal Law about “Reproducing and Distributing”%对刑法第217条关于“复制发行”规定的法理分析

    Institute of Scientific and Technical Information of China (English)

    王泽众

    2015-01-01

    不论是学术界还是实务界,对刑法第217条关于“复制发行”规定的含义都存在多种理解方式。从法理的应然角度和刑事政策的实然角度分析,“复制发行”应当理解为包括单独的复制行为或既复制又发行行为两种情况,而单独的非法发行行为属于销售侵权复制品罪的范畴,应当适用刑法第218条的规定。%Both in the theory and practice fields,there are many ways of understanding the 217th article of the criminal law about the“reproducing and distributing”.Analyzing from the necessities of jurisprudence and the realities of criminal policies,“reproducing and distributing”behavior ought to be interpreted as two situations:reproducing behavior or both reproducing and distributing behavior. The simple distributing behavior belongs to the category of crime of selling pirated goods that should apply the provisions of the 218th article of the criminal law.

  7. Decay of the ground state and the 29/2+ isomer in 217Ac and G factor measurements by perturbed angular distribution of α-particles

    International Nuclear Information System (INIS)

    The nucleus 217Ac was studied using the 205Tl(16O, 4n), 206Pb (15N, 4n) and 209Bi (12C, 4n) reactions. The measurements included α-γ, γ-γ, α-ce and ce-ce coincidence experiments as well as γ-ray and α-particle perturbed angular distribution studies. Results are: g(217Acsup(gs))=+0.85 (1) and Tsub(1/2)(217Acsup(gs))=69(4) ns, the shortest known α-decay of a ground state. 217Agsup(m) decays mainly by a γ cascade, but also by α-emission to the single particles states πhsub(9/2), fsub(7/2), isub(13/2) of 213Fr. Spins and parities of levels to the 29/2+ isomer at 2013 keV with Tsub(1/2)=740(40)ns and g=+0.347(5) are determined. The level scheme of 217Ac and the α decay of N=128 isotones are discussed. (orig.)

  8. High temperature oxidation and its induced coercivity loss of a 2:17 type SmCo-based magnet

    International Nuclear Information System (INIS)

    Oxidation has been explained as one possibility for unacceptable and irreversible coercivity loss of 2:17 type SmCo-based magnets at high temperatures over 550 °C, but the question for how oxidation affects coercivity in the magnet has not been fundamentally answered. In this work, oxidation and its induced degradation of the magnetic phases of a Sm(CobalFe0.22Cu0.08Zr0.02)7.5 magnet in air at 600 °C have been investigated by using transmission electron microscopy and correlated with the demagnetization curves measured. It shows that the coercivity loss, which is significantly increased with oxidation time, is small and independent of time in the magnet unaffected by oxidation. The reason lies in that the 2:17 cell and 1:5 cell boundary, although they have been completely disintegrated in the oxidized part by external oxidation of Co, Fe, and Cu and internal oxidation of Sm, remains in the unoxidized part except that 1:5 boundary close to the oxidized part is decreased in thickness and Cu content

  9. 2:17-type SmCo magnets prepared by powder injection molding using a water-based binder

    International Nuclear Information System (INIS)

    2:17-type SmCo permanent magnets by powder injection molding using a water-based binder have been studied. The water-based binder is methylcellulose solution, which consists of deionized water and methylcellulose. When the solution concentration is 0.5 wt%, the carbon content of the sintered magnets is below 0.1 wt% and the magnets have better magnetic properties. The magnetic properties and density of the sintered magnets can be increased through pre-sintering in vacuum (10-3 Pa) at 1200 deg. C. However, the Sm content of the magnets loses obviously in pre-sintering for a long period. The appropriate pre-sintering duration is 20-40 min. The magnetic properties of the magnets are: Br=0.97 T, Hcj=871 kA/m, BHmax=157 kJ/m3. The structure of the magnet consists of the matrix phases (2:17 phases) and the precipitate phases (1:5 phases)

  10. Roflumilast: APTA 2217, B9302-107, BY 217, BYK 20869.

    Science.gov (United States)

    2004-01-01

    Roflumilast [APTA 2217, B9302-107, BY 217, BYK 20869] is a selective phosphodiesterase IV inhibitor. It is being developed by Altana Pharma (formerly Byk Gulden), a subsidiary of Altana Group, as an orally administered therapy for asthma, chronic obstructive pulmonary disease (COPD), allergic rhinitis and psoriasis. The drug is awaiting regulatory approval in Europe for the treatment of asthma and COPD. Byk Gulden has stated that roflumilast relieves asthma symptoms through both an anti-inflammatory effect and a muscle relaxant effect. Roflumilast has potential as first-line long-term therapy in mild-to-moderate COPD and as additive long-term therapy in moderate-to-severe COPD. Altana has stated that roflumilast is to be marketed under the brand name Daxas. Altana Group and Pharmacia Corporation (now Pfizer) signed an agreement on 22 April 2002 to collaborate on the development and commercialisation of roflumilast for the treatment of respiratory disorders, including asthma and COPD. The companies will jointly develop the drug for the US, Europe and other markets. Pharmacia will co-ordinate development in the US and Altana will co-ordinate development in Europe. After approval of the drug, Pharmacia and Altana will jointly launch and promote roflumilast in the US, Europe and elsewhere. Altana will receive an upfront payment and additional milestone payments. Altana additionally has the option to co-promote Pharmacia products in the US and elsewhere. On 16 April 2003, Pharmacia Corporation was acquired by, and merged into, Pfizer. In November 2002, Altana and Tanabe Seiyaku signed an agreement to collaborate on the development and commercialisation of roflumilast for the treatment of respiratory diseases, including asthma and COPD. Tanabe Seiyaku and Altana will develop roflumilast for asthma and COPD in Japan, and will jointly launch and co-promote roflumilast in Japan following regulatory approval. Roflumilast has been in multinational phase III clinical studies

  11. Astatination of closo-dodecaborate(2-) anion

    Czech Academy of Sciences Publication Activity Database

    Orlova, A.; Lebeda, Ondřej; Tolmachev, V.; Lundquist, H.; Carlsson, J.; Sjöberg, S.

    Cambridge : The Royal Society of Chemistry , 2000 - (Davidson, M.; Hughes, A.; Marder, T.; Wade , K.), s. 144-147 [Conference "Contemporary Boron Chemistry ". Durham (GB), 11.07.1999-15.07.1999] Institutional research plan: CEZ:AV0Z1048901 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  12. Results of the independent verification of radiological remedial action at 217 South 2nd East Street, Monticello, Utah (MS00097)

    International Nuclear Information System (INIS)

    In 1980 the site of a vanadium and uranium mill at Monticello, Utah, was accepted into the US Department of Energy's (DOE's) Surplus Facilities Management Program, with the objectives of restoring the government-owned mill site to safe levels of radioactivity, disposing of or containing the tailings in an environmentally safe manner, and performing remedial actions on off-site (vicinity) properties that had been contaminated by radioactive material resulting from mill operations. During 1985 and 1986, UNC Geotech, the remedial action contractor designated by DOE, performed remedial action on the vicinity property at 217 South 2nd East Street, Monticello, Utah. The Pollutant Assessments Group (PAG) of Oak Ridge National Laboratory was assigned the responsibility of verifying the data supporting the adequacy of remedial action and confirming the site's compliance with DOE guidelines. The PAG found that the site successfully meets the DOE remedial action objectives. Procedures used by PAG are described. 3 refs., 2 tabs

  13. Positional cloning of ZNF217 and NABC1: genes amplified at 20q13.2 and overexpressed in breast carcinoma.

    Science.gov (United States)

    Collins, C; Rommens, J M; Kowbel, D; Godfrey, T; Tanner, M; Hwang, S I; Polikoff, D; Nonet, G; Cochran, J; Myambo, K; Jay, K E; Froula, J; Cloutier, T; Kuo, W L; Yaswen, P; Dairkee, S; Giovanola, J; Hutchinson, G B; Isola, J; Kallioniemi, O P; Palazzolo, M; Martin, C; Ericsson, C; Pinkel, D; Albertson, D; Li, W B; Gray, J W

    1998-07-21

    We report here the molecular cloning of an approximately 1-Mb region of recurrent amplification at 20q13.2 in breast cancer and other tumors and the delineation of a 260-kb common region of amplification. Analysis of the 1-Mb region produced evidence for five genes, ZNF217, ZNF218, and NABC1, PIC1L (PIC1-like), CYP24, and a pseudogene CRP (Cyclophillin Related Pseudogene). ZNF217 and NABC1 emerged as strong candidate oncogenes and were characterized in detail. NABC1 is predicted to encode a 585-aa protein of unknown function and is overexpressed in most but not all breast cancer cell lines in which it was amplified. ZNF217 is centrally located in the 260-kb common region of amplification, transcribed in multiple normal tissues, and overexpressed in all cell lines and tumors in which it is amplified and in two in which it is not. ZNF217 is predicted to encode alternately spliced, Kruppel-like transcription factors of 1,062 and 1,108 aa, each having a DNA-binding domain (eight C2H2 zinc fingers) and a proline-rich transcription activation domain. PMID:9671742

  14. Draft Genome Sequences of Seven Bacterial Strains Isolated from a Polymicrobial Culture of Coccolith-Bearing (C-Type) Emiliania huxleyi M217

    Science.gov (United States)

    Rosana, Albert Remus R.; Orata, Fabini D.; Xu, Yue; Simkus, Danielle N.; Bramucci, Anna R.; Boucher, Yan

    2016-01-01

    Strains of Rhodobacteraceae, Sphingomonadales, Alteromonadales, and Bacteroidetes were isolated from a polymicrobial culture of the coccolith-forming (C-type) haptophyte Emiliania huxleyi strain M217. The genomes encode genes for the production of algal growth factors and the consumption of their hosts’ metabolic by-products, suggesting that the polymicrobial culture harbors many symbiotic interactions. PMID:27417845

  15. Activity and expression of acetylcholinesterase in PC12 cells exposed to intermittent 1.8 GHz 217-GSM mobile phone signal.

    Science.gov (United States)

    Valbonesi, Paola; Franzellitti, Silvia; Bersani, Ferdinando; Contin, Andrea; Fabbri, Elena

    2016-01-01

    Purpose Due to its role in learning, memory and in many neurodegenerative diseases, acetylcholinesterase (AChE) represents an interesting endpoint to assess possible targets of exposure to radiofrequency electromagnetic fields (RF-EMF) generated by mobile phones. We investigated possible alterations of enzymatic activity, gene and protein expression of AChE in neuronal-like cells exposed to a 1.8 GHz Global System for Mobile Communication (GSM) modulated signal (217-GSM). Materials and methods Rat PC12 cells were exposed for 24 h to 1.8 GHz 217-GSM signal. Specific adsorption rate (SAR) was 2 W/kg. AChE enzyme activity was assessed spectrophotometrically by Ellman's method, mRNA expression level was evaluated by real time polymerase chain reaction, and protein expression was assessed by Western blotting. Results AChE enzymatic activity increased of 1.4-fold in PC12 cells exposed to 217-GSM signal for 24 h, whilst AChE transcriptional or translational pathways were not affected. Conclusion Our results provide the first evidence of effects on AChE activity after in vitro exposure of mammalian cells to the RF-EMF generated by GSM mobile phones, at the SAR value 2 W/kg. The obtained evidence promotes further investigations on AChE as a possible target of RF-EMF and confirm the ability of 1.8 GHz 217-GSM signal to induce biological effects in different mammalian cells. PMID:26630175

  16. Herschel/HIFI search for H2-17O and H2-18O in IRC+10216: constraints on models for the origin of water vapor

    CERN Document Server

    Neufeld, David A; Agúndez, Marcelino; González-Alfonso, Eduardo; Decin, Leen; Daniel, Fabien; Cernicharo, José; Melnick, Gary J; Schmidt, Miroslaw; Szczerba, Ryszard

    2013-01-01

    We report the results of a sensitive search for the minor isotopologues of water, H2-17O and H2-18O, toward the carbon-rich AGB star IRC+10216 (a.k.a. CW Leonis) using the HIFI instrument on the Herschel Space Observatory. This search was motivated by the fact that any detection of isotopic enhancement in the H2-17O and H2-18O abundances would have strongly implicated CO photodissociation as the source of the atomic oxygen needed to produce water in a carbon-rich circumstellar envelope. Our observations place an upper limit of 1/470 on the H2-17O/H2-16O abundance ratio. Given the isotopic 17O/16O ratio of 1/840 inferred previously for the photosphere of IRC+10216, this result places an upper limit of a factor 1.8 on the extent of any isotope-selective enhancement of H2-17O in the circumstellar material, and provides an important constraint on any model that invokes CO photodissociation as the source of O for H2O production. In the context of the clumpy photodissociation model proposed previously for the origi...

  17. Apendicectomia em pacientes com idade superior a 40 anos: análise dos resultados de 217 casos

    Directory of Open Access Journals (Sweden)

    Antonio Sérgio Brenner

    2006-06-01

    Full Text Available INTRODUÇÃO: A baixa freqüência de apendicite aguda em pacientes acima de 40 anos indica que uma melhor análise desse grupo torna-se necessária. MÉTODO: Realizamos um estudo de Coorte em 1343 pacientes submetidos a apendicectomia entre 2001 a 2005. Duzentos e dezessete pacientes apresentavam idade superior a 40 anos. Os pacientes foram divididos em 2 grupos: pacientes com idade superior (n=217 e inferior (n=1126. O Banco de Dados do Serviço em Cirurgia do Hospital Universitário Evangélico foi utilizado para fornecer os achados operatórios, os exames histopatológicos e o resultado clínico imediato. RESULTADOS: No grupo com idade acima de 40 anos, os achados cirúrgicos demonstraram o apêndice em fase edematosa em 42,85% e em 26,72% foi identificada supuração. A incisão mediana foi realizada em 39,17% e o tempo de internação médio foi de 4,65 dias. No grupo com idade abaixo de 40 anos, os achados cirúrgicos demonstraram o apêndice em fase edematosa em 24,5% e supuração em 32,6%. A incisão mediana foi utilizada em 11,90% dos pacientes e o tempo de internação médio foi de 3,35 dias. CONCLUSÃO: Nos pacientes acima de 40 anos, observamos casos mais complexos, provavelmente pelo baixo índice de suspeição.INTRODUCTION: The low frequency of acute appendicitis in patients over 40 years old suggests that a better analysis is necessary. METHOD: We have made a Cohort in 1343 patients submitted to appendectomy from 2001 to 2005. Patients were divided in two groups: over (n = 217 and under (n = 1126 40 years old. The Evangelico Hospital Colorectal Data Base was accessed to give surgical, histopathologic and clinical outcome. RESULTS: In the over 40 group, surgical findings demonstrated edematous appendicitis in 42.85% and suppuration in 26.72%. Median incision was used in 39.17% and the average hospital stay was 4.65 days. In the under 40 group, surgical findings demonstrated edematous appendicitis in 24.5% and suppuration in 32

  18. The anterior flavum ligamentum space in lumbar nerve root compression: a comparison study of MG and CTM of 217 cases

    International Nuclear Information System (INIS)

    Purpose: To study the findings of lumbar nerve-roots compression in myelography (MG) and CT-myelography (CTM), proposing a new concept of anterior flavum ligament space (AFLS) and evaluate the AFLS as well as other findings in diagnosis of compressed lumbar radiculopathy, in order to guide lumbar plain CT study. Methods: The images of MG and CTM of 217 cases were reviewed, and the relative sites to the pediculus of L3∼S1 nerve roots getting out of the dural sac at each side, the width of AFLS, the width of superior outlet of lateral recess and the morphology of the disks and the sagittal diameter of the dural sac in L4 to S1 were recorded respectively. The relations of these parameters to the compressed swollen lumbar nerve roots shown in MG were analysed. Results: 254 lumbar nerve roots of 217 cases were swollen as shown in MG. The herniations or bulgings of intervertebral disk were found in 195 level with the diameter of the corresponding dural sac < 10 mm. The sensitivity was 71.4%, specificity was 82.9% and accuracy 80.2% for diagnosis of L-nerve root compression. The width of the superior outlet≤ 3mm was found in 286 lateral recesses, and it's sensitivity, specificity and accuracy were 55.1%, 86.1% and 80.0% respectively in the diagnosis of the lumbar compressed radiculopathy. 229 in 271 (90.2%) lumbar nerve roots were compressed and swollen as demonstrated in MG with the AFLS<5 mm. It's sensitivity was 90.2%, specificity 96.0% and accuracy 94.9% in the diagnosis of the lumbar compressed radiculopathy. The mean width of the AFLS with the corresponding swollen nerve root as shown in MG was 3.6 mm and the mean width of AFLS without the corresponding swollen nerve root shown in MG was 6.9 mm (P<0.001, U test). Conclusion: The AFLS<5 mm can be used as a valuable criterion in diagnosing lumbar nerve root compression in CT study

  19. VizieR Online Data Catalog: HK photometry in an UCHII region near Sh2-217 (Brand+, 2011)

    Science.gov (United States)

    Brand, J.; Massi, F.; Zavagno, A.; Deharveng, L.; Lefloch, B.

    2010-11-01

    Coordinates and photometric parameters (magnitudes and colours) are presented of the stars located in a molecular condensation on the SW-border of the Galactic HII region Sh2-217. The data were obtained on January 4, 2004 with the 3.58-m Telescopio Nazionale Galileo (TNG; La Palma, Canary Islands, Spain). Near-infrared observations were carried out through H and K' broad-band filters with the camera NICS. The image scale is 0.25arcsec/pixel, yielding a field of view of about 4.2'x4.2'. Observing strategy and exposure times are described in Deharveng et al. (2006A&A...458..191D), the only difference being that the dithering sequence for the H-band images was the same as adopted for K'. The data reduction steps adopted are outlined in Deharveng et al. (2006A&A...458..191D). Aperture photometry was done using the DAOPHOT package in IRAF. We followed the same procedure described in Deharveng et al. (2006A&A...458..191D) to obtain aperture photometry, after which PSF-fitting photometry was performed. Although the seeing was good (position on the image of a sample of stars and fitting those positions to the equatorial coordinates given by Deharveng et al. (2006A&A...458..191D), using tasks of STSDAS/IRAF. The typical accuracy of this procedure is of the order of 1". (1 data file).

  20. Status of the 7 MeV/u, 217 MHz Injector Linac for the Heidelberg Cancer Therapy Facility

    CERN Document Server

    Schlitt, B; Hutter, G; Klos, F; Lu, Y; Minaev, S A; Mühle, C; Ratzinger, U; Schlitt, B; Tiede, R; Vinzenz, W; Will, C; Zurkan, O

    2004-01-01

    A clinical synchrotron facility for cancer therapy using energetic proton and ion beams (C, He and O) is under construction and will be installed at the Radiologische Universitätsklinik in Heidelberg, Germany, starting in 2005. The status of the ECR ion source systems, the beam line components of the low energy beam transport lines, the 400 keV/u RFQ and the 20 MV IH-cavity as well as the linac rf system will be reported. Two prototype magnets of the linac quadrupole magnets have been built at GSI and have been tested successfully. A test bench for the 1.4 MW, 217 MHz cavity amplifier built by industry has been installed at GSI including a 120 kW driver amplifier which will be used also for high power tests of the RFQ. A test bench for the RFQ using proton beams is presently being set up at the IAP. RF tuning of the 1:2 scaled IH-DTL model as well as Microwave Studio simulations of the model and the power cavity have been also performed at the IAP [1].

  1. HERSCHEL/HIFI SEARCH FOR H217O AND H218O IN IRC+10216: CONSTRAINTS ON MODELS FOR THE ORIGIN OF WATER VAPOR

    International Nuclear Information System (INIS)

    We report the results of a sensitive search for the minor isotopologues of water, H217O and H218O, toward the carbon-rich asymptotic giant branch star IRC+10216 (a.k.a. CW Leonis) using the HIFI instrument on the Herschel Space Observatory. This search was motivated by the fact that any detection of isotopic enhancement in the H217O and H218O abundances would have strongly implicated CO photodissociation as the source of the atomic oxygen needed to produce water in a carbon-rich circumstellar envelope. Our observations place an upper limit of 1/470 on the H217O/H216O abundance ratio. Given the isotopic 17O/16O ratio of 1/840 inferred previously for the photosphere of IRC+10216, this result places an upper limit of a factor 1.8 on the extent of any isotope-selective enhancement of H217O in the circumstellar material, and provides an important constraint on any model that invokes CO photodissociation as the source of O for H2O production. In the context of the clumpy photodissociation model proposed previously for the origin of water in IRC+10216, our limit implies that 12C16O (not 13C16O or SiO) must be the dominant source of 16O for H2O production, and that the effects of self-shielding can only have reduced the 12C16O photodissociation rate by at most a factor ∼2.

  2. Long-term exposure to low frequency electro-magnetic fields of 50- and 217-Hz leads to learning and memory deficits in mice

    OpenAIRE

    Soheila Khodakarim; Mostafa Rezaei-Tavirani; Elaheh Nooshinfar

    2012-01-01

    Electromagnetic field (EMF) radiation affects cellular and brain chemistry and function, resulting in deleterious effects such as free radicals formation, impaired DNA repair, reduced melatonin and blood brain barrier protection, and defects on learning and memory and other higher brain functions. In this paper the effects of low frequency EMF of 50- and 217 Hz, ranges often associated with common electronic devices such as televisions and cell phones were examined on learning and memory in a...

  3. Herschel/HIFI Search for H_2^{17}O and H_2^{18}O in IRC+10216: Constraints on Models for the Origin of Water Vapor

    Science.gov (United States)

    Neufeld, David A.; Tolls, Volker; Agúndez, Marcelino; González-Alfonso, Eduardo; Decin, Leen; Daniel, Fabien; Cernicharo, José; Melnick, Gary J.; Schmidt, Miroslaw; Szczerba, Ryszard

    2013-04-01

    We report the results of a sensitive search for the minor isotopologues of water, H_2^{17}O and H_2^{18}O, toward the carbon-rich asymptotic giant branch star IRC+10216 (a.k.a. CW Leonis) using the HIFI instrument on the Herschel Space Observatory. This search was motivated by the fact that any detection of isotopic enhancement in the H_2^{17}O and H_2^{18}O abundances would have strongly implicated CO photodissociation as the source of the atomic oxygen needed to produce water in a carbon-rich circumstellar envelope. Our observations place an upper limit of 1/470 on the H_2^{17}O/H_2^{16}O abundance ratio. Given the isotopic 17O/16O ratio of 1/840 inferred previously for the photosphere of IRC+10216, this result places an upper limit of a factor 1.8 on the extent of any isotope-selective enhancement of H_2^{17}O in the circumstellar material, and provides an important constraint on any model that invokes CO photodissociation as the source of O for H2O production. In the context of the clumpy photodissociation model proposed previously for the origin of water in IRC+10216, our limit implies that 12C16O (not 13C16O or SiO) must be the dominant source of 16O for H2O production, and that the effects of self-shielding can only have reduced the 12C16O photodissociation rate by at most a factor ~2. Herschel is an ESA space observatory with science instruments provided by European-led Principal Investigator consortia and with important participation from NASA.

  4. IUPAC critical evaluation of the rotational-vibrational spectra of water vapor. Part I-Energy levels and transition wavenumbers for H217O and H218O

    International Nuclear Information System (INIS)

    This is the first part of a series of articles reporting critically evaluated rotational-vibrational line positions, transition intensities, pressure dependence and energy levels, with associated critically reviewed assignments and uncertainties, for all the main isotopologues of water. The present article contains energy levels and data for line positions of the singly substituted isotopologues H217O and H218O. The procedure and code MARVEL, standing for measured active rotational-vibrational energy levels, is used extensively in all stages of determining the validated levels and lines and their self-consistent uncertainties. The spectral regions covered for both isotopologues H217O and H218O are 0-17125cm-1. The energy levels are checked against ones determined from accurate variational calculations. The number of critically evaluated and recommended levels and lines are, respectively, 2687 and 8614 for H217O, and 4839 and 29 364 for H218O. The extensive lists of MARVEL lines and levels obtained are deposited in the Supplementary Material, as well as in a distributed information system applied to water, W-DIS, where they can easily be retrieved. A distinguishing feature of the present evaluation of water spectroscopic data is the systematic use of all available experimental data and validation by first-principles theoretical calculations.

  5. Investigating the effects of 217 Hz frequency of cell phone on learning and spatial memory in rats

    Directory of Open Access Journals (Sweden)

    Kohzad S

    2013-03-01

    Full Text Available Background: Extremely low frequency (0-300 Hz fields from power lines, electronic equipment and medical devices, have been reported to produce various biological effects. Global system for mobile (GSM is most largely used in everybody's life. This system utilizes a low frequency band as well as a high frequency range of electromagnetic field. This study investigated the effects of 217 Hz electromagnetic field (the modulating signal in GSM on spatial learning and memory in rat.Methods: Twenty four male Wistar rat (200- 250 g were randomly divided in to three groups as: test, sham and control. Using a Helmholtz coil system, the test group was exposed to a uniform pulsed EMF of 200 µT (micro Tesla intensity for 4 h/day for 21 days (2 time in a day. This procedure was repeated for the sham group but with no field. All groups were trained prior to the day 21 on the 15th day for five days four trial per day in Morris Water-Maze system. Then the probe test was carried out for 60 seconds with no platform.Results: The ANOVA test revealed that no significant differences were found between control and exposed rats in all day of learning acquisition. Also, in probe test for investigating the memory, no significant differences observed. (P≤0.05 is accepted for significant level.Conclusion: This finding is in consistent with previous studies and indicates low frequency band of electromagnetic fields (EMF (200 µT intensity in cell phone may not have any effect on the learning acquisition and spatial memory in rat.

  6. The Effect of 217 Hz Magnetic Field of Cell Phone with Different Intensities on Apoptosis of Normal and Cancerous Cells Treated with Chemotherapy Drug

    Directory of Open Access Journals (Sweden)

    Mahsa Mansourian

    2012-03-01

    Full Text Available Background: According to the increasing development of home and business electronic equipment in today's world, the biological effects of ELF magnetic fields have been studied at two molecular-cellular and animal- human levels. Considering the therapeutic viewpoint of this study regarding the effects of low-frequency fields of mobile phone, the effect of acute exposure to this field on chemotherapy will be studied.Materials and Methods: In this experimental study, based on measurement of the intensity of the magnetic fields from mobile phones in another research, flux densities of magnetic field of 159.44, 93.25 and 120µ tesla with frequency of 217Hz was generated in magnetic field generator system, and the apoptosis level in K562 cancer cells and healthy cells of lymphocytes was assessed after exposure to field using flow cytometry method. This evaluation method was also performed for the cells treated with bleomycin after exposure to this field.Results: 217 Hz magnetic field exposure significantly increases the rate of apoptosis percentage (p > 0.05 in K562 cancer cells and in two intensities of 120 and 159.44µ tesla compared to the control group, but such effect is not observed in lymphocyte cells. Bleomycin-induced apoptosis percentage following exposure to the mentioned magnetic field shows no significant difference compared to the group of treatment with drug and without field exposure. This lack of significant difference is observed between the groups of drug after field exposure and field alone as well as between groups exposed to field and groups treated with bleomycin.Conclusion: Study results showed that 217 Hz magnetic field of mobile phone can induce apoptosis on cancer cells, but it has no effect on healthy cells. Thus, in order to use mobile phone as an effective factor in their treatment, some studies should be conducted at animal-human level.

  7. Epidemiology of Staphylococcus aureus in Bangalore, India: emergence of the ST217 clone and high rate of resistance to erythromycin and ciprofloxacin in the community

    Science.gov (United States)

    Bouchiat, C.; El-Zeenni, N.; Chakrakodi, B.; Nagaraj, S.; Arakere, G.; Etienne, J.

    2015-01-01

    This study aimed to determine the antibiotic susceptibility pattern of Staphylococcus aureus (SA) and the circulating clones in Bangalore, India. Susceptibility testing was performed for all cases of SA infections in a tertiary-care hospital. Panton-Valentine leucocidin (PVL) encoding genes were detected, and sequence type and spa type were determined. Out of the 92 collected strains, 52.2% were methicillin-resistant SA (MRSA), isolated from community-acquired (CA) infections in 60.4% and hospital-acquired (HA) infections in 39.6%. S. aureus isolates were also highly resistant to erythromycin (54.3%) and ciprofloxacin (70.6%) in methicillin-susceptible SA (MSSA) and MRSA, as well as in CA and HA infections. MRSA were found to be significantly more resistant to gentamicin (p <0.001), cotrimoxazole (p <0.001) and ciprofloxacin (p 0.001) than MSSA, but no significant difference was observed between CA- and HA-SA. ST217 appeared as a new emerging and prevalent clone, but ST772 remained the predominant clone, all being PVL-positive isolates. Our study points out the high prevalence of MRSA, even in the community, and the worrying increase of resistance to ciprofloxacin and erythromycin among CA-MSSA. Emergence of clone ST217 is reported for the first time in India. PMID:26110062

  8. Role of the non-opioid dynorphin peptide des-Tyr-dynorphin (DYN-A2-17) in food intake and physical activity, and its interaction with orexin-A.

    Science.gov (United States)

    Gac, L; Butterick, T A; Duffy, C M; Teske, J A; Perez-Leighton, C E

    2016-02-01

    Food intake and physical activity are regulated by multiple neuropeptides, including orexin and dynorphin (DYN). Orexin-A (OXA) is one of two orexin peptides with robust roles in regulation of food intake and spontaneous physical activity (SPA). DYN collectively refers to several peptides, some of which act through opioid receptors (opioid DYN) and some whose biological effects are not mediated by opioid receptors (non-opioid DYN). While opioid DYN is known to increase food intake, the effects of non-opioid DYN peptides on food intake and SPA are unknown. Neurons that co-express and release OXA and DYN are located within the lateral hypothalamus. Limited evidence suggests that OXA and opioid DYN peptides can interact to modulate some aspects of behaviors classically related to orexin peptide function. The paraventricular hypothalamic nucleus (PVN) is a brain area where OXA and DYN peptides might interact to modulate food intake and SPA. We demonstrate that injection of des-Tyr-dynorphin (DYN-A2-17, a non opioid DYN peptide) into the PVN increases food intake and SPA in adult mice. Co-injection of DYN-A2-17 and OXA in the PVN further increases food intake compared to DYN-A2-17 or OXA alone. This is the first report describing the effects of non-opioid DYN-A2-17 on food intake and SPA, and suggests that DYN-A2-17 interacts with OXA in the PVN to modulate food intake. Our data suggest a novel function for non-opioid DYN-A2-17 on food intake, supporting the concept that some behavioral effects of the orexin neurons result from combined actions of the orexin and DYN peptides. PMID:26654796

  9. All-solid-state continuous-wave frequency doubling Nd:LuVO4/LBO laser with 2.17 W output power at 543 nm

    Science.gov (United States)

    Li, B.; Zhao, L.; Zhang, Y. B.; Zheng, Q.; Zhao, Y.; Yao, Y.

    2013-03-01

    Efficient and compact green-yellow laser output at 543 nm is generated by intracavity frequency doubling of a CW diode-pumped Nd:LuVO4 laser at 1086 nm under the condition of suppressing the higher gain transition near 1064 nm. With 16 W of diode pump power and the frequency-doubling crystal LBO, as high as 2.17 W of CW output power at 543 nm is achieved, corresponding to an optical-to-optical conversion efficiency of 13.6% and the output power stability over 8 hours is better than 2.86%. To the best of our knowledge, this is the highest watt-level laser at 543 nm generated by intracavity frequency doubling of a diode pumped Nd:LuVO4 laser at 1086 nm.

  10. Hydrogen decrepitation as a method of powder preparation of a 2:17-type, Sm(Co, Cu, Fe, Zr)sub(8.92) magnetic alloy

    International Nuclear Information System (INIS)

    The present work has shown that hydrogen decrepitation of a 2:17-type Sm(Cosub(0.673)Cusub(0.080)Fesub(0.222)Zrsub(0.025))sub(8.92) alloy is a very rapid and convenient means of producing powdered material for the production of polymer-bonded permanent magnets. The magnets made from the hydrogen decrepitated powder (average particle size approx. 100 μm) exhibited improved demagnetization loop shapes, higher intrinsic coercivities and improved elevated temperature stability when compared with the magnets produced from the standard milled powder material (average particle size approx. 40 μm). These differences in properties have been related to the differences in the character of the powders produced by the two methods of decrepitation. (author)

  11. A representation of the Sm-Co-Zr-Cu-Fe quinary system: a tool for optimisation of 2/17 permanent magnets

    International Nuclear Information System (INIS)

    In order to optimise the elaboration process of Sm2Co17 type magnets, the boundary of the single-phase domain at 1150 C and of the two-phase domain involving the 1/5 and the 2/17 at 850 C must be known. The knowledge of solid-liquid equilibria is also needed in order to avoid formation of other phases during sintering. It was then necessary to investigate phase equilibria in the Sm-Co-Zr-Cu-Fe system. However, since the variability of a such system under isobaric and isothermal conditions is four, the classic graphical representation can not be used. The presented part of the work concerns the region of interest near 1150 C. A specific approach of the quinary system is developed. It starts from the Sm-Co binary system, then the Sm-Co-Zr ternary system has been investigated: 1150 C isothermal section has been drawn for high Co contents and special attention has been paid to in the structural modification induced by Zr addition. Based on our knowledge of the ternary system, the Sm-Co-Zr-Cu quaternary one has been studied; an isothermal section has been drawn for a Cu concentration of 4 at.%. Finally a representation of the 1150 C single-phase domain in the quinary system Sm-Co-Zr-Cu-Fe is proposed. For this purpose, a method consisting of a two-dimensional projection of the domain coupled with a three-dimensional one is applied. This representation makes possible to predict if a quinary alloy is single-phased at 1150 C or not. Magnetic behaviour of alloys is shown. This easy to read, easy to use representation appears a good tool to optimise the 2/17-type permanent magnets. (orig.)

  12. Malachi’s concern for social justice: Malachi 2:17 and 3:5 and its ethical imperatives for faith communities

    Directory of Open Access Journals (Sweden)

    Blessing O. Bọlọjẹ

    2014-02-01

    Full Text Available Any time humans in any culture consider primary ethical concepts, justice will be to the fore. Much seems to hinge upon it whether human society is to function with any semblance of civil order, security and harmony. When justice is pervasively trampled upon, the very fabric of liveable society crumbles. The apprehension for justice is clearly reflected in almost all of the Old Testament (OT. It is an important theological motif in the OT. This is found in such OT literature as historical, legal, prophetic and wisdom writings. This evidence thus reveals that the apprehension for the issue of justice was one of the many ways by which Israel’s multifaceted social life was knit together throughout its various ancient historical developments. No aspect of the life of Israel was excluded from this kind of apprehension for justice, and Yahweh was understood to be actively involved in its entire phase. This article examines Malachi’s fourth disputation in the light of the lawlessness alluded to in Malachi 2:17 and the corruption of personal and civil morality in Malachi 3:5. In the discussions that follow, this article examines the need for the justice of Yahweh; that is, Yahweh’s righting of past wrongs and the reversal of sinful societal order. The purpose is to enact a communal ethic for those who generously care for the neighbourhood and are firm in their devotion to Him, that is, God.

  13. IUPAC critical evaluation of the rotational–vibrational spectra of water vapor. Part IV. Energy levels and transition wavenumbers for D216O, D217O, and D218O

    International Nuclear Information System (INIS)

    This paper is the fourth of a series of papers reporting critically evaluated rotational–vibrational line positions, transition intensities, pressure dependences, and energy levels, with associated critically reviewed assignments and uncertainties, for all the main isotopologues of water. This paper presents energy level and transition data for the following doubly and triply substituted isotopologues of water: D216O, D217O, and D218O. The MARVEL (Measured Active Rotational–Vibrational Energy Levels) procedure is used to determine the levels, the lines, and their self-consistent uncertainties for the spectral regions 0–14 016, 0–7969, and 0–9108 cm−1 for D216O, D217O, and D218O, respectively. For D216O, D217O, and D218O, 53 534, 600, and 12 167 lines are considered, respectively, from spectra recorded in absorption at room temperature and in emission at elevated temperatures. The number of validated energy levels is 12 269, 338, and 3351 for D216O, D217O, and D218O, respectively. The energy levels have been checked against the ones determined, with an average accuracy of about 0.03 cm−1, from variational rovibrational computations employing exact kinetic energy operators and an accurate potential energy surface. Furthermore, the rovibrational labels of the energy levels have been validated by an analysis of the computed wavefunctions using the rigid-rotor decomposition (RRD) scheme. The extensive list of MARVEL lines and levels obtained is deposited in the Supplementary Material of this paper, in a distributed information system applied to water, W@DIS, and on the official MARVEL website, where they can easily be retrieved. - Highlights: • All published transitions are collected and analyzed. • A set of validated rovibrational transitions are presented. • Experimental energy levels for all three D2O isotopologues are determined. • Synthetic spectra are presented using these validated energy levels

  14. Regulatory Assistance, Stakeholder Outreach, and Coastal and Marine Spatial Planning Activities In Support Marine and Hydrokinetic Energy Deployment: Task 2.1.7 Permitting and Planning Fiscal Year 2012 Year-End Report

    Energy Technology Data Exchange (ETDEWEB)

    Geerlofs, Simon H.; Hanna, Luke A.; Judd, Chaeli R.; Blake, Kara M.

    2012-09-01

    This fiscal year 2012 year-end report summarizes activities carried out under DOE Water Power task 2.1.7, Permitting and Planning. Activities under Task 2.1.7 address the concerns of a wide range of stakeholders with an interest in the development of the MHK industry, including regulatory and resource management agencies, tribes, NGOs, and industry. Objectives for 2.1.7 are the following: • To work with stakeholders to streamline the MHK regulatory permitting process. • To work with stakeholders to gather information on needs and priorities for environmental assessment of MHK development. • To communicate research findings and directions to the MHK industry and stakeholders. • To engage in spatial planning processes in order to further the development of the MHK industry. These objectives are met through three subtasks, each of which are described in this report: • 2.1.7.1—Regulatory Assistance • 2.1.7.2—Stakeholder Outreach • 2.1.7.3—Coastal and Marine Spatial Planning As the MHK industry works with the regulatory community and stakeholders to plan, site, permit and license MHK technologies they have an interest in a predictable, efficient, and transparent process. Stakeholders and regulators have an interest in processes that result in sustainable use of ocean space with minimal effects to existing ocean users. Both stakeholders and regulators have an interest in avoiding legal challenges by meeting the intent of federal, state, and local laws that govern siting and operation of MHK technologies. The intention of work under 2.1.7 is to understand these varied interests, explore mechanisms to reduce conflict, identify efficiencies, and ultimately identify pathways to reduce the regulatory costs, time, and potential environmental impacts associated with developing, siting, permitting, and deploying MHK systems.

  15. Process for producing astatine-211 for radiopharmaceutical use

    International Nuclear Information System (INIS)

    A one-step chemical manipulation is described in combination with a distillation and collection process for producing At-211 comprising; a. providing a target of irradiated Bismuth coated to a predetermined thickness of a backing member, b. providing a vapor-producing still operably connected with a condenser that has a water cooled condensate collector formed of a dry silica gel mesh maintained at a temperature above the freezing point of water, and providing an effluent gas filter that is operably connected to receive effluent gas from the condenser, c. heating the target in the still at a temperature in the range of about 6300-6800C for a time period in the range of 50 to 80 minutes, to evole At-211 vapor from the target, c. providing a dry carrier gas having an oxygen concentration that is sufficient to form Bi/sub 2/O/sub 3/ thereby to essentially preclude vaporization of Bi metal, passing the carrier gas through the still to carry the At-211 vapor to the condenser, and to carry effluent from the condenser to the effluent gas filter, e. eluting At-211 from the condensate collector of the condenser with a controlled volume of eluent containing predetermined solvents that are compatible with a given desired radiopharmaceutical procedure, and f. collecting the At-211 in the controlled volume of eluent for use in the given radiopharmaceutical procedure

  16. Analysis of 217 Strains Bacteria and their Drug Susceptibility from Hospitalized Children with Lower Respiratory Tract Infections%儿童下呼吸道感染217株细菌分析及药物敏感趋势监测

    Institute of Scientific and Technical Information of China (English)

    方敏; 何邱宁

    2012-01-01

    目的:了解儿童下呼吸道感染致病菌的流行趋势和药物敏感性,为临床合理用药提供依据.方法:对2010年3月1日~2011年8月31日在我科住院的下呼吸道感染患儿痰液标本中分离出的病原菌进行药物敏感性监测分析.结果:共分离出217株病原菌.G-杆菌以大肠埃希菌(28.11%)、解鸟氨酸克雷伯菌(7.37%)、洛菲不动杆菌(6.91%)为主;G+菌以腐生葡萄球菌(9.68%)、表皮葡萄球菌(6.45%)、金黄色葡萄球菌(3.69%)为主.G-杆菌对第三代头孢菌素中的头孢他啶、头孢吡肟、氨曲南、亚胺培南、哌拉西林/他唑巴坦、头孢哌酮/舒巴坦、阿米卡星等抗生素敏感性高;G+球菌对青霉素、红霉素、克林霉素及阿奇霉素耐药率高,对其他抗生素敏感.超广谱β-内酰胺酶(ESBLs)的确证试验结果:61株大肠埃希菌产酶率55.74%;21株腐生葡萄球菌、耐甲氧西林凝固酶阴性葡萄球菌(MRSCN)产酶率9.52%,14株表皮葡萄球菌MRSCN的产酶率7.14%;5株屎肠球菌高水平氨基糖苷类耐药株( HLAR)40.00%,4株粪肠球菌HLAR为25.00%.结论:加强细菌培养和耐药性监测对临床合理使用抗生素十分必要.%Objective;To investigate the trend of lower respiratory tract infections in children and drug susceptibility to provide basis for reasonable use of drugs in clinical practice. Methods; A total of 217 strains of bacteria were isolated from sputum specimen of children who were hospitalized with lower respiratory tract infections form March 2010 to August 2011 in our hospital. The bacteria were cultured with blood dish and identified. Drug susceptibility was monitored. Results; 217 strains of bacteria were isolated. The first three places of Cram-negative bacilli were Escherichia coli (28. 11%), Klebsiella omithinolytica (7.37%) and Acinetobacter lwoffi (6.91%). The first three places of Cram-positive cocci were S. saprophyticus (9. 68% ) , S. epidermidis (6

  17. Molecular dynamics simulation and free energy landscape methods in probing L215H, L217R and L225M βI-tubulin mutations causing paclitaxel resistance in cancer cells.

    Science.gov (United States)

    Tripathi, Shubhandra; Srivastava, Gaurava; Sharma, Ashok

    2016-08-01

    Drug resistance poses a threatening challenge for mankind, as the development of resistance to already well-established drugs causes serious therapeutic problems. Resistance to paclitaxel (Ptxl), a complex diterpenoid working as microtubule stabilizer, is one such issue in cancer treatment. Microtubule stabilizer drugs, stabilises microtubules upon binding to β-tubulin subunit of tubulin heterodimer thus causing mitotic arrest leading to death of cancer cell. Leucine point mutations viz. L215H, L217R, and L225M were reported for Ptxl resistance in various cancers. In the current study, molecular mechanism of these resistance causing mutations was explored using molecular docking, molecular dynamics (MD) simulation, binding energy estimation (MMPBSA), free energy decomposition, principle component analysis (PCA) and free energy landscape (FEL) methods. A total of five systems including unbound βI-tubulin (Apo), docked wild+Ptxl, L215H+Ptxl, L217R+Ptxl and L225M+Ptxl were prepared, and 50 ns MD simulation was performed for each system. Binding energy estimation indicated that leucine mutation reduces the binding affinity of Ptxl in mutant types (MTs) as compared to wild type (WT). Further, in contrast to WT Ptxl interactions with the M-loop (PHE270-VAL286), S6-S7 loop and H9-H10 were significantly altered in MTs. Results showed that in MTs, Ptxl had weak interaction with M-loop residues, while having strong affinity with S6-S7 loop and H6-H7 loop. Moreover, PCA and FEL analysis revealed that M-loop flexible region (THR274-LEU284) was strongly bound with Ptxl in WT preventing its flexible movement and the causing factor for microtubule stabilization. In MTs due to poor interaction with Ptxl, M-loop flexible region retains its flexibility, therefore unable to stabilize microtubule. This study will give an insight into the importance of M-loop flexible region interaction with Ptxl for microtubule stabilization. In addition, it clearly provides the molecular basis of

  18. 76 FR 16526 - Airworthiness Directives; Pratt & Whitney JT8D-209, -217, -217A, -217C, and -219 Series Turbofan...

    Science.gov (United States)

    2011-03-24

    .../stage 4 LPT turbine blades shroud wear and subsequent high-cycle fatigue. They suggested that the... stage and 4th stage low- pressure turbine (LPT) blades for shroud notch wear and replacement of the... prevent turbine blade failures that could result in uncontained engine debris and damage to the...

  19. 22 CFR 217.47 - Nonacademic services.

    Science.gov (United States)

    2010-04-01

    ... services. (a) Physical education and athletics. (1) In providing physical education courses and athletics... or that operates or sponsors intercollegiate, club, or intramural athletics shall provide...

  20. 22 CFR 217.13 - Employment criteria.

    Science.gov (United States)

    2010-04-01

    ..., the test results accurately reflect the applicant's or employee's job skills, aptitude, or whatever... criteria. (a) A recipient may not make use of any employment test or other selection criterion that screens... test score or other selection criterion, as used by the recipient, is shown to be job-related for...

  1. 49 CFR 212.217 - Car inspector.

    Science.gov (United States)

    2010-10-01

    ... (ii) The Freight Car Safety Standards (49 CFR part 215), Safety Glazing Standards (49 CFR part 223), Safety Appliance Standards (49 CFR part 231) and Power Brake Standards (49 CFR part 232); (3) The... Safety Standards (49 CFR part 215), Safety Glazing Standards (49 CFR part 223), Safety...

  2. 14 CFR 16.217 - Witnesses.

    Science.gov (United States)

    2010-01-01

    ... may designate as a witness any person who is able and willing to give testimony that is relevant and... witness has no right to examine the witness or otherwise participate in the development of testimony. ... section. (b) The hearing officer may exclude testimony of witnesses that would be irrelevant,...

  3. 22 CFR 217.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ..., muscular dystrophy, multiple sclerosis, cancer, heart disease, diabetes, mental retardation, emotional... mental impairment which substantially limits one or more major life activities, (ii) has a record of such... this section the phrase: (i) Physical or mental impairment includes but is not limited to such...

  4. 50 CFR 217.204 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ... SPECIFIED ACTIVITIES Taking Of Marine Mammals Incidental To The Port of Anchorage Marine Terminal... cease and vessels will reduce to the slowest speed practicable while still maintaining control of...

  5. 48 CFR 217.7302 - Procedures.

    Science.gov (United States)

    2010-10-01

    ... paragraph (a) of this section does not apply to contracts that are— (1) For commercial items; or (2) Valued... OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Identification...

  6. 36 CFR 21.7 - Health examinations.

    Science.gov (United States)

    2010-07-01

    ... required by the Superintendent, and being found free from any infectious or communicable disease. Cross Reference: For a list of communicable diseases included in the regulations of the United States Public Health Service, see 21 CFR 1240.54....

  7. Evaluation of a Wet Chemistry Method for Isolation of Cyclotron Produced [211At]Astatine

    Directory of Open Access Journals (Sweden)

    Shigeki Watanabe

    2013-09-01

    Full Text Available A “wet chemistry” approach for isolation of 211At from an irradiated bismuth target is described. The approach involves five steps: (1 dissolution of bismuth target in conc. HNO3; (2 removal of the HNO3 by distillation; (3 dissolution of residue in 8 M HCl; (4 extraction of 211At from 8 M HCl into DIPE; and (5 extraction of 211At from DIPE into NaOH. Results from 55 “optimized” 211At isolation runs gave recovery yields of approximately 78% after decay and attenuation corrections. An attenuation-corrected average of 26 ± 3 mCi in the target provided isolated (actual yields of 16 ± 3 mCi of 211At. A sixth step, used for purification of 211At from trace metals, was evaluated in seven runs. In those runs, isolated 211At was distilled under reductive conditions to provide an average 71 ± 8% recovery. RadioHPLC analyses of the isolated 211At solutions, both initial and after distillation, were obtained to examine the 211At species present. The primary species of 211At present was astatide, but astatate and unidentified species were also observed. Studies to determine the effect of bismuth attenuation on 211At were conducted to estimate an attenuation factor (~1.33 for adjustment of 211At readings in the bismuth target.

  8. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  9. Astatination of nanoparticles containing silver as possible carriers of 211At

    Czech Academy of Sciences Publication Activity Database

    Lebeda, Ondřej; Kučka, Jan; Hrubý, Martin; Koňák, Čestmír; Kozempel, Ján

    2006-01-01

    Roč. 64, - (2006), s. 201-206. ISSN 0969-8043 R&D Projects: GA AV ČR KJB4048302; GA AV ČR KJB4050408 Institutional research plan: CEZ:AV0Z1048901 Keywords : nanoparticles * 211AT * Atalpha particle therapy Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.924, year: 2006

  10. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  11. Big Desire Equal to No Desire:Chuang-tzu's Thoughts in Passage 217 of Tsurezuregus%《徒然草》第二百十七段中的《庄子》思想——以“大欲与无欲相似”为视点

    Institute of Scientific and Technical Information of China (English)

    陈秉珊

    2012-01-01

    The process of a rich man's acquisition of wealth is narrated in Passage 217 of Tsurezuregus. According to the millionaire, accumulation of wealth is the most important thing in one's life, and one should practice spiritual asceticism for the good of one's wealth. Anyhow, this point of view is opposed by Kenk6, who insists that a big amount of wealth accumulated by suppressing one's desire is nothing better than no wealth at all ;therefore, wealth is nothing better than poverty in the rich man's case. The author of this article believes that Kenk's comment on wealth and desire has relevance to the thoughts in Chuang-tzu.%《徒然草》第二百十七段中某大富翁认为,人生最重要的就是不断积累财富,为积蓄财富,就要禁锢一切欲望,进行精神上的修行。对此,兼好提出异议,认为通过禁止任何欲望积累钱财,还不如一开始就没有钱财的好。按大富翁的逻辑,贫富将无区别,大欲与无欲相似。该段与《庄子》思想有较强的关联性。

  12. Alkaline earth-gold-aluminides. Synthesis and structure of SrAu{sub 3}Al{sub 2}, SrAu{sub 2.83}Al{sub 2.17}, BaAu{sub 2.89}Al{sub 2.11} and BaAu{sub 7.09}Al{sub 5.91}

    Energy Technology Data Exchange (ETDEWEB)

    Gerke, Birgit; Poettgen, Rainer [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie

    2015-07-01

    New alkaline earth-gold-aluminides were synthesized from the elements in sealed tantalum or quartz ampoules in muffle furnaces at maximum annealing temperatures of 1325 K. The structures were refined from single crystal X-ray diffractometer data. SrAu{sub 3}Al{sub 2} crystallizes in an ordered version of the LT-SrZn{sub 5} structure: Pnma, a = 1315.9(3), b = 549.0(1), c = 684.5(3) pm, wR2 = 0.0232, 930 F{sup 2} values, 35 variables. SrAu{sub 2.83}Al{sub 2.17} (a = 1065.0(2), b = 845.0(2), c = 548.1(1) pm, wR2 = 0.0416, 452 F{sup 2} values, 22 variables) and BaAu{sub 2.89}Al{sub 2.11} (a = 1096.1(3), b = 835.7(3), c = 554.0(1) pm, wR2 = 0.0280, 501 F{sup 2} values, 22 variables) both adopt the BaZn{sub 5} type, space group Cmcm with Au/Al mixing on the 4c site. The gold and aluminum atoms in both types form three-dimensional networks of condensed tetrahedra with the strontium and barium atoms in large cavities. BaAu{sub 7.09}Al{sub 5.91} is a new member of the NaZn{sub 13} type: Fm anti 3c, a = 1257.6(2) pm, wR2 = 0.0267, 168 F{sup 2} values, 12 variables. Both the 96i and 8b sites show Au/Al mixing. The crystal chemical details are discussed.

  13. 29 CFR 1910.217 - Mechanical power presses.

    Science.gov (United States)

    2010-07-01

    ... cylinders shall incorporate means to retain the piston and rod in case of breakage or loosening. (iv) Air... dependent upon spring action, the spring(s) shall be of the compression type, operating on a rod or guided..., operating on a rod or guided within a hole or tube, or designed to prevent interleaving of spring coils...

  14. Dicty_cDB: SHH217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 16 3 BM056853 |BM056853.1 2154-85 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides feli...9 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDN...2018A03 5', mRNA sequence. 88 6e-14 2 BM058578 |BM058578.1 2193-94 hindgut and Malpighian tubule subtracted cDNA library Ctenocephali...des felis cDNA clone 2193-94, mRNA sequence. 90 1e-13 1 BM058379 |BM058379.1 2191-2

  15. Dicty_cDB: VFB217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ', mRNA sequence. 68 3e-07 1 BE459798 |BE459798.1 EST415090 tomato developing/immature green fruit Lycopersico...c, DNA sequence. 66 1e-12 2 BI921109 |BI921109.1 EST541012 tomato callus Lycopersicon esculentum... 1 AI771812 |AI771812.1 EST252912 tomato ovary, TAMU Lycopersicon esculentum cDNA clone cLED38E1, mRNA seque...nce. 68 3e-07 1 AW932476 |AW932476.1 EST358319 tomato fruit mature green, TAMU Lycopersicon esculentum cDNA ...clone cLEF48O8 5', mRNA sequence. 68 3e-07 1 AW033447 |AW033447.1 EST277018 tomato callus, TAMU Lyco

  16. 50 CFR 217.202 - Permissible methods of taking.

    Science.gov (United States)

    2010-10-01

    ... leucas), harbor seals (Phoca vitulina), harbor porpoises (Phocoena phocoena), and killer whales (Orcinus orca). (c) The taking by injury or death of the species listed in paragraph (b) of this section or...

  17. 31 CFR 31.217 - Confidentiality of information.

    Science.gov (United States)

    2010-07-01

    ... business days of detecting a violation of the prohibitions in paragraph (b), above. The security measures... insider trading, when the arrangement relates to the acquisition, valuation, management, or disposition...

  18. 22 CFR 217.43 - Treatment of students; general.

    Science.gov (United States)

    2010-04-01

    ... aid, physical education, athletics, recreation, transportation, other extracurricular, or other postsecondary education aid, benefits, or services to which this subpart applies. (b) A recipient to which this... HANDICAP IN PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Postsecondary Education §...

  19. 49 CFR 234.217 - Flashing light units.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION GRADE CROSSING SIGNAL SYSTEM SAFETY AND STATE ACTION PLANS Maintenance... interior of the unit. Roundels and reflectors shall be clean and in good condition. (c) All light...

  20. Dicty_cDB: VSF217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GWEMPVQYPAGVMKEHLHV RKESGLFDVSHMGQLRIHGKDRVKFFESIVVADLQALPTGHSKLSVFTNEKGGIIDDTMI TNAGDSLYVVVNAGCADKDISHINE...HLHV RKESGLFDVSHMGQLRIHGKDRVKFFESIVVADLQALPTGHSKLSVFTNEKGGIIDDTMI TNAGDSLYVVVNAGCADKDISHINEKIKEFKSVNPTHDVSMQ

  1. 7 CFR 2.17 - Under Secretary for Rural Development.

    Science.gov (United States)

    2010-01-01

    ..., and Deposit Insurance Protection Act of 1996, Subtitle E of Public Law No. 104-208. (24)-(25) (26... joint regulations issued pursuant thereto by the Attorney General and the Comptroller General (4 CFR..., exercise the functions delegated to the Secretary by Executive Order 12580, 3 CFR, 1987 Comp., p....

  2. 48 CFR 217.172 - Multiyear contracts for supplies.

    Science.gov (United States)

    2010-10-01

    ... the agency shall submit to USD(C)(P/B) information supporting the agency's determination that this... supporting this certification to USD(C)(P/B) for transmission to Congress through the Secretary of...

  3. Dicty_cDB: VHO217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ld acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_05ca09, mRNA sequence. 56 8e-...one CR_CEa01K07, mRNA sequence. 56 8e-04 1 CB293061 |CB293061.1 UCRCS01_05ca09_g1 Washington Navel orange co

  4. 50 CFR 217.205 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... during all in-water pile driving operations but will continue monitoring one-year post in-water... of a Letter of Authorization shall submit a monthly report to NMFS' Headquarters Permits, Education... must notify the Director, Office of Protected Resources, NMFS, or designee, by e-mail or telephone...

  5. 48 CFR 217.171 - Multiyear contracts for services.

    Science.gov (United States)

    2010-10-01

    ... services that include— (i) An unfunded contingent liability in excess of $20 million (Section 8008(a) of... contingent liabilities for the assembly, training, or transportation of a specialized work force; and...

  6. 78 FR 217 - Shared Responsibility for Employers Regarding Health Coverage

    Science.gov (United States)

    2013-01-02

    ...)(2) as an employer that employed an average of at least 50 full-time employees on business days... FR 70644). Those HHS proposed regulations provide that the percentage of the total allowed cost of... taxpayer's social security benefits (as defined in section 86(d)) which is not included in gross...

  7. 29 CFR 778.217 - Reimbursement for expenses.

    Science.gov (United States)

    2010-07-01

    .... (2) The actual or reasonably approximate amount expended by an employee in purchasing, laundering or... expenses, such as taxicab fares, incurred while traveling on the employer's business. (4) “Supper money”,...

  8. Dicty_cDB: CHQ217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available yvsrw*lyhg*wyww*inlr*qic**klqiktfr srytlngqrwcqhqwftilylccsn*lvrr*trcirfch*rygcr*kdgscwftir*nyq tsrhcqlwstlnyqhiafl**liri...fl**lirikrxiqfff Translated Amino Acid sequence (All Frames) Frame A: t*nn*k*qllnqppqkthvssli...n mRNA, ... 253 1e-65 EU126917_1( EU126917 |pid:none) Gerbera hybrid cultivar cyclophili...-65 AF020434_1( AF020434 |pid:none) Arabidopsis thaliana cyclophilin (... 250 5e-65 AF126551_1( AF126551 |pi...*wyww*inlr*qic**klqiktfr srytlngqrwcqhqwftilylccsn*lvrr*trcirfch*rygcr*kdgscwftir*nyq tsrhcqlwstlnyqhia

  9. 50 CFR 216.217 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ..., and any other Federal, state or local agency with regulatory authority over the offshore oil-and-gas...) Acoustic surveys will be run concurrent with requisite pre-detonation surveys, beginning with the surface observations and concluding at the finish of the aerial surveys when the detonation(s) is allowed to...

  10. Dicty_cDB: CFD217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kp*lvklspwkskvltt lkmlkpksqdkegippdqqrlifagkqledgrtlsdyniqkestlhlvlrlrggmqifvk tltgktitleg*r**YIEMSKPNXRQXRX...IKRVVCN XLLXLSLVKPSP*kskvvitlkmskpksktkkvfhqdqqrxifagkqledgrtlsdyniq kestlhlvlrlrggmqifvktltgktitlevegsdnien...vkakiqdkegippdqqrlifa gkqledgrtlsdyniqkestlhlvlrlrggmqifvktltgktitlevegsdnienvkaki qdkegippdqqrlifagkqledgrt...xxdyniqkestlpfsxqxkxvvtkfga Translated Amino Acid sequence (All Frames) Frame A: fty*limqifvktltgktitlevegsd...nienvkakiqdkegippdqqrlifagkqledgr tlsdyniqkestlhlvlrlrggmqifvktltgktitlevegsdnien

  11. Dicty_cDB: AFL217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ranslated Amino Acid sequence llyky*ihilffyil*HFIKKKKKKKXKKXPFLKKK--- ---NVKPXFQDKGGFPPXQXRFISXVXN*xmxxlslipiskknxls...- ---NVKPXFQDKGGFPPXQXRFISXVXN*xmxxlslipiskknxlshlvxrlrggmqifv ktltgktitlevegsdnienvktkiqdkegippdqqrlifagkql

  12. 47 CFR 25.217 - Default service rules.

    Science.gov (United States)

    2010-10-01

    ... with terrestrial wireless services shall comply with the requirements in § 25.203(c). (c)(1) For all... paragraph (c)(1) of this paragraph in frequency bands shared with terrestrial wireless services shall comply... licenses to operate a satellite system in a frequency band granted after a domestic frequency...

  13. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  14. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE,CERN

    OpenAIRE

    Rothe, Sebastian

    2012-01-01

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spec...

  15. Inactivation of human osteosarcoma cells in vitro by {sup 211}At-TP-3 monoclonal antibody: Comparison with astatine-211 and external-beam X rays

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, R.H. [Univ. of Oslo (Norway)]|[Institute for Cancer Research, Oslo (Norway); Bruland, O.S. [Institute for Cancer Research, Oslo (Norway); Hoff, P.; Alstad, J. [Univ. of Oslo (Norway); Lindmo, T. [Institute for Cancer Research, Oslo (Norway); Rofstad, E.K. [Norwegian Institute of Technology, Trondheim (Norway)

    1994-08-01

    The potential usefulness of {alpha}-particle radioimmunotherapy in the treatment of osteosarcoma was studied in vitro by using the monoclonal antibody TP-3 and cells of three human osteosarcoma cell lines (OHS, SAOS and KPDX) differing in antigen expression. Cell survival curves were established after treatment with (a) {sup 211}At-TP-3 of different specific activities, (b) {sup 211}At-labeled bovine serum albumin (BSA), (c) free {sup 211}At and (d) external-beam X rays. The three osteosarcoma cell lines showed similar survival curves, whether treated with external-beam X rays, {sup 211}At-BSA or free {sup 211}At. The D{sub o}`s were lower for free {sup 211}At than for {sup 211}At-BSA. The survival curves for {sup 211}At-TP-3 treatment, on the other hand, differed significantly among the cell lines, suggesting that sensitivity to {sup 211}At-TP-3 treatment was governed by cellular properties other than sensitivity to external-beam X rays. The cellular property most important for sensitivity to {sup 211}At-TP-3 treatment was the antigen expression. Cell inactivation after {sup 211}At-TP-3 treatment increased substantially with increasing specific activity of the {sup 211}At-TP-3. At high specific activities, the cytotoxic effect of {sup 211}At-TP-3 was significantly higher than that of {sup 211}At-BSA. In conclusion, {sup 211}At-TP-3 has the potential to give clinically favorable therapeutic ratios in the treatment of osteosarcoma. 39 refs., 5 figs., 2 tabs.

  16. Progress of Recycling in the Built Environment Final report of the RILEM Technical Committee 217-PRE

    CERN Document Server

    2013-01-01

    This report is a useful tool for countries starting to recycle aggregates or construction and demolition waste. It contains the latest developments in this field, introduces a completely new approach to the procedure of proportioning concrete mixtures with recycled aggregate, references recent publications, opinions and discrepancies in relation to the durability of recycled concrete, such as freeze-thaw standards, studies of chloride penetration and diffusion, and sulfate attacks, the use of the fine fraction <4mm, quality assurance of concrete recycled aggregate, sustainability and recycling construction waste and global impact assessment of urban renewal based on sustainable recycling strategies for construction and demolition waste. This volume will be of interest to recyclers, researchers and consumers.

  17. People and things. CERN Courier, September 1981, v. 21(7)

    International Nuclear Information System (INIS)

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events: The King of Belgium recently paid a state visit to the People's Republic of China and invited four Belgian scientists to accompany him — M. Engelborghs-Bertelsr P. Melchior (Royal Observatory of Brussels and Louvain), J. van der Veken (Louvain) and Y. Go/dschmidt-Clermont (Brussels and CERN). Yves Goldschmidt- Clermont provided us with the following report. Italian physicists are presently developing a large modular track detector to be installed in the future Gran Sasso underground laboratory. Such a 'Giant Underground track- Detector' (GUD), up to 10 Kt in mass, should be capable of investigating nucleon decay and the interactions of high energy cosmic neutrinos. An International Conference on Nucleus-Nucleus Collisions will be held at Michigan State University from 26 September to 1 October, 1982

  18. SU-E-T-217: Intrinsic Respiratory Gating in Small Animal CT

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Y; Smith, M; Mistry, N [University of Maryland School of Medicine, Baltimore, MD (United States)

    2014-06-01

    Purpose: Preclinical animal models of lung cancer can provide a controlled test-bed for testing dose escalation or function-based-treatment-planning studies. However, to extract lung function, i.e. ventilation, one needs to be able to image the lung at different phases of ventilation (in-hale / ex-hale). Most respiratory-gated imaging using micro-CT involves using an external ventilator and surgical intervention limiting the utility in longitudinal studies. A new intrinsic respiratory retrospective gating method was developed and tested in mice. Methods: A fixed region of interest (ROI) that covers the diaphragm was selected on all projection images to estimate the mean intensity (M). The mean intensity depends on the projection angle and diaphragm position. A 3-point moving average (A) of consecutive M values: Mpre, Mcurrent and Mpost, was calculated to be subtracted from Mcurrent. A fixed threshold was used to enable amplitude based sorting into 4 different phases of respiration. Images at full-inhale and end-exhale phases of respiration were reconstructed using the open source OSCaR. Lung volumes estimated at the 2 phases of respiration were validated against literature values. Results: Intrinsic retrospective gating was accomplished without the use of any external breathing waveform. While projection images were acquired at 360 different angles. Only 138 and 104 projections were used to reconstruct images at full-inhale and end-exhale. This often results in non-uniform under-sampled angular projections leading to some minor streaking artifacts. The calculated expiratory, inspiratory and tidal lung volumes correlated well with the values known from the literature. Conclusion: Our initial result demonstrates an intrinsic gating method that is suitable for flat panel cone beam small animal CT systems. Reduction in streaking artifacts can be accomplished by oversampling the data or using iterative reconstruction methods. This initial experience will enable freebreathing small animal micro-CT imaging to fuel longitudinal studies of lung function.

  19. Q/SdR.04.896-2008 SQR7130A217/Model A Car

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    1.Background As the development of global economy demands an increasingly large quantity of energy,the energy crisis is getting more severe.Auto manufacturers in Japan,America,and Europe have all began to develop hybrid power vehicles or its technology platform since 1990s,so as to save energy.Relied on its THS system which consists of the planet wheel and e-CVT,TOYOTA developed a series of strong hybrid power vehicles,such as Prius,Lexus,Highlander,Camry,etc.Based on its IMA system,HONDA developed a series of mild hybrid power vehicles,such as Insight,Civic,Accord,etc.On the basis of its Belt-driven Starter Generator (BSG) system,French SPA Group developed a series of weak hybrid power vehicles,such as Citroen C3,Citroen C2,Citroen 1007,Citroen 207,etc.In America the research of hybrid power vehicle is being done actively by a group of relevant parties consisting of Department of Transport,Department of Defense,major auto companies and relevant organizations under the leadership of Department of Energy and with the large quantity ofinvestment from GE Motors Co.and CHRYSLER.

  20. 37 CFR 1.217 - Publication of a redacted copy of an application.

    Science.gov (United States)

    2010-07-01

    ... translation is accurate; (3) A marked-up copy of the application showing the redactions in brackets; and (4) A... brackets; and (ii) A copy of each submission previously filed by the applicant including any desired... material in brackets. (2) In addition to providing the submission required by paragraphs (c) and (d)(1)...

  1. Yeast Interacting Proteins Database: YHR114W, YDL217C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YHR114W BZZ1 SH3 domain protein implicated in the regulation of actin polymerization , able to re ... cruit actin polymerization ... machinery through its SH3 domains, colocalizes wit ... main protein implicated in the regulation of actin polymerization , able to recruit actin polymerization ... machinery th ...

  2. SU-E-T-217: Intrinsic Respiratory Gating in Small Animal CT

    International Nuclear Information System (INIS)

    Purpose: Preclinical animal models of lung cancer can provide a controlled test-bed for testing dose escalation or function-based-treatment-planning studies. However, to extract lung function, i.e. ventilation, one needs to be able to image the lung at different phases of ventilation (in-hale / ex-hale). Most respiratory-gated imaging using micro-CT involves using an external ventilator and surgical intervention limiting the utility in longitudinal studies. A new intrinsic respiratory retrospective gating method was developed and tested in mice. Methods: A fixed region of interest (ROI) that covers the diaphragm was selected on all projection images to estimate the mean intensity (M). The mean intensity depends on the projection angle and diaphragm position. A 3-point moving average (A) of consecutive M values: Mpre, Mcurrent and Mpost, was calculated to be subtracted from Mcurrent. A fixed threshold was used to enable amplitude based sorting into 4 different phases of respiration. Images at full-inhale and end-exhale phases of respiration were reconstructed using the open source OSCaR. Lung volumes estimated at the 2 phases of respiration were validated against literature values. Results: Intrinsic retrospective gating was accomplished without the use of any external breathing waveform. While projection images were acquired at 360 different angles. Only 138 and 104 projections were used to reconstruct images at full-inhale and end-exhale. This often results in non-uniform under-sampled angular projections leading to some minor streaking artifacts. The calculated expiratory, inspiratory and tidal lung volumes correlated well with the values known from the literature. Conclusion: Our initial result demonstrates an intrinsic gating method that is suitable for flat panel cone beam small animal CT systems. Reduction in streaking artifacts can be accomplished by oversampling the data or using iterative reconstruction methods. This initial experience will enable freebreathing small animal micro-CT imaging to fuel longitudinal studies of lung function

  3. 48 CFR 3052.217-92 - Inspection and manner of doing work (USCG).

    Science.gov (United States)

    2010-10-01

    ... work (USCG). As prescribed in USCG guidance at (HSAR) 48 CFR 3017.9000(a) and (b), insert the following..., American Bureau of Shipping, or Department of the Navy for the type of welding being performed... proper closing of all openings to the vessel's underwater structure upon which work has been...

  4. Children of Working Mothers, March 1977. Special Labor Force Report 217.

    Science.gov (United States)

    Grossman, Allyson Sherman

    1979-01-01

    This special labor force report, focusing on children of working mothers, summarizes findings from the 1977 annual survey of marital and family characteristics of workers in the population who are 16 years old and over. Data are given on: the numbers of children of various ages with working mothers, the percentages of black and white children…

  5. Subtask 2.17 - CO{sub 2} Storage Efficiency in Deep Saline Formations

    Energy Technology Data Exchange (ETDEWEB)

    Gorecki, Charles; Liu, Guoxiang; Braunberger, Jason; Klenner, Robert; Ayash, Scott; Dotzenrod, Neil; Steadman, Edward; Harju, John

    2014-02-01

    As the field of carbon capture and storage (CCS) continues to advance, and large-scale implementation of geologic carbon dioxide (CO{sub 2}) storage progresses, it will be important to understand the potential of geologic formations to store meaningful amounts of CO{sub 2}. Geologic CO{sub 2} storage in deep saline formations (DSFs) has been suggested as one of the best potential methods for reducing anthropogenic CO{sub 2} emission to the atmosphere, and as such, updated storage resource estimation methods will continue to be an important component for the widespread deployment of CCS around the world. While there have been several methodologies suggested in the literature, most of these methods are based on a volumetric calculation of the pore volume of the DSF multiplied by a storage efficiency term and do not consider the effect of site-specific dynamic factors such as injection rate, injection pattern, timing of injection, pressure interference between injection locations, and overall formation pressure buildup. These volumetric methods may be excellent for comparing the potential between particular formations or basins, but they have not been validated through real-world experience or full-formation injection simulations. Several studies have also suggested that the dynamic components of geologic storage may play the most important role in storing CO{sub 2} in DSFs but until now have not directly compared CO{sub 2} storage resource estimates made with volumetric methodologies to estimates made using dynamic CO{sub 2} storage methodologies. In this study, two DSFs, in geographically separate areas with geologically diverse properties, were evaluated with both volumetric and dynamic CO{sub 2} storage resource estimation methodologies to compare the results and determine the applicability of both approaches. In the end, it was determined that the dynamic CO{sub 2} storage resource potential is timedependent and it asymptotically approaches the volumetric CO{sub 2} storage resource potential over very long periods of time in the two systems that were evaluated. These results indicate that the volumetric assessments can be used as long as the appropriate storage efficiency terms are used and it is understood that it will take many wells over very long periods of time to fully realize the storage potential of a target formation. This subtask was funded through the Energy & Environmental Research Center (EERC)– U.S. Department of Energy (DOE) Joint Program on Research and Development for Fossil Energy-Related Resources Cooperative Agreement No. DE-FC26-08NT43291. Nonfederal funding was provided by the IEA Greenhouse Gas R&D Programme.

  6. Basic webliography on health promotion and disease prevention - doi:10.5020/18061230.2009.p217

    Directory of Open Access Journals (Sweden)

    Ana Claudia Camargo Gonçalves da Silva

    2012-01-01

    Full Text Available Objectives: To introduce a basic webliography to access highly qualified evidence-based material on health promotion and disease prevention, aiming at the continuing education of health professionals. Methods: By means of Google® browser, applying the descriptors in sequence to progressively refine the search on Internet and key concepts to be learned, all previously defined by the authors themselves, we proceeded a qualitative analyses of the 20 first listed links for each searched issue and the final selection of the most scientifically relevant ones. Results: The 34 selected links are presented in 4 groups: 23 portals, 5 guides and recommendations, 4 scientific journals and 3 blogs that allow free access to health promotion and disease prevention related subjects, such as: concepts; national and international public policies; epidemiology, statistics and health indicators; diseases screening and prophylaxis; counseling for behavior change of health related habits; and interdisciplinary work. Among the selected links 10 (29% are written in English while the others are in Portuguese. Conclusions: The identification of reading materials on health promotion and disease prevention available on Internet, many in Portuguese, allowed us to select relevant scientifically qualified literature and turn it accessible to health professionals, enabling the acquisition of new knowledge or quick update.

  7. 18 CFR 2.17 - Price discrimination and anticompetitive effect (price squeeze issue).

    Science.gov (United States)

    2010-04-01

    ... proceeding, the intervening customer or other interested person must support its allegation by a prima facie case. The elements of the prima facie case shall include at a minimum: (1) Specification of the filing... present their case, including prima facie showing, on price squeeze issues. (c) Within 30 days from...

  8. 42 CFR 435.217 - Individuals receiving home and community-based services.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Individuals receiving home and community-based... receiving home and community-based services. The agency may provide Medicaid to any group or groups of individuals in the community who meet the following requirements: (a) The group would be eligible for...

  9. Abandon Hope All Ye Who Enter Here? (N217-11)

    OpenAIRE

    Pecchenino, Rowena

    2011-01-01

    Hope plays an important role in all individuals’ lives both today and in the future. While hope and hopelessness are important concepts and the subjects of much theorizing in psychology, theology, philosophy, political science, nursing, as well as in literature and the arts, it is absent from economics. This silence on hope is notable since hope is fundamentally at the centre of choice, especially intertemporal choice, which is at the centre of economic analysis. To place hope ...

  10. Laboratory manual for salt-mixing test in 37- and 217-pin bundles

    International Nuclear Information System (INIS)

    This laboratory manual deals with the procedure employed during salt tracer experiments used in evaluating the hydraulic characteristics of a rod bundle. A description of the standard equipment used is given together with the details of manufacture of probes used for detecting the salt concentration. Details of the bundle construction have been excluded as they are availble in the reference cited. An attempt has been made to point out potential trouble areas and procedures

  11. 77 FR 47492 - Thirteenth Meeting: RTCA Special Committee 217, Terrain and Airport Mapping Databases, Joint With...

    Science.gov (United States)

    2012-08-08

    ....gouv.fr , telephone, 33-5 57 92 57 81, mobile telephone, 33-6 10 74 56 00. Honeywell's Prague facility... Mapping Databases, Joint With EUROCAE WG-44 AGENCY: Federal Aviation Administration (FAA), U.S. Department... Mapping Databases, Joint with EUROCAE WG-44. SUMMARY: The FAA is issuing this notice to advise the...

  12. Optimisation of 2/17 permanent magnets using the quinary Sm-Co-Cu-Fe-Zr phase diagram

    International Nuclear Information System (INIS)

    The combination of high magnetisation and high Curie temperature of the Sm2Co17 type magnets makes them attractive for a number of applications requiring high-energy products and long term stability for continuous operating up to 300 C. In order to optimise the elaboration process, it was necessary to investigate phase equilibria in the Sm-Co-Zr-Cu-Fe system. The presented part of the work concerns two regions of interest near 1150 C and 850 C. A specific method is proposed to represent the diagram where a two dimension projection of the different domains is coupled with a three dimensional one. This representation appears as a tool to understand the metallurgical process and to obtain better reproducibility of the alloys magnetic properties. Then an optimisation could be made. Magnetic behaviour of alloys is discussed. (orig.)

  13. Ser217Cys mutation in the Ig Ⅱ domain of FGFR3 in a Chinese family with autosomal dominant achondroplasia

    Institute of Scientific and Technical Information of China (English)

    ZHANG Shi-rong; ZHOU Xiao-qing; REN Xiang; WANG Tian-tian; YUAN Ming-xiong; WANG Qing; LIU Jing-yu; LIU Mu-gen

    2007-01-01

    @@ Achondroplasia (ACH) is the most common form of skeletal dysplasia characterized by disproportionately short stature, lumbar lordosis, relative macrocephaly and other skeletal anomalies resulting from a defect in the maturation of the chondrocytes in the growth plate of the cartilage. The combined frequency of the disease has been estimated to be 1 in 15 000 live births.1 ACH is inherited in autosomal dominant fashion with a complete penetrance, more than 80% of affected individuals have de novo mutations associated with increased paternal age.

  14. Kryptonita: un Superman argentino entre Patoruzú y Afanancio : Oyola, Leandro (2011): Kryptonita. Buenos Aires, Mondadori, pp. 217

    OpenAIRE

    Yema, Sihuén

    2012-01-01

    Luego de leer Kryptonita de Leandro Oyola volví a sentir esa sensación de que los superhéroes pueden estar allí afuera. Pero no con trajes especiales ni poderes demenciales. Ni siquiera precisan ser superhéroes a la manera que los define el comic, pero una pizca de realidad puede haber en las historias de Batman o Superman

  15. A response matrix method for improved modeling of neutron streaming in large control rod holes of prismatic VHTR cores - 217

    International Nuclear Information System (INIS)

    This paper presents a response matrix method developed for accurate modeling of neutron streaming through empty, large control rod holes in VHTRs. In this approach, a response matrix based on transport solution is derived for each control rod channel region and embedded in the whole-core transport solution scheme. Depending on the region geometry only, each element of the response matrix represents the outgoing partial current at a surface due to a unit incoming partial current at another surface. In order to improve the axial solution accuracy, this response matrix approach was incorporated into the DeCART code that solves whole-core transport problems by coupling two-dimensional MOC and one-dimensional nodal solutions. Verification test results showed very good agreements in control rod worth and axial power distributions with MCNP5 solutions. (authors)

  16. Tritiated water detection in the 2.17 µM spectral region by cavity ring down spectroscopy

    International Nuclear Information System (INIS)

    Nuclear waste containers are intended to be stored in dedicated disposal sites. For the inside and environmental safety of the disposal sites, the tiny outgassing rates leaking out the containers are measured. Presently, the radioactive HT gas is measured by liquid scintillation. However an alternative method—cavity ring down spectroscopy, an isotopically selective laser technique based on molecular spectroscopy—is currently developed and evaluated for tritium measurement in its oxidized form, HTO. Applying this method, the number density of the gaseous HTO sample hold in the optical cavity cell, is derived from the laser beam absorption by vibrational symmetric stretching 2ν1 (R) HTO lines in the 4590 and 4600 cm−1 spectral range. To ensure a future accurate HTO measurement, the theoretical line intensities are confronted to the experiment: two tritiated water standards are measured with a dedicated CRDS set-up. Compared to the theoretical database, the line positions are correct (−0.067 to −0.128 cm−1), their relative intensities are in agreement with the database, but their absolute intensities are 20% weaker. Among the seven intense lines, the 4596.485 cm−1 line (intensity 8.22 10−22 cm/molecule) and the 4592.407 cm−1 line (intensity 9.83 10−22 cm/molecule) are isolated and intense for a sensitive detection. The HTO detection limit with the present set-up is 3 kBq (10 min), equivalent to 1.8 1012 molecules in the 111 cm3 CRDS cell. This detection limit could be improved by a factor 3 by reducing the detection noise

  17. 50 CFR 226.217 - Critical habitat for the Gulf of Maine Distinct Population Segment of Atlantic Salmon (Salmo salar).

    Science.gov (United States)

    2010-10-01

    ... reference was approved by the Director of the Federal Register in accordance with 5 U.S.C. 552(a) and 1 CFR... as defined by the ordinary high-water line (33 CFR 329.11). In areas where the ordinary high-water.... Kennebec Augusta, Benton, Chelsea, China, Clinton, Farmingdale, Fayette, Gardiner, Hallowell,...

  18. In vivo emergence of Aspergillus terreus with reduced azole susceptibility and a Cyp51a M217I alteration

    DEFF Research Database (Denmark)

    Arendrup, Maiken C; Jensen, Rasmus; Grif, Katharina;

    2012-01-01

    Azole resistance in Aspergillus terreus isolates was explored. Twenty related (MB) and 6 unrelated A. terreus isolates were included. CYP51A sequencing and RAPD genotyping was performed. Five MB isolates were itraconazole susceptible, whereas the minimum inhibitory concentrations (MICs) for 15 MB...

  19. 41 CFR 101-6.217 - Laws authorizing Federal financial assistance for programs to which this subpart applies.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Laws authorizing Federal... Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT..., preserving and compiling, and publishing of documentary sources significant to the history of the...

  20. What Is Physical Oceanography? A Learning Experience for Coastal and Oceanic Awareness Studies, No. 217. [Project COAST].

    Science.gov (United States)

    Delaware Univ., Newark. Coll. of Education.

    This unit is concerned with an overview of physical oceanography - the study of currents, tides, waves, and particle movements. The activities are designed for use by junior high school age students. Included in the unit are activities related to properties of sea water, physical phenomena of the ocean, and physical features of the ocean.…

  1. Shelf-Life of ɛ-Lysyl-3-(Trimethylstannyl)Benzamide Immunoconjugates, Precursors for 211At Labeling of Antibodies

    OpenAIRE

    Aneheim, Emma; Halleröd, Jenny; Albertsson, Per; Jensen, Holger; Holgersson, Stellan; Lindegren, Sture

    2015-01-01

    Astatine-211 is possibly the most promising radionuclide for targeted α-particle therapy when it comes to the treatment of occult disseminated cancer. Preclinical research has proven effective, and patient studies have been initiated based on these results. However, a lack of production capacity and the complex radiochemistry of 211At are major obstacles for research and prospective clinical applications. In the present study, astatination of immunoconjugates, already prepared well in advance...

  2. 26 CFR 1.217-2 - Deduction for moving expenses paid or incurred in taxable years beginning after December 31, 1969.

    Science.gov (United States)

    2010-04-01

    ... REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Additional... chapter (Employment Tax Regulations). The term self-employed individual as used in this section is defined..., expenses of occupying temporary quarters do not include, for example, the cost of entertainment,...

  3. Melhaoui Mohammed, Peste, contagion et martyre. Histoire du fléau en Occident médiéval, Paris, Publisud, 2005, 217 p.

    Directory of Open Access Journals (Sweden)

    Stéphane Barry

    2007-07-01

    Full Text Available En France, à l’exception des études du médecin, historien et démographe Jean-Noël Biraben (1975-1976, peu de travaux existent sur la Peste noire et ses conséquences dans l’Occident musulman médiéval. On comprendra alors tout l’intérêt de l’ouvrage de Mohammed Melhaoui sur ce thème qu’il connaît bien puisqu’il lui a consacré non seulement une thèse de doctorat d’histoire, mais aussi quelques études portant notamment sur la « perception de la peste en pays chrétiens byzantins et musulman » (Co...

  4. SU-E-J-217: Multiparametric MR Imaging of Cranial Tumors On a Dedicated 1.0T MR Simulator Prior to Stereotactic Radiosurgery

    International Nuclear Information System (INIS)

    Purpose: Quantitative magnetic resonance imaging (MRI) of cranial lesions prior to stereotactic radiosurgery (SRS) may improve treatment planning and provide potential prognostic value. The practicality and logistics of acquiring advanced multiparametric MRI sequences to measure vascular and cellular properties of cerebral tumors are explored on a 1.0 Tesla MR Simulator. Methods: MR simulation was performed immediately following routine CT simulation on a 1T MR Simulator. MR sequences used were in the order they were performed: T2-Weighted Turbo Spin Echo (T2W-TSE), T2 FLAIR, Diffusion-weighted (DWI, b = 0, 800 to generate an apparent diffusion coefficient (ADC) map), 3D T1-Weighted Fast Field Echo (T1W-FFE), Dynamic Contrast Enhanced (DCE) and Post Gadolinium Contrast Enhanced 3D T1W-FFE images. T1 pre-contrast values was generated by acquiring six different flip angles. The arterial input function was derived from arterial pixels in the perfusion images selected manually. The extended Tofts model was used to generate the permeability maps. Routine MRI scans took about 30 minutes to complete; the additional scans added 12 minutes. Results: To date, seven patients with cerebral tumors have been imaged and tumor physiology characterized. For example, on a glioblastoma patient, the volume contoured on T1 Gd images, ADC map and the pharmacokinetic map (Ktrans) were 1.9, 1.4, and 1.5 cc respectively with strong spatial correlation. The mean ADC value of the entire volume was 1141 μm2/s while the value in the white matter was 811 μm2/s. The mean value of Ktrans was 0.02 min-1 in the tumor volume and 0.00 in the normal white matter. Conclusion: Our initial results suggest that multiparametric MRI sequences may provide a more quantitative evaluation of vascular and tumor properties. Implementing functional imaging during MR-SIM may be particularly beneficial in assessing tumor extent, differentiating radiation necrosis from tumor recurrence, and establishing reliable bio-markers for treatment response evaluation. The Department of Radiation Oncology at Henry Ford Health System has research agreement with Varian Medical System and Philips Health Care

  5. The VIMOS VLT Deep Survey: Star Formation Rate Density of Lya emitters from a sample of 217 galaxies with spectroscopic redshifts 2

    CERN Document Server

    Cassata, P; Garilli, B; Maccagni, D; Le Brun, V; Scodeggio, M; Tresse, L; Ilbert, O; Zamorani, G; Cucciati, O; Contini, T; Bielby, R; Mellier, Y; McCracken, H J; Pollo, A; Zanichelli, A; Bardelli, S; Cappi, A; Pozzetti, L; Vergani, D; Zucca, E

    2010-01-01

    Aims. The aim of this work is to study the contribution of the Ly-alpha emitters to the Star Formation Rate Density (SFRD) of the Universe in the interval 2 1.5x10^18 erg/s/cm^2 are 33 galaxies/arcmin2 and ~ 4x10^-2 Mpc^-3, respectively. We find that the the observed luminosity function of LAE does not evolve from z=2 to z=6. This implies that, after correction f or the redshift dependant IGM absorption and dust, the intrinsic LF must have evolved significantly over 3 Gyr. The star formation rate density from LAE is found to be contributing about 20% of the SFRD at z = 2 -- 3 while the LAE appear to be the dominant source of star formation producing ionizing photons in the early universe z > 5 -- 6, becoming equivalent to that of Lyman Break Galaxies.

  6. SU-E-J-217: Multiparametric MR Imaging of Cranial Tumors On a Dedicated 1.0T MR Simulator Prior to Stereotactic Radiosurgery

    Energy Technology Data Exchange (ETDEWEB)

    Wen, N; Glide-Hurst, C; Liu, M; Hearshen, D; Brown, S; Siddiqui, S; Chetty, I [Henry Ford Health System, Detroit, MI (United States)

    2015-06-15

    Purpose: Quantitative magnetic resonance imaging (MRI) of cranial lesions prior to stereotactic radiosurgery (SRS) may improve treatment planning and provide potential prognostic value. The practicality and logistics of acquiring advanced multiparametric MRI sequences to measure vascular and cellular properties of cerebral tumors are explored on a 1.0 Tesla MR Simulator. Methods: MR simulation was performed immediately following routine CT simulation on a 1T MR Simulator. MR sequences used were in the order they were performed: T2-Weighted Turbo Spin Echo (T2W-TSE), T2 FLAIR, Diffusion-weighted (DWI, b = 0, 800 to generate an apparent diffusion coefficient (ADC) map), 3D T1-Weighted Fast Field Echo (T1W-FFE), Dynamic Contrast Enhanced (DCE) and Post Gadolinium Contrast Enhanced 3D T1W-FFE images. T1 pre-contrast values was generated by acquiring six different flip angles. The arterial input function was derived from arterial pixels in the perfusion images selected manually. The extended Tofts model was used to generate the permeability maps. Routine MRI scans took about 30 minutes to complete; the additional scans added 12 minutes. Results: To date, seven patients with cerebral tumors have been imaged and tumor physiology characterized. For example, on a glioblastoma patient, the volume contoured on T1 Gd images, ADC map and the pharmacokinetic map (Ktrans) were 1.9, 1.4, and 1.5 cc respectively with strong spatial correlation. The mean ADC value of the entire volume was 1141 μm2/s while the value in the white matter was 811 μm2/s. The mean value of Ktrans was 0.02 min-1 in the tumor volume and 0.00 in the normal white matter. Conclusion: Our initial results suggest that multiparametric MRI sequences may provide a more quantitative evaluation of vascular and tumor properties. Implementing functional imaging during MR-SIM may be particularly beneficial in assessing tumor extent, differentiating radiation necrosis from tumor recurrence, and establishing reliable bio-markers for treatment response evaluation. The Department of Radiation Oncology at Henry Ford Health System has research agreement with Varian Medical System and Philips Health Care.

  7. Post irradiation fatigue tests of type 316 LN stainless steel. Final report for the ITER Task T511, Subtask 1. European Technology Programme Task GB5-T217

    International Nuclear Information System (INIS)

    The main objective of this Subtask was to estimate the corrosion fatigue behaviour of 316L Stainless Steel (SS) and SS/SS joints, and to check among others the influence of irradiation. Joints were produced by solid Hot Isostatic Pressure (HIP) and powder HIP. Conventional material was used for comparison. The specimens were supplied by EFDA and were irradiated to 4 dpa in Dimitrovgrad (Russia). All specimens were tested at 150 deg C in hydrogenated high purity water. Testing was performed with a stepwise decrease in ΔK keeping Kmax constant. The crack growth rates of irradiated as well as unirradiated specimens tested earlier are of the same magnitude, around 2x10-5 mm/cycle at ΔK= 18 MPa√m. Thus, irradiation does not seem to enhance the fatigue crack growth rate, at least not up to irradiation levels of 4 dpa. But it is worth noting that the exponents in the da/dN versus ΔK equation, also known as Paris' law, seems to fall within two areas, either around 3.5 or just below 2. Both Powder HIPed and Solid HIPed specimens are found in both groups. The reason for this is not evident. The fracture surfaces of the specimens show typical fatigue appearance

  8. SU-E-J-217: Accuracy Comparison Between Surface and Volumetric Registrations for Patient Setup of Head and Neck Radiation Therapy

    International Nuclear Information System (INIS)

    Purpose: Optical surface imaging has been applied to radiation therapy patient setup. This study aims to investigate the accuracy of the surface registration of the optical surface imaging compared with that of the conventional method of volumetric registration for patient setup in head and neck radiation therapy. Methods: Clinical datasets of planning CT and treatment Cone Beam CT (CBCT) were used to compare the surface and volumetric registrations in radiation therapy patient setup. The Iterative Closest Points based on point-plane closest method was implemented for surface registration. We employed 3D Slicer for rigid volumetric registration of planning CT and treatment CBCT. 6 parameters of registration results (3 rotations and 3 translations) were obtained by the two registration methods, and the results were compared. Digital simulation tests in ideal cases were also performed to validate each registration method. Results: Digital simulation tests showed that both of the registration methods were accurate and robust enough to compare the registration results. In experiments with the actual clinical data, the results showed considerable deviation between the surface and volumetric registrations. The average root mean squared translational error was 2.7 mm and the maximum translational error was 5.2 mm. Conclusion: The deviation between the surface and volumetric registrations was considerable. Special caution should be taken in using an optical surface imaging. To ensure the accuracy of optical surface imaging in radiation therapy patient setup, additional measures are required. This research was supported in part by the KIST institutional program (2E24551), the Industrial Strategic technology development program (10035495) funded by the Ministry of Trade, Industry and Energy (MOTIE, KOREA), and the Radiation Safety Research Programs (1305033) through the Nuclear Safety and Security Commission, and the NIH (R01EB016777)

  9. 26 CFR 1.217-1 - Deduction for moving expenses paid or incurred in taxable years beginning before January 1, 1970.

    Science.gov (United States)

    2010-04-01

    ...-month period and who teaches on a full-time basis for more than 6 months in fulfillment of such contract.... After working full-time for 30 weeks his job is terminated, and he subsequently moves to and secures... reimbursed $600 by M. After working for M for a period of 3 months, A becomes dissatisfied with the job...

  10. Diagnostic value of a new myocardial perfusion agent, teboroxime (SO 30,217), utilizing a rapid planar imaging protocol: Preliminary results

    International Nuclear Information System (INIS)

    Technetium-99m-labeled agents have advantages over thallium-201 in terms of photon statistics, cost and clinical availability. They have been suggested as an alternative to thallium for myocardial perfusion imaging. Teboroxime is a new boronic acid adduct of technetium dioxime (BATO) compound that demonstrates favorable characteristics in preliminary studies. With use of a novel (seated) patient positioning technique and a rapid dynamic acquisition protocol, 30 patients underwent planar imaging with teboroxoime while at rest and after maximal treadmill exercise. Postexercise scans were completed in an average time (mean +/- SD) of 4.4 +/- 1.6 min, with 4.8 +/- 1.5 min for the views at rest. These results were compared with coronary arteriography or thallium scintigraphy after treadmill exercise, or both. Diagnostic agreement (abnormal versus normal) was present in 28 of the 30 patients (p less than 0.001). Regarding physiologic assessment as compared with thallium scintigraphy, the finding of infarction and ischemia was concordant in 89% and 86% of patients, respectively. This report describes the initial use of teboroxime with a rapid dynamic planar imaging technique, resulting in a high correlation with exercise thallium scintigraphy. Delayed postexercise images obtained 5 to 10 min after exercise demonstrated rapid disappearance of exercise-induced defects noted on the initial (0 to 5 min) postexercise views. The rapid differential washout with teboroxime has not been previously described and the possible clinical significance is discussed

  11. Diagnostic value of a new myocardial perfusion agent, teboroxime (SQ 30,217), utilizing a rapid planar imaging protocol: Preliminary results

    Energy Technology Data Exchange (ETDEWEB)

    Hendel, R.C.; McSherry, B.; Karimeddini, M.; Leppo, J.A. (Univ. of Massachusetts Medical Center, Worcester (USA))

    1990-10-01

    Technetium-99m-labeled agents have advantages over thallium-201 in terms of photon statistics, cost and clinical availability. They have been suggested as an alternative to thallium for myocardial perfusion imaging. Teboroxime is a new boronic acid adduct of technetium dioxime (BATO) compound that demonstrates favorable characteristics in preliminary studies. With use of a novel (seated) patient positioning technique and a rapid dynamic acquisition protocol, 30 patients underwent planar imaging with teboroxime while at rest and after maximal treadmill exercise. Postexercise scans were completed in an average time (mean +/- SD) of 4.4 +/- 1.6 min, with 4.8 +/- 1.5 min for the views at rest. These results were compared with coronary arteriography or thallium scintigraphy after treadmill exercise, or both. Diagnostic agreement (abnormal versus normal) was present in 28 of the 30 patients (p less than 0.001). Regarding physiologic assessment as compared with thallium scintigraphy, the finding of infarction and ischemia was concordant in 89% and 86% of patients, respectively. This report describes the initial use of teboroxime with a rapid dynamic planar imaging technique, resulting in a high correlation with exercise thallium scintigraphy. Delayed postexercise images obtained 5 to 10 min after exercise demonstrated rapid disappearance of exercise-induced defects noted on the initial (0 to 5 min) postexercise views. The rapid differential washout with teboroxime has not been previously described and the possible clinical significance is discussed.

  12. Diagnostic value of a new myocardial perfusion agent, teboroxime (SO 30,217), utilizing a rapid planar imaging protocol: Preliminary results

    Energy Technology Data Exchange (ETDEWEB)

    Hendel, R.C.; McSherry, B.; Karimeddini, M.; Leppo, J.A. (Univ. of Massachusettes Medical Center, Worcester (USA))

    1990-11-01

    Technetium-99m-labeled agents have advantages over thallium-201 in terms of photon statistics, cost and clinical availability. They have been suggested as an alternative to thallium for myocardial perfusion imaging. Teboroxime is a new boronic acid adduct of technetium dioxime (BATO) compound that demonstrates favorable characteristics in preliminary studies. With use of a novel (seated) patient positioning technique and a rapid dynamic acquisition protocol, 30 patients underwent planar imaging with teboroxoime while at rest and after maximal treadmill exercise. Postexercise scans were completed in an average time (mean +/- SD) of 4.4 +/- 1.6 min, with 4.8 +/- 1.5 min for the views at rest. These results were compared with coronary arteriography or thallium scintigraphy after treadmill exercise, or both. Diagnostic agreement (abnormal versus normal) was present in 28 of the 30 patients (p less than 0.001). Regarding physiologic assessment as compared with thallium scintigraphy, the finding of infarction and ischemia was concordant in 89% and 86% of patients, respectively. This report describes the initial use of teboroxime with a rapid dynamic planar imaging technique, resulting in a high correlation with exercise thallium scintigraphy. Delayed postexercise images obtained 5 to 10 min after exercise demonstrated rapid disappearance of exercise-induced defects noted on the initial (0 to 5 min) postexercise views. The rapid differential washout with teboroxime has not been previously described and the possible clinical significance is discussed.

  13. Effects of diabetes definition on global surveillance of diabetes prevalence and diagnosis: pooled analysis of 82 population-based studies with 217,000 participants

    OpenAIRE

    Danaei, Goodarz; Fahimi, Saman; Lu, Yuan; Zhou, Bin; Hajifathalian, Kaveh; Di Cesare, Mariachiara; Ezzati, Majid; NCD-RisC, Group

    2015-01-01

    Background: Diabetes has been defi ned on the basis of different biomarkers, including fasting plasma glucose (FPG), 2-h plasma glucose in an oral glucose tolerance test (2hOGTT), and HbA1c. We assessed the effect of different diagnostic definitions on both the population prevalence of diabetes and the classifi cation of previously undiagnosed individuals as having diabetes versus not having diabetes in a pooled analysis of data from population-based health examination surveys in ...

  14. The crystal structure of franckeite, Pb21.7Sn9.3Fe4.0Sb8.1S56.9

    DEFF Research Database (Denmark)

    Makovicky, Emil; Petricek, Vaclav; Dusek, Michal; Topa, Dan

    layer (M = Sn4+, Fe2+) with a = 3.665(8), b = 6.2575(16), c = 17.419(5) Å, a = 95.25(2)°, ß = 95.45(2)°, ¿ = 89.97(2)°; the modulation vector is q = –0.00087(8) a* + 0.13725(16) b* – 0.0314(4) c*. The a and b vectors of both subsystems are parallel; the c vectors diverge. (3+2)D superspace refinement...... forms a homologous pair with cylindrite, which has thinner Q slabs. The Q slabs in franckeite are four atomic layers thick. The two components have their own lattices and a common modulation. The Q slab of the refined franckeite structure, Pb21.74Sn9.34Fe3.95Sb8.08S56.87, is an MS layer (M = Pb2+, Sn2......+, Sb3+) four atomic planes thick, with a = 5.805(8), b = 5.856(16) Å, and the layer-stacking vector c = 17.338(5) Å. The lattice angles are a = 94.97(2)°, ß = 88.45(2)°, ¿ = 89.94(2)°; the modulation vector q = –0.00129(8) a* + 0.128436(10) b* – 0.0299(3) c*. The H layer is a single-octahedron MS2...

  15. The Impact of Education On Fertility and Child Mortality: Do Fathers Really Matter Less than Mothers? OECD Development Centre Working Paper, No. 217 (Formerly Webdoc No. 5)

    Science.gov (United States)

    Breierova, Lucia; Duflo, Esther

    2003-01-01

    This paper takes advantage of a massive school construction program that took place in Indonesia between 1973 and 1978 to estimate the effect of education on fertility and child mortality. Time and region varying exposure to the school construction program generates instrumental variables for the average education in the household, and the…

  16. PS2-17: Diabetes Social Support Feasibility Pilot Study: Utilizing Mobile Technology and Self-Identified Supporters to Enhance Self-Monitoring of Blood Glucose

    OpenAIRE

    Robinson, Brandi; Roblin, Douglas; Hipkens, James; Vupputuri, Suma; McMahon, Kevin

    2010-01-01

    Background and Aims: Self-monitoring of blood glucose (SMBG) is associated with improved glycemic control among patients with type 2 diabetes, however, the practice of daily self-monitoring is not optimal. Telecommunications technology may improve adherence to recommended self-management practices by remotely transmitting automated reminders to motivate patients, and utilizing social networking for peer support. The purpose of this pilot study is to demonstrate the feasibility and usability o...

  17. Coeliac disease: characterisation of monoclonal antibodies raised against a synthetic peptide corresponding to amino acid residues 206-217 of A-gliadin.

    OpenAIRE

    Ellis, H. J.; Doyle, A. P.; Sturgess, R P; Ciclitira, P J

    1992-01-01

    A dodecapeptide of A-gliadin, which shares amino acid homologies with the E1b protein of adenovirus 12, was used to produce murine monoclonal antibodies. Five monoclonal antibodies were produced and were screened by enzyme linked immunosorbant assay, immunodot assay, and immunoblotting. The antibodies were tested against whole wheat gliadin and its alpha, beta, gamma, and omega subfractions, and the prolamins of rye, barley, oats, maize, millet, rice, and sorghum. Four of the five antibodies ...

  18. Shelf-life of ɛ-lysyl-3-(trimethylstannyl)benzamide immunoconjugates, precursors for 211At labeling of antibodies

    DEFF Research Database (Denmark)

    Aneheim, Emma; Halleröd, Jenny; Albertsson, Per;

    2015-01-01

    Astatine-211 is possibly the most promising radionuclide for targeted α-particle therapy when it comes to the treatment of occult disseminated cancer. Preclinical research has proven effective, and patient studies have been initiated based on these results. However, a lack of production capacity ...

  19. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  20. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    International Nuclear Information System (INIS)

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons

  1. Separation of 211At from irradiated bismuth target and labelling of a model protein

    International Nuclear Information System (INIS)

    Astatine-211 is a promising radionuclide for therapeutic use in nuclear medicine. An efficient method (70%) for radiochemical separation from the irradiated Bi-target has been described. The level of Bi contamination in the purified 2'11At-solution was estimated. Finally labelling of a model protein has been tried. (author). 14 refs

  2. Ulnar ray defect in an infant with a 6q21;7q31.2 translocation: Further evidence of the existence of a limb defect gene in 6q21

    Energy Technology Data Exchange (ETDEWEB)

    Gurrieri, F.; Genuardi, M.; Pomponi, M.G. [Universita di Palermo (Italy)] [and others

    1995-01-30

    Ectrodactyly is a developmental defect of the distal limbs characterized by marked clinical variability and genetic heterogeneity, also reflected in the observation of different chromosome abnormalities nonrandomly associated with longitudinal postaxial limb deficiencies. The one most frequently found in patients with split hand-split foot (SHSF) involves chromosome band 7q22. Recently, structural anomalies of chromosome 6q21 have been reported in 2 unrelated patients with SHSF, suggesting that this region may also contain genes responsible for limb development. We report on a third patient who had a de novo, apparently balanced t(6;7)(q21;q31.2) translocation and bilateral ulnar aplasia with postaxial oligodactyly. In spite of the different phenotypic effects observed in these 3 patients, we consider our case as further evidence that genes in 6q21 may play a role in distal limb development. 8 refs., 3 figs.

  3. CTD data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT208-217 during 2009 (NODC Accession 0068957)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  4. Thermosalinograph data of the Hawaii Ocean Time-series (HOT) program in the North Pacific, 100 Miles North of Oahu, Hawaii for cruises HOT208-217 during 2009 (NODC Accession 0069501)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  5. Niskin bottle data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT208-217 during 2009 (NODC Accession 0069177)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  6. The crystal structure of franckeite, Pb.sub.21.7./sub.Sn.sub.9.3./sub.Fe.sub.4.0./sub.Sb.sub.8.1./sub.S.sub.56.9./sub..

    Czech Academy of Sciences Publication Activity Database

    Makovicky, E.; Petříček, Václav; Dušek, Michal; Topa, D.

    2011-01-01

    Roč. 96, 11-12 (2011), s. 1686-1702. ISSN 0003-004X Grant ostatní: AVČR(CZ) Praemium Academiae Institutional research plan: CEZ:AV0Z10100521 Keywords : franckeite * Pb-Sn-Sb-Fe sulfide * modulated layer-misfit crystal structure * 2D–non-commensurate layer structure Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.169, year: 2011

  7. Nanostructured crystals of fluorite phases Sr1-xRxF2+x (R are rare-earth elements) and their ordering: IV. Study of the optical transmission spectra in the 2-17-μm wavelength range

    International Nuclear Information System (INIS)

    Transmission spectra of two-component crystals of Sr1-xRxF2+x (R = Y, La-Lu; 0 ≤ x ≤ 0.5) in the 1-17-μm wavelength range were studied. The spectral characteristics of these crystals and of single-component crystals of MF2 (M = Ca, Sr, or Ba) and RF3 (R = La-Nd) were compared. The transmission cutoff of Sr1-xRxF2+x crystals is shifted to shorter wavelengths with increasing x. The same tendency is observed with the increasing atomic number R of rare-earth elements for two isoconcentration series of Sr1-xRxF2+x (x ∼ 0.10 and 0.28). This tendency is pronounced at large x. The transmission cutoff of Sr1-xRxF2+x crystals can be varied in the range of from 10.7 to 12.2 μm by changing their qualitative (R) and quantitative (x) composition. Hence, these crystals can be assigned to multicomponent fluoride optical materials with controlled optical characteristics. The Sr1-xRxF2+x crystals, where R = Ce-Sm, were shown to be promising materials for the design of selective optical filters in the 2-10-μm spectral range.

  8. Hurdles for a Broader Use of 211At and for the Synthesis of 211At-Labelled Radiopharmaceuticals at High Activities for Clinical Use

    International Nuclear Information System (INIS)

    One of the key impediments to the use of 211At is the very well known deleterious effect of high radiation fields caused by its alpha particles on the synthesis of 211At-labelled radiopharmaceuticals. This is problematic because radiolysis-mediated effects can produce diminishing efficiency of electrophilic astatination reactions due to increasing deposition of radiation dose with increasing activities and with the passage of the time. Astatine-211 has chemical properties that permit complex labelling strategies and a longer half-life than 213Bi that makes it more suitable when the targeting molecule does not gain immediate access to the tumour cells. The first clinical evaluation was published in 2001 [2] in patients with brain tumour. Although this study circumvents many of the challenges to entering clinical studies with 211At and many obstacles had to be surmounted before clinical studies could be initiated, several problems were encountered in maintaining efficient labelling with escalating radiation dose of α-particle even with fresh 211At elution [3]. Astatine-211 also has an additional hurdle to overcome before to its clinical application in labelled radiopharmaceuticals related with its production and distribution. Among the potential group of promising α- emitter it is the only one produced by cyclotrons, but due to the scarcity of cyclotrons equipped with 25−30 MeV α-particle beams, it will of necessity be utilized in distant locations from the site of production. It presents a major chemical challenge because the diminishing efficiency of electrophilic astatination reactions with the passage of the time is well known, a problem likely related to the radiolysis produced by the high LET (linear energy transfer) meaning that large amounts of energy are deposited in a highly localized manner. This problem has been most comprehensively investigated to understand and evaluate the role of the radiolysis effects of astatine alpha particles in the synthesis

  9. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  10. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita

    2011-01-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  11. Radiopharmaceutical Chemistry of Targeted Radiopharmaceutics. Synthesis of 211At-Labeled Radiopharmaceuticals at High Activities for Clinical Use

    International Nuclear Information System (INIS)

    Targeted α-particle radiotherapy is an appealing approach to cancer treatment because of the potential for delivering curative doses of radiation to tumor with minimal damage to normal tissue due to a range equivalent to only a few cell diameters. Compared with β-emitters they have significant advantages from a radiobiological perspective. The LET of 211At α-particles is more than 400 times higher than the β-particles emitted by 90Y, in addition the distance between ionizing events is almost the same as that between the two strands of DNA, yielding a high probability of creating non-repairable DNA damage. It gives the ability to kill cancer cells not compromised by hypoxia, dose rate effects or cell cycle position, enhancing their attractiveness for targeted radiotherapy. However, translation of the concept to the clinic has been slow, many obstacles had to be surmounted before clinical studies could be initiated, the first clinical evaluation of a 211At- labeled mAb was made in 2001. This study circumvents many of the challenges to entering clinical studies with 211At. But several problems were encountered in maintaining efficient labeling with escalating radiation dose of alpha-particle likely related to radiolysis. The impact of the radiolysis produced by the α-particle over the labeling chemistry is much higher in comparison with typical β-emitters due to a deposition of energy in the solvent in a highly localized manner two orders of magnitude per unit volume higher than 90Y or 131I. Due to these difficulties a comprehensive basic science study about the radiolytic effects of astatine alpha-particles over the synthesis of 211At-labeled radiopharmaceuticals was carried out. Its main goal was overcoming the problem of the synthesis of 211At-labeled radiopharmaceuticals at the high activities necessaries for therapy and also to extend the shelf life of astatine elutions. Briefly this study held several steps, the first one was to study the role of solvent

  12. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    International Nuclear Information System (INIS)

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on 211At and 124I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[211At]astato-2'-deoxyuridine (AUdR) and N-succinimidyl-4-[211At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [124I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[124I]iodo-2'-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for radioiodination of macromolecules

  13. Synthesis and characterization of NiFe2O4 electrocatalyst for the hydrogen evolution reaction in alkaline water electrolysis using different polymer binders

    Czech Academy of Sciences Publication Activity Database

    Chanda, D.; Hnát, J.; Paidar, M.; Schauer, Jan; Bouzek, K.

    2015-01-01

    Roč. 285, 1 July (2015), s. 217-226. ISSN 0378-7753 Institutional support: RVO:61389013 Keywords : alkaline water electrolysis * spinel oxides * polymer binder Subject RIV: CG - Electrochemistry Impact factor: 6.217, year: 2014

  14. 211At production and recovery: first results of a new start

    International Nuclear Information System (INIS)

    Full text: 211At is the only alpha-emitting isotope which can be introduced into organic molecular structures by covalent chemical binding and possesses superior decay characteristics for therapeutic applications when compared with other alpha emitters. However, its production requires a minimum of 27,5 MeV alpha-particles, which are relatively rarely available. In view of the revival of alpha-therapy approaches a production of 211At has been set up at the MHH cyclotron (MC-35). The first aim of this project was to establish a target- and work-up-system for the reliable production of several ten MBq-quantities of 211At for animal- and cell-research. An aluminum-target-system holds a 1.3 cm diameter Bi-disc of 0.25 mm thickness. The disk is pressed onto a the aluminum backing with 2 tons/cm2. The front is covered with a 125 μm Al foil, cooled by a He jet which is separated from the vacuum by a 250 μm Ti foil. Starting with 27.5 MeV alpha-particles the resulting target-energy is 25 MeV. This relatively low energy is chosen to avoid any contamination with 210At and 210Po in the first experimental period. A beam current of 10 μA for 15 min (9 mCoulomb) yields 16.4 MBq 211At theoretically. Astatine is recovered from the target by a dry distillation technique, using various gases as a transport support-medium. The small all-quartz distillation-apparatus is heated up to 900 oC. Astatine is recovered in a small cool able vessel containing various trapping media. Distillation and trapping can be monitored with small radioactivity monitors. The whole system fits in a cubical 0.5 m glove box. Continuous monitoring of the distillation process allowed to optimize the heating rate, the transport support-medium and its flow-rate. Various trapping solutions were tested for their efficiency. Different beam dispersion in the target seems to influence the release and distillation of astatine from the molten bismuth-target. Two different release patterns were observed. The first

  15. Inclusive measurement of (p,πsup(-)xn) double charge exchange reactions on bismuth from threshold to 800 MeV

    International Nuclear Information System (INIS)

    The energy dependence of the total angle-integrated cross section for the production of astatine isotopes from (p,πsup(-)xn) double charge exchange reactions on bismuth (sup(209)Bi) was measured from 120 to 800 MeV using activation and radiochemical techniques. Chemical yields were estimated by direct radioassaying of sup(211)At activity in thin (approximately 1 mg/cmsup(2)), irradiated bismuth targets. Calculations of the contributions of secondary (2-step) reactions to these measured astatine yields were performed, based partially upon the observed sup(211)At activity although even at the highest energies, the contribution to products lighter than sup(207)At was negligible. These data for products with as many as 7 neutrons removed from the doubly coherent product (sup(210)At) display nearby gaussian shapes for the mass distributions of the astatine residues with the maximum occurring for about sup(204)At. The most probable momentum transfer deduced from these distributions for the initial πsup(-) production step was 335 MeV/c. The observed excitation functions display a behaviour similar to that observed for the yield of sup(210)Po from a (p,πsup(O)) reaction on sup(209)Bi, but radically different from that observed for inclusive πsup(-) reactions on a heavy nucleus. These data are discussed in terms of recent theoretical approaches to negative pion production from bismuth. In addition, a simple, schematic model is developed to treat the rapidly decreasing percentage of the total inclusive πsup(-) emission which is observed for this double charge exchange reaction. This model reflects the capacity of a nucleus to a source of internal energetic protons

  16. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    OpenAIRE

    BAYRAM, Ali

    1998-01-01

    In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 1...

  17. Human radiation studies: Remembering the early years: Oral history of Dr. Patricia Wallace Durbin, Ph.D., conducted November 11, 1994

    International Nuclear Information System (INIS)

    This report is a transcript of an interview of Dr. Patricia Wallace Durbin by representatives of the US DOE Office of Human Radiation Research. Dr. Durbin was selected for this interview because of her knowledge of the human plutonium injections and her recollections of key figures, especially Joseph Hamilton. After a brief biographical sketch Dr. Durbin discusses her loss of research funding from DOE, her recollections concerning research into strontium metabolism as part of Project Sunshine, her recollections relating to the rationale for studies of human metabolism of radionuclides, her remembrances of Dr. Hamilton's Astatine and Plutonium research, and her experiences in gathering archival records concerning these researches

  18. Grupo de Estudios en Historia de las Ciencias, GEHC (Editores). Control Social y Objetivación : escrituras y tránsitos de las Ciencias en Chile, Universidad de Chile, Santiago de Chile, 2012. 217 p.

    OpenAIRE

    Pincheira Torres, Ivan

    2012-01-01

    Las articulaciones existentes entre discurso científico y prácticas de gobierno no han quedado fuera del campo de problematización de los estudios sociales latinoamericanos. De este modo, y aunque se ubiquen en distintas matrices de análisis, nos encontramos con distintos trabajos que van a reconocer la relevante labor desempeñada por las epistemologías europeas en la conformación de prácticas de gobierno que, actuando sobre estructuras tanto subjetivas como sociales, perpetuarán relaciones d...

  19. Dicty_cDB: Contig-U14370-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available n 73 Query: 74 ggtattgntgaaactgaattactatcncataatnaatccnatgaaaaagttttnnacnca 133 ||||||||||||||||||||||||||||...|||||||||||||||||||||||||||||||| Sbjct: 74 ggtattgntgaaactgaattactatcncataatnaatccnatgaaaaagttttnnacnca 133 ...||||| Sbjct: 217 tcaaatacaattaaaaaanaagntgntcnaaaaaatgtnagagtaatgatnatttccccn 158 Query: 74 ggtattgntgaaactgaattactatcncataatnaatccna...|||||||||||||||||||||||||||| Sbjct: 157 ggtattgntgaaactgaattactatcncataatnaatccnatgaaaaagttttnnacnca 98 Quer

  20. Sorption and degradation of 17ß-estradiol-17-sulfate in sterilized soil-water systems

    Science.gov (United States)

    To identify abiotic processes that govern the fate of a sulfate conjugated estrogen, 17ß-estradiol-17-sulfate (E2-17S), soil batch experiments were conducted to investigate the dissipation, sorption, and degradation of radiolabeled E2-17S under sterilized conditions. The aqueous dissipation half-liv...

  1. 76 FR 14587 - Defense Federal Acquisition Regulation Supplement; Multiyear Contract Authority for Electricity...

    Science.gov (United States)

    2011-03-17

    ... rule at 75 FR 34942 on June 21, 2010, to amend DFARS parts 217 and 241 to authorize the Department of... the approach described in the interim rule published at 75 FR 34942 on June 21, 2010, to be the most... Accordingly, the interim rule amending 48 CFR parts 217 and 241, which was published at 75 FR 34942 on June...

  2. Benthic harpacticoid copepod community of Saphala salt marsh along the west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Ingole, B.S.; Ansari, Z.A; Parulekar, A

    stream_size 4 stream_content_type text/plain stream_name Indian_J_Mar_Sci_19_217.pdf.txt stream_source_info Indian_J_Mar_Sci_19_217.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  3. Biochemical composition of zooplankton from the northern Arabian Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Bhat, K.L.; Sreepada, R; Ansari, Z.A.

    stream_size 7 stream_content_type text/plain stream_name Pak_J_Mar_Sci_2_17.pdf.txt stream_source_info Pak_J_Mar_Sci_2_17.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  4. 26 CFR 1.1232-3A - Inclusion as interest of original issue discount on certain obligations issued after May 27, 1969.

    Science.gov (United States)

    2010-04-01

    ... of the Federal Reserve. See 12 CFR 217.4(d). The stated redemption price at maturity is $13,382.26..., Regulation Q of the Board of Governors of the Federal Reserve System. See 12 CFR 217.4(d). Interest will be... 26 Internal Revenue 11 2010-04-01 2010-04-01 true Inclusion as interest of original issue...

  5. Mrp2 is essential for estradiol-17 beta(beta-D-glucuronide)-induced cholestasis in rats

    NARCIS (Netherlands)

    Huang, LY; Smit, JW; Meijer, DKF; Vore, M

    2000-01-01

    The present study evaluates the roles of the multidrug resistance-1 P-glycoprotein, Mdr1a/1b, the bile salt export pump (Bsep), and the multidrug resistance-associated protein-2 (Mrp2) in mediating cholestasis induced by estradiol-17 beta(beta-D-glucuronide) (E(2)17G). Administration of [H-3]E(2)17G

  6. EST Table: FS909084 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS909084 E_FL_fufe_16C18_F_0 10/09/28 56 %/217 aa ref|XP_001653706.1| glutathione s...ynthetase [Aedes aegypti] gb|EAT39012.1| glutathione synthetase [Aedes aegypti] 10/09/12 54 %/217 aa FBpp024

  7. AcEST: DK958261 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0030_I16 655 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0030_I16. 5' end seq ... 217 (93%) Frame = +3 Query: 3 GIRFFQLYVYKDRNVVAQLVRRAE KAGFRAIALTVDTPRLGRREADIKNRFVLPPHLTLK 182 GIRFFQLYVY ... KDRNVVAQLVRRAE +AGF+AIALTVDTPRLGRREADIKNRFVLPP LTLK Sbjct: 122 GIR ... FFQLYVYKDRNVVAQLVRRAE RAGFKAIALTVDTPRLGRREADIKNRFVLPPFLTLK 181 Query: 183 ... 217 (93%) Frame = +3 Query: 3 GIRFFQLYVYKDRNVVAQLVRRAE KAGFRAIALTVDTPRLGRREADIKNRFVLPPHLTLK 182 GIRFFQLYVY ...

  8. EST Table: BY915709 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available %/217 aa ref|XP_001846858.1| spectrin beta chain [Culex quinquefasciatus] gb|EDS44827.1| spectrin beta chain... gnl|Amel|GB11407-PA 10/09/10 90 %/217 aa gi|91081397|ref|XP_976147.1| PREDICTED: similar to beta chain spectrin isoform 2 [Tribolium castaneum] BY915709 maV3 ...

  9. 36 CFR 251.85 - Election of appeal process.

    Science.gov (United States)

    2010-07-01

    ... under the provisions of 36 CFR part 217 may intervene pursuant to 36 CFR 217.6(b). ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Election of appeal process... Election of appeal process. (a) No decision can be appealed by the same person under both this subpart...

  10. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    Directory of Open Access Journals (Sweden)

    Ali BAYRAM

    1998-03-01

    Full Text Available In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 10, 50 and 259 mm/min. Strength properties of dual-phase steels were investigated depending on annealing temperature, ratio of martensite and loading rate.

  11. A route for polonium 210 production from alpha-particle irradiated bismuth-209 target

    International Nuclear Information System (INIS)

    A method is proposed for production of polonium-210 via the 209Bi(α,3n)210 At nuclear reaction. Bombardment of a bismuth-209 target was performed with a 37 MeV alpha-particle beam that leads to the production of astatine-210 (T1/2 = 8.1 h), which decays to polonium-210. It is purified from the bismuth target matrix by employing liquid-liquid extraction using tributyl phosphate (TBP) in para-xylene from 7 M hydrochloric acid. Back extraction of polonium-210 was performed by 9 M nitric acid. This method allows to purify a tracer amount of Po-210 (2.6 x 10-13 mol) from macroscopic amount of Bi (2.8 x 10-2 mol).

  12. Effective bond orders from two-step spin–orbit coupling approaches: The I{sub 2}, At{sub 2}, IO{sup +}, and AtO{sup +} case studies

    Energy Technology Data Exchange (ETDEWEB)

    Maurice, Rémi, E-mail: remi.maurice@subatech.in2p3.fr; Montavon, Gilles [SUBATECH, CNRS UMR 6457, IN2P3/EMN Nantes/Université de Nantes, 4 rue Alfred Kastler, BP 20722, 44307 Nantes Cedex 3 (France); Réal, Florent; Gomes, André Severo Pereira; Vallet, Valérie [Laboratoire PhLAM, CNRS UMR 8523, Université de Lille, 59655 Villeneuve d’Ascq Cedex (France); Galland, Nicolas [CEISAM, UMR CNRS 6230, Université de Nantes, 2 rue de la Houssinière, BP 92208, 44322 Nantes Cedex 3 (France)

    2015-03-07

    The nature of chemical bonds in heavy main-group diatomics is discussed from the viewpoint of effective bond orders, which are computed from spin–orbit wave functions resulting from spin–orbit configuration interaction calculations. The reliability of the relativistic correlated wave functions obtained in such two-step spin–orbit coupling frameworks is assessed by benchmark studies of the spectroscopic constants with respect to either experimental data, or state-of-the-art fully relativistic correlated calculations. The I{sub 2}, At{sub 2}, IO{sup +}, and AtO{sup +} species are considered, and differences and similarities between the astatine and iodine elements are highlighted. In particular, we demonstrate that spin–orbit coupling weakens the covalent character of the bond in At{sub 2} even more than electron correlation, making the consideration of spin–orbit coupling compulsory for discussing chemical bonding in heavy (6p) main group element systems.

  13. Effective bond orders from two-step spin–orbit coupling approaches: The I2, At2, IO+, and AtO+ case studies

    International Nuclear Information System (INIS)

    The nature of chemical bonds in heavy main-group diatomics is discussed from the viewpoint of effective bond orders, which are computed from spin–orbit wave functions resulting from spin–orbit configuration interaction calculations. The reliability of the relativistic correlated wave functions obtained in such two-step spin–orbit coupling frameworks is assessed by benchmark studies of the spectroscopic constants with respect to either experimental data, or state-of-the-art fully relativistic correlated calculations. The I2, At2, IO+, and AtO+ species are considered, and differences and similarities between the astatine and iodine elements are highlighted. In particular, we demonstrate that spin–orbit coupling weakens the covalent character of the bond in At2 even more than electron correlation, making the consideration of spin–orbit coupling compulsory for discussing chemical bonding in heavy (6p) main group element systems

  14. Different ways to improve the clinical effectiveness of radioimmunotherapy in solid tumors

    Directory of Open Access Journals (Sweden)

    Chatal Jean-Francois

    2009-09-01

    Full Text Available Radioimmunotherapy (RIT has been proven effective in the treatment of radiosensitive non-Hodgkin lymphoma but, for radioresistant solid tumors, new approaches are necessary to improve the clinical effectiveness. A real improvement has been the introduction of the pretargeting technology which appeared to be able to significantly increase tumor-to-normal organ uptake ratios.Another very promising approach consists in associating RIT with other treatment modalities. Finally the use of alpha particle-emitting radionuclides such as astatin-211 or bismuth-213 (alpha-RIT should allow to efficiently eradicate disseminated microscopic clusters of tumor cells or isolated tumor cells which fit well with the short path length of alpha particles.

  15. Sequential radioimmunotherapy with 177Lu- and 211At-labeled monoclonal antibody BR96 in a syngeneic rat colon carcinoma model

    DEFF Research Database (Denmark)

    Eriksson, Sophie E; Elgström, Erika; Bäck, Tom;

    2014-01-01

    UNLABELLED: Alpha-particle emitters, such as astatine-211 (211At), are generally considered suitable for the treatment of small cell clusters due to their short path length, while beta-particle emitters, for example, Lutetium-177 (177Lu), have a longer path length and are considered better for...... small, established tumors. A combination of such radionuclides may be successful in regimens of radioimmunotherapy. In this study, rats were treated by sequential administration of first a 177Lu-labeled antibody, followed by a 211At-labeled antibody 25 days later. METHODS: Rats bearing solid colon...... carcinoma tumors were treated with 400 MBq/kg body weight 177Lu-BR96. After 25 days, three groups of animals were given either 5 or 10 MBq/kg body weight of 211At-BR96 simultaneously with or without a blocking agent reducing halogen uptake in normal tissues. Control animals were not given any 211At-BR96...

  16. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  17. Development of 211At Chemistry for Labelling Biomolecules

    International Nuclear Information System (INIS)

    Our studies have demonstrated that high recovery of 211At can be obtained using a “wet chemistry” approach to isolation from the bismuth target. We have also demonstrated that direct labelling of antibody-B10 conjugates with 211At can be performed in high yields, and that the astatinated antibodies are stable to in vivo deastatination. While these results will allow us to enter clinical studies with 211At-labelled antibodies, the chemistry associated with 211At is not fully understood. Therefore, it is important that many more basic studies to be conducted with 211At, so the optimal labelling reagent for each type of disease-targeting agent becomes apparent

  18. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena;

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... levels of γH2AX decreased during the first 24h in both cycling and stationary cultures and complete repair was seen in all cultures but cycling cells exposed to (211)At. Compared to stationary cells alpha particles were more harmful for cycling cultures, an effect also seen at the pChk2 levels...... cultures at a modest level of damage, clearly demonstrating that cell cycle status influences the relative effectiveness of alpha particles....

  19. Phylogenetic Analysis of Invasive Serotype 1 Pneumococcus in South Africa, 1989 to 2013.

    Science.gov (United States)

    du Plessis, Mignon; Allam, Mushal; Tempia, Stefano; Wolter, Nicole; de Gouveia, Linda; von Mollendorf, Claire; Jolley, Keith A; Mbelle, Nontombi; Wadula, Jeannette; Cornick, Jennifer E; Everett, Dean B; McGee, Lesley; Breiman, Robert F; Gladstone, Rebecca A; Bentley, Stephen D; Klugman, Keith P; von Gottberg, Anne

    2016-05-01

    Serotype 1 is an important cause of invasive pneumococcal disease in South Africa and has declined following the introduction of the 13-valent pneumococcal conjugate vaccine in 2011. We genetically characterized 912 invasive serotype 1 isolates from 1989 to 2013. Simpson's diversity index (D) and recombination ratios were calculated. Factors associated with sequence types (STs) were assessed. Clonal complex 217 represented 96% (872/912) of the sampled isolates. Following the introduction of the 13-valent pneumococcal conjugate vaccine (PCV13), ST diversity increased in children 14 years (D, 0.35 to 0.54, P 14 years (242/305 [79%] versus 96/148 [65%], P = 0.001), whereas ST-9067 increased (4/684 [0.6%] versus 24/228 [11%], P < 0.001). Three subclades were identified within ST-217: ST-217C1 (353/382 [92%]), ST-217C2 (15/382 [4%]), and ST-217C3 (14/382 [4%]). ST-217C2, ST-217C3, and single-locus variant (SLV) ST-8314 (20/912 [2%]) were associated with nonsusceptibility to chloramphenicol, tetracycline, and co-trimoxazole. ST-8314 (20/912 [2%]) was also associated with increased nonsusceptibility to penicillin (P < 0.001). ST-217C3 and newly reported ST-9067 had higher recombination ratios than those of ST-217C1 (4.344 versus 0.091, P < 0.001; and 0.086 versus 0.013, P < 0.001, respectively). Increases in genetic diversity were noted post-PCV13, and lineages associated with antimicrobial nonsusceptibility were identified. PMID:26962082

  20. Phylogenetic Analysis of Invasive Serotype 1 Pneumococcus in South Africa, 1989 to 2013

    Science.gov (United States)

    Allam, Mushal; Tempia, Stefano; Wolter, Nicole; de Gouveia, Linda; von Mollendorf, Claire; Jolley, Keith A.; Mbelle, Nontombi; Wadula, Jeannette; Cornick, Jennifer E.; Everett, Dean B.; McGee, Lesley; Breiman, Robert F.; Gladstone, Rebecca A.; Bentley, Stephen D.; Klugman, Keith P.; von Gottberg, Anne

    2016-01-01

    Serotype 1 is an important cause of invasive pneumococcal disease in South Africa and has declined following the introduction of the 13-valent pneumococcal conjugate vaccine in 2011. We genetically characterized 912 invasive serotype 1 isolates from 1989 to 2013. Simpson's diversity index (D) and recombination ratios were calculated. Factors associated with sequence types (STs) were assessed. Clonal complex 217 represented 96% (872/912) of the sampled isolates. Following the introduction of the 13-valent pneumococcal conjugate vaccine (PCV13), ST diversity increased in children 14 years (D, 0.35 to 0.54, P 14 years (242/305 [79%] versus 96/148 [65%], P = 0.001), whereas ST-9067 increased (4/684 [0.6%] versus 24/228 [11%], P < 0.001). Three subclades were identified within ST-217: ST-217C1 (353/382 [92%]), ST-217C2 (15/382 [4%]), and ST-217C3 (14/382 [4%]). ST-217C2, ST-217C3, and single-locus variant (SLV) ST-8314 (20/912 [2%]) were associated with nonsusceptibility to chloramphenicol, tetracycline, and co-trimoxazole. ST-8314 (20/912 [2%]) was also associated with increased nonsusceptibility to penicillin (P < 0.001). ST-217C3 and newly reported ST-9067 had higher recombination ratios than those of ST-217C1 (4.344 versus 0.091, P < 0.001; and 0.086 versus 0.013, P < 0.001, respectively). Increases in genetic diversity were noted post-PCV13, and lineages associated with antimicrobial nonsusceptibility were identified. PMID:26962082

  1. An improved synthesis of an 125I and 211At labelled benzamide for melanoma imaging

    International Nuclear Information System (INIS)

    Recent studies have indicated that benzamides can exhibit affinity for malignant melanoma and may be exploited diagnostically in the treatment of this cancer. Radioiodinated N-(2-diethylaminoethyl)-3-[123I/131I]iodo-4-methoxybenzamide (*I-IMBA) is a benzamide with promising diagnostic properties. A new synthesis procedure was developed to obtain 125I-IMBA suitable for use in vivo. The assets of the procedure include the use of less toxic reagents and better reproducible results when radiolabelling the precursor. The procedure also facilitates the synthesis of the astatinated N-(2-diethylaminoethyl)-3-[211At]astatine-4-methoxybenzamide (211At-AMBA), a new benzamide with a therapeutic potential. The regiospecific no-carrier-added 125I- and 211At-labeling of the benzamide is performed by demetalation of an organotin precursor. Using tributylstannyl as a leaving group, the radiochemical yield obtained after 15 minutes of reaction was 70 %-90 % for both 125I-IMBA and 211At-AMBA. The labelling was performed in a solution of MeOH:AcOH with NCS as the oxidising agent. The organotin precursor N-(2-diethylaminoethyl)-3-(tri-n-butylstannyl)-4-methoxy-benzamide was synthesized from 3-bromo-4-methoxybenzoic acid, with n-BuLi (2 eq) and Bu3SnCl (1 eq) in THF, giving 3-(tri-n-butylstannyl)-4-methoxybenzoic acid. The amide function was introduced by converting the acid group into an active N-succinimidyl-ester, a good leaving group in the reaction with 2-(diethylamino)ethylamine. The overall yield of the organotin precursor was 65 %

  2. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    Energy Technology Data Exchange (ETDEWEB)

    Marsh, B.A., E-mail: bruce.marsh@cern.ch [CERN, CH-1211 Geneva (Switzerland); Andel, B. [Comenius University, Bratislava (Slovakia); Andreyev, A.N. [University of York, Department of Physics, York YO10 5DD (United Kingdom); Antalic, S. [Comenius University, Bratislava (Slovakia); Atanasov, D. [Max-Planck-Institut für Kernphysik, Saupfercheckweg 1, 69117 Heidelberg (Germany); Barzakh, A.E. [Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, 188300 Gatchina (Russian Federation); Bastin, B. [Grand Accérateur National d’Ions Lourds (GANIL), Bd Henri Becquerel, F-14076 Caen (France); Borgmann, Ch. [Max-Planck-Institut für Kernphysik, Saupfercheckweg 1, 69117 Heidelberg (Germany); Capponi, L. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Cocolios, T.E.; Day Goodacre, T. [CERN, CH-1211 Geneva (Switzerland); University of Manchester, Manchester (United Kingdom); Dehairs, M. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Derkx, X. [University of the West of Scotland, School of Engineering, Paisley PA1 2BE (United Kingdom); De Witte, H. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fedorov, D.V. [Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, 188300 Gatchina (Russian Federation); Fedosseev, V.N.; Focker, G.J. [CERN, CH-1211 Geneva (Switzerland); Fink, D.A. [Ruprecht-Karls Universität, Seminarstr. 2, 69117 Heidelberg (Germany); CERN, CH-1211 Geneva (Switzerland); Flanagan, K.T. [University of Manchester, Manchester (United Kingdom); Franchoo, S. [CSNSM-IN2P3-CNRS, Université Paris-Sud, 91406 Orsay (France); and others

    2013-12-15

    Highlights: • Upgrade of the lasers, detectors and data acquisition for in-source resonance ionization spectroscopy at ISOLDE. • First use of the ISOLTRAP MR-ToF MS in combination with laser spectroscopy at ISOLDE. • Resonance ionization of astatine for the study of its nuclear structure. -- Abstract: At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar free ionization using the Laser Ion Source Trap, LIST (Po); isobar selective particle identification using the multi-reflection time-of-flight mass separator (MR-ToF MS) of ISOLTRAP (Au, At). These are summarized as part of an overview of the current status of the in-source resonance ionization spectroscopy setup at ISOLDE.

  3. Adjunctive levetiracetam in children, adolescents, and adults with primary generalized seizures: Open-label, noncomparative, multicenter, long-term follow-up study.

    LENUS (Irish Health Repository)

    Delanty, Norman

    2012-02-01

    Purpose: To evaluate the long-term efficacy and tolerability of adjunctive levetiracetam (LEV) in patients with uncontrolled idiopathic generalized epilepsy (IGE). Methods: This phase III, open-label, long-term, follow-up study (N167; NCT00150748) enrolled patients (4 to <65 years) with primary generalized seizures (tonic-clonic, myoclonic, absence). Patients received adjunctive LEV at individualized doses (1,000-4,000 mg\\/day; 20-80 mg\\/kg\\/day for children\\/adolescents weighing <50 kg). Efficacy results are reported for all seizure types [intention-to-treat (ITT) population, N = 217] and subpopulations with tonic-clonic (n = 152), myoclonic (n = 121), and\\/or absence (n = 70) seizures at baseline. Key Findings: One hundred twenty-five (57.6%) of 217 patients were still receiving treatment at the end of the study. Mean (standard deviation, SD) LEV dose was 2,917.5 (562.9) mg\\/day. Median (Q1-Q3) exposure to LEV was 2.1 (1.5-2.8) years, and the maximum duration was 4.6 years. Most patients were taking one (124\\/217, 57.1%) or >\\/=2 (92\\/217, 42.4%) concomitant antiepileptic drugs (AEDs). Seizure freedom of >\\/=6 months (all seizure types; primary efficacy end point) was achieved by 122 (56.2%) of 217 patients, and 49 (22.6%) of 217 patients had complete seizure freedom. Seizure freedom of >\\/=6 months from tonic-clonic, myoclonic, and absence seizures was achieved by 95 (62.5%) of 152, 75 (62.0%) of 121, and 44 (62.9%) of 70 patients, respectively. Mean (SD) maximum seizure freedom duration was 371.7 (352.4) days. At least one treatment-emergent adverse event (TEAE) was reported by 165 (76%) of 217 patients; most TEAEs were mild\\/moderate in severity, with no indication of an increased incidence over time. Seventeen (7.8%) of 217 patients discontinued medication because of TEAEs. The most common psychiatric TEAEs were depression (16\\/217, 7.4%), insomnia (9\\/217, 4.1%), nervousness (8\\/217, 3.7%), and anxiety (7\\/217, 3.2%). Significance: Adjunctive

  4. Ca2+-DEPENDENT PROTEIN KINASE C ISOFORMS ARE CRITICAL TO ESTRADIOL 17β-D-GLUCURONIDE-INDUCED CHOLESTASIS IN THE RAT

    OpenAIRE

    Crocenzi, Fernando A.; Enrique J Sánchez Pozzi; Ruiz, María Laura; Zucchetti, Andrés E.; Roma, Marcelo G.; Mottino, Aldo D.; Vore, Mary

    2008-01-01

    The endogenous estradiol metabolite estradiol 17β-D-glucuronide (E217G) induces an acute cholestasis in rat liver coincident with retrieval of the canalicular transporters Bsep (Abcc11) and Mrp2 (Abcc2) and their associated loss of function. We assessed the participation of Ca2+-dependent PKC isoforms (cPKC) in the cholestatic manifestations of E217G in the perfused rat liver (PRL) and in isolated rat hepatocyte couplets (IRHC). In the PRL, E217G (2 μmol/liver; intraportal, single injection) ...

  5. IgA Nephropathy: Molecular Mechanisms of the Disease

    Czech Academy of Sciences Publication Activity Database

    Městecký, Jiří; Raška, M.; Julian, B. A.; Gharavi, A. G.; Renfrow, M. B.; Moldoveanu, Z.; Novák, L.; Matoušovič, K.

    2013-01-01

    Roč. 8, č. 2013 (2013), s. 217-240. ISSN 1553-4006 Institutional support: RVO:61388971 Keywords : O-glycosylation * hinge region * circulating immune complexes Subject RIV: EC - Immunology Impact factor: 22.128, year: 2013

  6. No evidence for cumulative effects in a Dnmt3b hypomorph across multiple generations

    Czech Academy of Sciences Publication Activity Database

    Youngson, N.A.; Epp, Trevor; Roberts, A.R.; Daxinger, L.; Ashe, A.; Huang, E.; Lester, K.L.; Harten, S.K.; Kay, G.F.; Cox, T.; Matthews, J.M.; Chong, S.; Whitelaw, E.

    2013-01-01

    Roč. 24, 5-6 (2013), s. 206-217. ISSN 0938-8990 Institutional support: RVO:68378050 Keywords : epigenetic inheritance * mammalian development * transgenerational Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.883, year: 2013

  7. Do all frogs swim alike? The effect of ecological specialization on swimming kinematics in frogs

    Czech Academy of Sciences Publication Activity Database

    Robovská-Havelková, P.; Aerts, P.; Roček, Zbyněk; Přikryl, Tomáš; Fabre, A.-C.; Herrel, A.

    2014-01-01

    Roč. 217, č. 20 (2014), s. 3637-3644. ISSN 0022-0949 Institutional support: RVO:67985831 Keywords : Anura * kinematics * locomotion * swimming Subject RIV: EG - Zoology Impact factor: 2.897, year: 2014

  8. 78 FR 9771 - Federal Highway Administration

    Science.gov (United States)

    2013-02-11

    ... Federal Highway Administration Notice of Final Federal Agency Action on Proposed Transportation Project in Illinois and Indiana AGENCY: Federal Highway Administration (FHWA), DOT. ACTION: Notice of limitation on..., Federal Highway Administration, 3250 Executive Park Drive, Springfield, Illinois 62703, Phone: (217)...

  9. Ion Binding to Biomolecules

    Czech Academy of Sciences Publication Activity Database

    Lund, M.; Heyda, Jan; Jungwirth, Pavel

    New Jersey : World Scientific, 2010 - (Kunz, W.), s. 217-230 ISBN 978-981-4271-57-8 Institutional research plan: CEZ:AV0Z40550506 Keywords : proteins * salts * molecular dynamics Subject RIV: CF - Physical ; Theoretical Chemistry

  10. Gibsonnema nom. n., a new name for the nematode genus Paraseuratoides Moravec, Salgado-Maldonado et Aguilar-Aguilar, 2002

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Salgado-Maldonado, G.; Aguilar-Aguilar, R.

    2002-01-01

    Roč. 49, č. 3 (2002), s. 217. ISSN 0015-5683 Institutional research plan: CEZ:AV0Z6022909 Keywords : Gibsonnema * new name * Paraseuratoides Subject RIV: EG - Zoology Impact factor: 0.515, year: 2002

  11. BIOMASS, SPECIES IDENTIFICATION, SPECIES IDENTIFICATION - LIFE STAGE, TAXONOMIC CODE and species abundance tows data collected in the Gulf of Alaska on the ALPHA HELIX and WECOMA cruises HX201, HX203 and others as part of the NEP project from 1997-10-14 to 2004-10-08 (NODC Accession 0113956)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113956 includes tows and biological data collected aboard the ALPHA HELIX and WECOMA during cruises HX201, HX203, HX205, HX208, HX211, HX215, HX217,...

  12. Drug: D03362 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D03362 Drug Trafermin (genetical recombination) (JAN); Trafermin (USAN/INN); Fiblast (TN) C764H1 ... 201N217O219S6 17111.7836 17122.4232 Stroke ... treatment; Fibroblast growth factor Therapeutic ca ...

  13. Frequently Asked Questions about Surgical Site Infections

    Science.gov (United States)

    ... quirúrgico" [PDF - 217 KB] October 2008 Supplement of Infection Control and Hospital Epidemiology (Volume 29, Number S1) Guideline for the Prevention of Surgical Site Infection, 1999 Top of page Print page Get email ...

  14. BIOMASS, SPECIES IDENTIFICATION, TAXONOMIC CODE, SPECIES IDENTIFICATION - LIFE STAGE and species abundance tows data collected in the Gulf of Alaska on the ALPHA HELIX and WECOMA cruises HX201, HX203 and others as part of the NEP project from 1997-10-10 to 2004-10-07 (NODC Accession 0113896)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113896 includes tows and biological data collected aboard the ALPHA HELIX and WECOMA during cruises HX201, HX203, HX205, HX208, HX211, HX215, HX217,...

  15. Drug: D00251 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 217.2853 D00251.gif Antihypertensive; Enzyme inhibitor [angiotensin-converting] Therapeutic category: 2144 ...category of drugs in Japan [BR:br08301] 2 Agents affecting individual organs 21 Cardiovascular agents 214 Antihypertensive

  16. Diagnosis of Interstitial Cystitis/Bladder Pain Syndrome (Beyond the Basics)

    Science.gov (United States)

    ... is better understood. The American Urological Association (AUA) defines IC/BPS as an unpleasant sensation (pain, pressure, ... Am 1994; 21:7. Rosenberg MT, Hazzard M. Prevalence of interstitial cystitis symptoms in women: a population ...

  17. Assembly and iron-binding properties of human frataxin, the protein deficient in Friedreich ataxia

    Czech Academy of Sciences Publication Activity Database

    Cavadini, P.; ONeill, H.; Benada, Oldřich; Isaya, G.

    2002-01-01

    Roč. 11, č. 3 (2002), s. 217-227. ISSN 0964-6906 Institutional research plan: CEZ:AV0Z5020903 Keywords : assembly * human * frataxin Subject RIV: EE - Microbiology, Virology Impact factor: 8.726, year: 2002

  18. Protein (Cyanobacteria): 433086 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available antitermination protein NusG Prochlorococcus marinus str. MIT 9312 MSNELTTNLASSKANTSIARWYAVQVASSCEKKVKATLEQR...YP_396705.1 1117:25313 1212:957 1217:957 1218:957 1219:957 74546:217 transcription

  19. Experimental Studies at a Wind Turbin - EWT 315 kW Working in Mountain Conditions

    Czech Academy of Sciences Publication Activity Database

    Štekl, Josef

    Warsaw: Polish Group of the International Assotiation of Wind Engineering Building Research Institute, 1995, s. 217-220. [East Europian Conference on Wind Engineering. Warsaw (PL), 04.07.1994-08.07.1994] Keywords : turbine * wind

  20. Age at weaning, immunocompetence and ectoparasite performance in a precocial desert rodent

    Czech Academy of Sciences Publication Activity Database

    Dlugosz, E. M.; Goüy de Bellocq, Joëlle; Khokhlova, I. S.; Degen, A. A.; Pinshow, B.; Krasnov, B. R.

    2014-01-01

    Roč. 217, č. 17 (2014), s. 3078-3084. ISSN 0022-0949 Institutional support: RVO:68081766 Keywords : Fleas * PHA response * Weaning * Spiny mouse Subject RIV: EG - Zoology Impact factor: 2.897, year: 2014

  1. Field Plot and Observation Points for Dinosaur National Monument Vegetation Mapping Project

    Data.gov (United States)

    National Park Service, Department of the Interior — This point file displays the 727 vegetation plots and 217 observation points visited in 2002, 2003 and 2004 as part of the vegetation mapping project. Plots and...

  2. Drug: D03328 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D03328 Drug Carperitide (genetical recombination) (JAN); Carperitide (USAN/INN); Ha...l organs 21 Cardiovascular agents 217 Vasodilators 2179 Others D03328 Carperitide (genetical recombination)

  3. 26 CFR 31.3306(b)(9)-1 - Moving expenses.

    Science.gov (United States)

    2010-04-01

    ... expenses. (a) The term “wages” does not include remuneration paid on or after November 1, 1964, to or on... director or the courts finally to establish that a deduction is allowable under section 217. The...

  4. 日本における恋愛研究の動向

    OpenAIRE

    立脇, 洋介; 松井, 豊; 比嘉, さやか

    2005-01-01

    In this study, we review 217 Japanese articles about romantic love. Most of the articles are based on questionnaires completed by university students, and fall within the domain of social psychology. The following shifts in Japanese ...

  5. AcEST: BP919337 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Q98J83|Q98J83_RHILO Mlr2056 protein OS=Rhizobium loti GN=mlr2... 69 9e-11 tr|Q7NHD2|Q7NHD2_GLOVI Gll2605 protein OS=Gloeobacte...8 2e-10 tr|A1D217|A1D217_NEOFI Putative uncharacterized protein OS=Neosa... 67 3e-10 tr|Q6MY95|Q6MY95_ASPFU Putative uncharacte...IVAVVAALWWWL 245 >tr|Q7NHD2|Q7NHD2_GLOVI Gll2605 protein OS=Gloeobacter violaceus...RRYHEHVEAVKALIPEERLLCFEVVQ--GWEPLCAFLEVDVPGEPFPRIN 176 >tr|A1D217|A1D217_NEOFI Putative uncharacterized protein OS=Neos...: 202 E 202 >tr|B8KSY6|B8KSY6_9GAMM Putative uncharacterized protein OS=gamma proteobacte

  6. Teadlasena poliitikas - võimalused ja piirid = Als Wissenschaftler in der Politik - Chancen und Grenzen / Eiki Berg

    Index Scriptorium Estoniae

    Berg, Eiki, 1970-

    2005-01-01

    Autori hinnangul lasub teadlasel poliitikas suurem vastutus kui mistahes valdkonna esindajal, sest teaduslikult argumenteeritud poliitilised otsused on teadmiste jõu ja poliitilise võimu sümbioos. Vt. ka kommentaare lk. 217-222,467-472

  7. Funkční vlastnosti vysokohorských rostlin východního Ladaku (SZ Himaláje)

    OpenAIRE

    Chlumská, Zuzana

    2011-01-01

    Functional traits of 217 high altitude plants were studied in Eastern Ladakh (NW Himalayas, India). Changes in functional traits along altitudinal and moisture gradient were analysed. Plants were classified into 9 different habitats according to their frequency of occurence.

  8. Reference: IDRSZMFER1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available tial involvement of the IDRS cis-element in the developmental and environmental regulation of the AtFer1 ferritin gene from Arabidopsis. Planta. 217: 709-716 (2003) PubMed: 12728319 ...

  9. Reliability of diagnostic techniques for Erwinia amylovora, the causative agent of fire blight disease

    Czech Academy of Sciences Publication Activity Database

    Kokošková, B.; Mráz, Ivan

    2005-01-01

    Roč. 50, - (2005), s. 217-221. ISSN 0015-5632 Institutional research plan: CEZ:AV0Z5051902 Keywords : diagnostic techniques * plant diseases Subject RIV: EE - Microbiology, Virology Impact factor: 0.918, year: 2005

  10. Kunstkamera jako Švankmajerův mikrokosmos

    Czech Academy of Sciences Publication Activity Database

    Purš, Ivo

    Řevnice : Arbor vitae , 2012 - (Dryje, F.; Schmitt, B.), s. 195-217 ISBN 978-80-7467-015-2 Institutional support: RVO:68378033 Keywords : surrealism * fine art * film Subject RIV: AL - Art, Architecture, Cultural Heritage

  11. 76 FR 17622 - U.S. Education Mission to India

    Science.gov (United States)

    2011-03-30

    ..., International Trade Specialist, Tel: 414-217-8333, E- mail: Koreen.Grube@trade.gov . Matt Baker, International Trade Specialist, Tel: 520-470-5809, E- mail: Matt.Baker@trade.gov . Elnora Moye, U.S. Department...

  12. Možnosti mediální výchovy v učebnicích českého jazyka

    Czech Academy of Sciences Publication Activity Database

    Dufek, Ondřej

    2012-01-01

    Roč. 62, č. 5 (2012), s. 209-217. ISSN 0009-0786 Institutional support: RVO:68378092 Keywords : media literacy * media education * communication training * Czech language * Framework Educational Programme * cross-sectional subject Subject RIV: AI - Linguistics

  13. Structure and function of cyanobacterial mats in wetlands of Belize

    Czech Academy of Sciences Publication Activity Database

    Komárek, Jiří; Sirová, D.; Komárková-Legnerová, Jaroslava; Rejmánková, E.

    Boca Raton : CRC Press, 2015 - (Entry, J.; Gottlieb, A.; Jayachandran, K.; Ogram, A.), 194-217 ISBN 978-1-4987-1183-8 Institutional support: RVO:67985939 ; RVO:60077344 Keywords : Belize * swamps * cyanobacterial mats Subject RIV: EF - Botanics

  14. Hatchling sex ratio and female mating status in the great reed warbler, Acrocephalus arundinaceus (Aves, Passeriformes): further evidence for offspring sex ratio manipulation

    Czech Academy of Sciences Publication Activity Database

    Trnka, A.; Prokop, P.; Kašová, M.; Sobeková, Karolina; Kocian, Ľ.

    2012-01-01

    Roč. 79, č. 2 (2012), s. 212-217. ISSN 1125-0003 Institutional support: RVO:68081766 Keywords : Great reed warbler * sex ratio * social polygyny Subject RIV: EG - Zoology Impact factor: 0.890, year: 2012

  15. Nematodes from the genus Ascaridia parasitizing psittaciform birds: a review and determination key

    Czech Academy of Sciences Publication Activity Database

    Kajerová, V.; Baruš, Vlastimil; Literák, I.

    2004-01-01

    Roč. 49, č. 6 (2004), s. 217-223. ISSN 0375-8427 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z6093917 Keywords : ascarids * parrots * morphometry Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.790, year: 2004 http://www.vri.cz/docs/vetmed/49-6-217.pdf

  16. Nonwoven polymeric nanofiber scaffolds with bone marrow mesenchymal stem cells utilizable for spinal cord injury repair

    Czech Academy of Sciences Publication Activity Database

    Lesný, Petr; Jendelová, Pavla; Martinová, L.; Hejčl, Aleš; Jirsák, O.; Řeháková, M.; Syková, Eva

    2006-01-01

    Roč. 8, Supplement 1 (2006), s. 217-217. ISSN 1465-3249. [ ISCT 2006. 04.05.2006-07.05.2006, Berlin] R&D Projects: GA MŠk(CZ) 1M0021620803; GA ČR GA309/06/1246; GA MZd(CZ) 1A8697; GA MŠk 1M0538 Institutional research plan: CEZ:AV0Z50390512 Keywords : Cell Subject RIV: FH - Neurology

  17. Radioisotope space power generator. Annual report, July 1, 1975--September 30, 1976

    International Nuclear Information System (INIS)

    TPM-217 P-type selenide usefulness in thermoelectric converters depends on its dimensional, electrical and thermal stability at high temperature and its compatibility with other converter component materials in a low pressure environment. Experimental efforts have been directed at determining: the vaporization behavior at 9000C, the partial pressures of vaporizing species versus temperature, vapor suppression coatings, thermal expansion, dimensional stability, and the high temperature compatibility of TPM-217 with proposed end cap materials

  18. A dysregulated acetyl/SUMO switch of FXR promotes hepatic inflammation in obesity

    OpenAIRE

    Kim, Dong-Hyun; Xiao, Zhen; Kwon, Sanghoon; Sun, Xiaoxiao; Ryerson, Daniel; Tkac, David; Ma, Ping; Wu, Shwu-Yuan; Chiang, Cheng-Ming; Zhou, Edward; Xu, H. Eric; Palvimo, Jorma J; Chen, Lin-Feng; Kemper, Byron; Kemper, Jongsook Kim

    2014-01-01

    Acetylation of transcriptional regulators is normally dynamically regulated by nutrient status but is often persistently elevated in nutrient-excessive obesity conditions. We investigated the functional consequences of such aberrantly elevated acetylation of the nuclear receptor FXR as a model. Proteomic studies identified K217 as the FXR acetylation site in diet-induced obese mice. In vivo studies utilizing acetylation-mimic and acetylation-defective K217 mutants and gene expression profilin...

  19. AcEST: DK951338 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0011_C08 704 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0011_C08. 5' end seq ... Positives = 145/162 (89%) Frame = +1 Query: 217 STEPF RRLVKLVARAFYDDDMNAKGANKPKTEKFDNRGIAVVVLDALTRRQWVKED ... DLAK 396 S EPF RRLVKLVARAFYD+++ AKG N+ K++K DN+GIAVVVLDALTRRQWVKE+ ... DLAK Sbjct: 2 SIEPF RRLVKLVARAFYDEEIPAKGPNRSKSDKSDNKGIAVVVLDALTRRQWVKEE ... Positives = 138/162 (85%) Frame = +1 Query: 217 STEPF RRLVKLVARAFYDDDMNAKGANKPKTEKFDNRGIAVVVLDALTRRQWVKED ...

  20. 78 FR 78508 - Quarterly Rail Cost Adjustment Factor

    Science.gov (United States)

    2013-12-26

    ... 208.7 5 DEPRECIATION 11.9 221.0 217.8 6 INTEREST 2.0 76.6 76.6 7 OTHER ITEMS \\2\\ 21.9 220.0 220.5 8... EQUIPMENT RENTS 5.6 208.0 207.6 5 DEPRECIATION 11.5 218.9 217.8 6 INTEREST 2.3 87.3 87.3 7 OTHER ITEMS...

  1. Interplay of phase II enzymes and transporters in futile cycling: influence of multidrug resistance-associated protein 2-mediated excretion of estradiol 17beta-D-glucuronide and its 3-sulfate metabolite on net sulfation in perfused TR(-) and Wistar rat liver preparations.

    Science.gov (United States)

    Sun, Huadong; Zeng, Ying-Ying; Pang, K Sandy

    2010-05-01

    The hepatic disposition of estradiol 17beta-D-glucuronide (E(2)17G), a substrate of the organic anion-transporting polypeptides Oatp1a1, Oatp1a4, and Oatp1b2, was investigated in Wistar and TR(-) [multidrug resistance-associated protein (Mrp) 2-mutant] rats to elucidate how absence of Mrp2, the major excretory transporter for both E(2)17G and its 3-sulfate metabolite (E(2)3S17G), affected the net sulfation. With absence of Mrp2, lower microsomal desulfation activity and higher Mrp3 but unchanged immunoreactive protein expression of other transporters (Oatps and Mrp4) and estrogen sulfotransferase were found in TR(-) rats. In recirculating, perfused liver preparations, the rapid decay of E(2)17G and sluggish appearance of low levels of E(2)3S17G in perfusate for Wistar livers were replaced by a protracted, biexponential decay of E(2)17G and greater accumulation of E(2)3S17G, whose levels reached plateaus upon the almost complete obliteration of biliary excretion of E(2)17G and E(2)3S17G in the TR(-) liver. Much higher amounts of E(2)17G (28x) and E(2)3S17G (11x) in liver and reduced net sulfation (40 +/- 6 from 77 +/- 6% dose, P Mrp2 function led to decreased net sulfation of E(2)17G by raising the intracellular concentration of the metabolite, E(2)3S17G, which readily refurnished E(2)17G via desulfation. PMID:20124397

  2. EST Table: FS915186 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS915186 E_FL_fufe_34I06_F_0 10/09/28 63 %/217 aa ref|XP_001601993.1| PREDICTED: si.../216 aa gnl|Amel|GB18812-PA 10/09/10 60 %/218 aa gi|91080601|ref|XP_974038.1| PREDICTED...ow homology 10/09/10 54 %/217 aa AGAP002823-PA Protein|2R:27983820:27984479:-1|gene:MED7_ANOGA 10/09/10 61 %

  3. EST Table: FY015782 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY015782 rbmov15a07 11/11/04 75 %/217 aa ref|XP_001601993.1| PREDICTED: similar to ...nl|Amel|GB18812-PA 11/11/04 61 %/218 aa gi|91080601|ref|XP_974038.1| PREDICTED: s...gy 11/11/04 55 %/217 aa AGAP002823-PA Protein|2R:27983820:27984479:-1|gene:MED7_ANOGA 11/11/04 62 %/216 aa g

  4. Radioisotope space power generator annual report, July 1, 1974--June 30, 1975

    International Nuclear Information System (INIS)

    The Isotec Technology Program for FY-75 concentrated on materials development efforts in two areas: TPM-217 P-type material and SiGe technology. TPM-217 P-type material is a 3M proprietary thermoelectric material whose principal components are Cu, Ag, and Se. The usefulness of TPM-217 P-type selenide in thermoelectric converters depends on its dimensional, electrical, and thermal stability at high temperature and its compatibility with other converter component materials in a low-pressure environment. Experimental efforts were directed toward determining (1) the vapor species above TPM-217 from 7000 to 11000C, (2) the weight loss rate for TPM-217 at 9000C in vacuo, and (3) the stability of TPM-217 material in contact with Mo, Fe, 316 stainless steel, and pyrocarbon. The Si-Ge program is a continuation of the experimental work performed during FY-74. The development of coatings to suppress the vaporization of SiMo and SiGe continued. Techniques for applying ion-plated and chemical-vapor-deposited coatings of Si3N4 and (Si,Al)N alloys on SiMo were examined. Methods of controlling morphology and the chemical composition of these coatings were developed. Rates of vaporization for coated samples at 11000C were measured

  5. Thermoelectric materials evaluation program. Quarterly technical task report No. 46

    International Nuclear Information System (INIS)

    This forty-sixth Technical Task Report prepared under contract E(11-1)-2331 with the U.S. AEC and U.S. ERDA covers the performance period from October 1, 1975, to December 31, 1975. Highlights include the following tasks: N-type material development (material synthesis--gadolinium selenide compositions; material analyses; material processing; element contacting; ingradient compatibility and life testing; mechanical property characterization), TPM-217 P-type characterization (material preparation and analyses; element contacting; thermodynamic stability; isothermal chemical compatibility; ingradient compatibility and ingradient life testing; performance mapping of contacted and noncontacted elements; high-temperature partitioned P-legs), couple development (design and development of TPM-217/gadolinium selenide rare earth chalcogenide couple; design and development of TPM-217/3N-PbTe couples; advanced generator concepts), module development, liaison with Jet Propulsion Laboratory and material supply, liaison with GGA, and program management. 24 figures, 27 tables

  6. AcEST: BP921605 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rized protein OS=Janna... 92 2e-17 tr|Q7NHD2|Q7NHD2_GLOVI Gll2605 protein OS=Gloeobacter violac...217_NEOFI Putative uncharacterized protein OS=Neosa... 87 9e-16 tr|Q6MY95|Q6MY95_ASPFU Putative uncharacterized prote...: 178 WGPLCDFLHVPVPNTPFPRSNGRDE 202 >tr|Q7NHD2|Q7NHD2_GLOVI Gll2605 protein OS=Gloeobacter violaceus...NSSEE 200 >tr|A1D217|A1D217_NEOFI Putative uncharacterized protein OS=Neosartorya...rized protein OS=gamma proteobacterium NOR51-B Align length 131 Score (bit) 93.2 E-val

  7. Dicty_cDB: VHE368 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available krgydywkesrnvqfsgsnsnplyeqnpngsgvnplyndnsal*nkims Homology vs CSM-cDNA Score E Sequences producing signific...-14 9 ER665871 |ER665871.1 SB_BBc223-A10.F SB_BBc Sorghum bicolor genomic 5', genomic survey sequence. 48 0....R550385.1 Sequence 5516 from patent US 6747137. 44 5.3 1 dna update 2007. 7.14 Homology vs Protein Sco...HP644Q) /CSM/VH/VHP6-B/VHP644Q.Seq.d/ 1292 0.0 VHJ217 (VHJ217Q) /CSM/VH/VHJ2-A/VHJ217Q.Seq.d/ 1292 0.0 own update 2003.10.16 Homolog...re E Sequences producing significant alignments: (bits) Value ( Q94494 ) RecName: Full=Protein psi

  8. Culture of bovine embryos in polyester mesh sections: the effect of pore size and oxygen tension on in vitro development.

    Science.gov (United States)

    Somfai, T; Inaba, Y; Aikawa, Y; Ohtake, M; Kobayashi, S; Akai, T; Hattori, H; Konishi, K; Imai, K

    2010-12-01

    The purpose of this study was to assess the feasibility of polyester mesh culture for the in vitro production of bovine embryos, as polyester mesh is an alternative way for tracking individual embryos throughout culture using time-lapse cinematography (TLC). Bovine embryos were isolated during in vitro culture using sections of three different polyethylene terephthalate (PET) mesh products. In vitro matured and fertilized bovine oocytes were cultured in the 217 × 217, 230 × 230 or 238 × 238-μm openings of PET mesh sections or in simple micro-drops (control) for 7 days under either 20% or 5% O(2) tensions. No difference in embryo developmental rates was found between the culture groups in terms of cleavage, blastocyst formation and blastocyst expansion irrespective of O(2) tension. In contrast, under 20% O(2) tension, blastocysts that developed in PET mesh with 217 × 217-μm opening had significantly higher numbers of total and trophectoderm (TE) cells than control embryos; however, the numbers and proportions of inner cell mass (ICM) cells did not differ. Under 5% O(2) tension, no difference was found among the culture groups in the numbers of total, ICM and TE cells in embryos. All three PET mesh products investigated in this study were proven to be effective to prevent embryo movement. The results demonstrate that bovine embryos can be cultured in PET mesh sections without negative side-effects and suggest that embryo distance determined by the mesh affects embryo quality at atmospheric oxygen tension. Polyethylene terephthalate mesh with 217 × 217-μm openings was found to be the most suitable for further application in TLC. PMID:19845884

  9. Gclust Server: 88007 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 88007 CEL_F42A6.9_17540366 Cluster Sequences Related Sequences(217) 836 elks-1: mammal...tive annotation elks-1: mammalian ELKS/CAST/ERC/Rab6 interacting protein homolog family member (elks-1) Numb...Photosynthetic bacteria (15species) (%) 0.0 Non-photosynthetic bacteria (31species) (%) 0.0 Opisthokonts (Animals...er of Sequences 1 Homologs 1 Clustering threshold 1.00e-45 Plants and algae (7species) (%) 0.0 Other Bikonts (Chromal...s Link to related sequences Related Sequences(217) Sequence length 836 Representa

  10. Reseñas de Libros

    OpenAIRE

    Daniel Alcalde Güelfo; Mª Candelaria Fuentes Navarro; Karl J. Trybus; Flavia Pascariello; Alfonso Pinilla García; David Molina Rabadán; Jan Nelis; José Joaquín Fernández Alles; Antonio J. Piqueres Díez

    2009-01-01

    Achcar, Gilbert, El choque de barbaries, terrorismo y desorden mundial. Barcelona, Icaria-Antrazyt, 2007, 197 pp.Páginas 213-214Daniel Alcalde GüelfoDel Arco Blanco, Miguel Ángel, Hambre de Siglos. Mundo rural y apoyos sociales del franquismo en Andalucía Oriental (1936-1951). Granada, Comares Historia, 2007, 513 pp.Páginas 214-217Mª Candelaria Fuentes NavarroBen-Ghiat, Ruth; Fuller, Mia (eds.), Italian Colonialism. New York, Palgrave MacMillan, 2005, 266 pp.Páginas 217-219Karl J. TrybusBlack...

  11. Dicty_cDB: Contig-U15897-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ... 217 1e-71 AM933172_2155( AM933172 |pid:none) Salmonella enterica subsp. ente...... 217 2e-71 CP001127_2246( CP001127 |pid:none) Salmonella enterica subsp. ente... 218 2e-71 CP000468_2040(...monella enterica subsp. ente... 216 4e-71 AM933173_2128( AM933173 |pid:none) Salmonell...a enterica subsp. ente... 216 5e-71 CP001120_2250( CP001120 |pid:none) Salmonella enterica subsp. ente...s) Database: CSM 8402 sequences; 8,075,542 total letters Score E Sequences producing significant alignments: (bits) Val

  12. Indice botánico

    OpenAIRE

    2015-01-01

    Achiote: 91, 94, 198 Aguaje: 156 Aji: 59, 74, 171 Alamo: 171 Algodón: 94, 110, 124 Aliso: 52 Alnus acuminata: ver aliso Aloes: 171 Altramuce: 44 Arachis hypogaea: ver maní Arracacha esculenta: 69 Arveja: 74 Asaí: ver palmera Bactris gasipaes: 141 Balsa palo de: 180 Befaría ledifolia: 64 Bertholetia excelsa: 154 Bixa orellana: ver achiote Bombax: 178 Bombonax: ver palmera Barbasco: 199 Cabeza de negro: ver Humiro Cacao: 194, 217 Café: 175, 179, 217 Camote: 62, 69, 74, 97, 182, 192 Caña de azúc...

  13. Diethylstilbestrol can effectively accelerate estradiol-17-O-glucuronidation, while potently inhibiting estradiol-3-O-glucuronidation

    International Nuclear Information System (INIS)

    This in vitro study investigates the effects of diethylstilbestrol (DES), a widely used toxic synthetic estrogen, on estradiol-3- and 17-O- (E2-3/17-O) glucuronidation, via culturing human liver microsomes (HLMs) or recombinant UDP-glucuronosyltransferases (UGTs) with DES and E2. DES can potently inhibit E2-3-O-glucuronidation in HLM, a probe reaction for UGT1A1. Kinetic assays indicate that the inhibition follows a competitive inhibition mechanism, with the Ki value of 2.1 ± 0.3 μM, which is less than the possible in vivo level. In contrast to the inhibition on E2-3-O-glucuronidation, the acceleration is observed on E2-17-O-glucuronidation in HLM, in which cholestatic E2-17-O-glucuronide is generated. In the presence of DES (0–6.25 μM), Km values for E2-17-O-glucuronidation are located in the range of 7.2–7.4 μM, while Vmax values range from 0.38 to 1.54 nmol/min/mg. The mechanism behind the activation in HLM is further demonstrated by the fact that DES can efficiently elevate the activity of UGT1A4 in catalyzing E2-17-O-glucuronidation. The presence of DES (2 μM) can elevate Vmax from 0.016 to 0.81 nmol/min/mg, while lifting Km in a much lesser extent from 4.4 to 11 μM. Activation of E2-17-O-glucuronidation is well described by a two binding site model, with KA, α, and β values of 0.077 ± 0.18 μM, 3.3 ± 1.1 and 104 ± 56, respectively. However, diverse effects of DES towards E2-3/17-O-glucuronidation are not observed in liver microsomes from several common experimental animals. In summary, this study issues new potential toxic mechanisms for DES: potently inhibiting the activity of UGT1A1 and powerfully accelerating the formation of cholestatic E2-17-O-glucuronide by UGT1A4. - Highlights: • E2-3-O-glucuronidation in HLM is inhibited when co-incubated with DES. • E2-17-O-glucuronidation in HLM is stimulated when co-incubated with DES. • Acceleration of E2-17-O-glucuronidationin in HLM by DES is via activating the activity of UGT1A4

  14. Projected changes in flood-generating precipitation extremes over the Czech Republic in high-resolution regional climate models

    Czech Academy of Sciences Publication Activity Database

    Kyselý, Jan; Gaál, Ladislav; Beranová, Romana

    2011-01-01

    Roč. 59, č. 4 (2011), s. 217-227. ISSN 0042-790X R&D Projects: GA ČR GAP209/10/2045; GA AV ČR KJB300420801 Institutional research plan: CEZ:AV0Z30420517 Keywords : precipitation extremes * regional frequency analysis * climate change * regional climate models * Czech Republic Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 0.340, year: 2011 http://dlib.lib.cas.cz/6965/1/2011_59_4_kysely_217.pdf

  15. Charakterystyka stratyfikacji termicznej i chemicznej wód jeziora Ostrowite (PNBT) w roku 2015 = Features of the thermal and chemical stratification of the Ostrowite Lake water in the year 2015

    OpenAIRE

    Gierszewski, Piotr; Miler, Karol; Kaszubski, Michał

    2015-01-01

    Gierszewski Piotr, Miler Karol, Kaszubski Michał. Charakterystyka stratyfikacji termicznej i chemicznej wód jeziora Ostrowite (PNBT) w roku 2015 = Features of the thermal and chemical stratification of the Ostrowite Lake water in the year 2015. Journal of Education, Health and Sport. 2015;5(12):217-229. ISSN 2391-8306. DOI http://dx.doi.org/10.5281/zenodo.35354 http://ojs.ukw.edu.pl/index.php/johs/article/view/2015%3B5%2812%29%3A217-229 http://pbn.nauka.gov.pl/works/679838 ...

  16. 40 CFR 407.82 - Effluent limitations guidelines representing the degree of effluent reduction attainable by the...

    Science.gov (United States)

    2010-07-01

    ... Potato 3.46 2.17 1.58 Tortilla 2.41 1.50 1.09 Ethnic foods 2.39 1.41 0.96 Jams/jellies 0.42 0.26 0.19... 0.00 Baby food 2.23 1.55 0.95 Chips: Corn 2.90 2.17 1.53 Potato 6.25 4.49 2.97 Tortilla 4.34 3.11...

  17. Identification of electrostatic interaction sites between the regulatory and catalytic subunits of cyclic AMP-dependent protein kinase.

    OpenAIRE

    Gibson, R.M.; Ji-Buechler, Y.; Taylor, S S

    1997-01-01

    Two classes of molecules inhibit the catalytic subunit (C) of the cyclic AMP-dependent protein kinase (cAPK), the heat-stable protein kinase inhibitors (PKIs) and the regulatory (R) subunits. Basic sites on C, previously identified as important for R/C interaction in yeast TPK1 and corresponding to Lys213, Lys217, and Lys189 in murine C alpha, were replaced with either Ala or Thr and characterized for their kinetic properties and ability to interact with RI and PKI. rC(K213A) and rC(K217A) we...

  18. Drug: D01573 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D01573 Drug Etilefrine hydrochloride (JP16); Etilefrine hydrochloride (TN) C10H15NO...2. HCl 217.087 217.6925 D01573.gif Antihypotensive; Sympathomimetic Therapeutic category: 2119 ATC code: C01CA01 alpha1-adr...tion hsa04270(146+147+148) Vascular smooth muscle contraction hsa04970(146+147+148) Salivary secretion Therapeutic category of dr... 211 Cardiotonics 2119 Others D01573 Etilefrine hydrochloride (JP16) Anatomical T...AC STIMULANTS EXCL. CARDIAC GLYCOSIDES C01CA Adrenergic and dopaminergic agents C01CA01 Etilefrine D01573 Etilefrine hydr

  19. Physical Activity

    DEFF Research Database (Denmark)

    Andersen, Lars Bo; Anderssen, Sigmund Alfred; Wisløff, Ulrik;

    2014-01-01

    Andersen LB, Anderssen SA, Wisløff U, Hellénius M-L, Fogelholm M, Ekelund U. (Expert Group) Nordic Nutrition Recommendations 2012. Integrating nutrition and physical activity. Chapter: Physical Activity p. 195-217.Nordic Counsil of Ministers.......Andersen LB, Anderssen SA, Wisløff U, Hellénius M-L, Fogelholm M, Ekelund U. (Expert Group) Nordic Nutrition Recommendations 2012. Integrating nutrition and physical activity. Chapter: Physical Activity p. 195-217.Nordic Counsil of Ministers....

  20. EST Table: FY748703 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY748703 E_FL_famL_39P14_F_0 11/11/04 75 %/217 aa ref|XP_001601993.1| PREDICTED: si.../216 aa gnl|Amel|GB18812-PA 11/11/04 60 %/218 aa gi|91080601|ref|XP_974038.1| PREDICTED...ow homology 11/11/04 54 %/217 aa AGAP002823-PA Protein|2R:27983820:27984479:-1|gene:MED7_ANOGA 11/11/04 61 %

  1. EST Table: FS939139 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS939139 E_FL_fwgP_54A18_F_0 10/09/28 63 %/217 aa ref|XP_001601993.1| PREDICTED: si.../216 aa gnl|Amel|GB18812-PA 10/09/10 60 %/218 aa gi|91080601|ref|XP_974038.1| PREDICTED...ow homology 10/09/10 54 %/217 aa AGAP002823-PA Protein|2R:27983820:27984479:-1|gene:MED7_ANOGA 10/09/10 61 %

  2. EST Table: FY740768 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY740768 E_FL_famL_12O14_F_0 11/11/04 75 %/217 aa ref|XP_001601993.1| PREDICTED: si.../216 aa gnl|Amel|GB18812-PA 11/11/04 60 %/218 aa gi|91080601|ref|XP_974038.1| PREDICTED...ow homology 11/11/04 54 %/217 aa AGAP002823-PA Protein|2R:27983820:27984479:-1|gene:MED7_ANOGA 11/11/04 61 %

  3. EST Table: FS924698 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS924698 E_FL_fwgP_11F06_F_0 10/09/28 63 %/217 aa ref|XP_001601993.1| PREDICTED: si.../216 aa gnl|Amel|GB18812-PA 10/09/10 60 %/218 aa gi|91080601|ref|XP_974038.1| PREDICTED...ow homology 10/09/10 54 %/217 aa AGAP002823-PA Protein|2R:27983820:27984479:-1|gene:MED7_ANOGA 10/09/10 61 %

  4. Několik poznámek k problematice ochrany duševního vlastnictví

    Czech Academy of Sciences Publication Activity Database

    Krejčí, Jindřich

    2011-01-01

    Roč. 5, č. 2 (2011), s. 217-219. ISSN 1802-8152 R&D Projects: GA MŠk LM2010006 Institutional research plan: CEZ:AV0Z70280505 Keywords : social science databases * intellectual property rights * open access Subject RIV: AO - Sociology, Demography http://dav.soc.cas.cz/uploads/9aded5ef84867217588bfc788d640e8a3b0e50d2_DaVp217-219%20Krejci.pdf

  5. Differences between users and non-users of emergency contraception after a recognized unprotected intercourse

    DEFF Research Database (Denmark)

    Sørensen, M B; Pedersen, B L; Nyrnberg, L E

    2000-01-01

    setting, 217 women referred for termination of pregnancy were asked to fill in a questionnaire. Of the 217 women, 139 (64%) were aware of pregnancy risk but only 9 (4%) had used EC after the unprotected intercourse. 42% were estimated to have sufficient knowledge to use hormonal emergency contraception......Knowledge of emergency contraception is crucial but might not transform into use. Factors influencing decision-making related to use of emergency contraception after an unprotected intercourse and the characteristics of users of emergency contraception (EC) were assessed. In an abortion clinic...

  6. [Corrigendum] Constitutive activation of MAPK/ERK inhibits prostate cancer cell proliferation through upregulation of BRCA2.

    Science.gov (United States)

    Moro, Loredana; Arbini, Arnaldo A; Marra, Ersilia; Greco, Margherita

    2016-06-01

    After the publication of the article the authors noted the following errors in the assembling of the figures. In Fig. 3A the tubulin panel for PC-3 cells is incorrect. The correct panel is reported below. In Figs. 3B and 5B the panels are incorrect. The correct panels are shown below. These changes do not affect the interpretation of the data or conclusions of this work [the original article was published in the International Journal of Oncology 30: 217-224, 2007; DOI: 10.3892/ijo.30.1.217]. PMID:27082245

  7. The biokinetics of alpha-particle emitting radiopharmaceuticals

    International Nuclear Information System (INIS)

    The past two decades have seen wide interest in the application of alpha-particle emitting radionuclides for targeted endoradiotherapy and a large number of compounds labeled with 211At (T1/2 7.21 h), 212Bi (T1/2 1 h) or 213Bi (T1/2 0.78 h) have been studied. Knowledge of the biokinetic behaviour of such agents is important both for their optimal clinical exploitation and for general radiological protection purposes. Animal studies of the distribution and retention of 211At compounds, including ionic astatide, substituted aromatic compounds and labelled monoclonal antibodies, have provided new information on the biochemistry of astatine. With respect the thyroid gland the uptake of the astatide ion has been shown to be very much lower than that of the iodide ion. Less information is available for 212Bi-labelled radiopharmaceuticals. The available data for both 211At and 212Bi radiopharmaceuticals are reviewed. Cautious generic biokinetic models for inorganic and simple organic compounds of 211At and 212Bi; for [211At]-, and [212Bi]-biphosphonates and for [211At]-, and [212Bi]-monoclonal antibodies, are proposed for use in general radiological protection when compound-specific data are not available. (orig.)

  8. The radiolabeled monoclonal antibodies in immunoscintigraphy and radioimmunotherapy: current state and perspectives

    International Nuclear Information System (INIS)

    The antibodies can be satisfactorily labelled with technitium-99 m or indium-111 for tumor immunoscintigraphy. The immunoscintigraphy is not useful for the primary tumor diagnosis. It can be useful for the diagnosis of the some cancer extension and for recurrent tumor visualization. The immunoscintigraphy is widely competed with Positron Emission Tomography (PET) which gives accurate results. In the future the immunoscintigraphy, in pre-therapeutic stage, contribute to the estimation of the dose delivered to the tumor and to normal organs for adopting or not a radioimmunotherapy. The antibodies can also be labeled with Iodine-131 for an application in radioimmunotherapy (RIT). The RIT is efficient in the non-Hodgkin's lymphoma treatment because of their great radiosensitivity. Until now the results have been very modest in solid tumor treatment but methodological and biotechnological progresses have to improve the efficiency especially for the small tumors. In the future iodine-131 which requires the confinement (very expensive) of patients will be substituted by yttrium-90 beta emitter, more energetic than iodine-131 and can be injected in walking case. In the long term, the alpha emitter radionuclides (astatine-211 or bismuth-213) can be used for hematologic cancer treatment. In conclusion the future of radiolabeled monoclonal antibodies is essentially therapeutic. The radioimmunotherapy associated to the chemotherapy give promising perspectives for the radiosensitive cancer treatment and in general small solid tumor treatment (F.M.)

  9. Biological toxicity of intracellular radionuclide decay. Part of a coordinated programme on radiation biology of Auger emitters and their therapeutic applications

    International Nuclear Information System (INIS)

    Internal radiotherapy should be performed with short-lived radionuclides which emit high LET radiation and short ranged radiation, and accumulated within cancers. Based on these considerations, several radionuclides (tritium, copper-64, gallium-67, iodine-123, iodine 125, iodine-131 and astatine-211) were chosen and their toxicity was assessed using cell division in mammalian cultured cells as a criterion. It was apparent that the toxic effects obtained with 125I greatly exceeded those observed in cells treated with any other radionuclides. The possible hypotheses to explain the excessive radiosensitivity of 125I were discussed in relation to microdosimetry calculation. It was also found that the division delay induced by radionuclide decay is primarily due to damage to the cell nucleus but not to the plasma membrane. The key problem remains the development of agents which can serve as carriers for radionuclide accumulation within tumors. Although several promising approaches (Synkavit, tamoxifen, iododeoxyuridine, antibodies, liposomes) were investigated, only 125I-labelled Synkavit would be desirable for clinical application

  10. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  11. The biokinetics of alpha-particle emitting radiopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    Taylor, D.M. [School of Chemistry, Cardiff Univ., Cardiff (United Kingdom); Duffield, J.R. [Faculty of Applied Sciences, Univ. of the West of England, Bristol (United Kingdom)

    2005-07-01

    The past two decades have seen wide interest in the application of alpha-particle emitting radionuclides for targeted endoradiotherapy and a large number of compounds labeled with {sup 211}At (T{sup 1}/{sub 2} 7.21 h), {sup 212}Bi (T{sup 1}/{sub 2} 1 h) or {sup 213}Bi (T{sup 1}/{sub 2} 0.78 h) have been studied. Knowledge of the biokinetic behaviour of such agents is important both for their optimal clinical exploitation and for general radiological protection purposes. Animal studies of the distribution and retention of {sup 211}At compounds, including ionic astatide, substituted aromatic compounds and labelled monoclonal antibodies, have provided new information on the biochemistry of astatine. With respect the thyroid gland the uptake of the astatide ion has been shown to be very much lower than that of the iodide ion. Less information is available for {sup 212}Bi-labelled radiopharmaceuticals. The available data for both {sup 211}At and {sup 212}Bi radiopharmaceuticals are reviewed. Cautious generic biokinetic models for inorganic and simple organic compounds of {sup 211}At and {sup 212}Bi; for [{sup 211}At]-, and [{sup 212}Bi]-biphosphonates and for [{sup 211}At]-, and [{sup 212}Bi]-monoclonal antibodies, are proposed for use in general radiological protection when compound-specific data are not available. (orig.)

  12. Effect of cetuximab in combination with alpha-radioimmunotherapy in cultured squamous cell carcinomas

    International Nuclear Information System (INIS)

    Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 (211At-cMAb U36). Effects on 211At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with 211At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced 211At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.

  13. Tumor immunotargeting using innovative radionuclides.

    Science.gov (United States)

    Kraeber-Bodéré, Françoise; Rousseau, Caroline; Bodet-Milin, Caroline; Mathieu, Cédric; Guérard, François; Frampas, Eric; Carlier, Thomas; Chouin, Nicolas; Haddad, Ferid; Chatal, Jean-François; Faivre-Chauvet, Alain; Chérel, Michel; Barbet, Jacques

    2015-01-01

    This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality. PMID:25679452

  14. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  15. Proceedings of transuranium elements

    International Nuclear Information System (INIS)

    The identification of the first synthetic elements was established by chemical evidence. Conclusive proof of the synthesis of the first artificial element, technetium, was published in 1937 by Perrier and Segre. An essential aspect of their achievement was the prediction of the chemical properties of element 43, which had been missing from the periodic table and which was expected to have properties similar to those of manganese and rhenium. The discovery of other artificial elements, astatine and francium, was facilitated in 1939-1940 by the prediction of their chemical properties. A little more than 50 years ago, in the spring of 1940, Edwin McMillan and Philip Abelson synthesized element 93, neptunium, and confirmed its uniqueness by chemical means. On August 30, 1940, Glenn Seaborg, Arthur Wahl, and the late Joseph Kennedy began their neutron irradiations of uranium nitrate hexahydrate. A few months later they synthesized element 94, later named plutonium, by observing the alpha particles emitted from uranium oxide targets that had been bombarded with deuterons. Shortly thereafter they proved that is was the second transuranium element by establishing its unique oxidation-reduction behavior. The symposium honored the scientists and engineers whose vision and dedication led to the discovery of the transuranium elements and to the understanding of the influence of 5f electrons on their electronic structure and bonding. This volume represents a record of papers presented at the symposium

  16. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  17. Development and radiotherapeutic application of 211At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    International Nuclear Information System (INIS)

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of 131I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, 211At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of 211At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated

  18. Nuclear and chemical data for life sciences

    International Nuclear Information System (INIS)

    Use of reactor produced radionuclides is popular in life sciences. However, cyclotron production of proton rich radionuclides are being more focused in recent times. These radionuclides have already gained attention in various fields, including life sciences, provided they are obtained in pure form. This article is a representative brief of our contributions in generating nuclear data for the production of proton rich radionuclides of terbium, astatine, technetium, ruthenium, cadmium, niobium, zirconium, rhenium, etc., which may have application in clinical, biological, agriculture studies or in basic research. The chemical data required to separate the product isotopes from the corresponding target matrix have been presented along with a few propositions of radiopharmaceuticals. It also emphasizes on the development of simple empirical technique, based on the nuclear reaction model analysis, to generate reliable nuclear data for the estimation of yield and angular distribution of emitted neutrons and light charged particles from light as well as heavy ion induced reactions on thick stopping targets. These data bear utmost important in radiation dosimetry. (author)

  19. Studies of Stable Octupole Deformations in the Radium Region

    CERN Multimedia

    2002-01-01

    The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

  20. Effect of cetuximab in combination with alpha-radioimmunotherapy in cultured squamous cell carcinomas

    Energy Technology Data Exchange (ETDEWEB)

    Nestor, Marika, E-mail: marika.nestor@bms.uu.s [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden); Sundstroem, Magnus [Unit of Molecular Pathology, Department of Genetics and Pathology, Uppsala University (Sweden); Anniko, Matti [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden)

    2011-01-15

    Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ({sup 211}At-cMAb U36). Effects on {sup 211}At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with {sup 211}At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced {sup 211}At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.

  1. Alpha particle emitters in medicine

    International Nuclear Information System (INIS)

    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 (211At) and natural bismuth-212 (212Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 (223Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs

  2. Preparation of 211At-labeled humanized anti-Tac using 211At produced in disposable internal and external bismuth targets

    International Nuclear Information System (INIS)

    These studies describe the production and purification of 211At as well as the procedure for labeling humanized anti-Tac, the antibody to the α-chain of the IL-2 receptor (IL-2Rα), which has been shown to be a useful target for immunotherapy. The optimized protocol combines the advantages of the two-stage dry distillation procedure with the astatination of trialkylstannyl substances as labeling compounds for proteins. The 211At was produced by bombarding either an external or a recently developed disposable internal bismuth target with α-particles from a Cyclotron Corporation CS-30 cyclotron. The 211At was found to contain less than 0.01% 210At. The production rate for the external target was 0.15 mCi ± 0.056 μA-1 h-1 (n = 9) (5.55 MBq μA-1 h-1). The production rate for the internal target was 0.44 ± 0.14 mCi μA-1 h-1 (n = 16) (16.28 MBq μA-1 h-1)

  3. Bratrská Bible z roku 1596. Příběh výzdoby a polemiky

    Czech Academy of Sciences Publication Activity Database

    Šroněk, Michal

    Praha : Artefactum, 2013 - (Horníčková, K.; Šroněk, M.), s. 217-232 ISBN 978-80-86890-57-9 Institutional support: RVO:68378033 Keywords : Unity of the Brethren * images * confessional conflict Subject RIV: AL - Art, Architecture, Cultural Heritage

  4. The evolutionary ecology of the bitterling: reproductive strategies and co-evolution with freshwater mussles

    Czech Academy of Sciences Publication Activity Database

    Reichard, Martin

    Zagreb : Croatian Ichthyological Society, 2007 - (Buj, I.; Zanella, L.; Mrakovcic, M.). s. 217 [European Congress of Ichthyology /12./. 09.09.2007-13.09.2007, Cavtat (Dubrovnik)] Institutional research plan: CEZ:AV0Z60930519 Keywords : reproduction * fish Subject RIV: EH - Ecology, Behaviour

  5. FENO and AHR mannitol in patients referred to an out-of-hospital asthma clinic

    DEFF Research Database (Denmark)

    Backer, Vibeke; Sverrild, Asger; Porsbjerg, Celeste

    2014-01-01

    between FENO and AHR to mannitol in unselected individuals with possible asthma. METHODS: A real-life study on patients with possible asthma referred to a specialized asthma clinic. Data on asthma history, FEV(1), FENO, atopy, smoking, treatment and AHR to mannitol were collected. RESULTS: In 217...

  6. Impact of a Community-Based Prevention Marketing Intervention to Promote Physical Activity among Middle-Aged Women

    Science.gov (United States)

    Sharpe, Patricia A.; Burroughs, Ericka L.; Granner, Michelle L.; Wilcox, Sara; Hutto, Brent E.; Bryant, Carol A.; Peck, Lara; Pekuri, Linda

    2010-01-01

    A physical activity intervention applied principles of community-based participatory research, the community-based prevention marketing framework, and social cognitive theory. A nonrandomized design included women ages 35 to 54 in the southeastern United States. Women (n = 430 preprogram, n = 217 postprogram) enrolled in a 24-week behavioral…

  7. Innovation and Creativity.

    Science.gov (United States)

    1998

    This document contains four papers from a symposium on innovation and creativity and their relationship to human resource development (HRD). "Intrapreneurial Programs and Their Impact on Sales, Profit, and Return to Investors" (Melissa H. Marcus, Dennis G. Tesolowski, Clinton H. Isbell) reports on a study in which 100 of 217 randomly selected…

  8. Single Electrode Heat Effects

    DEFF Research Database (Denmark)

    Jacobsen, Torben; Broers, G. H. J.

    1977-01-01

    Standard Peltier entropies for the reactions in molten carbonate paste electrolytes at 1000°K have been determined fromthermogalvanic measurements. The results are –217 and –118 J/mole°K,respectively. No dependence on electrolyte composition is observed. The reversiblepart of the Peltier entropy ...

  9. The potential and limitations of geophysical measurements on archaeological sites partly investigated in the past: case studies from the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Křivánek, Roman

    2015-01-01

    Roč. 53, č. 2015 (2015), s. 212-217. ISSN 0066-5924. [International Conference on Archaeological Prospection /11./. Warszawa, 15.09.2015-19.09.2015] Institutional support: RVO:67985912 Keywords : geophysical survey * rondel * hillfort * extinct monastery * archaeological prospection Subject RIV: AC - Archeology, Anthropology, Ethnology

  10. Chaos and stability of age-0 fish assemblages in a temperate deep reservoir: unpredictable success and stable habitat use

    Czech Academy of Sciences Publication Activity Database

    Jůza, Tomáš; Vašek, Mojmír; Kratochvíl, Michal; Blabolil, Petr; Čech, Martin; Draštík, Vladislav; Frouzová, Jaroslava; Muška, Milan; Peterka, Jiří; Prchalová, Marie; Říha, Milan; Tušer, Michal; Kubečka, Jan

    2014-01-01

    Roč. 724, č. 1 (2014), s. 217-234. ISSN 0018-8158 R&D Projects: GA MŠk(CZ) EE2.3.20.0204 Institutional support: RVO:60077344 Keywords : horizontal migration * Římov reservoir * trawling * seining * fry distribution Subject RIV: EH - Ecology, Behaviour Impact factor: 2.275, year: 2014

  11. Storytelling Slide Shows to Improve Diabetes and High Blood Pressure Knowledge and Self-Efficacy: Three-Year Results among Community Dwelling Older African Americans

    Science.gov (United States)

    Bertera, Elizabeth M.

    2014-01-01

    This study combined the African American tradition of oral storytelling with the Hispanic medium of "Fotonovelas." A staggered pretest posttest control group design was used to evaluate four Storytelling Slide Shows on health that featured community members. A total of 212 participants were recruited for the intervention and 217 for the…

  12. La tipología del espanol y el rumano - el sistema verbal

    Czech Academy of Sciences Publication Activity Database

    Boček, Vít

    2007-01-01

    Roč. 56, č. 28 (2007), s. 217-233. ISSN 0231-7532 R&D Projects: GA MŠk(CZ) LC546 Institutional research plan: CEZ:AV0Z90610518 Keywords : typology * Romanian language * Spanish language Subject RIV: AI - Linguistics

  13. Late Cretaceous and Cenozoic dynamics of the Bohemian Massif inferred from the paleostress history of the Lusatian Fault Belt

    Czech Academy of Sciences Publication Activity Database

    Coubal, Miroslav; Málek, Jiří; Adamovič, Jiří; Štěpančíková, Petra

    2015-01-01

    Roč. 87, July 1 (2015), s. 26-49. ISSN 0264-3707 R&D Projects: GA ČR GAP210/12/0573 Institutional support: RVO:67985831 ; RVO:67985891 Keywords : paleostress * fault kinematics * Lusatian Fault Belt * Elbe fault system * Bohemian Massif * Alpine foreland Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.217, year: 2014

  14. Subtyping Cryptosporidium ubiquitum, a Zoonotic Pathogen Emerging in Humans

    Czech Academy of Sciences Publication Activity Database

    Li, N.; Alderisio, K.; Elwin, K.; Cebelinski, E.; Chalmers, R.; Santin, M.; Fayer, R.; Kváč, Martin; Ryan, U.; Sak, Bohumil; Stanko, M.; Guo, Y.; Wang, L.; Zhang, L.; Cai, J.; Roellig, D.; Feng, Y.

    2014-01-01

    Roč. 20, č. 2 (2014), s. 217-224. ISSN 1080-6040 R&D Projects: GA MŠk(CZ) LH11061 Institutional support: RVO:60077344 Keywords : cervine genotype * source tracking * small mammals Subject RIV: EE - Microbiology, Virology Impact factor: 6.751, year: 2014

  15. 76 FR 62055 - Wabash Gas Storage, LLC; Notice of Intent To Prepare an Environmental Assessment for the Planned...

    Science.gov (United States)

    2011-10-06

    ... Wabash Gas Storage, LLC (Wabash) near Paris in Edgar County, Illinois. This EA will be used by the..., 2011, Knights of Columbus Meeting Hall, 614 North Main Street, Paris, IL 61944, (217) 465-1085. This... mutually acceptable agreement. However, if the project is approved by the Commission, that approval...

  16. Genetic variation of Phoma sorghina isolates from southern Africa and Texas

    Czech Academy of Sciences Publication Activity Database

    Pažoutová, Sylvie

    2009-01-01

    Roč. 54, č. 3 (2009), s. 217-229. ISSN 0015-5632 Institutional research plan: CEZ:AV0Z50200510 Keywords : phoma sorghina * phytopathogen * originating Subject RIV: EE - Microbiology, Virology Impact factor: 0.978, year: 2009

  17. Diversity and phylogeny of insect trypanosomatids: all that is hidden shall be revealed

    Czech Academy of Sciences Publication Activity Database

    Maslov, D. A.; Votýpka, Jan; Yurchenko, V.; Lukeš, Julius

    2013-01-01

    Roč. 29, č. 1 (2013), s. 43-52. ISSN 1471-4922 R&D Projects: GA ČR GA204/09/1667 Institutional support: RVO:60077344 Keywords : biodiversity * Kinetoplastea * insect trypanosomatids * monoxenous parasites * phylogeny * taxonomy * Trypanosomatidae Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 6.217, year: 2013

  18. Formation of the reverse micelles of cetyl trimethylammonium bromide in chloroform and their behavior at subzero temperatures

    Czech Academy of Sciences Publication Activity Database

    Klíčová, L.; Šebej, P.; Štacko, P.; Filippov, Sergey K.; Klán, P.

    Philadelphia : American Chemical Society, 2012. s.103-COLL 217. [American Chemical Society National Meeting /244./ & Exposition - Materials for Health & Medicine. 19.08.2012-23.08.2012, Philadelphia] R&D Projects: GA ČR GAP108/12/0640 Institutional support: RVO:61389013 Keywords : aggregation * reverse micelles Subject RIV: CD - Macromolecular Chemistry

  19. Birth Order and Maladaptive Behavior in School-Aged Children.

    Science.gov (United States)

    Carmichael, Karla D.

    Drawing on Alfred Adler's theories on the effect of birth order on maladaptive behavior in children, this study focused on the relationship between birth order and the referral to counseling of school-aged children with maladaptive disorder. School-aged children (N=217) with academic or behavioral problems, ages 5 to 18, were referred to the staff…

  20. Population genetic structure of Myotis alcathoe, Myotis mystacinus and Myotis brandtii in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Zima Jr., Jan; Lučan, R. K.; Bryja, Josef

    Brno: Ústav biologie obratlovců AV ČR, 2012 - (Bryja, J.; Albrechtová, J.; Tkadlec, E.). s. 217 ISBN 978-80-87189-11-5. [Zoologické dny. 09.02.2012-10.02.2012, Olomouc] Institutional research plan: CEZ:AV0Z60930519 Keywords : bats * genetics Subject RIV: EG - Zoology

  1. WNS a letová aktivita netopýrů během hibernace

    Czech Academy of Sciences Publication Activity Database

    Zukal, Jan; Berková, Hana; Madaraszová, J.

    Brno: Ústav biologie obratlovců AV ČR, 2012 - (Bryja, J.; Albrechtová, J.; Tkadlec, E.). s. 217-218 ISBN 978-80-87189-11-5. [Zoologické dny. 09.02.2012-10.02.2012, Olomouc] Institutional research plan: CEZ:AV0Z60930519 Keywords : White-nose syndrome * bats Subject RIV: EG - Zoology

  2. Crystallization of a flavodoxin involved in nitrogen fixation in Rhodobacter capsulatus

    OpenAIRE

    Pérez-Dorado, Inmaculada; Bortolotti, Ana; Cortez, Néstor; Hermoso, Juan A.

    2008-01-01

    The flavodoxin NifF from R. capsulatus, a candidate for nitrogenase reduction during nitrogen fixation, has been crystallized using the hanging-drop vapour-diffusion method. Preliminary X-ray data processing at 2.17 Å resolution allowed determination of the crystal system and unit-cell parameters.

  3. AcEST: DK951698 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ribosomal protein S18 OS=Aequipecten ir... 217 3e-56 sp|P49202|RS18_CHLRE 40S ribosomal protein S18 OS=Chlam...RHYWGLRVRGQH 426 RGLRHYWGLRVRGQH Sbjct: 121 RGLRHYWGLRVRGQH 135 >sp|Q8IT98|RS18_AEQIR 40S ribosomal protein S18 OS=Aequip

  4. AcEST: DK955115 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=Branchiostoma ... 224 3e-58 sp|Q8IT98|RS18_AEQIR 40S ribosomal protein S18 OS=Aequipecten ir... 217 3e-5...GLRVRGQH 135 >sp|Q8IT98|RS18_AEQIR 40S ribosomal protein S18 OS=Aequipecten irradians GN=RPS18 PE=2 SV=1 Len

  5. Resolution of the Diagnosis among Parents of Children with Autism Spectrum Disorder: Associations with Child and Parent Characteristics

    Science.gov (United States)

    Milshtein, Shahaf; Yirmiya, Nurit; Oppenheim, David; Koren-Karie, Nina; Levi, Shlomit

    2010-01-01

    Resolution with the diagnosis of one's child involves coming to terms with and accepting the diagnosis and its implications. Parental resolution with the diagnosis was examined among 61 mothers and 60 fathers of 61 children with autism spectrum disorders aged 2-17 years. We investigated resolution rates and subtypes, and associations between…

  6. Size selective feeding in ICyclidium glaucoma/I (Ciliophora, Scuticociliatida) and its effects on bacterial community structure: a study from a continuous cultivation system

    Czech Academy of Sciences Publication Activity Database

    Posch, T.; Jezbera, Jan; Vrba, Jaroslav; Šimek, Karel; Pernthaler, J.; Andreatta, S.; Sonntag, B.

    2001-01-01

    Roč. 42, - (2001), s. 217-227. ISSN 0095-3628 Grant ostatní: ANB(AT) OENB6513; AKTION(AT) projects23p5; AKTION(AT) 2000/22 Keywords : protozoa * bacteria * predator-prey relation Subject RIV: EE - Microbiology, Virology Impact factor: 2.891, year: 2001

  7. Personal ways of handling everyday life

    DEFF Research Database (Denmark)

    Jensen, Lasse Meinert

    variations in everyday life pursuits:  How does a person's pursuit of goals and concerns lead him/her to experience and handle breaks, interruptions, and variation in everyday activities?  The research project so far holds quantitative data.  A convenient sample of 217 persons were administered a...

  8. Schlieren Movies of the 8-Inch Diameter Rigid Parachute Model of the Cook Research Laboratory Taken During the Fourth Phase of Testing in the Langley Unitary Plan Wind Tunnel

    Science.gov (United States)

    1958-01-01

    Canopy Model IV was tested in four different configuration series. Shroud lines were used in the first three series of tests; none were used in the fourth series. Other variables were Mach number (1.77, 2.17, 2.76), dynamic pressure (290, 250, 155 lb per sq ft), camera speed, and attitude.

  9. Activation of macrophages by food proteins: gluten, gliadin and their fragments

    Czech Academy of Sciences Publication Activity Database

    Tučková, Ludmila; Tlaskalová, Helena; Flegelová, Z.; Zídek, Z.

    Elsevier. Roč. 73, 2,3 (2000), s. 217. ISSN 0165-2478. [European Immunology Meeting EFIS 2000 /14./. 23.09.2000-27.09.2000, Poznaň] Institutional research plan: CEZ:AV0Z5020903 Subject RIV: EC - Immunology

  10. Aeronautical engineering: A continuing bibliography with indexes (supplement 318)

    Science.gov (United States)

    1995-01-01

    This bibliography lists 217 reports, articles, and other documents introduced into the NASA scientific and technical information system in June 1995. Subject coverage includes: design, construction and testing of aircraft and aircraft engines; aircraft components, equipment, and systems; ground support systems; and theoretical and applied aspects of aerodynamics and general fluid dynamics.

  11. Aeronautical engineering: A continuing bibliography with indexes (supplement 315)

    Science.gov (United States)

    1995-01-01

    This bibliography lists 217 reports, articles, and other documents introduced into the NASA scientific and technical information system in Mar. 1995. Subject coverage includes: design, construction and testing of aircraft and aircraft engines; aircraft components, equipment, and systems; ground support systems; and theoretical and applied aspects of aerodynamics and general fluid dynamics.

  12. 50 CFR 14.22 - Certain antique articles.

    Science.gov (United States)

    2010-10-01

    ....22 Certain antique articles. Any person may import at any Customs Service port designated for such purpose, any article (other than scrimshaw, defined in 16 U.S.C 1539(f)(1)(B) and 50 CFR 217.12 as any art... 50 Wildlife and Fisheries 1 2010-10-01 2010-10-01 false Certain antique articles. 14.22 Section...

  13. Geophysical prospection and rescue archaeological excavation of subsurface WWII remains in the foreland of brown coal mines in northwestern Bohemia

    Czech Academy of Sciences Publication Activity Database

    Křivánek, Roman; Čech, Petr; Soukup, Michal B.

    2015-01-01

    Roč. 53, č. 2015 (2015), s. 217-222. ISSN 0066-5924. [International Conference on Archaeological Prospection /11./. Warszawa, 15.09.2015-19.09.2015] Institutional support: RVO:67985912 Keywords : archaeological prospection * archaeological investigation * WWII * magnetometry * anti- aircraft defense Subject RIV: AC - Archeology, Anthropology, Ethnology

  14. Herbal medicine use among Turkish patients with chronic diseases

    Directory of Open Access Journals (Sweden)

    Munevver Tulunay

    2015-09-01

    Conclusions: In this study herbal medicine use was found to be higher among patients who had been diagnosed with chronic diseases. Therefore physicians should be aware of herbal medicine usage of their patients and inform them about the effectivity and side effects of herbal medicines. [J Intercult Ethnopharmacol 2015; 4(3.000: 217-220

  15. Emócie a presvedčenia

    Czech Academy of Sciences Publication Activity Database

    Hvorecký, Juraj

    Opava : Slezská univerzita, Filozoficko-přírodovědecká fakulta, Ústav informatiky, 2005 - (Kelemen, J.; Kvasnička, V.; Pospíchal, J.), s. 217-222 ISBN 80-7248-310-2. - (1) Institutional research plan: CEZ:AV0Z90090514 Keywords : Emotions * Convictions Subject RIV: AA - Philosophy ; Religion

  16. Kompozitní materiály na bázi syntetického hydrogelu a bakteriální celulózy

    Czech Academy of Sciences Publication Activity Database

    Hobzová, Radka; Dušková-Smrčková, Miroslava; Karpushkin, Evgeny; Michálek, Jiří; Gatenholm, P.

    2011-01-01

    Roč. 7, č. 13 (2011), s. 216-217. ISSN 1336-7242. [Zjazd chemikov /63./. 05.09.2011-09.09.2011, Tatranské Matliare] R&D Projects: GA MŠk 1M0538 Institutional research plan: CEZ:AV0Z40500505 Keywords : bacterial cellulose * hydrogel * methacrylates Subject RIV: FH - Neurology

  17. Revenue and efficiency in multi-unit uniform-price auctions

    Czech Academy of Sciences Publication Activity Database

    Břeský, Michal

    2013-01-01

    Roč. 82, November (2013), s. 205-217. ISSN 0899-8256 R&D Projects: GA ČR(CZ) GAP402/11/1531 Institutional support: RVO:67985998 Keywords : multi-unit auction * multiple-object auction * market efficiency Subject RIV: AH - Economic s Impact factor: 1.025, year: 2013

  18. Coexistence Properties of Higher n-Alkanes Modelled as Kihara Fluids: Gibbs Ensemble Simulations

    Czech Academy of Sciences Publication Activity Database

    Kettler, M.; Vörtler, H. L.; Nezbeda, Ivo; Strnad, Martin

    2001-01-01

    Roč. 181, 1-2 (2001), s. 83-94. ISSN 0378-3812 R&D Projects: GA ČR GA203/99/0134 Institutional research plan: CEZ:AV0Z4072921 Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.217, year: 2001

  19. 12 CFR 211.5 - Edge and agreement corporations.

    Science.gov (United States)

    2010-01-01

    ... and Q (12 CFR parts 204 and 217) in the same manner and to the same extent as if the Edge or agreement... (12 CFR part 204), and other Edge and agreement corporations; (3) Money-market instruments (including... (12 CFR 208.62). (l) Protection of customer information and consumer information. An Edge or...

  20. AcEST: BP917226 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_H09 454 Adiantum capillus-veneris mRNA. clone: YMU001_000097_H09. BP917226 CL27Con ... 01 (92%) Frame = -2 Query: 396 KIELGDEVGSFKFTPSTVTVSAGE AIEFALVGETGHNVVLDIPAGAPATVASELKAASMD 217 K+E+GDEVG+ ... FKF P ++TVSAGE A+EF LVGETGHN+V DIPAGAP TVASELKAASMD Sbjct: 2 KVEVG ...

  1. Sisters in the Struggle: African American Female Graduate Students Coping with Racism and Racism-Related

    Science.gov (United States)

    Foster, Kelsie

    2013-01-01

    This study examined if coping was predictive of perceived racism and racism related stress of African American female graduate students. Participants were 217 African American female graduate students attending Predominantly White Institutions (PWIs), Hispanic Serving Institutions (HSIs) and Historically Black Colleges and Universities (HBCUs) and…

  2. Response to cadmium of Daucus carota hairy roots dual cultures with glomus intraradices or Gigaspora margarita

    Czech Academy of Sciences Publication Activity Database

    Janoušková, Martina; Vosátka, Miroslav

    2005-01-01

    Roč. 15, - (2005), s. 217-224. ISSN 0940-6360 R&D Projects: GA ČR(CZ) GA526/02/0293 Institutional research plan: CEZ:AV0Z60050516 Keywords : arbuscular mycorrhiza * heavy metal * monoxenic culture Subject RIV: EF - Botanics Impact factor: 1.753, year: 2005

  3. Swimming against the current: genetic structure, host mobility and the drift paradox in trematode parasites

    Czech Academy of Sciences Publication Activity Database

    Blasco-Costa, Maria Isabel; Waters, J. M.; Poulin, R.

    2012-01-01

    Roč. 21, č. 1 (2012), s. 207-217. ISSN 0962-1083 Institutional support: RVO:60077344 Keywords : freshwater * genetic diversity loss * linear ecosystems * population genetic structure Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 6.275, year: 2012 http://onlinelibrary.wiley.com/doi/10.1111/j.1365-294X.2011.05374.x/pdf

  4. Domain Modeling: NP_001561.3 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_001561.3 chr3 Structural Basis for the Interaction of TAK1 Kinase with its Activ...ating Protein TAB1 p2evaa_ chr3/NP_001561.3/NP_001561.3_holo_194-543.pdb psi-blast 216I,217S,218Q,219G,224V,

  5. Domain Modeling: NP_071911.3 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_071911.3 chr10 Solution structure of the tandem four zf-C2H2 domain repeats of m...urine GLI-Kruppel family member HKR3 c2dlqa_ chr10/NP_071911.3/NP_071911.3_holo_111-217.pdb psi-blast 112C,1

  6. The Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Mansfeldová, Zdenka

    3. Cheltenham, Northampton : Edward Elgar, 2013 - (Berglund, S.; Ekman, J.; Deegan-Krause, K.; Knutsen, T.), s. 217-253 ISBN 978-0-85793-537-3 Institutional support: RVO:68378025 Keywords : cleavages * political change * Eastern Europe Subject RIV: AD - Politology ; Political Sciences

  7. Coordination of auxin and ethylene biosynthesis by the aminotransferase VAS1

    Czech Academy of Sciences Publication Activity Database

    Zheng, Z.Y.; Guo, Y.X.; Novák, Ondřej; Dai, X.H.; Zhao, Y.D.; Ljung, K.; Noel, J.P.; Chory, J.

    2013-01-01

    Roč. 9, č. 4 (2013), s. 244-246. ISSN 1552-4450 R&D Projects: GA AV ČR KAN200380801 Institutional research plan: CEZ:AV0Z50380511 Keywords : PLANT DEVELOPMENT * SHADE AVOIDANCE * ARABIDOPSIS Subject RIV: EC - Immunology Impact factor: 13.217, year: 2013

  8. Role of nitric oxide in plant development

    Czech Academy of Sciences Publication Activity Database

    Procházková, Dagmar; Wilhelmová, Naděžda

    Boca Raton : CRC Press, 2014, s. 217-226. ISBN 978-1-4665-5328-6 R&D Projects: GA ČR(CZ) GAP501/11/1239 Institutional support: RVO:61389030 Keywords : NO Biosynthesis * Plant Development * signaling molecules Subject RIV: EF - Botanics http://www.crcpress.com/product/isbn/9781466553286

  9. KAPPA: A Package for Synthesis of Optically Thin Spectra for the Non-Maxwellian kappa-distributions Based on the Chianti Database

    Czech Academy of Sciences Publication Activity Database

    Dzifčáková, Elena; Dudík, Jaroslav; Kotrč, Pavel; Fárník, František; Zemanová, Alena

    2015-01-01

    Roč. 217, č. 1 (2015), 14/1-14/14. ISSN 0067-0049 R&D Projects: GA ČR GAP209/12/1652 Institutional support: RVO:67985815 Keywords : numerical method * radiation mechanisms * coronae Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 11.215, year: 2014

  10. A Resurgence in Field Research is Essential to Better Understand the Diversity, Ecology, and Evolution of Microbial Eukaryotes

    Czech Academy of Sciences Publication Activity Database

    Heger, T.J.; Edgcomb, V.P.; Kim, E.; Lukeš, Julius; Leander, B. S.; Yubuki, N.

    2014-01-01

    Roč. 61, č. 2 (2014), s. 214-223. ISSN 1066-5234 Institutional support: RVO:60077344 Keywords : Algae * culture * food webs * microscopy * molecular phylogenetics * next-generation sequencing * protist Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.217, year: 2014

  11. Bayesian Filters in Practice

    Czech Academy of Sciences Publication Activity Database

    Krejsa, Jiří; Věchet, S.

    Bratislava: Slovak University of Technology in Bratislava, 2010, s. 217-222. ISBN 978-80-227-3353-3. [Robotics in Education . Bratislava (SK), 16.09.2010-17.09.2010] Institutional research plan: CEZ:AV0Z20760514 Keywords : mobile robot localization * bearing only beacons * Bayesian filters Subject RIV: JD - Computer Applications, Robotics

  12. Extending Campus Life to the Internet: Social Media, Discrimination, and Perceptions of Racial Climate

    Science.gov (United States)

    Tynes, Brendesha M.; Rose, Chad A.; Markoe, Suzanne L.

    2013-01-01

    Despite the fact that more college student interaction now takes place online, researchers have yet to examine the role the Internet plays in perceptions of campus racial climate. Using an online survey of a sample of 217 African American and European American college students, this study explored online factors including intergroup interaction as…

  13. A simulation study of the effect of soil water balance andwater stress on winter wheat production under different climate change scenarios

    Czech Academy of Sciences Publication Activity Database

    Eitzinger, J.; Šťastná, M.; Žalud, Z.; Dubrovský, Martin

    2003-01-01

    Roč. 61, - (2003), s. 195-217. ISSN 0378-3774 R&D Projects: GA ČR GA521/99/D040 Institutional research plan: CEZ:AV0Z3042911 Keywords : water stress effect * soil water balance * DSSAT crop model Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 0.865, year: 2003

  14. Promoting Teachers' Generalization of Intervention Use through Goal Setting and Performance Feedback

    Science.gov (United States)

    Duncan, Neelima G.; Dufrene, Brad A.; Sterling, Heather E.; Tingstrom, Daniel H.

    2013-01-01

    Consultation is beneficial for increasing teachers' intervention use for target students. However, little is known about teachers' generalized intervention use. This study is a systematic replication of Riley-Tillman and Eckert ("J Educ Psychol Consult" 12:217-241, 2001) and Martens et al. ("Sch Psychol Q" 12:33-41,…

  15. Implications of geomorphological research for recent and prehistoric avalanches and related hazards at Huascaran, Peru

    Czech Academy of Sciences Publication Activity Database

    Klimeš, Jan; Vilímek, V.; Omelka, M.

    2009-01-01

    Roč. 50, č. 1 (2009), s. 193-209. ISSN 0921-030X Institutional research plan: CEZ:AV0Z30460519 Keywords : rock debris avalanches * natural hazards * Huascaran Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 1.217, year: 2009

  16. Keeping It Frat: Exploring the Interaction among Fraternity Membership, Disinhibition, and Hypermasculinity on Sexually Aggressive Attitudes in College-Aged Males

    Science.gov (United States)

    Corprew, Charles S., III.; Mitchell, Avery D.

    2014-01-01

    This study examines correlates that contribute to sexually aggressive attitudes toward women. Using a sample that includes 217 college males from 3 southern universities, the study evaluates the relationship between college men's hypermasculine and sexually aggressive attitudes, as well as how fraternity membership and disinhibition moderate…

  17. Voltage clamp analysis of ajmaline-induced block of potassium currents in ventricular myocytes

    Czech Academy of Sciences Publication Activity Database

    Bahníková, M.; Matějovič, P.; Pásek, Michal; Šimurdová, M.; Šimurda, J.

    Brno : Brno University of Technology, 2002 - (Jan, J.; Kozumplík, J.; Provazník, I.), s. 217-219 ISBN 80-214-2633-0. ISSN 1211-412X. [Biosignal 2002. Brno (CZ), 26.06.2002-28.06.2002] Institutional research plan: CEZ:AV0Z2076919 Keywords : cardiac cell * potassium currents * ajmaline Subject RIV: BO - Biophysics

  18. Raman and IR phonons in ferroelectric Sr.sub.0.35./sub.Ba.sub.0.69./sub.Nb.sub.2./sub.O.sub.6.04./sub. single crystals

    Czech Academy of Sciences Publication Activity Database

    Buixaderas, Elena; Gregora, Ivan; Hlinka, Jiří; Dec, J.; Lukasiewicz, T.

    2013-01-01

    Roč. 86, 2-3 (2013), s. 217-229. ISSN 0141-1594 R&D Projects: GA ČR GAP204/10/0616 Institutional research plan: CEZ:AV0Z10100520 Keywords : ferroelectrics * Raman spectroscopy * IR spectroscopy * phonons * relaxors * tungsten-bronze materials Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.044, year: 2013

  19. Colorectal carcinoma: Importance of colonic environment for anti-cancer response and systemic immunity

    Czech Academy of Sciences Publication Activity Database

    Vannucci, Luca; Štěpánková, Renata; Grobárová, Valeria; Kozáková, Hana; Rossmann, Pavel; Klimešová, Klára; Benson, Veronika; Šíma, Petr; Fišerová, Anna; Tlaskalová, Helena

    2009-01-01

    Roč. 6, č. 4 (2009), s. 217-226. ISSN 1547-691X R&D Projects: GA AV ČR IAA500200509; GA AV ČR IAA500200917 Institutional research plan: CEZ:AV0Z50200510 Keywords : mucosal immunity * gut microbiota * tolerance Subject RIV: EC - Immunology Impact factor: 1.218, year: 2009

  20. Comparing Overexcitabilities of Gifted and Non-Gifted School Children in Hong Kong: Does Culture Make a Difference?

    Science.gov (United States)

    Siu, Angela F. Y.

    2010-01-01

    Overexcitabilities (OEs) are ways that an individual experiences the world and can be understood as channels of information flow. The current study examined the profile of OEs among a group of Hong Kong children. Participants included 229 non-gifted and 217 gifted children. OEs were measured using the Overexcitability Questionnaire II. Results…

  1. Eko-průmysl v České republice

    Czech Academy of Sciences Publication Activity Database

    Tošovská, Eva; Ritschelová, I.

    Pardubice: Univerzita Pardubice, 2006, s. 217-223. ISBN 80-7194-866-7. [The system of accounting and reporting for sustainable development at microeconomic and macreconomic levels. Brno (CZ), 22.05.2006-24.05.2006] Institutional research plan: CEZ:AV0Z70850503 Keywords : environmental accounting and reporting * sustainable development Subject RIV: AH - Economics

  2. Eco-Industry in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Tošovská, Eva; Ritschelová, I.

    Pardubice: University of Pardubice, 2006, s. 212-217. ISBN 80-7194-867-5. [The system of accounting and reporting for sustainable development at microeconomic and macreconomic levels. Brno (CZ), 22.05.2006-24.05.2006] Institutional research plan: CEZ:AV0Z70850503 Keywords : environmental accounting and reporting * sustainable development Subject RIV: AH - Economics

  3. New approach of data mining from the complex impedance plane: parameters you have always wanted to have

    Czech Academy of Sciences Publication Activity Database

    Macák, J. M.; Patil, D. S.; Fraenkl, M.; Zima, Vítězslav; Shimakawa, K.; Wágner, T.

    2014-01-01

    Roč. 61, č. 1 (2014), s. 217-221. ISSN 1938-5862. [ECS Meeting /225./. Orlando, 11.05.2014-15.05.2014] Institutional support: RVO:61389013 Keywords : impedance * random-walk approach * conductivity Subject RIV: CA - Inorganic Chemistry

  4. Implementing E-Learning Designed Courses in General Education

    Science.gov (United States)

    Nuangchalerm, Prasart; Sakkumduang, Krissada; Uhwha, Suleepornn; Chansirisira, Pacharawit

    2014-01-01

    The aim of this study is to implement e-learning designed course for general education. The study employed 3 phases for developing e-learning course: contextual study, designing, and implementing. Two courses general education, 217 undergraduate students are participated the study. Research tool consisted of interview about e-learning form and…

  5. 76 FR 13631 - Food and Drug Administration Modernization Act of 1997: Modifications to the List of Recognized...

    Science.gov (United States)

    2011-03-14

    .... Radiology 12-122 12-217 IEC 62083 Edition Withdrawn and 2.0:2009-09 Medical replaced with electrical newer... lens design modifications. H. Radiology 12-219 Medical electrical IEC 60336 (Fourth equipment--X-ray... of February 25, 1998 (63 FR 9561), FDA announced the availability of a guidance...

  6. 78 FR 61827 - Reef Fish Fishery of the Gulf of Mexico; 2013 Recreational Accountability Measure and Closure for...

    Science.gov (United States)

    2013-10-04

    ..., and the recreational ACT of 217,100 lb (98,475 kg), round weight (78 FR 27084, May 9, 2013), as... National Oceanic and Atmospheric Administration 50 CFR Part 622 RIN 0648-XC669 Reef Fish Fishery of the... measure (AM) for recreational gray triggerfish in the Gulf of Mexico (Gulf) reef fish fishery for the...

  7. 76 FR 40701 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2011-07-11

    ... technical and logistics support services, tools and test equipment, and other related elements of logistics... equipment, U.S. Government and contractor technical and logistics support services, tools and test equipment, and other related elements of logistics support. The estimated cost is $217 million. This...

  8. 76 FR 66044 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2011-10-25

    ... contractor engineering and logistics personnel support services, and other related elements of logistics... logistics personnel support services, and other related elements of logistics support. The estimated cost is... ALQ-217 Electronic Support Measure Systems. In addition, this proposed sale will include related...

  9. 50 CFR 216.45 - General Authorization for Level B harassment for scientific research.

    Science.gov (United States)

    2010-10-01

    ...) of the ESA and implementing regulations at 50 CFR parts 217-227, particularly at § 222.23 through... et seq.) and implementing regulations (50 CFR part 216), I hereby notify the National Marine... is subject to the requirements of 15 CFR part 904....

  10. Endemism

    NARCIS (Netherlands)

    Vidal, J.E.

    1969-01-01

    In the Flore générale de l’Indochine, 217 families have been described, 1794 genera, c. 9000 species. There is an amount of endemism, on the basis of which attempts have been made towards an inner subdivision of the region. The problem is, that the endemism is of uncertain status. A few percentages

  11. Vysoká škola politických a hospodářských věd 1949-1953

    Czech Academy of Sciences Publication Activity Database

    Devátá, Markéta

    Praha : Wolters Kluwer, 2011, s. 217-225 ISBN 978-80-7357-641-7 R&D Projects: GA ČR GAP410/10/2060 Institutional research plan: CEZ:AV0Z80630520 Keywords : college * teaching economics Subject RIV: AB - History

  12. A Simple Real Business Cycle Model of the Czech Economy

    Czech Academy of Sciences Publication Activity Database

    Baxa, Jaromír

    Bratislava : University of Economics in Bratislava, 2008, s. 28-38 ISBN 978-80-8078-217-7. [Quantitative Methods in Economics: Multiplie Criteria Decision Making XIV. Tatranská Lomnica (SK), 05.07.2008-07.07.2008] Institutional research plan: CEZ:AV0Z10750506 Keywords : real business cycle * DSGE model * Kdylant-Prescott filter * Czech economy Subject RIV: AH - Economics

  13. Genome-wide association analysis in primary sclerosing cholangitis identifies two non-HLA susceptibility loci

    NARCIS (Netherlands)

    E. Melum; A. Franke; C. Schramm; T.J. Weismüller; D.N. Gotthardt; F.A. Offner; B.D. Juran; J.K. Laerdahl; V. Labi; E. Björnsson; R.K. Weersma; L. Henckaerts; A. Teufel; C. Rust; E. Ellinghaus; T. Balschun; K.M. Boberg; D. Ellinghaus; A. Bergquist; P. Sauer; E. Ryu; J.R. Hov; J. Wedemeyer; B. Lindkvist; M. Wittig; R.J. Porte; K. Holm; C. Gieger; H.E. Wichmann; P. Stokkers; C.Y. Ponsioen; H. Runz; A. Stiehl; C. Wijmenga; M. Sterneck; S. Vermeire; U. Beuers; A. Villunger; E. Schrumpf; K.N. Lazaridis; M.P. Manns; S. Schreiber; T.H. Karlsen

    2011-01-01

    Primary sclerosing cholangitis (PSC) is a chronic bile duct disease affecting 2.4-7.5% of individuals with inflammatory bowel disease. We performed a genome-wide association analysis of 2,466,182 SNPs in 715 individuals with PSC and 2,962 controls, followed by replication in 1,025 PSC cases and 2,17

  14. 75 FR 41579 - Submitting Airline Data via the Internet

    Science.gov (United States)

    2010-07-16

    ..., traffic, operational, and consumer reports to BTS via the Internet on December 20, 2006, (71 FR 76226.... 12866: Regulatory and Planning Review Under Executive Order No. 12866, (58 FR 51735, October 4, 1993... Transportation 14 CFR Parts 217, 234, 241, et al. Submitting Airline Data via the Internet; Final Rule...

  15. Birth Defects in Newborns: Spina Bifida Index at Rio Grande Do Norte State in Brazil

    Directory of Open Access Journals (Sweden)

    Arnaldo CM Junior

    2014-08-01

    Conclusion: Northeast region is the one that has the major incidence of SB in Brazil country, but RN state has a number lower than others states from its region. It was made an update about therapeutic options to minimize the morbidity and mortality in newborn with SB congenital defects. [J Interdiscipl Histopathol 2014; 2(4.000: 217-223

  16. A prospective study on parental coping 4 months after termination of pregnancy for fetal anomalies

    NARCIS (Netherlands)

    Korenromp, M. J.; Page-Christiaens, G. C. M. L.; van den Bout, J.; Mulder, E. J. H.; Hunfeld, J. A. M.; Potters, C. M. A. A.; Erwich, J. J. H. M.; van Binsbergen, C. J. M.; Brons, J. T. J.; Omtzigt, A. W. J.; Visser, G. H. A.; Beekhuis, J.R.

    2007-01-01

    Objective To identify short-term factors influencing psychological outcome of termination of pregnancy for fetal anomaly, in order to define those patients most vulnerable to psychopathology. Study Design A prospective cohort of 217 women and 169 men completed standardized questionnaires 4 months af

  17. Academic Achievements and Study Habits of College Students of District Pulwama

    Science.gov (United States)

    Bhat, Younis Illahi; Khandai, Hemant

    2016-01-01

    This study was undertaken to study the academic achievement and study habits of male and female college students of district Pulwama (J and k). The sample for the study was 410 including 193 male and 217 female college students .which was further divided into different groups of rural-urban dichotomy. For this purpose descriptive survey method was…

  18. High School Social Climate and Antisocial Behavior: A 10 Year Longitudinal and Multilevel Study

    Science.gov (United States)

    Leblanc, Line; Swisher, Raymond; Vitaro, Frank; Tremblay, Richard E.

    2008-01-01

    A longitudinal and multilevel approach is used to examine the relationship between antisocial behavior during adolescence and high school social climate. The data are taken from a longitudinal study of 1,233 boys and girls who attended 217 public and private high schools. Students' disruptive behaviors were assessed yearly from 6 to 12 years of…

  19. 40 CFR Appendix A to Part 7 - Types of EPA Assistance as Listed in the “Catalog of Federal Domestic Assistance”

    Science.gov (United States)

    2010-07-01

    ... under the Resource Conservation and Recovery Act of 1976; as amended by the Solid Waste Disposal Act...) 13. Assistance provided by the Office of Research and Development under the Solid Waste Disposal Act... 1977, as amended; Pub. L. 95-217; 33 U.S.C. 1251 et seq.; Solid Waste Disposal Act, as amended by...

  20. Analysis of natural isolates of Lactobacilli resistant to bacteriocin nisin

    Directory of Open Access Journals (Sweden)

    Strahinić Ivana D.

    2005-01-01

    Full Text Available The collection of lactic acid bacteria (LAB was made by isolation of microorganisms from fermented products traditionally manufactured in different geographical regions (high mountains, river valleys, seaside, etc. Among collected LAB, 51 isolates were identified as Lactobacillus sp. Results showed that all isolated lactobacilli were mesophilic strains, since they grew at 15°C and 30°C but not at 45°C. Testing the ability of isolated lactobacilli to grow in the presence of nisin revealed that Lactobacillus sp. isolates designed BGCGK4, BGHN40, BGBUK2-8, BGBUK2-7 and BGBUK2-16 were resistant to nisin. Determination of the minimal inhibitory concentrations (MIC for nisin revealed that the most resistant isolate was Lactobacillus sp. BGCGK4. Isolate BGBUK2-16, determined as Lactobacillus paracasei subsp. paracasei, produces bacteriocin, named Bac217 and showed a resistance to 8000 IU/ml of nisin. Plasmid curing of BGBUK2-16 resulted in derivatives BGBUK2-16/K2 and BGBUK2-16/K4. Derivative BGBUK2-16/K2 retained resistance to Bac217 and nisin, but lost the ability to synthesise Bac217. Derivative BGBUK2-16/K4 lost concomitantly the resistance to both Bac217 and nisin.

  1. Crossing the Line: Examination of Student Demographic Changes Concomitant with Declining Academic Performance in Elementary Schools

    Science.gov (United States)

    Hochbein, Craig; Duke, Daniel

    2011-01-01

    The purpose of this study is to examine the relationship between school decline and changes in school demographics. Using a population of 981 (N = 981) elementary schools, the authors identified samples of declining schools: Relational Decline (n = 510), Absolute Decline (n = 217), and Crossing the Line (n = 165). Latent growth models assessed…

  2. Drug: D04613 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D04613 Drug Iridium Ir 192 (USAN); Iriditope (TN) Ir 191.9626 192.217 D04613.gif Radioactive age ... nt CAS: 14694-69-0 PubChem: 47206457 ATOM ... 1 1 Z Ir 21.0700 -16.3100 BOND 0 InChI=1S/Ir/i1+0 ...

  3. Problems of Implementation of Strategic Plans for Secondary Schools' Improvement in Anambra State

    Science.gov (United States)

    Chukwumah, Fides Okwukweka; Ezeugbor, Carol Obiageli

    2015-01-01

    This study investigated the extent of problems of strategic plans implementation for secondary schools' improvement in Anambra State, Nigeria for quality education provision. The study used a descriptive survey design paradigm. Respondents comprised 217 principals. There was no sampling. All the principals were used. Data were collected using…

  4. Developing Quality Strategic Plan in Secondary Schools for Successful School Improvement

    Science.gov (United States)

    Chukwumah, Fides Okwukweka

    2015-01-01

    The study examined the extent to which development of quality strategic plans for Anambra State secondary schools' improvement had been done by schools. The research design used was a descriptive survey. Respondents comprised 217 principals. There was no sampling since all the principals were used. Data were collected using "Schools'…

  5. AcEST: BP920800 [AcEST

    Lifescience Database Archive (English)

    Full Text Available DLNLALQVHSRMVRFGFNAEVEACGALINMYGKCGKVLYAQRVFDDT 298 Query: 206 RQQDVISWNDIISACAQRGHGTEALENFSQMLHEGIVPNSMTFTSVMQA---CNSIEGG...G L +A S F ++ +D+ISW +I +Q EA+ F Sbjct: 217 SEKNEATSNCLINGYMGLGNLEQAESLFNQMPVKDIISWTTMIKGYSQNKRYREAIAVFY 276 Query: 119 QMLHEG...EKAWRIFDGVSCKNLPSWNAIITGCVQGGLLEEAIDLYRHMK 281 Query: 110 HEGIVPNSMTFTSVMQAC---NSIEGGR 36 + + PN +T +V+ AC +...N IIS AQ G +EA+E ++ M Sbjct: 383 DITIGNAVVVMYAKLGLVDSARAVFNWLPNTDVISWNTIISGYAQNGFASEAIEMYNIME 442 Query: 110 HEG...EIDLGEQIHSLSVKTGFESDMYVSGVLIDMYSKYGWLEKARRVLEML 406 Query: 206 RQQDVISWNDIISACAQRGHGTEALENFSQMLHEGIVPNSMTFTSVMQACNSIEGG

  6. Technologie sumerských staveb

    Czech Academy of Sciences Publication Activity Database

    Hanzlíček, Tomáš; Straka, Pavel

    82(133), č. 4 (2003), s. 217-218. ISSN 0042-4544 R&D Projects: GA AV ČR IBS3046004 Institutional research plan: CEZ:AV0Z3046908 Keywords : Sumer * technology of buildings Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass

  7. Ateizm ve Din

    OpenAIRE

    ÜNAL, Yaşar; Martin, Michael

    2013-01-01

    The Cambridge Companion to ATHEISM, Edited by Michael Martin, Cambridge Collections Online ©Cambridge University Press, Printed in the United States of America, 2007, ss.217-232 içerisinde yer alan, “Atheism and Religion” isimli makaleden çevrilmiştir

  8. Expression, crystallization and preliminary X-ray crystallographic analyses of two N-terminal acetyltransferase-related proteins from Thermoplasma acidophilum

    OpenAIRE

    Han, Sang Hee; Ha, Jun Yong; Kim, Kyoung Hoon; Oh, Sung Jin; Kim, Do Jin; Kang, Ji Yong; Yoon, Hye Jin; Kim, Se-Hee; Seo, Ji Hae; Kim, Kyu-Won; Suh, Se Won

    2006-01-01

    An N-terminal acetyltransferase ARD1 subunit-related protein (Ta0058) and an N-terminal acetyltransferase-related protein (Ta1140) from T. acidophilum were crystallized. X-ray diffraction data were collected to 2.17 and 2.40 Å, respectively.

  9. Evaluation of Five Microcomputer CAD Packages.

    Science.gov (United States)

    Leach, James A.

    1987-01-01

    Discusses the similarities, differences, advanced features, applications and number of users of five microcomputer computer-aided design (CAD) packages. Included are: "AutoCAD (V.2.17)"; "CADKEY (V.2.0)"; "CADVANCE (V.1.0)"; "Super MicroCAD"; and "VersaCAD Advanced (V.4.00)." Describes the evaluation of the packages and makes recommendations for…

  10. Geochemical modeling of water-gas-rock interactions. Application to mineral diagenesis in geologic reservoirs; Modelisation geochimique des interactions eau-gaz-roche. Application a la diagenese minerale dans les reservoirs geologiques

    Energy Technology Data Exchange (ETDEWEB)

    Bildstein, O.

    1998-03-13

    The Ph.D. report describes a conceptual and numerical model for simulating gas-water-rock interaction during mineral diagenesis of sediments. The main specific features of this model are the following: applicable to open systems, half-implicit resolution numerical method, feedback on the texture evolution (grain model), existence of a gas phase, oxido-reduction phenomena. (author) 217 refs.

  11. Granitic magma emplacement and deformation during early-orogenic syn-convergent transtension: The Stare Sedlo complex, Bohemian Massif

    Czech Academy of Sciences Publication Activity Database

    Tomek, Filip; Žák, J.; Chadima, Martin

    2015-01-01

    Roč. 87, JUL (2015), s. 50-66. ISSN 0264-3707 Institutional support: RVO:67985831 Keywords : anisotropy of magnetic susceptibility (AMS) * Bohemian Massif * pluton emplacement * granite * transtension * Variscan orogeny Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.217, year: 2014

  12. 75 FR 2833 - Safety Zones; Hydroplane Races Within the Captain of the Port Puget Sound Area of Responsibility

    Science.gov (United States)

    2010-01-19

    ... Federal Register (73 FR 3316). Public Meeting We do not now plan to hold a public meeting. But you may...-speed watercraft races on navigable waterways during these events. DATES: Comments and related material...-217-6175, e-mail SectorSeattleWWM@uscg.mil . If you have questions on viewing or submitting...

  13. Planck early results. XVIII. The power spectrum of cosmic infrared background anisotropies

    DEFF Research Database (Denmark)

    Bucher, M.; Delabrouille, J.; Giraud-Héraud, Y.; Patanchon, G.; Piat, M.; Remazeilles, M.; Rosset, C.; Stompor, R.; Hobson, M.; Stolyarov, V.; Bhatia, R.; Blagrave, K.; Bond, J.R.; Martin, P.; Helou, G.; Shellard, P.; Yvon, D.; Linden-Vørnle, Michael; Nørgaard-Nielsen, Hans Ulrik; Toffolatti, L.; Netterfield, C.B.; Pinheiro Gonçalves, D.; Scott, D.; Oliver, S.; Juvela, M.; Keihänen, E.; Chiang, C.; Jones, W.C.; Cayón, L.; White, M.; Knox, L.; Lubin, P.M.; Zonca, A.; Matarrese, S.; De Bernardis, P.; Masi, S.; Melchiorri, A.; Piacentini, F.; Gregorio, A.; Balbi, A.; Cabella, P.; De Gasperis, G.; Mazzotta, P.; Vittorio, N.; Kneissl, R.; Dupac, X.; Mendes, L.; Giardino, G.; Laureijs, R.J.; Leonardi, R.; Tauber, J.A.; Kurki-Suonio, H.; Poutanen, T.; Umana, G.; Bonaldi, A.; Polenta, G.; Frailis, M.; Galeotta, S.; Maris, M.; Mennella, A.; Pasian, F.; Zacchei, A.; Burigana, C.; Cuttaia, F.; De Rosa, A.; Finelli, F.; Franceschi, E.; Gruppuso, A.; Mandolesi, N.; Morgante, G.; Natoli, P.; Ricciardi, S.; Sandri, M.; Terenzi, L.; Valenziano, L.; Villa, F.; Bersanelli, M.; Maino, D.; Tomasi, M.; Stivoli, F.; Désert, F.-X.; Chamballu, A.; Clements, D.L.; Jaffe, A.H.; Mortlock, D.; Novikov, D.; Rowan-Robinson, M.; Ganga, K.; Rusholme, B.; Benoît, A.; Aghanim, N.; Aumont, J.; Dole, H.; Douspis, M.; Grain, J.; Lagache, G.; Miville-Deschênes, M.-A.; Pajot, F.; Ponthieu, N.; Puget, J.-L.; Torre, J.-P.; Benabed, K.; Bouchet, F.R.; Colombi, S.; Delouis, J.-M.; Hivon, E.; Moneti, A.; Prunet, S.; Sygnet, J.-F.; Wandelt, B.D.; Fosalba, P.; Chiang, L.-Y.; Efstathiou, G.; Donzelli, S.; Eriksen, H.K.; Hansen, F.K.; Lilje, P.B.; Hoyland, R.J.; Rubiño-Martín, J.A.; Barreiro, R.B.; Herranz, D.; López-Caniego, M.; Martínez-González, E.; Vielva, P.; Bartlett, J.G.; Bock, J.J.; Doré, O.; Holmes, W.A.; Keskitalo, R.; Lawrence, C.R.; Mitra, S.; O'Dwyer, I.J.; Prézeau, G.; Rocha, G.; Seiffert, M.D.; Wade, L.A.; Davies, R.D.; Davis, R.J.; Maffei, B.; Ashdown, M.; Challinor, A.; Gratton, S.; Harrison, D.; Lasenby, A.; MacTavish, C.J.; Catalano, A.; Coulais, A.; Lamarre, J.-M.; Arnaud, M.; Starck, J.-L.; Cardoso, J.-F.; Hildebrandt, S.R.; MacÍas-Pérez, J.F.; Perotto, L.; Renault, C.; Santos, D.; Couchot, F.; Henrot-Versillé, S.; Perdereau, O.; Plaszczynski, S.; Tristram, M.; Kisner, T.S.; Smoot, G.F.; Dörl, U.; Enßlin, T.A.; Hovest, W.; Matthai, F.; Rachen, J.P.; Reinecke, M.; Riller, T.; Tuovinen, J.; Lockman, F.J.; Murphy, A.; Christensen, P.R.; Naselsky, P.; Novikov, I.; Crill, B.P.; Savini, G.; Baccigalupi, C.; Bonavera, L.; Danese, L.; De Zotti, G.; González-Nuevo, J.; Leach, S.; Perrotta, F.; Mann, R.; Ade, P.A.R.; Munshi, D.; Sudiwala, R.; Sunyaev, R.; Borrill, J.; Osborne, S.; Banday, A.J.; Bernard, J.-P.; Forni, O.; Giard, M.; Leroy, C.; Montier, L.; Pointecouteau, E.; Ristorcelli, I.; Reach, W.T.; Battaner, E.; Huffenberger, K.M.; Górski, K.M.

    2011-01-01

    Using Planck maps of six regions of low Galactic dust emission with a total area of about 140 deg2, we determine the angular power spectra of cosmic infrared background (CIB) anisotropies from multipole = 200 to = 2000 at 217, 353, 545 and 857 GHz. We use 21-cm observations of Hi as a tracer of t...

  14. Radiation hybrid mapping of the porcine AMPD1, PKLR and CHRNB2 genes to chromosome 4

    Czech Academy of Sciences Publication Activity Database

    Stratil, Antonín; Van Poucke, M.; Peelman, L. J.; Kopečný, Michal

    2003-01-01

    Roč. 48, č. 7 (2003), s. 275-278. ISSN 1212-1819 R&D Projects: GA ČR GA523/00/0669 Institutional research plan: CEZ:AV0Z5045916 Keywords : pig * radiation hybrid mapping Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.217, year: 2003

  15. First experiences from Copenhagen with paediatric single photon emission computed tomography/computed tomography

    DEFF Research Database (Denmark)

    Mortensen, Jann; Bech, Birthe Højlund; Højgaard, Liselotte;

    2011-01-01

    OBJECTIVE: This study evaluates the diagnostic value of single photon emission computed tomographic (SPECT)/multislice computed tomographic (MSCT) fusion images compared with planar scintigraphy in children. METHODS: Fifteen children [eight girls, mean age 13 years (range 2-17 years)] who were...

  16. MULTIPLEXED IMMUNOASSAYS FOR SIMULTANEOUS QUANTIFICATION OF CARDIOVASCULAR BIOMARKERS IN THE MODEL OF H-G-NITRO-L-ARGININE METHYLESTER (L-NAME) HYPERTENSIVE RAT

    Czech Academy of Sciences Publication Activity Database

    Adamcova, M.; Růžičková, Šárka; Simko, F.

    2013-01-01

    Roč. 64, č. 2 (2013), s. 211-217. ISSN 0867-5910 Institutional research plan: CEZ:AV0Z50520701 Keywords : cardiac biomarkers * multiplex assay * cardiac troponin Subject RIV: ED - Physiology Impact factor: 2.720, year: 2013

  17. Phylogeny, Diversity, Distribution, and Host Specificity of Haemoproteus spp. (Apicomplexa: Haemosporida: Haemoproteidae) of Palaearctic Tortoises

    Czech Academy of Sciences Publication Activity Database

    Javanbakht, H.; Kvičerová, Jana; Dvořáková, N.; Mikulíček, P.; Sharifi, M.; Kautman, M.; Maršíková, Aneta; Široký, P.

    2015-01-01

    Roč. 62, č. 5 (2015), s. 670-678. ISSN 1066-5234 R&D Projects: GA ČR(CZ) GAP506/11/1738 Institutional support: RVO:60077344 Keywords : Barcoding * cytochrome b * intraspecific variability * Leptoconops * morphology * Testudo Subject RIV: EG - Zoology Impact factor: 3.217, year: 2014

  18. Identifying the Challenging Factors in the Transition from Colleges of Engineering to Employment

    Science.gov (United States)

    Baytiyeh, Hoda; Naja, Mohamad

    2012-01-01

    The transition from university to a career in engineering is a challenging process. This study examined the perceptions of engineering graduates regarding the difficulties they encountered in their transition from the university to the workplace. Lebanese practising engineers (n=217), living around the world, were surveyed to identify their…

  19. Electronic database of historical natural stones of the Czech Republic: structuring field and laboratory data

    Czech Academy of Sciences Publication Activity Database

    Kampfová, Hana; Přikryl, R.

    London: Geological Society, 2010 - (Přikryl, R.; Torok, A.), s. 211-217. (Geological Society Special Publications. 333). ISBN 978-1-86239-291-5 Institutional research plan: CEZ:AV0Z30460519 Keywords : building stone * database * exploitation * monument Subject RIV: DB - Geology ; Mineralogy

  20. Planck 2013 results. XXX. Cosmic infrared background measurements and implications for star formation

    DEFF Research Database (Denmark)

    Ade, P. A. R.; Aghanim, N.; Armitage-Caplan, C.;

    2014-01-01

    We present new measurements of cosmic infrared background (CIB) anisotropies using Planck. Combining HFI data with IRAS, the angular auto-and cross-frequency power spectrum is measured from 143 to 3000 GHz, and the auto-bispectrum from 217 to 545 GHz. The total areas used to compute the CIB power...

  1. Planck 2013 results. XVII. Gravitational lensing by large-scale structure

    DEFF Research Database (Denmark)

    Ade, P. A. R.; Aghanim, N.; Armitage-Caplan, C.;

    2013-01-01

    On the arcminute angular scales probed by Planck, the cosmic microwave background (CMB) anisotropies are gently perturbed by gravitational lensing. Here we present a detailed study of this eect, detecting lensing independently in the 100, 143, and 217 GHz frequency bands with an overall significa...

  2. Jan Evangelista Purkyně (nejen) slezským rostlinozpytcem

    Czech Academy of Sciences Publication Activity Database

    Fidlerová, A. A.; Honys, David

    2011-01-01

    Roč. 59, č. 5 (2011), s. 214-217. ISSN 0044-4812 Institutional support: RVO:61389030 Keywords : Purkyně’s work * living bodies * plant physiology Subject RIV: EF - Botanics http://ziva.avcr.cz/2011-5/jan-evangelista-purkyne-nejen-slezskym-rostlinozpytcem.html

  3. Asymmetric giant magnetoimpedance is twisted CoFeCrSiB amorphous ribbons

    Czech Academy of Sciences Publication Activity Database

    Kraus, Luděk; Malátek, M.; Yoon, S.S.; Kim, C.G.

    2006-01-01

    Roč. 304, - (2006), s. 214-217. ISSN 0304-8853. [Soft Magnetic Materials /17./. Bratislava, 07.09.2005-09.09.2005] Institutional research plan: CEZ:AV0Z10100520 Keywords : amorphous systems - soft magnetic * magnetoimpedance * helical anisotropy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.212, year: 2006

  4. Disasters, Victimization, and Children's Mental Health

    Science.gov (United States)

    Becker-Blease, Kathryn A.; Turner, Heather A.; Finkelhor, David

    2010-01-01

    In a representative sample of 2,030 U.S. children aged 2-17, 13.9% report lifetime exposure to disaster, and 4.1% report experiencing a disaster in the past year. Disaster exposure was associated with some forms of victimization and adversity. Victimization was associated with depression among 2- to 9-year-old disaster survivors, and with…

  5. Correlates of Early Alcohol and Drug Use in Hispanic Adolescents: Examining the Role of ADHD with Comorbid Conduct Disorder, Family, School, and Peers

    Science.gov (United States)

    Lopez, Barbara; Schwartz, Seth J.; Prado, Guillermo; Huang, Shi; Rothe, Eugenio M.; Wang, Wei; Pantin, Hilda

    2008-01-01

    This study examined correlates of early adolescent alcohol and drug use in a community sample of 217 eighth-grade adolescents with behavior problems and from Hispanic/Latino immigrant families. Structural equation modeling was used to examine relationships of multiple contexts (e.g., family, school, and peers) to alcohol and drug use. Results…

  6. The proteomic study of sodium butyrate antiproliferative/cytodifferentiation effects on K562 cells

    Czech Academy of Sciences Publication Activity Database

    Grebeňová, D.; Kuželová, K.; Pluskalová, M.; Pešlová, G.; Halada, Petr; Hrkal, Z.

    2006-01-01

    Roč. 37, - (2006), s. 210-217. ISSN 1079-9796 R&D Projects: GA MZd NL7681 Institutional research plan: CEZ:AV0Z50200510 Keywords : k562 * cell cycle * hemoglobin synthesis Subject RIV: EE - Microbiology, Virology Impact factor: 2.678, year: 2006

  7. Perceived Social Support and the Self-Concepts of Gifted Adolescents

    Science.gov (United States)

    Rinn, Anne N.; Reynolds, Marilyn J.; McQueen, Kand S.

    2011-01-01

    This study investigated the relationship between perceived social support and the multidimensional self-concepts of gifted adolescents. Participants included 217 gifted students who had completed grades 5 through 10 and were attending a summer program for the gifted. Self-concept was measured using the Self-Description Questionnaire II (SDQ-II; H.…

  8. 77 FR 60101 - Newspapers To Be Used for Publication of Legal Notice of Appealable Decisions and Publication of...

    Science.gov (United States)

    2012-10-02

    ... publication of the legal notice of the decision in the principal newspaper for both 36 CFR parts 215 and 217... Forest Service Newspapers To Be Used for Publication of Legal Notice of Appealable Decisions and... notice of decisions subject to administrative appeal in the legal notice section of the newspapers...

  9. Distribution of SMI-32-immunoreactive neurons in the central auditory system of the rat

    Czech Academy of Sciences Publication Activity Database

    Ouda, Ladislav; Druga, R.; Syka, Josef

    2012-01-01

    Roč. 217, č. 1 (2012), s. 19-36. ISSN 1863-2653 R&D Projects: GA ČR GA309/07/1336; GA MŠk(CZ) LC554 Institutional research plan: CEZ:AV0Z50390512 Keywords : neurofilament proteins * auditory brain centers Subject RIV: FH - Neurology Impact factor: 7.837, year: 2012

  10. Feminismus, dějiny žen a gender history v recenzní rubrice českého časopisu historického v letech 1990-2002

    Czech Academy of Sciences Publication Activity Database

    Ratajová, Jana

    Ústí nad Labem : Kristina Kaiserová - albis international, 2009, s. 217-229. ISBN 978-80-86971-92-6 R&D Projects: GA ČR(CZ) GA404/07/0868 Institutional research plan: CEZ:AV0Z90090514 Keywords : gender history * feminism * women's history * czech historical review * history of historiography Subject RIV: AA - Philosophy ; Religion

  11. Characterisation of Particulate Matter in Different Types of Archives

    Czech Academy of Sciences Publication Activity Database

    Mašková, Ludmila; Smolík, Jiří; Vodička, Petr

    2015-01-01

    Roč. 107, APR 2015 (2015), s. 217-224. ISSN 1352-2310 R&D Projects: GA MK DF11P01OVV020 Keywords : indoor particles * chemical composition * mass closure Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.281, year: 2014

  12. AcEST: DK946499 [AcEST

    Lifescience Database Archive (English)

    Full Text Available +ELESHA Q+L EVYP+GP+ Sbjct: 187 ILVNTFIELESHAIQSLSGSTVPEVYPVGPI 217 >tr|Q8W237|Q8W237_DORBE Betanidin 6-O-glucosyltransferase OS=Doro...theanthus bellidiformis PE=2 SV=1 Length = 481 Score = 33.1 bits (74), Expect = 7.1

  13. Nickel tolerance of serpentine and non-serpentine Knautia arvensis plants as affected by arbuscular mycorrhizal symbiosis

    Czech Academy of Sciences Publication Activity Database

    Doubková, Pavla; Sudová, Radka

    2014-01-01

    Roč. 24, č. 3 (2014), s. 209-217. ISSN 0940-6360 R&D Projects: GA AV ČR KJB600050812 Institutional support: RVO:67985939 Keywords : arbuscular mycorrhizal * symbiosis * nickel toxicity * semi-hydroponics Subject RIV: EF - Botanics Impact factor: 3.459, year: 2014

  14. The growth and survival of three closely related Myosotis species in a 3-year transplant experiment

    Czech Academy of Sciences Publication Activity Database

    Koutecká, Eva; Lepš, Jan

    2013-01-01

    Roč. 91, č. 4 (2013), s. 209-217. ISSN 1916-2790 R&D Projects: GA ČR GA206/09/1471; GA MŠk LC06073 Institutional support: RVO:60077344 ; RVO:67985939 Keywords : competition * field experiment * home-site advantage Subject RIV: EH - Ecology, Behaviour Impact factor: 1.035, year : 2013

  15. Starch Overproduction by Means of Algae

    Czech Academy of Sciences Publication Activity Database

    Zachleder, Vilém; Brányiková, I.

    Dordrecht, Heidelberg, london, New York: Springer Science+Business Media, 2014 - (Bajpai, R.; Prokop, A.; Zappi, M.), s. 217-240. (Cultivation of cells and products. Volume 1). ISBN 978-94-007-7493-3 R&D Projects: GA MŠk OE 221; GA MŠk OE09025 Institutional support: RVO:61388971 Keywords : starch * alga * overproduction Subject RIV: EE - Microbiology, Virology

  16. Search for the Xb and other hidden-beauty states in the π+π−Υ(1S) channel at ATLAS

    Czech Academy of Sciences Publication Activity Database

    Aad, G.; Abbott, B.; Abdallah, J.; Böhm, Jan; Chudoba, Jiří; Havránek, Miroslav; Hejbal, Jiří; Jakoubek, Tomáš; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Lysák, Roman; Marčišovský, Michal; Mikeštíková, Marcela; Němeček, Stanislav; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Vrba, Václav

    2015-01-01

    Roč. 740, Jan (2015), 199-217. ISSN 0370-2693 R&D Projects: GA MŠk(CZ) LG13009 Institutional support: RVO:68378271 Keywords : experimental results * ATLAS * CERN LHC Coll Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 6.131, year: 2014

  17. Adornova mimetická sociologie

    Czech Academy of Sciences Publication Activity Database

    Hauser, Michael

    Plzeň : Aleš Čeněk, 2007 - (Šubrt, J.), s. 205-217 ISBN 978-80-7380-061-1 Institutional research plan: CEZ:AV0Z90090514 Keywords : Adorno * late capitalism * classes * subject Subject RIV: AA - Philosophy ; Religion

  18. Cold Temperature and Biodiesel Fuel Effects on Speciated Emissions of Volatile Organic Compounds from Diesel Trucks

    Science.gov (United States)

    Speciated volatile organic compounds (VOCs) were measured in diesel exhaust from three medium heavy-duty trucks equipped with modern aftertreatment technologies. Emissions testing was conducted on a chassis dynamometer at two ambient temperatures (-6.7°C and 21.7°C) operating on ...

  19. Aromatic cytokinins in micropropagated potato plants

    Czech Academy of Sciences Publication Activity Database

    Baroja, F. E.; Aguirreolea, J.; Martínková, Hana; Hanuš, Jan; Strnad, Miroslav

    2002-01-01

    Roč. 40, č. 3 (2002), s. 217-224. ISSN 0981-9428 R&D Projects: GA MŠk OC 844.10; GA ČR GA301/02/0475 Institutional research plan: CEZ:AV0Z5038910 Keywords : Acclimatization * Aromatic cytokinins * Micropropagation Subject RIV: CE - Biochemistry Impact factor: 1.582, year: 2002

  20. TECHNOLOGY ASSESSMENT OF WETLANDS FOR MUNICIPAL WASTEWATER TREATMENT

    Science.gov (United States)

    The innovative and alternative technology provisions of the Clean Water Act of 1977 (PL 95-217) provide financial incentives to communities that use wastewater treatment alternatives to reduce costs or energy consumption over conventional systems. Some of these technologies have ...

  1. Cold rotation in the reaction 19F+15V

    Institute of Scientific and Technical Information of China (English)

    WangQi; LuJun; 等

    1997-01-01

    Excitation functions of the dissipative products in the reaction 19F+51V have been measured from 102.25to 109.50MeV in a step of 250keV at θ=21.7°,Nuclear temperature of the system is extracted and discussed by using a concept of cold rotation.

  2. Establishing the potential dependent equilibrium oxide coverage on platinum in alkaline solution and its influence on the oxygen reduction

    DEFF Research Database (Denmark)

    Wiberg, Gustav; Arenz, Matthias

    2012-01-01

    Publication year: 2012 Source:Journal of Power Sources, Volume 217 Gustav K.H. Wiberg, Matthias Arenz The oxidation process of polycrystalline platinum subjected to alkaline solution is re-examined using a combination of cyclic voltammetry and potential hold techniques in Ar, H2 and O2 purged 0.1 M...

  3. Preparation and photocatalytic activity of rare earth doped TiO2 nanoparticles

    Czech Academy of Sciences Publication Activity Database

    Štengl, Václav; Bakardjieva, Snejana; Murafa, Nataliya

    2009-01-01

    Roč. 114, č. 1 (2009), s. 217-226. ISSN 0254-0584 Institutional research plan: CEZ:AV0Z40320502 Keywords : anatase * urea * rare earth Subject RIV: CA - Inorganic Chemistry Impact factor: 2.015, year: 2009

  4. Production and identification of new, neutron-rich nuclei in the $^{208}$Pb region

    CERN Document Server

    Rykaczewski, K; Plochocki, A; Karny, M; Szerypo, J; Evensen, A H; Kugler, E; Lettry, Jacques; Ravn, H L; Van Duppen, P; Andreyev, A; Huyse, M; Wöhr, A; Jokinen, A; Äystö, J; Nieminen, A; Huhta, M; Ramdhane, M; Walter, G; Hoff, P

    2000-01-01

    The recently developed methods allowing the experimental studies on new neutron-rich nuclei beyond doubly-magic $^{208}$Pb are briefly described. An identification of new neutron-rich isotopes $^{215}$Pb and $^{217}$Bi, and new decay properties of $^{216}$Bi studied by means of a pulsed release element selective technique at PS Booster- ISOLDE are reported. (9 refs).

  5. Groupware.

    Science.gov (United States)

    Davenport, Elisabeth; McKim, Geoffrey

    1995-01-01

    Focuses on computer systems that support groups who complete tasks together despite separations in space, time, or variations in team size. Reviews the literature on the history of the technology, application packages, case histories, and current research, and includes a synopsis of activity in academic and commercial institutions. Contains 217

  6. Respiratory tract tumor

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    2010336 Study on the association between DNA double-strand break repair gene NBS1 polymorphisms and susceptibility on lung cancer. FAN Lihui(樊丽辉),et al. Dept Epidemiol,Public Health Sch,Fujian Med Univ,Fuzhou 350004.Chin J Epidemiol 2010;31(2):213-217.

  7. Investigating the Effect of Participation in the Cyberspace in the Relations between Spouses

    Science.gov (United States)

    Latifi, Zohreh

    2015-01-01

    The present study aims to investigate the relationship between participation in the cyberspace with marriage satisfaction and tendency to divorce. The present study is a correlational research from research methodology perspective. The statistical population consists of married males and females in the city of Isfahan in 2015. A sample of 217

  8. Planck early results. VI. The High Frequency Instrument data processing

    DEFF Research Database (Denmark)

    Bucher, M.; Castex, G.; Colley, J.-M.; Cressiot, C.; Delabrouille, J.; Giraud-Héraud, Y.; Kaplan, J.; Le Jeune, M.; Patanchon, G.; Piat, M.; Remazeilles, M.; Rosset, C.; Roudier, G.; Stompor, R.; Hills, R.; Hobson, M.; Stolyarov, V.; Bond, J.R.; Helou, G.; Matsumura, T.; Shellard, P.; Melin, J.-B.; Yvon, D.; Nørgaard-Nielsen, Hans Ulrik; Marleau, F.; Netterfield, C.B.; Chiang, C.; Jones, W.C.; Knox, L.; Dunkley, J.; De Bernardis, P.; Masi, S.; Nati, F.; Piacentini, F.; Kneissl, R.; Tauber, J.A.; Zacchei, A.; Mandolesi, N.; Bersanelli, M.; Guyot, G.; Désert, F.-X.; Chamballu, A.; Clements, D.L.; Jaffe, A.H.; Mortlock, D.; Novikov, D.; Rowan-Robinson, M.; Chary, R.-R.; Chen, X.; Ganga, K.; Lange, A.E.; McGehee, P.; Pearson, T.J.; Rusholme, B.; Benoît, A.; Aghanim, N.; Aumont, J.; Boulanger, F.; Dole, H.; Douspis, M.; Gispert, R.; Kunz, M.; Lagache, G.; Mercier, C.; Miville-Deschênes, M.-A.; Noviello, F.; Pajot, F.; Ponthieu, N.; Puget, J.-L.; Torre, J.-P.; Vibert, L.; Benabed, K.; Bouchet, F.R.; Colombi, S.; Delouis, J.-M.; Hivon, E.; Lesgourgues, J.; Moneti, A.; Prunet, S.; Riazuelo, A.; Sygnet, J.-F.; Wandelt, B.D.; Fosalba, P.; Wiesemeyer, H.; Thum, C.; Efstathiou, G.; Van Leeuwen, F.; Bartlett, J.G.; Bock, J.J.; Doré, O.; Holmes, W.A.; Lawrence, C.R.; Mitra, S.; Prézeau, G.; Rocha, G.; Saha, R.; Wade, L.A.; Maffei, B.; Ashdown, M.; Challinor, A.; Gratton, S.; Harrison, D.; Lasenby, A.; MacTavish, C.J.; Sutton, D.; Catalano, A.; Coulais, A.; Lamarre, J.-M.; Arnaud, M.; Starck, J.-L.; Cardoso, J.-F.; Vibert, D.; Girard, D.; Hildebrandt, S.R.; MacÍas-Pérez, J.F.; Perotto, L.; Renault, C.; Santos, D.; Ansari, R.; Couchot, F.; Filliard, C.; Haissinski, J.; Henrot-Versillé, S.; Lavabre, A.; Perdereau, O.; Plaszczynski, S.; Touze, F.; Tristram, M.; Dolag, K.; Hernández-Monteagudo, C.; White, S.D.M.; McAuley, I.; Murphy, A.; Peacocke, T.; Yurchenko, V.; Crill, B.P.; Savini, G.; Bradshaw, T.; Crook, M.; Mann, R.; Ade, P.A.R.; Griffin, M.; North, C.; Spencer, L.; Sudiwala, R.; Woodcraft, A.; Sunyaev, R.; Borrill, J.; Church, S.; Osborne, S.; Bartelmann, M.; Schaefer, B.M.; Banday, A.J.; Bernard, J.-P.; Forni, O.; Giard, M.; Leroy, C.; Marshall, D.J.; Montier, L.; Pointecouteau, E.; Ristorcelli, I.; Reach, W.T.; Battaner, E.; Huffenberger, K.M.; Górski, K.M.

    2011-01-01

    We describe the processing of the 336 billion raw data samples from the High Frequency Instrument (HFI) which we performed to produce six temperature maps from the first 295 days of Planck-HFI survey data. These maps provide an accurate rendition of the sky emission at 100, 143, 217, 353, 545 and...

  9. Gclust Server: 31971 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 31971 PPT_174088 Cluster Sequences Related Sequences(20) 217 estExt_gwp_gw1.C_30325...; no annotation 3 1.00e-60 42.86 0.0 0.0 0.0 0.0 0.0 Show 31971 Cluster ID 31971 Sequence ID PPT_174088 Link

  10. Gclust Server: 197168 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 197168 Neq_NEQ545 Cluster Sequences - 217 hypothetical protein 1 1.00e-99 0.0 0.0 0.0 0.0 3.23 0.0 Show 1971...68 Cluster ID 197168 Sequence ID Neq_NEQ545 Link to cluster sequences Cluster Seque

  11. Codependency: Clarifying the Construct.

    Science.gov (United States)

    Springer, Carrie A.; Britt, Thomas W.; Schlenker, Barry R.

    1998-01-01

    College students (N=217) completed questionnaires to examine associations between codependency, relationship quality, and personality characteristics. Codependency was associated with lower self-esteem and lower perception of interpersonal control. Codependency was also found to be associated with greater self-consciousness, social anxiety, and…

  12. Russki stihh : metrika, sistemõ stihhoslozhenija, prosodija (generativnõi podhod) / Mihhail Lotman

    Index Scriptorium Estoniae

    Lotman, Mihhail, 1952-

    2000-01-01

    Russian verse: its metrics, versification systems, and prosody (generative synopsis). Lk. 217-218 ; Vene värss: meetrika, värsisüsteemid ja prosoodika (generatiivne ülevaade). Lk. 241. Üldisest värsimõõduteooriast ja selle rakendamisest vene värsile

  13. 75 FR 18536 - Agency Information Collection Activities: Proposed Collection, Comment Request

    Science.gov (United States)

    2010-04-12

    ... Reduction Act of 1995 (PRA), we are inviting comments on a collection of information that we will submit to... collection request (ICR) is ``30 CFR Parts 202, 206, 210, 212, 217, and 218, Solid Minerals and Geothermal... questions on technical issues, contact Glenn W. Kepler, Sr., Solid Minerals and Geothermal (SM&G),...

  14. Dicty_cDB: Contig-U15405-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s troglodyt... 44 0.80 1 ( BV495481 ) S217P61918FE2.T0 Noemie Pan troglodytes troglodyt... 44 0.80 1 ( BV436248 ) S237P6495RF5.T0 Por...tugueseWaterDog Canis familiar... 44 0.80 1 ( BV312740 )

  15. Education for a New World, 1994.

    Science.gov (United States)

    Institute of International Education, New York, NY.

    This annual report marks the 75th anniversary of the Institute of International Education (IIE) and describes the IIE's 1994 activities and programs. During 1994 more than 10,000 individuals studied, conducted research, received practical training, or provided international technical assistance under 248 programs IIE administered for 217 sponsors,…

  16. The most species-rich plant communities in the Czech Republic and Slovakia (with new world records)

    Czech Academy of Sciences Publication Activity Database

    Chytrý, M.; Dražil, T.; Hájek, M.; Kalníková, V.; Preislerová, Z.; Šibík, J.; Ujházy, K.; Axmanová, I.; Bernátová, D.; Blanár, D.; Dančák, M.; Dřevojan, P.; Fajmon, K.; Galvánek, D.; Hájková, Petra; Herben, Tomáš; Hrivnák, R.; Janeček, Štěpán; Janišová, M.; Jiráská, Š.; Kliment, J.; Kochjarová, J.; Lepš, J.; Lejskovjanská, A.; Merunková, K.; Mládek, J.; Slezák, M.; Šeffer, J.; Šefferová, V.; Škodová, I.; Uhlířová, J.; Ujházyová, M.; Vymazalová, M.

    2015-01-01

    Roč. 87, č. 3 (2015), s. 217-278. ISSN 0032-7786 R&D Projects: GA ČR GB14-36079G Institutional support: RVO:67985939 Keywords : alpha diversity * semi-natural grasslands * vegetation database Subject RIV: EF - Botanics Impact factor: 4.104, year: 2014

  17. EPR study of human hair

    Czech Academy of Sciences Publication Activity Database

    Křížová, Jana; Káfuňková, Eva; Stopka, Pavel

    2005-01-01

    Roč. 99, č. 14 (2005), s. 217-218. ISSN 0009-2770 R&D Projects: GA MZd(CZ) NL7567; GA MZd(CZ) NB7377 Institutional research plan: CEZ:AV0Z40320502 Keywords : EPR Subject RIV: CA - Inorganic Chemistry Impact factor: 0.445, year: 2005

  18. Differences in injury risk and characteristics between Dutch amateur and professional soccer players

    NARCIS (Netherlands)

    Beijsterveldt, A.M.C. van; Stubbe, J.H.; Schmikli, S.L.; Port, I.G.L. van de; Backx, F.J.G.

    2015-01-01

    Objectives: To compare the incidence and characteristics of injuries between Dutch amateur and professional male soccer players during one entire competition season. Design: A prospective two-cohort design. Methods: During the 2009-2010 season, 456 Dutch male amateur soccer players and 217 professio

  19. Growth rate of bacteria is affected by soil texture and extraction procedure

    Czech Academy of Sciences Publication Activity Database

    Uhlířová, Eva; Šantrůčková, Hana

    2003-01-01

    Roč. 35, - (2003), s. 217-224. ISSN 0038-0717 Institutional research plan: CEZ:AV0Z6066911 Keywords : soil texture * extraction of bacteria * biosynthetic activity of bacteria Subject RIV: EH - Ecology, Behaviour Impact factor: 1.915, year: 2003

  20. Help-Seeking Tendencies during Early Adolescence: An Examination of Motivational Correlates and Consequences for Achievement

    Science.gov (United States)

    Ryan, Allison M.; Shin, Huiyoung

    2011-01-01

    The present study examined the motivational correlates and achievement consequences of students' help-seeking tendencies during sixth grade (N = 217). Students' grades were collected from school records at the beginning and end of the school year. Midway through the year students reported on their academic self-efficacy and social demonstration…