WorldWideScience

Sample records for astatine 215

  1. Organic chemistry of astatine

    International Nuclear Information System (INIS)

    The paper surveys the investigations on the chemical behaviour of astatine in organic systems and deals with the preparation and identification of its organic compounds. A discussion is given on some of the physico-chemical properties of these compounds determined by extrapolation techniques as well as by direct measurement. The biomedical importance of 211At-labelled compounds is briefly referred to. (authors)

  2. Bibliography of astatine chemistry and biomedical applications

    International Nuclear Information System (INIS)

    An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)

  3. Astatine-211: production and availability.

    Science.gov (United States)

    Zalutsky, Michael R; Pruszynski, Marek

    2011-07-01

    The 7.2-h half life radiohalogen (211)At offers many potential advantages for targeted α-particle therapy; however, its use for this purpose is constrained by its limited availability. Astatine-211 can be produced in reasonable yield from natural bismuth targets via the (209)Bi(α,2n)(211)At nuclear reaction utilizing straightforward methods. There is some debate as to the best incident α-particle energy for maximizing 211At production while minimizing production of (210)At, which is problematic because of its 138.4-day half life α-particle emitting daughter, (210)Po. The intrinsic cost for producing (211)At is reasonably modest and comparable to that of commercially available (123)I. The major impediment to (211)At availability is attributed to the need for a medium energy α-particle beam for its production. On the other hand, there are about 30 cyclotrons in the world that have the beam characteristics required for (211)At production. PMID:22201707

  4. Recent advances in the organic chemistry of astatine

    International Nuclear Information System (INIS)

    Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211At species, 211At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs

  5. Dosimetrical considerations in astatine-211 radioimmunotherapy

    International Nuclear Information System (INIS)

    Several dosimetrical quantities have been suggested for use in alpha-particle dosimetry. To evaluate the expected biological effect when using these quantities, a Monte Carlo program was set to register the single-event distribution of both specific energy and alpha-particle track length to a cell nucleus (r=5.6 μm). Distributions were acquired for both 'bound' (simulating the effect of 211At-labelled antibodies bound to antigens on cell surfaces (r=7.0 μm)) as well as 'non-bound' (simulating 211At-labelled antibodies that have not bound to a cell) astatine-211. From these distributions, various theoretical cell survival curves were established for 3 different dosimetrical quantities, i.e. specific energy, number of alpha-particle hits and total track length. The survival curves for all quantities are presented for the corresponding mean absorbed dose in order to facilitate comparisons of the expected effects of using the 3 different quantities for both distributions of 211At decays. The theoretical survival curves presented here could, combined with experiments using 'bound' and 'non-bound' 211At in a single-cell suspension, reveal which dosimetrical quantity is most suitable for 211 At-radioimmunotherapy. (author)

  6. Discovery of the astatine, radon, francium, and radium isotopes

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  7. IT 215 courses / snaptutorial

    OpenAIRE

    IT 210 snaptutorial

    2015-01-01

    For more classes visit www.snaptutorial.com   IT 215 Week 1 CheckPoint: Text Printing Program   IT 215 Week 1 DQ 1   IT 215 Week 1 DQ 2   IT 215 Week 2 CheckPoint: Payroll Program Part 1   IT 215 Week 2 CheckPoint: Benefits of Programming Knowledge   IT 215 Week 3 CheckPoint: Payroll Program Part 2   IT 215 Week 3 DQ 1   IT 215 Week 3 DQ 2   IT 215 Week 4 CheckPoint: Method...

  8. Extraction of astatine isotopes for development of radiopharmaceuticals using a 211Rn-211At generator

    International Nuclear Information System (INIS)

    In order to utilize a 211At isotope, a promising α-emitter for radionuclide therapy, the chemical properties of astatine isotopes are studied. We have examined wet chemistry methods through the distribution ratios of astatine in liquid-liquid extraction. The astatine isotopes have been found to be well extracted into DIPE and MIBK. We observed that the distribution ratio of astatine isotopes increases with concentrations of HCl greater than 3 M, while it decreases with the HCl concentration less than 2 M. The results will be useful for development of the 211Rn-211At generator. (author)

  9. Astatine-211-Labeled Targeted Radiotherapeutics: An Update

    International Nuclear Information System (INIS)

    The heavy halogen 211At was first proposed for use in α-particle targeted radiotherapy more than 30 years ago and continues to be one of the most promising radionuclides for this purpose. Although its 7.2-h half life is not ideal for intravenously administered whole antibodies, it is compatible with the pharmacokinetics of antibody fragments, peptides, aptamers and organic molecules. Its diverse chemistry allows its incorporation into a wide array of targeting vehicles, relying on its chemical similarity to iodine to provide a useful point of departure. On the other hand, the relatively low carbon-astatine bond strength is challenging. In common with the other α-emitters being discussed at this symposium, lack of reliable availability is one of the biggest hurdles in the use of 211At for targeted radiotherapy. However, in the case of 211At, it is not a question of production cost or availability of target material, because 211At can be produced in reasonable yield from natural bismuth targets. Rather, the difficulty is the lack of cyclotrons equipped with the medium energy α-particle beams required for its production. If the infrastructure for producing 211At is to be improved to the stage where 211At-labeled radiopharmaceuticals can have a meaningful impact, several developments must occur. First, the ability to produce clinically relevant levels of 211At that can be shipped to remote locations in chemically tractable form must be demonstrated. Approaches under consideration include compensating for radiolysis-mediated effects and the consideration of alternative chemistries. Second, strategies for compensating for heterogeneities in dose deposition must be developed, hopefully in a way that is compatible with approval for human use. And third, it is essential that more clinical trials be performed with 211At-labeled therapeutics, particularly in settings of minimum residual disease where the radiobiological advantages of α-particles can be best exploited. Our

  10. Scrutinizing "Invisible" astatine: A challenge for modern density functionals.

    Science.gov (United States)

    Sergentu, Dumitru-Claudiu; David, Grégoire; Montavon, Gilles; Maurice, Rémi; Galland, Nicolas

    2016-06-01

    The main-group 6p elements did not receive much attention in the development of recent density functionals. In many cases it is still difficult to choose among the modern ones a relevant functional for various applications. Here, we illustrate the case of astatine species (At, Z = 85) and we report the first, and quite complete, benchmark study on several properties concerning such species. Insights on geometries, transition energies and thermodynamic properties of a set of 19 astatine species, for which reference experimental or theoretical data has been reported, are obtained with relativistic (two-component) density functional theory calculations. An extensive set of widely used functionals is employed. The hybrid meta-generalized gradient approximation (meta-GGA) PW6B95 functional is overall the best choice. It is worth noting that the range-separated HSE06 functional as well as the old and very popular B3LYP and PBE0 hybrid-GGAs appear to perform quite well too. Moreover, we found that astatine chemistry in solution can accurately be predicted using implicit solvent models, provided that specific parameters are used to build At cavities. © 2016 Wiley Periodicals, Inc. PMID:27059181

  11. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  12. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates.

    Science.gov (United States)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Svedhem, Sofia; Lindegren, Sture

    2016-03-16

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single cancer cells. A promising radioactive nuclide for this type of therapy is astatine-211. Astatine-211 attached to tumor-specific antibodies as carrier molecules is a system currently under investigation for use in targeted alpha therapy. In the common radiolabeling procedure, astatine is coupled to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies. PMID:26791409

  13. Astatine-211: production, injection into monoclonal antibodies radiological effect, possible application to cancer treatment

    International Nuclear Information System (INIS)

    Methods developed in the Laboratory of Nuclear Problems, JINR, for producing astatine-211 and injecting it into monoclonal antibodies are described. The use of its diethylene triamine penta-acetic acid complex is shown to be the most effective method of injecting astatine into a biomolecules. The biological effect of the α-particles emitted from the astatine-211 is investigated using Chinese hamster fibroblasts and Ehrlich carcinoma cells. It is established that the mitotic activity depression, number of degenerating cells, number of cells with chromosome aberrations, and cellular surviving fraction depend on the concentration of the radionuclide in the medium 'in vitro'. The RBE of α-particles in comparison with 60Co γ-rays is 3. Injection of astatine-211 absorbed on tellurium particles into mice with ascitic tumors resulted in prolongation of their life or elimination of the tumors. (author). 39 refs, 7 figs

  14. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    OpenAIRE

    Rothe, S.; A. N. Andreyev; Antalic, S; Borschevsky, A.; Capponi, L.; Cocolios, T.E.; Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the io...

  15. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    Science.gov (United States)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-07-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and physical properties for use in targeted therapies for cancer. Due to the very short range of the emitted α-particles, this therapy is particularly suited to treating occult, disseminated cancers. Astatine is not intrinsically tumour-specific; therefore, it requires an appropriate tumour-specific targeting vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method that combines dry distillation of astatine-211 and a synthesis module for producing radiopharmaceuticals into a process platform. This platform will standardize production of astatinated radiopharmaceuticals, and hence, it will facilitate large clinical studies focused on this promising, but chemically challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies.

  16. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-01-01

    vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method......To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....

  17. Study of Astatine (III) reactions with O, S and N ligands in solution

    International Nuclear Information System (INIS)

    Full text of publication follows. Astatine (At, Z=85: [Xe]4f145d106s26p5) belongs to the halogen group and is located below iodine in the periodic table. One of its isotopes (211At) appears promising as a therapeutic agent in nuclear medicine (Ref.1) owing to the energy of the alpha particles emitted during the disintegration of its nucleus and its short physical half-life (7.2 h). Since there are no stable isotopes of astatine, the chemistry of this element remains poorly understood. Generally, At is supposed to behave as a halogen (Ref.2) but it has been shown recently in our group that astatine presents a metallic behaviour in aqueous solution: it notably exists as At+ and AtO+ species under the oxidation states +I and +III (Ref.3). At the present time, the number of studies dealing with the complexation properties of the cationic forms of astatine remains limited (Ref.4), owing to its low availability. In this work, we have investigated the reactions of AtO+ species with different hetero-atomic (N, S, O) model ligands. A combined approach based on experimental and theoretical studies has been used (Ref.5). On account of the difficulties of experimental investigations of astatine species, the reactivity of AtO+ was explored using a competition method founded on astatine distributions between two distinct phases. Furthermore, for each AtO+/ ligand complex, the nature of the species formed and the associated thermodynamic constants were determined by computational modeling (DFT calculations). In this framework, an original computational methodology was developed to take into account the specificities of astatine, notably the associated relativistic effects. The computed equilibrium constants have been confronted with the experimental results. This comparison demonstrates an outstanding coherence between experience and theory. Furthermore, the analysis of the results shows a key role of solvent effects on astatine chemistry. Lastly, a specific reactivity for the

  18. Some aspects of the organic, biological and inorganic chemistry of astatine

    International Nuclear Information System (INIS)

    Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments (209At, 210At, 211At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)

  19. Comment: 215 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available 215.png Taxonomy icon (c) Database Center for Life Science licensed under CC Attribution2.1 Japan アイコン:電子顕微鏡バージョン bando 2010/02/15 15:30:03 2010/02/15 15:30:03 ...

  20. Astatine-211 Pathway from Radiochemistry to Clinical Investigation

    International Nuclear Information System (INIS)

    Particularly in clinical settings where tumour burden is low and cancers are located in close proximity to essential normal tissue structures, α-particle emitting radionuclides can offer significant advantages for targeted radionuclide therapy. One of the first alpha emitters to be evaluated for this purpose is the 7.2-h half-life radiohalogen Astatine-211 (211At). From a commercialization-potential perspective 211At, is less appealing than the longer half-life alpha particle emitters Radium-223, Actinium-225 and Thorium-227, which have become the focus of many laboratories. However, if methods for providing a better supply of 211At could be developed, this alpha emitter would be the radionuclide of choice for many potential therapeutic applications. With regard to the production of 211At, this can be readily be accomplished by bombarding natural bismuth targets with 28−29.5 MeV alpha particles via the 209Bi(α,2n)211At reaction. The goal is to utilize an alpha particle beam energy that provides the required balance for maximizing 211At production while minimizing creation of 210At, which is problematic because of its 138.4-day half life alpha-particle emitting daughter, 210Po. For most intended clinical applications, alpha particle beam energy of about 29 MeV offers the best compromise between maximizing yield and providing 211At with sufficient radionuclidic purity for clinical use. Clinically relevant levels of 211At have been produced at several institutions using both internal and external cyclotron targets

  1. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  2. IT 215 UOP Tutorial Courses/ Uoptutorial

    OpenAIRE

    kalam1

    2015-01-01

    For more course tutorials visit www.uoptutorial.com   IT 215 Week 1 CheckPoint: Text Printing Program   IT 215 Week 1 DQ 1   IT 215 Week 1 DQ 2   IT 215 Week 2 CheckPoint: Payroll Program Part 1   IT 215 Week 2 CheckPoint: Benefits of Programming Knowledge   IT 215 Week 3 CheckPoint: Payroll Program Part 2   IT 215 Week 3 DQ 1   IT 215 Week 3 DQ 2   IT 215 Week 4 CheckPoin...

  3. IT 215 UOP Course Tutorial / Tutorialoutlet

    OpenAIRE

    abilagh

    2015-01-01

    For more course tutorials visit www.tutorialoutlet.com       IT 215 Week 1 CheckPoint: Text Printing Program IT 215 Week 1 Discussion Question 1 IT 215 Week 1 Discussion Question 2 IT 215 Week 2 CheckPoint: Payroll Program Part 1 IT 215 Week 2 CheckPoint: Benefits of Programming Knowledge IT 215 Week 3 CheckPoint: Payroll Program Part 2 IT 215 Week 3 Discussion Question 1 IT 215 Week 3 Discussion Question 2 IT 215 Week 4 Check...

  4. 76 FR 6536 - Airworthiness Directives; Bombardier, Inc. Model CL-215-1A10 (CL-215), CL-215-6B11 (CL-215T...

    Science.gov (United States)

    2011-02-07

    ... products. That NPRM was published in the Federal Register on November 9, 2010 (75 FR 68728). That NPRM... Regulatory Policies and Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant.... Model CL-215-1A10 (CL- 215), CL-215-6B11 (CL-215T Variant), and CL-215-6B11 (CL-415 Variant)...

  5. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    International Nuclear Information System (INIS)

    A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)

  6. IT 215 UOP COURSE TUTORIAL/ UOPHELP

    OpenAIRE

    RAVIBHARGAVI

    2015-01-01

    For more course tutorials visit www.uophelp.com   IT 215 Week 1 CheckPoint: Text Printing Program   IT 215 Week 1 Discussion Question 1   IT 215 Week 1 Discussion Question 2   IT 215 Week 2 CheckPoint: Payroll Program Part 1   IT 215 Week 2 CheckPoint: Benefits of Programming Knowledge   IT 215 Week 3 CheckPoint: Payroll Program Part 2   IT 215 Week 3 Discussion Question 1   IT 215 Week...

  7. Labelling prospects of astatine-211 with immunoglobulins (IgG): some general considerations

    International Nuclear Information System (INIS)

    The tumour therapeutic potential of the short lived alpha emitting radiohalogen 211At has been already been well recognised in the field of radioimmuno therapy. There is no evidence as such to show that astatine itself is a tumour seeking isotope. Therefore it has to be tagged to tumour seeking compound such as a drug or a protein preferably an antibody (IgG). In this communication, the labelling parameters which are required to be investigated for obtaining a stable product which could be useful as radioimmuno therapeutic agent, are described. (author). 6 refs

  8. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron anity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photodetachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral linewidth of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in o-line tests by the clear observation of the photodetachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148 [1].

  9. Extraction of 211At-astatine from hydrochloric acid solutions by means of TOPO, TBP, and triphenylphosphine

    International Nuclear Information System (INIS)

    The extraction behaviour of astatine was studied under defined conditions from hydrochloride acid solutions (cHCl>0.1 M or 1 and 2M). Therefore other effects like adsorption, reduction or hydrolysis can be excluded. The present work describes the extraction with tri- n- octylphosphinoxide (TOPO), tri- n-butylphosphate (TBP) and tri-phenylphosphine in chloroform. (orig.)

  10. No-carrier-added astatination of N-succinimidyl-3-(tri-n-butylstannyl) benzoate (ATE) via electrophilic destannylation

    International Nuclear Information System (INIS)

    The no-carrier-added synthesis of N-succinimidyl 3-[211At]astato-benzoate from N-succinimidyl 3-(tri-n-butylstannyl)benzoate (ATE) is described. The nature of the solvent in which the 211At was isolated from the target was an important factor influencing both the radiochemical yields and the nature of the incorporated astatine activity. (orig.)

  11. 75 FR 68728 - Airworthiness Directives; Bombardier, Inc. Model CL-215-1A10 (CL-215), CL-215-6B11 (CL-215T...

    Science.gov (United States)

    2010-11-09

    ... Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant economic impact, positive or.... Model CL-215-1A10 (CL- 215), CL-215-6B11 (CL-215T Variant), and CL-215-6B11 (CL-415 Variant) Airplanes...: * * * * * Seven cases of on-ground hydraulic accumulator screw cap or end cap failure have been experienced on...

  12. 211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    211At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At- to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At- anions, but first of all because of the kinetic inertness of low spin rhodium(III) d6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh3+. The experiments related to optimization of the reaction conditions were performed with the 131I, basing on a chemical similarity of I- to At-. The experiments with 211At were then carried out under the conditions found optimal for I-. The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211At-Rh(16-S4-diol) complex

  13. 48 CFR 215.404 - Proposal analysis.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Proposal analysis. 215.404 Section 215.404 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT... Proposal analysis....

  14. 48 CFR 1333.215 - Contract clauses.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clauses. 1333.215 Section 1333.215 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE GENERAL CONTRACTING REQUIREMENTS PROTESTS, DISPUTES, AND APPEALS Disputes and Appeals 1333.215 Contract clauses. Alternate I of...

  15. 48 CFR 1433.215 - Contract clauses.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clauses. 1433.215 Section 1433.215 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR GENERAL CONTRACTING REQUIREMENTS PROTESTS, DISPUTES, AND APPEALS Disputes and Appeals 1433.215 Contract clauses. The...

  16. 48 CFR 833.215 - Contract clause.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clause. 833.215 Section 833.215 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS GENERAL CONTRACTING REQUIREMENTS PROTESTS, DISPUTES, AND APPEALS Disputes and Appeals 833.215 Contract clause. The...

  17. 7 CFR 65.215 - Pork.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Pork. 65.215 Section 65.215 Agriculture Regulations of..., PORK, LAMB, CHICKEN, GOAT MEAT, PERISHABLE AGRICULTURAL COMMODITIES, MACADAMIA NUTS, PECANS, PEANUTS, AND GINSENG General Provisions Definitions § 65.215 Pork. Pork means meat produced from hogs....

  18. 31 CFR 800.215 - Foreign national.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Foreign national. 800.215 Section 800.215 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... TAKEOVERS BY FOREIGN PERSONS Definitions § 800.215 Foreign national. The term foreign national means...

  19. 6 CFR 21.5 - Discrimination prohibited.

    Science.gov (United States)

    2010-01-01

    ... 6 Domestic Security 1 2010-01-01 2010-01-01 false Discrimination prohibited. 21.5 Section 21.5... FROM THE DEPARTMENT OF HOMELAND SECURITY § 21.5 Discrimination prohibited. (a) General. No person in... participation in, be denied the benefits of, or be otherwise subjected to discrimination under, any program...

  20. 49 CFR 21.5 - Discrimination prohibited.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Discrimination prohibited. 21.5 Section 21.5... DEPARTMENT OF TRANSPORTATION-EFFECTUATION OF TITLE VI OF THE CIVIL RIGHTS ACT OF 1964 § 21.5 Discrimination... discrimination under, any program to which this part applies. (b) Specific discriminatory actions prohibited:...

  1. 22 CFR 215.2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 215.2 Section 215.2 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT REGULATIONS FOR IMPLEMENTATION OF PRIVACY ACT OF 1974 § 215.2... citizen of the United States or an alien lawfully admitted for permanent residence; (e) Maintain...

  2. 2 CFR 215.34 - Equipment.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Equipment. 215.34 Section 215.34 Grants and... ORGANIZATIONS (OMB CIRCULAR A-110) Post Award Requirements Property Standards § 215.34 Equipment. (a) Title to equipment acquired by a recipient with Federal funds shall vest in the recipient, subject to conditions...

  3. 32 CFR 215.6 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 215.6 Section 215.6 National... EMPLOYMENT OF MILITARY RESOURCES IN THE EVENT OF CIVIL DISTURBANCES § 215.6 Responsibilities. (a) The... the accomplishment of his public affairs responsibilities set forth in paragraph (f) of this...

  4. 14 CFR 121.215 - Cabin interiors.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Cabin interiors. 121.215 Section 121.215 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR CARRIERS..., FLAG, AND SUPPLEMENTAL OPERATIONS Special Airworthiness Requirements § 121.215 Cabin interiors....

  5. 33 CFR 117.215 - Niantic River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Niantic River. 117.215 Section 117.215 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.215 Niantic River. (a) The draw...

  6. 47 CFR 80.215 - Transmitter power.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Transmitter power. 80.215 Section 80.215... MARITIME SERVICES General Technical Standards § 80.215 Transmitter power. (a) Transmitter power shown on the radio station authorization is the maximum power the licensee is authorized to use. Power...

  7. 49 CFR 215.203 - Restricted cars.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Restricted cars. 215.203 Section 215.203..., DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Restricted Equipment § 215.203 Restricted cars. (a) This section restricts the operation of any railroad freight car that is— (1) More than...

  8. 27 CFR 555.215 - Housekeeping.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Housekeeping. 555.215 Section 555.215 Alcohol, Tobacco Products, and Firearms BUREAU OF ALCOHOL, TOBACCO, FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE EXPLOSIVES COMMERCE IN EXPLOSIVES Storage § 555.215 Housekeeping....

  9. 7 CFR 215.15 - Withholding payments.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Withholding payments. 215.15 Section 215.15 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.15 Withholding payments. In accordance with Departmental regulations...

  10. 7 CFR 215.10 - Reimbursement procedures.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Reimbursement procedures. 215.10 Section 215.10 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.10 Reimbursement procedures. (a) To be entitled to...

  11. 7 CFR 215.17 - Program information.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Program information. 215.17 Section 215.17 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.17 Program information. School Food Authorities and...

  12. 7 CFR 215.8 - Reimbursement payments.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Reimbursement payments. 215.8 Section 215.8 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.8 Reimbursement payments. (a) (b)(1) The rate of reimbursement...

  13. 25 CFR 215.12 - Advertising costs.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Advertising costs. 215.12 Section 215.12 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEAD AND ZINC MINING OPERATIONS AND LEASES, QUAPAW AGENCY § 215.12 Advertising costs. All advertising costs, publication fees,...

  14. 48 CFR 215.270 - Peer Reviews.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Peer Reviews. 215.270 Section 215.270 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT... of Proposals and Information 215.270 Peer Reviews. Agency officials shall conduct Peer Reviews...

  15. 47 CFR 215.1 - Background.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Background. 215.1 Section 215.1... POINT FOR ELECTROMAGNETIC PULSE (EMP) INFORMATION § 215.1 Background. (a) The nuclear electromagnetic... available protective measures, and in order to avoid duplication of research efforts, it is desirable...

  16. ADJ 215 UOP Course Tutorial/TutorialRank

    OpenAIRE

    apj

    2015-01-01

    For more course tutorials visit www.tutorialrank.com Tutorial Purchased: 1 Times, Rating:     ADJ 215 Week 1 Checkpoint Survey of Local Crime Prevention Methods ADJ 215 Week 1 DQ 1 and DQ 2 ADJ 215 Week 2 Assignment Just Desserts ADJ 215 Week 3 DQ 1 and DQ 2 ADJ 215 Week 4 Checkpoint Social Structure Crime ADJ 215 Week 4 Checkpoint Diversion Program ADJ 215 Week 4 Assignment Socialization and Criminal Behavior ADJ 215 Week 5 Checkpoint...

  17. 76 FR 34014 - Airworthiness Directives; Bombardier, Inc. Model CL-215-1A10, CL-215-6B11 (CL-215T Variant), and...

    Science.gov (United States)

    2011-06-10

    ... Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant economic impact, positive or.... Model CL-215-1A10, CL- 215-6B11 (CL-215T Variant), and CL-215-6B11 (CL-415 Variant) Airplanes AGENCY.... Model CL-215-1A10 airplanes, serial numbers 1051 through 1125 inclusive; Model CL-215- 6B11...

  18. Dicty_cDB: SSI215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI215 (Link to dictyBase) - - - Contig-U12249-1 SSI215Z (Link... to Original site) - - SSI215Z 640 - - - - Show SSI215 Library SS (Link to library) Clone ID SSI215 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSI2-A/SSI215Q.Seq.d/ Representative seq. ID SSI21...5Z (Link to Original site) Representative DNA sequence >SSI215 (SSI215Q) /CSM/SS/SSI2-A/SSI215Q.Seq.d/ XXXXX... producing significant alignments: (bits) Value SSI215 (SSI215Q) /CSM/SS/SSI2-A/SSI215Q.Seq.d/ 803 0.0 VSC83

  19. Unexpected Behavior of the Heaviest Halogen Astatine in the Nucleophilic Substitution of Aryliodonium Salts.

    Science.gov (United States)

    Guérard, François; Lee, Yong-Sok; Baidoo, Kwamena; Gestin, Jean-François; Brechbiel, Martin W

    2016-08-22

    Aryliodonium salts have become precursors of choice for the synthesis of (18) F-labeled tracers for nuclear imaging. However, little is known on the reactivity of these compounds with heavy halides, that is, radioiodide and astatide, at the radiotracer scale. In the first comparative study of radiohalogenation of aryliodonium salts with (125) I(-) and (211) At(-) , initial experiments on a model compound highlight the higher reactivity of astatide compared to iodide, which could not be anticipated from the trends previously observed within the halogen series. Kinetic studies indicate a significant difference in activation energy (Ea =23.5 and 17.1 kcal mol(-1) with (125) I(-) and (211) At(-) , respectively). Quantum chemical calculations suggest that astatination occurs via the monomeric form of an iodonium complex whereas iodination occurs via a heterodimeric iodonium intermediate. The good to excellent regioselectivity of halogenation and high yields achieved with diversely substituted aryliodonium salts indicate that this class of compounds is a promising alternative to the stannane chemistry currently used for heavy radiohalogen labeling of tracers in nuclear medicine. PMID:27305065

  20. 7 CFR 215.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... administration of the Program in the State in accordance with the provisions of this part, 7 CFR parts 235, 245, 15, 15a, 15b and, as applicable, 7 CFR part 3015, 7 CFR part 3016 and 7 CFR part 3019, and with FNS... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 215.3 Section 215.3...

  1. 5 CFR 179.215 - Refunds.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Refunds. 179.215 Section 179.215 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS... (unless expressly prohibited by statute or regulation); or (2) An administrative or judicial order...

  2. 48 CFR 233.215 - Contract clause.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contract clause. 233.215....215 Contract clause. Use Alternate I of the clause at FAR 52.233-1, Disputes, when— (1) The... (v) Tracked combat vehicles (vi) Related electronic systems; (2) The contracting officer...

  3. 14 CFR 21.215 - Application.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Application. 21.215 Section 21.215 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT CERTIFICATION... Office in the geographic area in which the manufacturer or air carrier is located. The application...

  4. 2 CFR 215.52 - Financial reporting.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Financial reporting. 215.52 Section 215.52... Financial reporting. (a) The following forms or such other forms as may be approved by OMB are authorized... information and the recipient's accounting records are not normally kept on the accrual basis, the...

  5. 2 CFR 215.31 - Insurance coverage.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Insurance coverage. 215.31 Section 215.31 Grants and Agreements OFFICE OF MANAGEMENT AND BUDGET CIRCULARS AND GUIDANCE Reserved UNIFORM... Insurance coverage. Recipients shall, at a minimum, provide the equivalent insurance coverage for...

  6. 25 CFR 215.13 - Bond.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Bond. 215.13 Section 215.13 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEAD AND ZINC MINING OPERATIONS AND LEASES, QUAPAW... or notes in the aggregate sum prescribed as security for the carrying out of the terms,...

  7. 36 CFR 2.15 - Pets.

    Science.gov (United States)

    2010-07-01

    ... section does not apply to dogs used by authorized Federal, State and local law enforcement officers in the... accordance with applicable Federal and State laws and in accordance with conditions which may be established... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Pets. 2.15 Section 2.15...

  8. 24 CFR 884.215 - Lease requirements.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Lease requirements. 884.215 Section... RENTAL HOUSING PROJECTS Project Development and Operation § 884.215 Lease requirements. The Lease shall... provisions listed in paragraph (c) of this section. (a) Term of lease. The term of the Lease shall be for...

  9. 76 FR 66620 - Airworthiness Directives; Bombardier, Inc. Model CL-215-1A10, CL-215-6B11 (CL-215T Variant), and...

    Science.gov (United States)

    2011-10-27

    ... Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant economic impact, positive or.... Model CL-215-1A10, CL- 215-6B11 (CL-215T Variant), and CL-215-6B11 (CL-415 Variant) Airplanes AGENCY... comments. SUMMARY: We are adopting a new airworthiness directive (AD) for certain Bombardier, Inc. Model...

  10. Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

    CERN Document Server

    Andreyev, Andrei

    2013-01-01

    Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

  11. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  12. 49 CFR 215.303 - Stenciling of restricted cars.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Stenciling of restricted cars. 215.303 Section 215... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Stenciling § 215.303 Stenciling of restricted cars. (a) Each restricted railroad freight car that is described in § 215.205(a)...

  13. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  14. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  15. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    International Nuclear Information System (INIS)

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  16. 49 CFR 215.7 - Prohibited acts.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS General § 215.7 Prohibited acts. Any... railroad; a manager, supervisor, official, or other employee or agent of a railroad; any owner... providing goods or services to a railroad; and any employee of such owner, manufacturer, lessor, lessee,...

  17. 10 CFR 215.3 - Supply reports.

    Science.gov (United States)

    2010-01-01

    ... ENERGY OIL COLLECTION OF FOREIGN OIL SUPPLY AGREEMENT INFORMATION § 215.3 Supply reports. (a) Any person having the right to lift for export by virtue of any equity interest, reimbursement for services... barrels per day or more of crude oil for a period of at least one year, or (2) a total of...

  18. 2 CFR 215.24 - Program income.

    Science.gov (United States)

    2010-01-01

    ... to further eligible project or program objectives. (2) Used to finance the non-Federal share of the... REQUIREMENTS FOR GRANTS AND AGREEMENTS WITH INSTITUTIONS OF HIGHER EDUCATION, HOSPITALS, AND OTHER NON-PROFIT ORGANIZATIONS (OMB CIRCULAR A-110) Post Award Requirements Financial and Program Management § 215.24...

  19. 23 CFR 645.215 - Approvals.

    Science.gov (United States)

    2010-04-01

    .... 109, 111, and 116, and 23 CFR 1.23 and 1.27, and meet the requirements of this regulation, the FHWA... Accommodation of Utilities § 645.215 Approvals. (a) Each State transportation department shall submit a... the FHWA for prior concurrence, except when the proposed installation is not in accordance with...

  20. 48 CFR 215.404-4 - Profit.

    Science.gov (United States)

    2010-10-01

    ... DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 215.404-4... prenegotiation profit or fee objective on any negotiated contract action when cost or pricing data is obtained... analysis when assessing cost realism in competitive acquisitions. (2) When using a structured approach,...

  1. 48 CFR 215.407-5 - Estimating systems.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Estimating systems. 215.407-5 Section 215.407-5 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM....407-5 Estimating systems....

  2. 29 CFR 1910.215 - Abrasive wheel machinery.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 5 2010-07-01 2010-07-01 false Abrasive wheel machinery. 1910.215 Section 1910.215 Labor... OCCUPATIONAL SAFETY AND HEALTH STANDARDS Machinery and Machine Guarding § 1910.215 Abrasive wheel machinery. (a... wheel in motion. (5) Excluded machinery. Natural sandstone wheels and metal, wooden, cloth, or...

  3. 23 CFR 668.215 - Programming and project procedures.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Programming and project procedures. 668.215 Section 668.215 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS EMERGENCY RELIEF PROGRAM Procedures for Federal Agencies for Federal Roads § 668.215...

  4. 41 CFR 101-6.215-3 - Supervision and coordination.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Supervision and coordination. 101-6.215-3 Section 101-6.215-3 Public Contracts and Property Management Federal Property...-Nondiscrimination in Programs Receiving Federal Financial Assistance § 101-6.215-3 Supervision and coordination....

  5. 26 CFR 1.215-1 - Periodic alimony, etc., payments.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Periodic alimony, etc., payments. 1.215-1 Section 1.215-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME..., etc., payments. (a) A deduction is allowable under section 215 with respect to periodic payments...

  6. 40 CFR 5.215 - Membership practices of certain organizations.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Membership practices of certain organizations. 5.215 Section 5.215 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL... Coverage § 5.215 Membership practices of certain organizations. (a) Social fraternities and...

  7. 49 CFR 215.119 - Defective freight car truck.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Defective freight car truck. 215.119 Section 215... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Freight Car Components Suspension System § 215.119 Defective freight car truck. A railroad may not place or continue in service...

  8. 40 CFR 21.5 - Issuance of statements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Issuance of statements. 21.5 Section 21.5 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL SMALL BUSINESS § 21.5 Issuance of statements. (a) Upon application by a small business concern pursuant to § 21.3 the...

  9. 48 CFR 215.407-3 - Forward pricing rate agreements.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Forward pricing rate agreements. 215.407-3 Section 215.407-3 Federal Acquisition Regulations System DEFENSE ACQUISITION... Contract Pricing 215.407-3 Forward pricing rate agreements. (b)(i) Use forward pricing rate agreement...

  10. 7 CFR 215.9 - Effective date for reimbursement.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Effective date for reimbursement. 215.9 Section 215.9 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.9 Effective date for reimbursement. (a) A State Agency,...

  11. 7 CFR 215.14a - Procurement standards.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Procurement standards. 215.14a Section 215.14a Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.14a Procurement standards. (a) General. State agencies and...

  12. 7 CFR 215.7 - Requirements for participation.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Requirements for participation. 215.7 Section 215.7 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.7 Requirements for participation. (a) Any school or...

  13. 7 CFR 215.6 - Use of funds.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Use of funds. 215.6 Section 215.6 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.6 Use of funds. (a) Federal funds made available under the Program shall be...

  14. 7 CFR 215.1 - General purpose and scope.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false General purpose and scope. 215.1 Section 215.1 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.1 General purpose and scope. This part announces the policies...

  15. 7 CFR 215.13 - Management evaluations and audits.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Management evaluations and audits. 215.13 Section 215.13 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.13 Management evaluations and audits. (a) Unless...

  16. 7 CFR 215.11 - Special responsibilities of State agencies.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Special responsibilities of State agencies. 215.11 Section 215.11 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.11 Special responsibilities of State agencies....

  17. 7 CFR 215.5 - Method of payment to States.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Method of payment to States. 215.5 Section 215.5 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.5 Method of payment to States. (a) Funds to be paid to any...

  18. Stability and in vivo behavior of Rh[16aneS4-diol]211At complex: A potential precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    Introduction: The heavy halogen 211At is of great interest for targeted radiotherapy because it decays by the emission of short-range, high-energy α-particles. However, many astatine compounds that have been synthesized are unstable in vivo, providing motivation for seeking other 211At labeling strategies. One relatively unexplored approach is to utilize prosthetic groups based on astatinated rhodium (III) complex stabilized with a tetrathioether macrocyclic ligand – Rh[16aneS4-diol]211At. The purpose of the current study was to evaluate the in vitro and in vivo stability of this complex in comparison to its iodine analog – Rh[16aneS4-diol]131I. Methods: Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I complexes were synthesized and purified by HPLC. The stability of both complexes was evaluated in vitro by incubation in phosphate-buffered saline (PBS) and human serum at different temperatures. The in vivo behavior of the two radiohalogenated complexes was assessed by a paired-label biodistribution study in normal Balb/c mice. Results: Both complexes were synthesized in high yield and purity. Almost no degradation was observed for Rh[16aneS4-diol]131I in PBS over a 72 h incubation. The astatinated analog exhibited good stability in PBS over 14 h. A slow decline in the percentage of intact complex was observed for both tracers in human serum. In the biodistribution study, retention of 211At in most tissues was higher than that of 131I at all time points, especially in spleen and lungs. Renal clearance of Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I predominated, with 84.1 ± 2.3% and 94.6 ± 0.9% of injected dose excreted via the urine at 4 h. Conclusions: The Rh[16aneS4-diol]211At complex might be useful for constructing prosthetic groups for the astatination of biomolecules and further studies are planned to evaluate this possibility

  19. 25 CFR 215.7 - Advertisement of sale of leases.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Advertisement of sale of leases. 215.7 Section 215.7 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEAD AND ZINC MINING OPERATIONS AND LEASES, QUAPAW AGENCY § 215.7 Advertisement of sale of leases. Upon authority being granted by the Secretary of the Interior to...

  20. 32 CFR 215.8 - Organization and administration.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Organization and administration. 215.8 Section...) MISCELLANEOUS EMPLOYMENT OF MILITARY RESOURCES IN THE EVENT OF CIVIL DISTURBANCES § 215.8 Organization and administration. (a) A DoD Civil Disturbance Steering Committee will be established to provide advice...

  1. 36 CFR 215.7 - Legal notice of decision.

    Science.gov (United States)

    2010-07-01

    ... subject to appeal pursuant to 36 CFR part 215 and include the following: (i) Name and address of the Appeal Deciding Officer with whom an appeal is to be filed. The notice shall specify a street, postal..., or a designee, has determined that an emergency situation exists (§ 215.10), and which portion of...

  2. 12 CFR 347.215 - Exemptions from deposit insurance requirement.

    Science.gov (United States)

    2010-01-01

    ... importance of maintaining and improving the availability of credit to all sectors of the United States... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Exemptions from deposit insurance requirement. 347.215 Section 347.215 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION REGULATIONS...

  3. 10 CFR 215.5 - Pricing and volume reports.

    Science.gov (United States)

    2010-01-01

    ... DEPARTMENT OF ENERGY OIL COLLECTION OF FOREIGN OIL SUPPLY AGREEMENT INFORMATION § 215.5 Pricing and volume reports. To the extent not reported pursuant to § 215.3, any person lifting for export crude oil from a... directly or indirectly for crude oil; changes in participation ratios; changes in...

  4. 48 CFR 952.215-70 - Key Personnel.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Key Personnel. 952.215-70... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 952.215-70 Key Personnel. As prescribed in 915.408-70, the contracting officer shall insert the following clause: Key Personnel (DEC...

  5. 48 CFR 2052.215-70 - Key personnel.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Key personnel. 2052.215-70... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 2052.215-70 Key personnel. As... following clause as applicable to the requirement: Key Personnel (JAN 1993) (a) The following...

  6. 2 CFR 215.45 - Cost and price analysis.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Cost and price analysis. 215.45 Section 215... ADMINISTRATIVE REQUIREMENTS FOR GRANTS AND AGREEMENTS WITH INSTITUTIONS OF HIGHER EDUCATION, HOSPITALS, AND OTHER... Cost and price analysis. Some form of cost or price analysis shall be made and documented in...

  7. 49 CFR 215.121 - Defective car body.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Freight Car Components Car Bodies § 215.121 Defective car body. A railroad may not place or continue in service a car, if: (a) Any portion of... 49 Transportation 4 2010-10-01 2010-10-01 false Defective car body. 215.121 Section...

  8. 14 CFR 21.5 - Airplane or Rotorcraft Flight Manual.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Airplane or Rotorcraft Flight Manual. 21.5... CERTIFICATION PROCEDURES FOR PRODUCTS AND PARTS General § 21.5 Airplane or Rotorcraft Flight Manual. (a) With each airplane or rotorcraft that was not type certificated with an Airplane or Rotorcraft Flight...

  9. 47 CFR 36.215 - Miscellaneous revenue-Account 5200.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Miscellaneous revenue-Account 5200. 36.215..., REVENUES, EXPENSES, TAXES AND RESERVES FOR TELECOMMUNICATIONS COMPANIES 1 Operating Revenues and Certain Income Accounts Operating Revenues § 36.215 Miscellaneous revenue—Account 5200. (a) Directory...

  10. 32 CFR Appendix C to Part 45 - DD Form 215

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false DD Form 215 C Appendix C to Part 45 National... CERTIFICATE OF RELEASE OR DISCHARGE FROM ACTIVE DUTY (DD FORM 214/5 SERIES) Pt. 45, App. C Appendix C to Part 45—DD Form 215 EC21OC91.050...

  11. 2 CFR 215.42 - Codes of conduct.

    Science.gov (United States)

    2010-01-01

    ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Codes of conduct. 215.42 Section 215.42... Codes of conduct. The recipient shall maintain written standards of conduct governing the performance of... interest is not substantial or the gift is an unsolicited item of nominal value. The standards of...

  12. 22 CFR 215.6 - Special procedures: Medical records.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Special procedures: Medical records. 215.6... PRIVACY ACT OF 1974 § 215.6 Special procedures: Medical records. If the Assistant Director for Administration or the Privacy Liaison Officer, determines that the release directly to the individual of...

  13. 20 CFR 416.215 - You leave the United States.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false You leave the United States. 416.215 Section... Eligible § 416.215 You leave the United States. You lose your eligibility for SSI benefits for any month during all of which you are outside of the United States. If you are outside of the United States for...

  14. 42 CFR 57.215 - Records, reports, inspection, and audit.

    Science.gov (United States)

    2010-10-01

    ... overdue report. (3) The school must also comply with the requirements of 45 CFR part 74 and section 798(e... 42 Public Health 1 2010-10-01 2010-10-01 false Records, reports, inspection, and audit. 57.215... Health Professions Student Loans § 57.215 Records, reports, inspection, and audit. (a) Each...

  15. 48 CFR 215.470 - Estimated data prices.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Estimated data prices. 215.470 Section 215.470 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM....470 Estimated data prices. (a) DoD requires estimates of the prices of data in order to evaluate...

  16. 45 CFR 618.215 - Membership practices of certain organizations.

    Science.gov (United States)

    2010-10-01

    ....215 Section 618.215 Public Welfare Regulations Relating to Public Welfare (Continued) NATIONAL SCIENCE... institutions of higher education. (b) YMCA, YWCA, Girl Scouts, Boy Scouts, and Camp Fire Girls. These Title IX... Young Women's Christian Association (YWCA), the Girl Scouts, the Boy Scouts, and Camp Fire Girls....

  17. 37 CFR 1.215 - Patent application publication.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Patent application publication. 1.215 Section 1.215 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES National Processing Provisions...

  18. Dicty_cDB: VFH215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available um calcium-dependent cell adhesion molecule-1 DdCAD-1 (cadA) mRNA, complete cds. 1065 0...3 |AF340153.1 Dictyostelium discoideum calcium-dependent cell adhesion molecule-1...ts) Value ( P54657 ) RecName: Full=Calcium-dependent cell adhesion molecule ... 378 e-104 U20997_1( U20997 |pid:non...l.tsukuba.ac.jp/CSM/VF/VFH2-A/VFH215Q.Seq.d/ Representative seq. ID VFH215F (Link to Original si...te) Representative DNA sequence >VFH215 (VFH215Q) /CSM/VF/VFH2-A/VFH215Q.Seq.d/ AAATA

  19. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D., Scott

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  20. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    International Nuclear Information System (INIS)

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET α-emitter astatine-211 (211At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 (123I), 340-fold for technetium-99m pertechnetate (99mTcO4-) and 60-fold for 211At. Cellular 211At accumulation was found to be dependent on extracellular Na+ ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and 99mTcO4- uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated 211At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and 211At were rapidly (apparent t1/2 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times (123I), 25 times (99mTcO4-) and 10 times (211At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of 123I and 211At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for 123I, 5.2 h for 211At) and preliminary dosimetric calculations indicate high tumour absorbed doses (3.5 Gy/MBqtumour for 131I and 50.3 Gy/MBqtumour for 211At). In

  1. 18 CFR 367.2150 - Account 215, Appropriated retained earnings.

    Science.gov (United States)

    2010-04-01

    ... NATURAL GAS ACT Balance Sheet Chart of Accounts Proprietary Capital § 367.2150 Account 215, Appropriated... ACT OF 2005, FEDERAL POWER ACT AND NATURAL GAS ACT UNIFORM SYSTEM OF ACCOUNTS FOR CENTRALIZED...

  2. Dicty_cDB: VHP215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gy vs Protein Score E Sequences producing significant alignments: (bits) Value AY631393_1( AY631393 |pid:none) Dictyostelium discoide...G19... 132 4e-29 AF350242_1( AF350242 |pid:none) Pichia angusta aminopeptidase gen...e... 130 9e-29 ( P32454 ) RecName: Full=Aminopeptidase 2, mitochondrial; ... 129 3e-28 protein update 2009....e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP2-A/VHP215Q.Seq.d/ Representati...ve seq. ID VHP215P (Link to Original site) Representative DNA sequence >VHP215 (VHP215Q) /CSM/VH/VHP2-A/VHP

  3. 48 CFR 215.404-76 - Reporting profit and fee statistics.

    Science.gov (United States)

    2010-10-01

    ... statistics. 215.404-76 Section 215.404-76 Federal Acquisition Regulations System DEFENSE ACQUISITION... Contract Pricing 215.404-76 Reporting profit and fee statistics. Follow the procedures at PGI 215.404-76 for reporting profit and fee statistics....

  4. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    Energy Technology Data Exchange (ETDEWEB)

    Petrich, T.; Helmeke, H.-J.; Meyer, G.J.; Knapp, W.H.; Poetter, E. [Department of Nuclear Medicine, Medizinische Hochschule Hannover (Germany)

    2002-07-01

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET {alpha}-emitter astatine-211 ({sup 211}At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 ({sup 123}I), 340-fold for technetium-99m pertechnetate ({sup 99m}TcO{sub 4}{sup -}) and 60-fold for {sup 211}At. Cellular {sup 211}At accumulation was found to be dependent on extracellular Na{sup +} ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and {sup 99m}TcO{sub 4}{sup -} uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated {sup 211}At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and {sup 211}At were rapidly (apparent t{sub 1/2} 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times ({sup 123}I), 25 times ({sup 99m}TcO{sub 4}{sup -}) and 10 times ({sup 211}At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of {sup 123}I and {sup 211}At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for {sup 123}I, 5.2 h for {sup 211}At) and

  5. 18 CFR 157.215 - Underground storage testing and development.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Underground storage... of the Natural Gas Act for Certain Transactions and Abandonment § 157.215 Underground storage testing... observation wells for the testing or development of underground reservoirs for the possible storage of gas,...

  6. 48 CFR 2052.215-75 - Proposal presentation and format.

    Science.gov (United States)

    2010-10-01

    ... exception to submitting cost or pricing data shall be made in accordance with FAR 52.215-20(a). (iii) If the contracting officer does not grant the offeror an exception from the requirement to submit cost or pricing... the basic provision: (b)(2)(iv) The offeror's cost proposal shall be based on the NRC's...

  7. 48 CFR 215.404-71-1 - General.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 215... range provides values based on above normal or below normal conditions. In the price negotiation... risk; (2) Contract type risk; (3) Facilities capital employed; and (4) Cost efficiency. (b)...

  8. 6 CFR 27.215 - Security vulnerability assessments.

    Science.gov (United States)

    2010-01-01

    ...-risk, the facility must complete a Security Vulnerability Assessment. A Security Vulnerability... 6 Domestic Security 1 2010-01-01 2010-01-01 false Security vulnerability assessments. 27.215... provided in § 27.235, a covered facility must complete the Security Vulnerability Assessment through...

  9. 2 CFR 215.15 - Metric system of measurement.

    Science.gov (United States)

    2010-01-01

    ... Programs” (56 FR 35801, 3 CFR, 1991 Comp., p. 343). ... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Metric system of measurement. 215.15 Section... measurement. The Metric Conversion Act, as amended by the Omnibus Trade and Competitiveness Act (15 U.S.C....

  10. 36 CFR 215.5 - Legal notice of proposed actions.

    Science.gov (United States)

    2010-07-01

    ... the notice of availability (NOA) in the Federal Register (§ 215.6(a)(2)). The legal notice must be published after the NOA and contain the NOA publication date. (vi) A statement that only those who submit... proposed action to be analyzed and documented in an EA. The publication date of the NOA in the...

  11. 36 CFR 215.19 - Appeal Reviewing Officer.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Appeal Reviewing Officer. 215... Reviewing Officer. (a) Designation. The Appeal Reviewing Officer shall be: (1) Designated by the Chief or... Appeal Reviewing Officer shall review an appeal and the decision documentation and make a...

  12. 49 CFR 180.215 - Reporting and record retention requirements.

    Science.gov (United States)

    2010-10-01

    ... QUALIFICATION AND MAINTENANCE OF PACKAGINGS Qualification, Maintenance and Use of Cylinders § 180.215 Reporting... must include the following information: (1) Calibration test records. For each test to demonstrate calibration, the date; serial number of the calibrated cylinder; calibration test pressure; total, elastic...

  13. 20 CFR 628.215 - State Human Resource Investment Council.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false State Human Resource Investment Council. 628... PROGRAMS UNDER TITLE II OF THE JOB TRAINING PARTNERSHIP ACT State Planning § 628.215 State Human Resource..., 702, and 703 of the Act, establish a State Human Resource Investment Council (HRIC). The...

  14. 36 CFR 21.5 - Therapeutic bathing requirements.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Therapeutic bathing... INTERIOR HOT SPRINGS NATIONAL PARK; BATHHOUSE REGULATIONS § 21.5 Therapeutic bathing requirements. Baths... physicians only if the bath is administered in accordance with the bath directions prescribed by...

  15. 7 CFR 1260.215 - Patents, copyrights, inventions and publications.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Patents, copyrights, inventions and publications... AGRICULTURE BEEF PROMOTION AND RESEARCH Beef Promotion and Research Order Miscellaneous § 1260.215 Patents, copyrights, inventions and publications. (a) Any patents, copyrights, inventions or publications...

  16. 40 CFR 180.215 - Naled; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Naled; tolerances for residues. 180... PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances § 180.215 Naled; tolerances for residues. (a) General. (1) Tolerances are established for residues of...

  17. 48 CFR 52.215-17 - Waiver of Facilities Capital Cost of Money.

    Science.gov (United States)

    2010-10-01

    ... Capital Cost of Money. 52.215-17 Section 52.215-17 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.215-17 Waiver of Facilities Capital Cost of Money. As prescribed in 15.408(i), insert the following clause: Waiver of Facilities Capital Cost of Money (OCT 1997) The Contractor did...

  18. 48 CFR 52.215-16 - Facilities Capital Cost of Money.

    Science.gov (United States)

    2010-10-01

    ... Money. 52.215-16 Section 52.215-16 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....215-16 Facilities Capital Cost of Money. As prescribed in 15.408(h), insert the following provision: Facilities Capital Cost of Money (JUN 2003) (a) Facilities capital cost of money will be an allowable...

  19. 25 CFR 215.25 - Other minerals and deep-lying lead and zinc minerals.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Other minerals and deep-lying lead and zinc minerals. 215.25 Section 215.25 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEAD AND ZINC MINING OPERATIONS AND LEASES, QUAPAW AGENCY § 215.25 Other minerals and deep-lying...

  20. 41 CFR 102-37.215 - When must a SASP make a certification regarding lobbying?

    Science.gov (United States)

    2010-07-01

    ... certification regarding lobbying? 102-37.215 Section 102-37.215 Public Contracts and Property Management Federal... Property § 102-37.215 When must a SASP make a certification regarding lobbying? You are subject to the anti-lobbying certification and disclosure requirements in part 105-69 of this title when all of the...

  1. 40 CFR 1065.215 - Pressure transducers, temperature sensors, and dewpoint sensors.

    Science.gov (United States)

    2010-07-01

    ... sensors, and dewpoint sensors. 1065.215 Section 1065.215 Protection of Environment ENVIRONMENTAL... Measurement of Engine Parameters and Ambient Conditions § 1065.215 Pressure transducers, temperature sensors, and dewpoint sensors. (a) Application. Use instruments as specified in this section to...

  2. 50 CFR 226.215 - Critical habitat for the North Pacific Right Whale (Eubalaena japonica).

    Science.gov (United States)

    2010-10-01

    ... Right Whale (Eubalaena japonica). 226.215 Section 226.215 Wildlife and Fisheries NATIONAL MARINE... DESIGNATED CRITICAL HABITAT § 226.215 Critical habitat for the North Pacific Right Whale (Eubalaena japonica). (a) Primary Constituent Elements. The primary constituent elements of the North Pacific right...

  3. 48 CFR 215.404-71-3 - Contract type risk and working capital adjustment.

    Science.gov (United States)

    2010-10-01

    ... working capital adjustment. 215.404-71-3 Section 215.404-71-3 Federal Acquisition Regulations System... CONTRACTING BY NEGOTIATION Contract Pricing 215.404-71-3 Contract type risk and working capital adjustment. (a... varying contract types. The working capital adjustment is an adjustment added to the profit objective...

  4. 26 CFR 1.215-1T - Alimony, etc., payments (temporary).

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Alimony, etc., payments (temporary). 1.215-1T Section 1.215-1T Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Additional Itemized Deductions for Individuals § 1.215-1T Alimony,...

  5. 41 CFR 102-34.215 - May Government contractors use Government motor vehicles?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false May Government contractors use Government motor vehicles? 102-34.215 Section 102-34.215 Public Contracts and Property... PROPERTY 34-MOTOR VEHICLE MANAGEMENT Official Use of Government Motor Vehicles § 102-34.215 May...

  6. 7 CFR 215.4 - Payments of funds to States and FNSROs.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Payments of funds to States and FNSROs. 215.4 Section 215.4 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.4 Payments of funds to States and FNSROs. (a) For...

  7. 7 CFR 215.18 - Information collection/recordkeeping-OMB assigned control numbers.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Information collection/recordkeeping-OMB assigned control numbers. 215.18 Section 215.18 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.18 Information...

  8. 7 CFR 215.12 - Claims against schools or child-care institutions.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Claims against schools or child-care institutions. 215.12 Section 215.12 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.12 Claims against schools or...

  9. 7 CFR 215.16 - Suspension, termination and grant closeout procedures.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Suspension, termination and grant closeout procedures. 215.16 Section 215.16 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SPECIAL MILK PROGRAM FOR CHILDREN § 215.16 Suspension, termination and...

  10. 48 CFR 1452.215-70 - Examination of Records by the Department of the Interior.

    Science.gov (United States)

    2010-10-01

    ... the Department of the Interior. 1452.215-70 Section 1452.215-70 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR CONTRACT MANAGEMENT SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1452.215-70 Examination of Records by the Department of the Interior. As prescribed...

  11. Dicty_cDB: CFJ215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFJ215 (Link to dictyBase) - - - Contig-U16287-1 - (Link to Original site) ... equence. 66 6e-07 1 CF514038 |CF514038.1 CAbud0007_IVF _G07 Vitis vinifera cv. cabernet sauvignon (Clone 8 ... ) Bud - CABUD Vitis vinifera cDNA clone CAbud0007_IVF _G07 5', mRNA sequence. 64 3e-06 1 CB910900 |CB9109 ...

  12. Durable donor engraftment after radioimmunotherapy using α-emitter astatine-211-labeled anti-CD45 antibody for conditioning in allogeneic hematopoietic cell transplantation.

    Science.gov (United States)

    Chen, Yun; Kornblit, Brian; Hamlin, Donald K; Sale, George E; Santos, Erlinda B; Wilbur, D Scott; Storer, Barry E; Storb, Rainer; Sandmaier, Brenda M

    2012-02-01

    To reduce toxicity associated with external γ-beam radiation, we investigated radioimmunotherapy with an anti-CD45 mAb labeled with the α-emitter, astatine-211 ((211)At), as a conditioning regimen in dog leukocyte antigen-identical hematopoietic cell transplantation (HCT). Dose-finding studies in 6 dogs treated with 100 to 618 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) without HCT rescue demonstrated dose-dependent myelosuppression with subsequent autologous recovery, and transient liver toxicity in dogs treated with (211)At doses less than or equal to 405 μCi/kg. Higher doses of (211)At induced clinical liver failure. Subsequently, 8 dogs were conditioned with 155 to 625 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) before HCT with dog leukocyte antigen-identical bone marrow followed by a short course of cyclosporine and mycophenolate mofetil immunosuppression. Neutropenia (1-146 cells/μL), lymphopenia (0-270 cells/μL), and thrombocytopenia (1500-6560 platelets/μL) with prompt recovery was observed. Seven dogs had long-term donor mononuclear cell chimerism (19%-58%), whereas 1 dog treated with the lowest (211)At dose (155 μCi/kg) had low donor mononuclear cell chimerism (5%). At the end of follow-up (18-53 weeks), only transient liver toxicity and no renal toxicity had been observed. In conclusion, conditioning with (211)At-labeled anti-CD45 mAb is safe and efficacious and provides a platform for future clinical trials of nonmyeloablative transplantation with radioimmunotherapy-based conditioning. PMID:22134165

  13. 27 CFR 24.215 - Wine or wine products not for beverage use.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Wine or wine products not for beverage use. 24.215 Section 24.215 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Production of Other Than Standard Wine § 24.215 Wine or wine products not for...

  14. Functional brain studies with H215O-PET

    International Nuclear Information System (INIS)

    Positron emission tomography (PET) with intravenous injection of H215O allows us to obtain regional cerebral blood flow (rCBF) images repeatedly within a short period of time. Since the increase of electrical activity in a specific brain region is followed by the abrupt increase of rCBF, the technique with H215O-PET is suitable for functional stimulation-activation studies. In this study, we examined the following fundamental issues : (1) reproducibility of rCBF during resting condition (2) effect of physiological stimulation on CBF (3) anatomical identification of activated area. Our data suggest that relative CBF images and their paired subtraction are suitable for tapping functional localization. The changes in rCBF in association cortex for more complicated tasks are, in general, smaller than those in primary cortex. Combination display of PET image with MR-3D reconstructed brain surface image in each subject is the most reliable technique for anatomical identification of activated site. (J.P.N.)

  15. 22 CFR 215.4 - Times, places, and requirements for identification of individuals making requests.

    Science.gov (United States)

    2010-04-01

    ... identification of individuals making requests. 215.4 Section 215.4 Foreign Relations AGENCY FOR INTERNATIONAL... verify the individual's identity; e.g. driver's license, employee identification card or medicare card... identity and which stipulates that the individual understands that knowingly or willfully seeking...

  16. 22 CFR 215.5 - Access to requested information by individuals.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Access to requested information by individuals. 215.5 Section 215.5 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT REGULATIONS FOR..., determination that access to the record may be granted, verification of the identity of the individual...

  17. 48 CFR 253.215-70 - DD Form 1547, Record of Weighted Guidelines Application.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1547, Record of... Forms 253.215-70 DD Form 1547, Record of Weighted Guidelines Application. Follow the procedures at PGI 253.215-70 for completing DD Form 1547....

  18. 48 CFR 215.404-70 - DD Form 1547, Record of Weighted Guidelines Method Application.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1547, Record of... TYPES CONTRACTING BY NEGOTIATION Contract Pricing 215.404-70 DD Form 1547, Record of Weighted Guidelines Method Application. Follow the procedures at PGI 215.404-70 for use of DD Form 1547 whenever a...

  19. 12 CFR 215.5 - Additional restrictions on loans to executive officers of member banks.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Additional restrictions on loans to executive officers of member banks. 215.5 Section 215.5 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM LOANS TO EXECUTIVE OFFICERS, DIRECTORS, AND PRINCIPAL SHAREHOLDERS OF MEMBER BANKS (REGULATION O) §...

  20. 31 CFR 20.215 - What must I include in my drug-free awareness program?

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false What must I include in my drug-free awareness program? 20.215 Section 20.215 Money and Finance: Treasury Office of the Secretary of the Treasury...-free awareness program to inform employees about— (a) The dangers of drug abuse in the workplace;...

  1. 25 CFR 215.21 - Payment of gross production tax on lead and zinc.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Payment of gross production tax on lead and zinc. 215.21... ZINC MINING OPERATIONS AND LEASES, QUAPAW AGENCY § 215.21 Payment of gross production tax on lead and zinc. The superintendent of the Quapaw Indian Agency is hereby authorized and directed to pay at...

  2. 49 CFR 215.9 - Movement of defective cars for repair.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Movement of defective cars for repair. 215.9... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS General § 215.9 Movement of defective cars for repair. (a) A railroad freight car which has any component described as defective in...

  3. 49 CFR 40.215 - What information about the DER do employers have to provide to BATs and STTs?

    Science.gov (United States)

    2010-10-01

    ... to provide to BATs and STTs? 40.215 Section 40.215 Transportation Office of the Secretary of... Personnel § 40.215 What information about the DER do employers have to provide to BATs and STTs? As an employer, you must provide to the STTs and BATs the name and telephone number of the appropriate DER (and...

  4. 41 CFR 102-85.215 - What if another customer agency forces a GSA customer to move?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What if another customer agency forces a GSA customer to move? 102-85.215 Section 102-85.215 Public Contracts and Property... § 102-85.215 What if another customer agency forces a GSA customer to move? If a GSA customer agency,...

  5. 49 CFR Appendix A to Part 215 - Railroad Freight Car Components

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Pt. 215, App. A Appendix A to... manufactured before May 7, 1958. 4. Griffin, three-riser cast steel wheel, ball rim design, 70-ton capacity....

  6. Importance of the CEP215-Pericentrin Interaction for Centrosome Maturation during Mitosis

    OpenAIRE

    Seongjae Kim; Kunsoo Rhee

    2014-01-01

    At the onset of mitosis, the centrosome undergoes maturation, which is characterized by a drastic expansion of the pericentriolar material (PCM) and a robust increase in microtubule-organizing activity. CEP215 is one of the major PCM components which accumulates at the centrosome during mitosis. The depletion phenotypes indicate that CEP215 is essential for centrosome maturation and bipolar spindle formation. Here, we performed a series of knockdown-rescue experiments to link the protein-prot...

  7. Treatment of cultured glioma cells with the EGFR-TKI gefitinib (''Iressa'', ZD1839) increases the uptake of astatinated EGF despite the absence of gefitinib-mediated growth inhibition

    International Nuclear Information System (INIS)

    The EGFR-TKI (epidermal growth factor receptor tyrosine kinase inhibitor) gefitinib (''Iressa'', ZD1839), a reversible growth inhibitor of EGFR-expressing tumour cells, has been shown to enhance the antitumour effect of ionising radiation, and also to increase the uptake of radioiodinated EGF. Thus, combination of gefitinib treatment and radionuclide targeting is an interesting option for therapy of brain tumours that are difficult to treat with conventional methods. The aim of this study was to evaluate how pre-treatment with gefitinib affects binding of astatinated EGF (211At-EGF) to cultured glioma U343 cells, which express high levels of EGFR. The growth of U343 cells in the presence of gefitinib was investigated, and it was found that gefitinib does not significantly inhibit the growth of these cells. Nevertheless, the uptake of 211At-EGF in U343 cells was markedly increased (up to 3.5 times) in cells pre-treated with gefitinib (1 μM). This indicates that a combination of gefitinib treatment and radionuclide targeting to EGFR might be a useful therapeutic modality, even for patients who do not respond to treatment with gefitinib alone. (orig.)

  8. 31 CFR 585.215 - Conveyances and cargo suspected of being in violation of United Nations sanctions; detention...

    Science.gov (United States)

    2010-07-01

    ... being in violation of United Nations sanctions; detention; blocking. 585.215 Section 585.215 Money and... and cargo suspected of being in violation of United Nations sanctions; detention; blocking. (a) Except... § 585.201, but which are suspected of a violation of United Nations Security Council Resolutions No....

  9. 30 CFR 250.215 - What hydrogen sulfide (H2S) information must accompany the EP?

    Science.gov (United States)

    2010-07-01

    ... methodologies outlined in 40 CFR part 68. ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What hydrogen sulfide (H2S) information must... Contents of Exploration Plans (ep) § 250.215 What hydrogen sulfide (H2S) information must accompany the...

  10. 20 CFR 405.215 - Procedures before a Federal reviewing official.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Procedures before a Federal reviewing... PROCESS FOR ADJUDICATING INITIAL DISABILITY CLAIMS Review of Initial Determinations by a Federal Reviewing Official § 405.215 Procedures before a Federal reviewing official. (a) General. The Federal...

  11. 75 FR 32440 - Catalog of Federal Domestic Assistance (CFDA) Number: 84.215J

    Science.gov (United States)

    2010-06-08

    ... Federal Relay Service, toll free, at 1-800-877-8339. SUPPLEMENTARY INFORMATION: Purpose of Program: The...-Service Community Schools Catalog of Federal Domestic Assistance (CFDA) Number: 84.215J AGENCY: Office of..., definitions, and selection criteria for the Full-Service Community Schools (FSCS) program. The Secretary...

  12. 9 CFR 113.215 - Bovine Virus Diarrhea Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Bovine Virus Diarrhea Vaccine, Killed... REQUIREMENTS Killed Virus Vaccines § 113.215 Bovine Virus Diarrhea Vaccine, Killed Virus. Bovine Virus Diarrhea... paragraph. (i) Eight bovine virus diarrhea susceptible calves (five vaccinates and three controls) shall...

  13. Molecular and immuno-characteristics of immunoglobulin-like glycoproteins in cancer cell-expressed biomarker, CA215.

    Science.gov (United States)

    Lee, Gregory; Cheung, Anthony P; Li, Bo; Ge, Bixia; Chow, Po-Ming

    2012-01-01

    RP215 monoclonal antibody (Mab) was shown to recognize a specific carbohydrate-associated epitope found in cancer cell-expressed glycoproteins, known as CA215. The membrane-bound and soluble forms of CA215 were detected in almost all of the cancer cells in humans, but rarely found in normal tissues. Through MALDI-TOF MS analysis, it has been reported previously that as much as 40% of the detected tryptic peptides of CA215 showed high degrees of sequence homology to those found in immunoglobulin heavy chains. The cancer cell-derived immunoglobulins were further purified from CA215 by affinity column-linked with goat anti-human IgG for molecular characterizations. Semi-quantitative RT-PCR was used to determine the mRNA levels of various immunoglobulin genes expressed by cancer cells of single or multi-cell origins and compared with those found in normal human serum. The stability of CA215 was investigated under different experimental conditions. It was observed that the RP215-specific epitope in CA215 is stable at neutral pH, in human serum or in mice (half life of 5-18 days), but unstable at extreme pH's (pH ≤ 2.0; pH ≥ 12.0) or high temperatures. Enzyme immunoassays were performed with several secondary antibody probes related to human IgG. It was demonstrated that cancer cell-expressed immunoglobulins with RP215-specific epitope have much lower immunoactivity than that of normal human IgG (≤ 5%), despite the fact that both showed almost identical amino acid sequence in the respective Fc region reported previously. This could be the result of aberrant glycosylation of CA215 in cancer cells. Aberrant glycosylation of glycoproteins may have important biological implications on the proliferation of cancer cells in vitro or in vivo. PMID:22417288

  14. 48 CFR 853.215-70 - VA Form 10-1170, Application for Furnishing Nursing Home Care to Beneficiaries of VA.

    Science.gov (United States)

    2010-10-01

    ..., Application for Furnishing Nursing Home Care to Beneficiaries of VA. 853.215-70 Section 853.215-70 Federal... 853.215-70 VA Form 10-1170, Application for Furnishing Nursing Home Care to Beneficiaries of VA. VA Form 10-1170, Application for Furnishing Nursing Home Care to Beneficiaries of VA, will be used...

  15. Downregulation of Plasma miR-215 in Chronic Myeloid Leukemia Patients with Successful Discontinuation of Imatinib

    Directory of Open Access Journals (Sweden)

    Kazuma Ohyashiki

    2016-04-01

    Full Text Available Approximately 40% of chronic myeloid leukemia (CML patients who discontinue imatinib (IM therapy maintain undetectable minimal residual disease (UMRD for more than one year (stopping IM (STOP-IM. To determine a possible biomarker for STOP-IM CML, we examined plasma miRNA expression in CML patients who were able to discontinue IM. We first screened candidate miRNAs in unselected STOP-IM patients, who had sustained UMRD after discontinuing IM for more than six months, in comparison with healthy volunteers, by using a TaqMan low-density array for plasma or exosomes. Exosomal miR-215 and plasma miR-215 were downregulated in the STOP-IM group compared to the control, indicating that the biological relevance of the plasma miR-215 level is equivalent to that of the exosomal level. Next, we performed real-time quantitative RT-PCR in 20 STOP-IM patients, 32 patients with UMRD on continued IM therapy (IM group and 28 healthy volunteers. The plasma miRNA-215 level was significantly downregulated in the STOP-IM group (p < 0.0001; we determined the cut-off level and divided the IM group patients into two groups according to whether the plasma miR-215 was downregulated or not. The IM group patients with a low plasma miR-215 level had a significantly higher total IM intake, compared to the patients with elevated miR-215 levels (p = 0.0229. Functional annotation of miR-215 target genes estimated by the Database for Annotation, Visualization and Integrated Discovery (DAVID bioinformatic tools involved cell cycle, mitosis, DNA repair and cell cycle checkpoint. Our study suggests a possible role of miR-215 in successful IM discontinuation.

  16. 49 CFR Appendix C to Part 215 - FRA Freight Car Standards Defect Code

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Pt. 215, App. C Appendix C to... 13/4″. (C)(1) Rim thickness is 11/16″ or less; (2) Rim thickness is 5/8″ or less; (3) Rim thickness is 9/16″ or less; (D) Wheel cracked or broken in: (1) rim, (2) flange, (3) plate or (4) hub area....

  17. 49 CFR Appendix B to Part 215 - Schedule of Civil Penalties 1

    Science.gov (United States)

    2010-10-01

    ... $100,000 for any violation where circumstances warrant. See 49 CFR part 209, appendix A. Failure to... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Pt. 215, App. B Appendix B to... 7,500 (c) Rim thickness of: (1) 11/16″ or less but more than 5/8″ 2,500 5,000 (2) 5/8″ or less...

  18. Synthesis of 2,15-Hexadecanedione as a Precursor of Muscone

    Institute of Scientific and Technical Information of China (English)

    郭媛; 顾焕; 史真

    2005-01-01

    Muscone is a precious fragrant compound scarce in nature. Many synthetic attempts for this unique natural product have been carried out. In this work, the one-carbon unit transfer reaction of tetrahydrofolate coenzyme was initialed. Bisbenzimidazolium salt was used as tetrahydrofolate coenzyme model, and thus the biomimetic synthesis of 2,15-hexadecanedione, a precursor of muscone, was successfully accomplished by using the addition-hydrolysis reaction of bisbenzimidazolium salt with methyl magnesium iodide.

  19. Modal Interpolation Program, L 215 (INTERP). Volume 2; Supplemental System Design and Maintenance Document

    Science.gov (United States)

    Hirayama, M. Y.; Kroll, R. I.; Clemmons, R. E.

    1979-01-01

    The design, structure, and usage of the modal interpolation program L215 are presented. The program uses modal data sets of arrays containing interpolation coefficients. The interpolation arrays are used to determine displacements at various aerodynamic control points. The displacements consist of translations normal to the aerodynamic surface and surface slopes that are parallel and perpendicular to the free stream direction. Five different interpolation methods are available.

  20. Molecular line survey of Orion A from 215 to 247 GHz

    International Nuclear Information System (INIS)

    Molecular line emission from the core of the Orion molecular cloud has been surveyed from 215 to 247 GHz to an average sensitivity of about 0.2 K. A total of 544 resolvable lines were detected, of which 517 are identified and attributed to 25 distinct chemical species. A large fraction of the lines are partially blended with other identified transitions. Because of the large line width in the Orion core, the spectrum is near the confusion limit for the weakest lines identified (roughly-equal0.2 K)

  1. System for cerebral blood flow measurement using an H215O autoradiographic method and positron emission tomography

    International Nuclear Information System (INIS)

    A system for CBF measurement using an H215O autoradiographic method and positron emission tomography (PET) has been designed and installed as a clinical tool. Following an intravenous injection of H215O, a radioactivity accumulation in the brain tissue for 60 s and a continuous record of radioactivity in arterial blood were measured by a high counting speed PET device and a beta-ray detector, respectively, and CBF was calculated by a table-lookup procedure. First, this method was compared with the C15O2 inhalation steady-state method on 17 cerebrovascular disease patients and four normal subjects. The two values for CBF agreed with each other when H215O autoradiographic method was applied by correction for the dispersion in the measured arterial radioactivity-time curve. However, without the correction, the CBF by the H215O autoradiographic method revealed substantial overestimation by 30.6 +/- 17.5%. A reduced gray/white ratio of CBF was also observed in the H215O autoradiographic method. Second, simulation was performed in order to determine optimal accumulation time by PET scan; the result was that errors due to dispersion and time mismatch became critical as the accumulation time was shortened to less than 60 s

  2. A possible Chandra and Hubble Space Telescope detection of extragalactic WHIM towards PG 1116+215

    CERN Document Server

    Bonamente, M; Tilton, E; Liivamagi, J; Tempel, E; Heinamaki, P; Fang, T

    2016-01-01

    (Abridged) We have analyzed Chandra LETG and XMM-Newton RGS spectra towards the z=0.177 quasar PG 1116+215, a sightline that is rendered particularly interesting by the HST detection of several OVI and HI broad Lyman-alpha absorption lines that may be associated with the warm-hot intergalactic medium. We performed a search for resonance K-alpha absorption lines from OVII and OVIII at the redshifts of the detected far-ultraviolet lines. We detected an absorption line in the Chandra spectra at 5.2 sigma confidence level at wavelengths corresponding to OVIII K-alpha at z=0.0911+-0.0004+-0.0005 (statistical followed by systematic error). This redshift is within 3 sigma of that of a HI broad Lyman-alpha of b=130 km/s at z=0.09279+-0.00005. We have also analyzed the available XMM-Newton RGS data towards PG 1116+215. Unfortunately, the XMM-Newton data are not suitable to investigate this line because of instrumental features at the wavelengths of interest. At the same redshift, the Chandra and XMM-Newton spectra hav...

  3. A possible Chandra and Hubble Space Telescope detection of extragalactic WHIM towards PG 1116+215

    Science.gov (United States)

    Bonamente, M.; Nevalainen, J.; Tilton, E.; Liivamägi, J.; Tempel, E.; Heinämäki, P.; Fang, T.

    2016-04-01

    We have analysed Chandra low energy transmission grating and XMM-Newton Reflection Grating Spectrometer (RGS) spectra towards the z = 0.177 quasar PG 1116+215, a sightline that is rendered particularly interesting by the Hubble Space Telescope (HST) detection of several O VI and H I broad Lyman α absorption (BLA) lines that may be associated with the warm-hot intergalactic medium (WHIM). We performed a search for resonance Kα absorption lines from O VII and O VIII at the redshifts of the detected far-ultraviolet lines. We detected an absorption line in the Chandra spectra at the 5.2σ confidence level at wavelengths corresponding to O VIII Kα at z = 0.0911 ± 0.0004 ± 0.0005 (statistical followed by systematic error). This redshift is within 3σ of that of an H I broad Lyman α of b ≃ 130 km s-1 (corresponding to a temperature of log T(K) ≃ 6.1) at z = 0.092 79 ± 0.000 05. We have also analysed the available XMM-Newton RGS data towards PG 1116+215. Unfortunately, the XMM-Newton data are not suitable to investigate this line because of instrumental features at the wavelengths of interest. At the same redshift, the Chandra and XMM-Newton spectra have O VII Kα absorption-line features of significance 1.5σ and 1.8σ, respectively. We also analysed the available Sloan Digital Sky Survey (SDSS) spectroscopic galaxy survey data towards PG 1116+215 in the redshift range of interest. We found evidence for a galaxy filament that intersect the PG 1116+215 sightline and additional galaxy structures that may host WHIM. The H I BLA and the O VIII Kα absorbers are within a few Mpc of the filament (assuming that redshifts track Hubble flow distances) or consistent with gas accreting on to the filament from either direction relative to the sightline with velocities of a few × 100 km s-1. The combination of HST, Chandra, XMM-Newton and SDSS data indicates that we have likely detected a multi-temperature WHIM at z ≃ 0.091-0.093 towards PG 1116+215. The O VIII K

  4. Conformational flexibility related to enzyme activity: evidence for a dynamic active-site gatekeeper function of Tyr(215) in Aerococcus viridans lactate oxidase.

    Science.gov (United States)

    Stoisser, Thomas; Brunsteiner, Michael; Wilson, David K; Nidetzky, Bernd

    2016-01-01

    L-Lactate oxidase (LOX) belongs to a large family of flavoenzymes that catalyze oxidation of α-hydroxy acids. How in these enzymes the protein structure controls reactivity presents an important but elusive problem. LOX contains a prominent tyrosine in the substrate binding pocket (Tyr(215) in Aerococcus viridans LOX) that is partially responsible for securing a flexible loop which sequesters the active site. To characterize the role of Tyr(215), effects of substitutions of the tyrosine (Y215F, Y215H) were analyzed kinetically, crystallographically and by molecular dynamics simulations. Enzyme variants showed slowed flavin reduction and oxidation by up to 33-fold. Pyruvate release was also decelerated and in Y215F, it was the slowest step overall. A 2.6-Å crystal structure of Y215F in complex with pyruvate shows the hydrogen bond between the phenolic hydroxyl and the keto oxygen in pyruvate is replaced with a potentially stronger hydrophobic interaction between the phenylalanine and the methyl group of pyruvate. Residues 200 through 215 or 216 appear to be disordered in two of the eight monomers in the asymmetric unit suggesting that they function as a lid controlling substrate entry and product exit from the active site. Substitutions of Tyr(215) can thus lead to a kinetic bottleneck in product release. PMID:27302031

  5. 20 CFR 652.215 - Do any provisions in WIA change the requirement that State merit-staff employees must deliver...

    Science.gov (United States)

    2010-04-01

    ... requirement that State merit-staff employees must deliver services provided under the Act? 652.215 Section 652... § 652.215 Do any provisions in WIA change the requirement that State merit-staff employees must deliver... authority of the Act, including services to veterans, be provided by State merit-staff employees....

  6. Conformational flexibility related to enzyme activity: evidence for a dynamic active-site gatekeeper function of Tyr215 in Aerococcus viridans lactate oxidase

    Science.gov (United States)

    Stoisser, Thomas; Brunsteiner, Michael; Wilson, David K.; Nidetzky, Bernd

    2016-01-01

    L-Lactate oxidase (LOX) belongs to a large family of flavoenzymes that catalyze oxidation of α-hydroxy acids. How in these enzymes the protein structure controls reactivity presents an important but elusive problem. LOX contains a prominent tyrosine in the substrate binding pocket (Tyr215 in Aerococcus viridans LOX) that is partially responsible for securing a flexible loop which sequesters the active site. To characterize the role of Tyr215, effects of substitutions of the tyrosine (Y215F, Y215H) were analyzed kinetically, crystallographically and by molecular dynamics simulations. Enzyme variants showed slowed flavin reduction and oxidation by up to 33-fold. Pyruvate release was also decelerated and in Y215F, it was the slowest step overall. A 2.6-Å crystal structure of Y215F in complex with pyruvate shows the hydrogen bond between the phenolic hydroxyl and the keto oxygen in pyruvate is replaced with a potentially stronger hydrophobic interaction between the phenylalanine and the methyl group of pyruvate. Residues 200 through 215 or 216 appear to be disordered in two of the eight monomers in the asymmetric unit suggesting that they function as a lid controlling substrate entry and product exit from the active site. Substitutions of Tyr215 can thus lead to a kinetic bottleneck in product release. PMID:27302031

  7. 48 CFR 215.403-1 - Prohibition on obtaining cost or pricing data (10 U.S.C. 2306a and 41 U.S.C. 254b).

    Science.gov (United States)

    2010-10-01

    ... METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 215.403-1 Prohibition on obtaining... clearly established on the basis of price analysis (see FAR 15.404-1(b)). (3) Commercial items. (A) Follow the procedures at PGI 215.403-1(c)(3)(A) for pricing commercial items. (B) By November 30th of...

  8. Results of the radiological survey at 1110 Central Avenue, Albany, New York (AL215)

    International Nuclear Information System (INIS)

    A number of properties in the Albany/Colonie area have been identified as being potentially contaminated with uranium originating from the former National Lead Company's uranium forming plant in Colonie, New York. The property at 1110 Central Avenue in Albany, New York (AL215) was the subject of a radiological investigation initiated May 4, 1987. This commercial property consists of a one-story concrete block office building (Building 1), a one-story concrete block warehouse (Building 2), and four connected storage buildings constructed variously of wood, metal, or concrete block. The structures are situated on an irregularly shaped lot. A diagram of the property showing the approximate boundaries and the 10-m grid network established for measurements outside the buildings is shown. The lot included in the radiological survey was /approximately/45 m wide by 98 m deep. Two views of the property are shown. 13 refs., 6 figs., 5 tabs

  9. 1 215例次恶性胆管梗阻内镜治疗的体会%Endoscopic management of 1 215 malignant bile duct obstructions

    Institute of Scientific and Technical Information of China (English)

    胡冰; 周岱云; 龚彪; 王书智; 杨广顺; 吴孟超

    2001-01-01

    目的探讨采用治疗性内窥镜逆行胰胆管插管技术(ERCP技术),姑息性解除恶性肿瘤所致胆管梗阻的可行性。方法采用ERCP治疗929例1 215例次胆管恶性梗阻,包括胆管癌567例次、肝癌255例次、胆囊癌83例次、胰腺癌172例次、乳头壶腹癌97例次、其它转移性肿瘤41例次;导致胆管低位梗阻263例次、中段梗阻43例次、高位梗阻909例次;血清胆红素(284.3±174.5)μmol/L。共行胆道内置管引流599例次、鼻胆管引流385例次,放置可膨式金属胆道支架167例次,联合引流39例次,乳头括约肌切开19例次,乳头开窗造口术6例次。结果操作成功率94.3%,消除黄疸总有效率81.8%,治疗后患者平均生存14个月,1、2、3年的预计存活率分别为75.9%、44.0%和25.2%。全组发生与操作有关并发症23例(2.6%),死亡3例(0.2%)。结论内镜介入治疗技术是安全有效解除胆道恶性梗阻的方法,对中晚期胆道肿瘤患者基本可替代姑息性胆道手术。%Objective To review the experience with endoscopic palliation of malignant obstructive jaundice (MOJ) in 929 patients. Methods From 1994 to 1998, 929 patients (598 Males and 331 females) underwent 1 215 endoscopic palliation drainages for MOJ in our hospital. The mean age of these patients was 57 years (range 8-86). Tumor obstruction occurred in the distal CBD (263 patients), the middle CBD (43), and the hilum (909), with a mean bilirubin level of 284 μmol/L (range 26-810). Of the 1 215 drainages, 599 were performed by stenting with plastic endoprosthesis, 385 by nasobiliary catheterization, 167 by expandable metal stents, 39 by combined drainage methods, 19 by tumor papillotomy, and 6 by endoscopic fistulostomy.  Results The success rate of endoscopic procedure was 94.3%. Jaundice was inproved in 81.8% of the patients with a significant reduction of serum bilirubin (64.7%). Post-drainage complication rate was 2.6%; which

  10. Functional brain mapping using H215O positron emission tomography (II): mapping of human working memory

    International Nuclear Information System (INIS)

    To localize and compare the neural basis of verbal and visual human working memory, we performed functional activation study using H215O PET. Repeated H215O PET scans with one control and three different activation tasks were performed on six right-handed normal volunteers. Each activation task was composed of 13 matching trials. On each trial, four targets, a fixation dot and a prove were presented sequentially and subject's tasks was to press a response button to indicate whether or not the prove was one of the previous targets. Short meaningful Korean words, simple drawings and monochromic pictures of human faces were used as matching objects for verbal or visual memory. All the images were spatially normalized and the differences between control and activation states were statistically analyzed using SPM96. Statistical analysis of verbal memory activation with short words showed activation in the left Broca's area, premotor cortex, cerebellum and right cingulate gyrus. In verbal memory with simple drawing, activation was shown in the larger regions including where activated with short words and left superior temporal cortex, basal ganglia, thalamus, prefrontal cortex, anterior portion of right superior temporal gyrus and right infero-lateral frontal cortex. On the other hand, the visual memory task activated predominantly right-sided structures, especially inferior frontal cortex, supplementary motor cortex and superior parietal cortex. The results are consistent with the hypothesis of the laterality and dissociation of the verbal and visual working memory from the invasive electrophysiological studies and emphasize the pivotal role of frontal cortex and cingulate gyrus in working memory system

  11. 12 CFR Appendix to Part 215 - Section 5200 of the Revised Statutes Total Loans and Extensions of Credit

    Science.gov (United States)

    2010-01-01

    ... funds to or on behalf of a person pursuant to a contractual commitment; and (2) The term person shall... surplus. (5) Loans or extensions of credit to or secured by unconditional takeout commitments or... Loans and Extensions of Credit Appendix to Part 215 Banks and Banking FEDERAL RESERVE SYSTEM BOARD...

  12. Nonlinear competition between the whistler and Alfven firehoses. Journal of Geophysical Research, 106, 13,215, 2001

    Czech Academy of Sciences Publication Activity Database

    Hellinger, Petr; Matsumoto, H.

    2001-01-01

    Roč. 106, - (2001), s. 13,215-13,224. ISSN 0148-0227 R&D Projects: GA AV ČR IAB3042106 Institutional research plan: CEZ:AV0Z3042911 Keywords : instability * whistler * Alfven wave Subject RIV: BE - Theoretical Physics Impact factor: 2.609, year: 2001

  13. Zum 215. Gebutstag von Admiral Ferdinand Baron von Wrangell : (29. Dezember 1797 - 25. 25. Mai 1870) / Peter Krienitz

    Index Scriptorium Estoniae

    Krienitz, Peter

    2012-01-01

    Admiral Ferdinand Baron von Wrangellist tema 215. sünniaastapäeva puhul. Silmapaistavast Kirde-Siberi uurijast. Tema poliitilisest tegevusest ja elust Roela mõisas. Ferdinand Baroni poolt seatud viisil tähistati jõulusid Roelas kuni 1944. aasta lõpuni.

  14. Astatination of closo-dodecaborate(2-) anion

    Czech Academy of Sciences Publication Activity Database

    Orlova, A.; Lebeda, Ondřej; Tolmachev, V.; Lundquist, H.; Carlsson, J.; Sjöberg, S.

    Cambridge : The Royal Society of Chemistry , 2000 - (Davidson, M.; Hughes, A.; Marder, T.; Wade , K.), s. 144-147 [Conference "Contemporary Boron Chemistry ". Durham (GB), 11.07.1999-15.07.1999] Institutional research plan: CEZ:AV0Z1048901 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  15. Application of a network analysis in H215O-PET study

    International Nuclear Information System (INIS)

    The goal of this study was to examine effective connectivity among brain areas involved in a memory function using a statistical method, i.e., structural equation modeling (SEM). Eight brain areas were chosen in left hemisphere including visual, frontal, and parahippocampal areas activated (analyzed with SPM99) during an associative memory task based on a H215O-PET study. A connectivity model consisting of these brain regions, its anatomical pathways, and the functional influences of these paths was hypothesized and task effect (picture memory task vs. perceptual control task) was compared with a statistical package program for SEM (AMOS 4.0). The strongest functional linkage from fusiform to parahippocampus was found in both tasks. Linkages both from cuneus and inferior prefrontal areas to middle frontal were significantly strong in the perceptual task (p<.005), whereas linkages from cuneus to fusiform as well as from parahippocampus to middle frontal were significantly strong in the memory task (p<.005). Our results confirmed that SEM can be a useful analysis method on hypothesized neural pathways among brain areas identified in functional images

  16. Autoguía para el telescopio 2,15 mts de CASLEO

    Science.gov (United States)

    Aballay, J. A.; Casagrande, A. R.; Pereyra, P. F.; Marún, A. H.

    Se está desarrollando un sistema de autoguía para el telescopio de 2,15 mts. El mismo se realizará aprovechando el Offset Guider. Al ocular móvil de éste se vinculará alguna cámara digital (ST4-ST7-CH250) para lograr la visión del objeto. El funcionamiento del equipo será el siguiente: primero, dadas las coordenadas del objeto a observar, se tomarán las coordenadas del telescopio para que, a través de una base de datos, se determine un campo de objetos que sirvan para la cámara de visión, luego, la PC obtendrá el offset entre la estrella de observación y la estrella seleccionada como guía, este valor será trasladado a los motores que posicionarán en forma automática el ocular. Una vez que la estrella es visualizada en la cámara (monitor de PC ) se correrá el programa que guiará el telescopio automáticamente.

  17. Biopsy of human morula-stage embryos: outcome of 215 IVF/ICSI cycles with PGS.

    Directory of Open Access Journals (Sweden)

    Elena E Zakharova

    Full Text Available Preimplantation genetic diagnosis (PGD is commonly performed on biopsies from 6-8-cell-stage embryos or blastocyst trophectoderm obtained on day 3 or 5, respectively. Day 4 human embryos at the morula stage were successfully biopsied. Biopsy was performed on 709 morulae from 215 ICSI cycles with preimplantation genetic screening (PGS, and 3-7 cells were obtained from each embryo. The most common vital aneuploidies (chromosomes X/Y, 21 were screened by fluorescence in situ hybridization (FISH. No aneuploidy was observed in 72.7% of embryos, 91% of those developed to blastocysts. Embryos were transferred on days 5-6. Clinical pregnancy was obtained in 32.8% of cases, and 60 babies were born. Patients who underwent ICSI/PGS treatment were compared with those who underwent standard ICSI treatment by examining the percentage of blastocysts, pregnancy rate, gestational length, birth height and weight. No significant differences in these parameters were observed between the groups. Day 4 biopsy procedure does not adversely affect embryo development in vitro or in vivo. The increased number of cells obtained by biopsy of morulae might facilitate diagnostic screening. There is enough time after biopsy to obtain PGD results for embryo transfer on day 5-6 in the current IVF cycle.

  18. Results of the ultraviolet photometry of stars by means of Kosmos 215 satellite

    International Nuclear Information System (INIS)

    Photometric studies of stars have been made. Parallel direction telescopes with two photometers (lambdasub(max)=2740 A, Δlambda=120 A and lambdasub(max)=2275 A, Δlambda=110 A) for the entrance diafragm of 5 cm, visual field about 1 deg and relative aperture 1/3.5 were installed on the board of the ''Kosmos-215'' satellite. The satellite was not oriented, but a special damping system was used for lowering the angular velocity. The identification of stars was done with a magnetometer and two photometers which registered radiation fluxes from the stars in bands close to the B and V bands of the UBV system. Monochromatic fluxes in the wavelengths of 2740 and 2275 A have been determined for 36 stars; a comparison with other measurements was carried out for 15 stars. Data for 9 stars are in satisfactory agreement with the present measurements (within the accuracy limits of calibration and telemetry), for 6 stars a difference exists with the data obtained earlier. The dichromatic diagrams (U2740-V)-B-V) and (U2275-V)-(B-V) on the whole do not contradict the dependence found previously

  19. Measurement of regional cerebral blood flow with H215O positron emission tomography during Matas test - report of three cases

    International Nuclear Information System (INIS)

    The authors carried out a Matas test with a regional cerebral blood flow (rCBF) study using H215O positron emission tomography (PET) for three cases of large internal carotid artery aneurysms. There is a likely correlation between the cerebral blood flow (CBF) reduction rate obtained by PET, and the mean stump pressure available from a conventional balloon occlusion test. The advantages of this noninvasive and quantitative method are presented in comparison with other methods. (author)

  20. Cortical activation in profoundly deaf patients during cochlear implant stimulation demonstrated by H2(15)O PET

    International Nuclear Information System (INIS)

    Cochlear implants (CIs) are used to provide sensations of sound to profoundly deaf patients. The performance of the CI is assessed mainly by the subjective reports of patients. The aim of this study was to look for objective cortical responses to the stimulation of the CI. Two postlingually and two prelingually deaf patients were investigated by positron emission tomography (PET) using 15O-labeled water (H215O) to determine the regional cerebral blood flow (rCBF). Instead of quantifying rCBF in absolute terms, it was estimated by referring the regional tissue concentration of H215O to the mean whole brain concentration. CI stimulation encoded from white noise and sequential words led to an increased rCBF in the primary and secondary (Wernicke) auditory cortex. Relative elevations of up to 33% were observed bilaterally, although they were higher contralateral to the CI. These results were obtained not only in the postlingually deaf patients but also in two patients who had never been able to hear. Thus, it could be demonstrated that PET measurements of cerebral H215O distribution yield objective responses of the central auditory system during electrical stimulation by CIs in profoundly deaf patients

  1. microRNA-215异常激活抑制Dicer1促进肝癌细胞迁移和转化

    Institute of Scientific and Technical Information of China (English)

    李文娟; 韩翰; 孙丹; 沈洪星; 李友军; 张进祥

    2015-01-01

    microRNA异常表达促进癌症的发生发展.本研究通过microRNA表达谱分析2个肝癌细胞和2个正常细胞microRNA的表达,寻找与肝癌相关的microRNA,发现microRNA-215在肝癌细胞中高表达,qRT—PCR验证microRNA-215在肝癌细胞呈显著高表达.进一步研究发现,microRNA-215直接靶向Dicerl基因的3'UTR并抑制Dicerl蛋白表达,Dicerl是microRNA加工成熟过程中必需的蛋白.过表达microRNA-215抑制Dicerl从而促进肝癌细胞迁移和转化,而抑制microRNA-215表达起相反作用.Dicerl抑制后,许多抑癌microRNA表达被抑制,从而促进迁移和转化.相对于癌旁组织,Dicerl在肝癌组织呈明显低表达.本研究揭示,microRNA-215异常活化并抑制Dicerl表达与肝癌发展相关.

  2. ARCON: experience in 215 patients with advanced head-and-neck cancer

    International Nuclear Information System (INIS)

    Purpose: 'ARCON' combines accelerated radiotherapy to counteract tumor repopulation with carbogen breathing and nicotinamide to reduce chronic and acute hypoxia. The aim of this Phase II study was to assess the feasibility, toxicity, and potential effectiveness of ARCON for advanced head-and-neck cancer. Methods and Materials: The study included 215 patients with head-and-neck carcinoma distributed as follows: larynx, n = 100; hypopharynx, n=50; oropharynx, n=52; oral cavity, n=13; Stage II, n=8, Stage III, n=71, and Stage IV, n=136. Accelerated radiotherapy was given to a total dose of 64-68 Gy in 2-Gy fractions within 36-38 days. This was combined with carbogen breathing during irradiation and administration of nicotinamide (60-80 mg/kg) 1-1.5 h before irradiation. Results: There was full compliance with carbogen breathing in 88% of the patients. A nicotinamide dose of 80 mg/kg produced severe nausea and vomiting, necessitating discontinuation of the drug, in 31% of the patients. Adjustment of the dose to 60 mg/kg and antiemesis prophylaxis reduced the discontinuation rate to 10%. Confluent mucositis was observed in 91% of the patients with a median duration of 6 weeks. Grade 4 late complications occurred in 5% of the patients. The actuarial 3-year local control rates were 80% for larynx, 69% for hypopharynx, 88% for oropharynx, and 37% for oral cavity tumors. For T3-4 tumors, the local control rates were 80% for larynx, 60% for hypopharynx, 87% for oropharynx, and 29% for oral cavity. Regional control rates were 100% for N0, 93% for N1, and 74% for N2 disease. Conclusion: ARCON yields high local and regional control rates in advanced head-and-neck carcinomas, and compliance is satisfactory and morbidity acceptable. The local control rate of 80% for T3 and T4 larynx carcinomas offers excellent possibilities for organ preservation

  3. Functional brain mapping using H215O positron emission tomography (I): statistical parametric mapping method

    International Nuclear Information System (INIS)

    We investigated the statistical methods to compose the functional brain map of human working memory and the principal factors that have an effect on the methods for localization. Repeated PET scans with successive four tasks, which consist of one control and three different activation tasks, were performed on six right-handed normal volunteers for 2 minutes after bolus injections of 925 MBq H215O at the intervals of 30 minutes. Image data were analyzed using SPM96 (Statistical Parametric Mapping) implemented with Matlab (Mathworks Inc., U.S.A.). Images from the same subject were spatially registered and were normalized using linear and nonlinear transformation methods. Significant difference between control and each activation state was estimated at every voxel based on the general linear model. Differences of global counts were removed using analysis of covariance (ANCOVA) with global activity as covariate. Using the mean and variance for each condition which was adjusted using ANCOVA, t-statistics was performed on every voxel. To interpret the results more easily, t-values were transformed to the standard Gaussian distribution (Z-score). All the subjects carried out the activation and control tests successfully. Average rate of correct answers was 95%. The numbers of activated blobs were 4 for verbal memory I, 9 for verbal memory II, 9 for visual memory, and 6 for conjunctive activation of these three tasks. The verbal working memory activates predominantly left-sided structures, and the visual memory activates the right hemisphere. We conclude that rCBF PET imaging and statistical parametric mapping method were useful in the localization of the brain regions for verbal and visual working memory

  4. Growth, physicochemical properties, and morphogenesis of Chinese wild-type PRV Fa and its gene-deleted mutant strain PRV SA215

    Directory of Open Access Journals (Sweden)

    Tang Shanhu

    2011-06-01

    Full Text Available Abstract Background PRV Fa is common in China and causes most of the pseudorabies in the pig industry. A PRV SA215 strain with deleted gE, gI, and TK genes was constructed to develop a commercial attenuated live vaccine. However, the physicochemical properties, growth pattern, penetration kinetics, and morphogenesis of the PRV SA215 and its parental PRV Fa strain are unclear. Results A series of experiments were conducted to characterize both strains and provide more information. PRV Fa and PRV SA215 were found to have similar penetration patterns, with about 5 min half-time of penetration. The SA215 strain exhibited a slight delay in entry compared with PRV Fa. In the one-step growth test, the titers of the SA215 strain were first detected at 8 h, rapidly increased, and peaked at 12 h. A plateau was formed between 12-36 h of culturing. PRV SA215 showed delayed replication and approximately 10-30-fold lower titers during 0-16 h of culturing compared with the PRV-Fa strain. After 16 h, the PRV Fa titers dramatically decreased, whereas those of PRV SA215 were prolonged to 36 h and reached a titer value equal to that of PRV Fa and then decreased. Both strains were sensitive to both heat and acid-alkali treatments; however, PRV Fa was relatively more stable to heat treatment than PRV SA215. Both strains could propagate in the cultures with pH values from 5.0 to 9.0. Cultures with pH below 3.0 or above 11.0 were fatal to both strains. Both strains had considerable resistance to freeze-thawing treatments. Morphogenetic investigations showed that typical phases in the maturation pathway were observed in the PRV Fa-infected PK15 cells, whereas secondary envelopment was not observed in the PRV SA215 strain. Instead, capsid aggregations with concomitants of electrodense materials were observed. Conclusions These results suggest that PRV SA215 is a promising strain for vaccine development

  5. Hepatitis B virus X protein mutant HBxΔ127 promotes proliferation of hepatoma cells through up-regulating miR-215 targeting PTPRT

    International Nuclear Information System (INIS)

    Highlights: • Relative to wild type HBx, HBX mutant HBxΔ127 strongly enhances cell proliferation. • Relative to wild type HBx, HBxΔ127 remarkably up-regulates miR-215 in hepatoma cells. • HBxΔ127-elevated miR-215 promotes cell proliferation via targeting PTPRT mRNA. - Abstract: The mutant of virus is a frequent event. Hepatitis B virus X protein (HBx) plays a vital role in the development of hepatocellular carcinoma (HCC). Therefore, the identification of potent mutant of HBx in hepatocarcinogenesis is significant. Previously, we identified a natural mutant of the HBx gene (termed HBxΔ127). Relative to wild type HBx, HBxΔ127 strongly enhanced cell proliferation and migration in HCC. In this study, we aim to explore the mechanism of HBxΔ127 in promotion of proliferation of hepatoma cells. Our data showed that both wild type HBx and HBxΔ127 could increase the expression of miR-215 in hepatoma HepG2 and H7402 cells. However, HBxΔ127 was able to significantly increase miR-215 expression relative to wild type HBx in the cells. We identified that protein tyrosine phosphatase, receptor type T (PTPRT) was one of the target genes of miR-215 through targeting 3′UTR of PTPRT mRNA. In function, miR-215 was able to promote the proliferation of hepatoma cells. Meanwhile anti-miR-215 could partially abolish the enhancement of cell proliferation mediated by HBxΔ127 in vitro. Knockdown of PTPRT by siRNA could distinctly suppress the decrease of cell proliferation mediated by anti-miR-215 in HepG2-XΔ127/H7402-XΔ127 cells. Moreover, we found that anti-miR-215 remarkably inhibited the tumor growth of hepatoma cells in nude mice. Collectively, relative to wild type HBx, HBxΔ127 strongly enhances proliferation of hepatoma cells through up-regulating miR-215 targeting PTPRT. Our finding provides new insights into the mechanism of HBx mutant HBxΔ127 in promotion of proliferation of hepatoma cells

  6. Hepatitis B virus X protein mutant HBxΔ127 promotes proliferation of hepatoma cells through up-regulating miR-215 targeting PTPRT

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Fabao [Department of Cancer Research, College of Life Sciences, Nankai University, Tianjin 300071 (China); Department of Biochemistry, College of Life Sciences, Nankai University, Tianjin 300071 (China); You, Xiaona [Department of Cancer Research, College of Life Sciences, Nankai University, Tianjin 300071 (China); Chi, Xiumei [Department of Hepatology, The First Hospital, Jilin University, Changchun 130021 (China); Wang, Tao [Department of Cancer Research, College of Life Sciences, Nankai University, Tianjin 300071 (China); Ye, Lihong [Department of Biochemistry, College of Life Sciences, Nankai University, Tianjin 300071 (China); Niu, Junqi, E-mail: junqiniu@yahoo.com.cn [Department of Hepatology, The First Hospital, Jilin University, Changchun 130021 (China); Zhang, Xiaodong, E-mail: zhangxd@nankai.edu.cn [Department of Cancer Research, College of Life Sciences, Nankai University, Tianjin 300071 (China)

    2014-02-07

    Highlights: • Relative to wild type HBx, HBX mutant HBxΔ127 strongly enhances cell proliferation. • Relative to wild type HBx, HBxΔ127 remarkably up-regulates miR-215 in hepatoma cells. • HBxΔ127-elevated miR-215 promotes cell proliferation via targeting PTPRT mRNA. - Abstract: The mutant of virus is a frequent event. Hepatitis B virus X protein (HBx) plays a vital role in the development of hepatocellular carcinoma (HCC). Therefore, the identification of potent mutant of HBx in hepatocarcinogenesis is significant. Previously, we identified a natural mutant of the HBx gene (termed HBxΔ127). Relative to wild type HBx, HBxΔ127 strongly enhanced cell proliferation and migration in HCC. In this study, we aim to explore the mechanism of HBxΔ127 in promotion of proliferation of hepatoma cells. Our data showed that both wild type HBx and HBxΔ127 could increase the expression of miR-215 in hepatoma HepG2 and H7402 cells. However, HBxΔ127 was able to significantly increase miR-215 expression relative to wild type HBx in the cells. We identified that protein tyrosine phosphatase, receptor type T (PTPRT) was one of the target genes of miR-215 through targeting 3′UTR of PTPRT mRNA. In function, miR-215 was able to promote the proliferation of hepatoma cells. Meanwhile anti-miR-215 could partially abolish the enhancement of cell proliferation mediated by HBxΔ127 in vitro. Knockdown of PTPRT by siRNA could distinctly suppress the decrease of cell proliferation mediated by anti-miR-215 in HepG2-XΔ127/H7402-XΔ127 cells. Moreover, we found that anti-miR-215 remarkably inhibited the tumor growth of hepatoma cells in nude mice. Collectively, relative to wild type HBx, HBxΔ127 strongly enhances proliferation of hepatoma cells through up-regulating miR-215 targeting PTPRT. Our finding provides new insights into the mechanism of HBx mutant HBxΔ127 in promotion of proliferation of hepatoma cells.

  7. Superpave 在青海省 G215 大察公路上的应用

    Institute of Scientific and Technical Information of China (English)

    彭艳丽

    2008-01-01

    该文介绍了Superpave的发展应用情况及其特点,并结合Superpave在青海省G215大察公路上的应用情况,介绍了Superpave的配合比设计方法、施工技术以及应用效果,为今后推广使用Superpave沥青路面,提高沥青路面施工质量提供借鉴.

  8. Crystal structure of spinel-type Li0.64Fe2.15Ge0.21O4

    OpenAIRE

    Günther J. Redhammer; Gerold Tippelt

    2016-01-01

    Spinel-type Li0.64Fe2.15Ge0.21O4, lithium diiron(III) germanium tetraoxide, has been formed as a by-product during flux growth of an Li–Fe–Ge pyroxene-type material. In the title compound, lithium is ordered on the octahedral B sites, while Ge4+ orders onto the tetrahedral A sites, and iron distributes over both the octahedral and tetrahedral sites, and is in the trivalent state as determined from Mössbauer spectroscopy. The oxygen parameter u is 0.2543; thus, the spinel is close to having an...

  9. 外周血单个核细胞与HepG2.215细胞共培养体系的研究%Study of peripheral blood mononuclear cells and HepG2.215 cells co-culture system

    Institute of Scientific and Technical Information of China (English)

    胡勇; 吴晓蔓

    2011-01-01

    目的 建立外周血单个核细胞与HepG2.215细胞共培养体系,探讨不同培养基及效靶比对共培养体系的影响.方法 分离正常人外周血单个核细胞,加人植物血凝素(PHA),置于不同的培养基(DMEM,RPMI1640)中进行培养,采用不同效靶比((5:1、10:1、20:1、40:1)构建PBMCs与HepG2.215细胞共培养体系.用倒置显微镜观察细胞的形态及生长情况,台盼蓝拒染法检测PBMCs与HepG2.215细胞的细胞活力,cck-8法检测HepG2.215细胞的增殖活性.结果 DMEM培养基培养的HepG2.215细胞的细胞活力比RPM11640培养基培养的细胞高;而两种培养基培养的PBMCs的细胞活力无明显变化.共培养条件下,PBMCs对HepG2.215细胞增殖活性的抑制作用随效靶比的不同而有所差别,效靶比为20:1时抑制作用最强.结论 在PBMCs与HepG2.215细胞共培养体系中,细胞培养基和效靶比对HepG2.215细胞的生长有影响.%Objective To establish the co-culture system of peripheral blood mononuclear cells and HepG2.215 cells,and explore the effects of different culture medium and the target ratio on the impact of co-culture system. Methods PBMCs separated from normal human blood were cultured with PHA in different mediums (DMEM, RPMI1640).The co-culture system of PBMCs and HepG2.215 cells was established in different proportion (5:1,10:1,20:1,40:1 ).Morphology and growth condition of cells were observed by inverted microscope. The activity of PBMCs and HepG2.215 cells was evaluated by Trypan blue staining. The proliferation of HepG2.215 cells was measured by cck-8. Results The activity of HepG2.215 cells cultured with DMEM was higher than that of cells cultured with RPMI 1640(P<0.05). The activity of PBMCs had no significant change.The inhibition of PBMCs on HepG2.215 cells changed with the ratio of effector cells and target cells in co-culture condition,and shoed the strongest inhibition when the target ratio was 20:1. Conclusion In the PBMCs and HepG2.215

  10. Parametric image of rMBF using factor analysis and cluster analysis on H215 dynamic myocardial PET

    International Nuclear Information System (INIS)

    Composition of parametric image (PI) of rMBF measured by H215O PET has been the goal of many research efforts. However, this has been difficult to accomplish because of the low SNR of the TAC of each voxel, and the complex kinetic model which includes parameters to correct partial volume and spillover effects. To develop a method to make a PI of rMBF by combining factor analysis and cluster analysis on H215O dynamic myocardial PET. First, right and left ventricular input functions and their factor images were obtained by applying the factor analysis to dynamic frames. By subtracting the factor images from the original dynamic frames, tissue image was obtained in which the vascular components were excluded. Cluster analysis, which averaged voxels with the same shape TACs (NeuroImage, 9:554-61, 1999), was applied to the pure tissue image to reduce calculation time and to improve SNR of the PI. Image quality and contrast was significantly improved in comparison to either the factor image of tissue or the subtracted image composed by subtracting the initial 30 sec-image from the 2 min one. Computation time was less than 1 min on the workstation 333 MHz with CPU. Parametric image developed in this study will serve as an important investigative tool for cardiovascular disease

  11. Limited ability of humoral immune responses in control of viremia during infection with SIVsmmD215 strain

    Energy Technology Data Exchange (ETDEWEB)

    Ribiero, Ruy M [Los Alamos National Laboratory

    2009-01-01

    To investigate the impact of humoral immunity on SIV replication, 11 rhesus macaques (RMs) were inoculated with the neutralization-sensitive strain SIVsmmD215. Seven RMs were treated every three weeks, with 50 mglkg of an anti-CD20 antibody (Rituxan, gift from Genentech) starting from day -7 p.i., as follows: four RMs were treated for two months, and three were treated for five months. The remaining four RMs were used as controls. Three RMs were completely depleted of CD20 cells. Four RMs only partially depleted CD20 cells in the LNs and intestine. The efficacy of tissue CD20 depletion predicted the ablation of antibody production, with SIVsmm seroconversion being delayed in the animals with complete tissue CD20 depletion, and neutralizing antibody production being significantly delayed and at low levels in all CD20-depleted RMs. There was no significant difference in acute or chronic VLs between CD20-depleted RMs and control monkeys, with a tendency for lower set-point VLs in CD20-depleted RMs. At 6 weeks p.i., cellular immune responses were significantly stronger in CD20 depleted RMs than in controls. After two years p.i., there was no significant difference in survival between CD20-depleted and control RMs. We concluded that CD20 depletion plays no significant role in the control of SIV replication or disease progression in SIVsmmD215-infected RMs.

  12. MiR-21-5p Links Epithelial-Mesenchymal Transition Phenotype with Stem-Like Cell Signatures via AKT Signaling in Keloid Keratinocytes

    Science.gov (United States)

    Yan, Li; Cao, Rui; Liu, YuanBo; Wang, LianZhao; Pan, Bo; Lv, XiaoYan; Jiao, Hu; Zhuang, Qiang; Sun, XueJian; Xiao, Ran

    2016-01-01

    Keloid is the abnormal wound healing puzzled by the aggressive growth and high recurrence rate due to its unrevealed key pathogenic mechanism. MicroRNAs contribute to a series of biological processes including epithelial-mesenchymal transition (EMT) and cells stemness involved in fibrotic disease. Here, using microRNAs microarray analysis we found mir-21-5p was significantly up-regulated in keloid epidermis. To investigate the role of miR-21-5p in keloid pathogenesis, we transfected miR-21-5p mimic or inhibitor in keloid keratinocytes and examined the abilities of cell proliferation, apoptosis, migration and invasion, the expressions of EMT-related markers vimentin and E-cadherin and stem-like cells-associated markers CD44 and ALDH1, and the involvement of PTEN and the signaling of AKT and ERK. Our results demonstrated that up-regulation or knockdown of miR-21-5p significantly increased or decreased the migration, invasion and sphere-forming abilities of keloid keratinocytes, and the phenotype of EMT and cells stemness were enhanced or reduced as well. Furthermore, PTEN and p-AKT were shown to participate in the regulation of miR-21-5p on EMT phenotypes and stemness signatures of keloid keratinocytes, which might account for the invasion and recurrence of keloids. This molecular mechanism of miR-21-5p on keloid keratinocytes linked EMT with cells stemness and implicated novel therapeutic targets for keloids. PMID:27596120

  13. MiR-21-5p Links Epithelial-Mesenchymal Transition Phenotype with Stem-Like Cell Signatures via AKT Signaling in Keloid Keratinocytes.

    Science.gov (United States)

    Yan, Li; Cao, Rui; Liu, YuanBo; Wang, LianZhao; Pan, Bo; Lv, XiaoYan; Jiao, Hu; Zhuang, Qiang; Sun, XueJian; Xiao, Ran

    2016-01-01

    Keloid is the abnormal wound healing puzzled by the aggressive growth and high recurrence rate due to its unrevealed key pathogenic mechanism. MicroRNAs contribute to a series of biological processes including epithelial-mesenchymal transition (EMT) and cells stemness involved in fibrotic disease. Here, using microRNAs microarray analysis we found mir-21-5p was significantly up-regulated in keloid epidermis. To investigate the role of miR-21-5p in keloid pathogenesis, we transfected miR-21-5p mimic or inhibitor in keloid keratinocytes and examined the abilities of cell proliferation, apoptosis, migration and invasion, the expressions of EMT-related markers vimentin and E-cadherin and stem-like cells-associated markers CD44 and ALDH1, and the involvement of PTEN and the signaling of AKT and ERK. Our results demonstrated that up-regulation or knockdown of miR-21-5p significantly increased or decreased the migration, invasion and sphere-forming abilities of keloid keratinocytes, and the phenotype of EMT and cells stemness were enhanced or reduced as well. Furthermore, PTEN and p-AKT were shown to participate in the regulation of miR-21-5p on EMT phenotypes and stemness signatures of keloid keratinocytes, which might account for the invasion and recurrence of keloids. This molecular mechanism of miR-21-5p on keloid keratinocytes linked EMT with cells stemness and implicated novel therapeutic targets for keloids. PMID:27596120

  14. Quantitative cerebral H215O perfusion PET without arterial blood sampling, a method based on washout rate

    International Nuclear Information System (INIS)

    The quantitative determination of regional cerebral blood flow (rCBF) is important in certain clinical and research applications. The disadvantage of most quantitative methods using H215O positron emission tomography (PET) is the need for arterial blood sampling. In this study a new non-invasive method for rCBF quantification was evaluated. The method is based on the washout rate of H215O following intravenous injection. All results were obtained with Alpert's method, which yields maps of the washin parameter K1 (rCBFK1) and the washout parameter k2 (rCBFk2). Maps of rCBFK1 were computed with measured arterial input curves. Maps of rCBFk2* were calculated with a standard input curve which was the mean of eight individual input curves. The mean of grey matter rCBFk2* (CBFk2*) was then compared with the mean of rCBFK1 (CBFK1) in ten healthy volunteer smokers who underwent two PET sessions on day 1 and day 3. Each session consisted of three serial H215O scans. Reproducibility was analysed using the rCBF difference scan 3-scan 2 in each session. The perfusion reserve (PR = rCBFacetazolamide-rCBFbaseline) following acetazolamide challenge was calculated with rCBFk2* (PRk2*) and rCBFK1 (PRK1) in ten patients with cerebrovascular disease. The difference CBFk2*-CBFK1 was 5.90±8.12 ml/min/100 ml (mean±SD, n=55). The SD of the scan 3-scan 1 difference was 6.1% for rCBFk2* and rCBFK1, demonstrating a high reproducibility. Perfusion reserve values determined with rCBFK1 and rCBFk2* were in high agreement (difference PRk2*-PRK1=-6.5±10.4%, PR expressed in percentage increase from baseline). In conclusion, a new non-invasive method for the quantitative determination of rCBF is presented. The method is in good agreement with Alpert's original method and the reproducibility is high. It does not require arterial blood sampling, yields quantitative voxel-by-voxel maps of rCBF, and is computationally efficient and easy to implement. (orig.)

  15. Spectroscopy of nuclei 215Fr and 219 Ac: a contribution to the study of the nuclear structure of light actinides

    International Nuclear Information System (INIS)

    Using α-particle and γ-ray spectroscopy, it has been possible to establish the high spin pattern in 215Fr and propose a decay scheme up to Iπ = (47/2+) containing six isomeric states. These results are interpreted using the recent version of the deformed Woods-Saxon model and the Strutinsky normalisation technique. A similar study in 219 Ac has revealed the existence of two quasi-bands each formed of states of alternating parity and connected by strong E1 transitions. This data for 219Ac fits better with the stable octupole deformation model, mainly because of the high-spin parity doublets observed for the first time, than with the α-cluster model

  16. Further investigations at the Naigani Lapita site (VL 21/5), Fiji : excavation, radiocarbon dating and palaeofaunal extinction

    International Nuclear Information System (INIS)

    This paper brings up-to-date a report by S. Best of initial excavations at Naigani in 1981. The results of subsequent fieldwork in 2000 include the excavation and dating of Lapita-age ovens associated with early settlement and extinct palaeofauna. These include the giant megapode (Megavitiornis altirostris), a species of Ducula pigeon, the giant iguana (Lapitiguana impensa), and probably the endemic crocodile (Volia athollandersoni). The Lapita site of VL 21/5 dates from 900 BC and represents an initial colonising settlement within the Fiji Islands. The period of occupation ended around 750 BC. The significance of Naigani is considered in terms of chronology, ceramic history, economy, extinctions, origins and interactions. (author). 33 refs., 10 figs., 2 tabs.

  17. Optimization of protein production by Geotrichum candidum MIUG 2.15 by cultivation on paper residues, using response surface methodology

    Directory of Open Access Journals (Sweden)

    Gigi Coman

    2012-11-01

    Full Text Available Response surface methodology (RSM based on the 23 factorial central composite design (CCD was used to optimize the biotechnological conditions for growth and protein production by a selected fungal strain Geotrichum candidum MIUG 2.15, by solid-state cultivation on a semisolid medium based on a mixture of paper residues, i.e. office paper, newspaper, and cardboard, mixed in a ratio of 1:1:1(w/w, supplemented with cheese whey waste and complex manure. Three independent variables, the solid:liquid ratio, the concentration of complex manure, and cultivation time, were evaluated to determine their correlative effect on biomass production and protein biosynthesis. The optimal conditions for obtaining a maximum protein yield of 9.53% w/w dry mass were the following: the complex manure concentration of 0.5%, the solid:liquid ratio of 1:5, and the growth time of 10 days.

  18. Crystal structure of spinel-type Li0.64Fe2.15Ge0.21O4.

    Science.gov (United States)

    Redhammer, Günther J; Tippelt, Gerold

    2016-04-01

    Spinel-type Li0.64Fe2.15Ge0.21O4, lithium diiron(III) germanium tetra-oxide, has been formed as a by-product during flux growth of an Li-Fe-Ge pyroxene-type material. In the title compound, lithium is ordered on the octa-hedral B sites, while Ge(4+) orders onto the tetra-hedral A sites, and iron distributes over both the octa-hedral and tetra-hedral sites, and is in the trivalent state as determined from Mössbauer spectroscopy. The oxygen parameter u is 0.2543; thus, the spinel is close to having an ideal cubic closed packing of the O atoms. The title spinel is compared with other Li- and Ge-containing spinels. PMID:27375876

  19. A diagnostic method for suspected Alzheimer's disease using H215O positron emission tomography perfusion Z score

    International Nuclear Information System (INIS)

    We developed cerebral perfusion Z score map (Z map) images using H215O and positron emission tomography (PET), and examined their use in diagnosing Alzheimer's disease (AD). Cerebral blood flow (CBF) images were obtained using the PET and H215O autoradiographic method. The best region for normalising the CBF value to remove individual variation was determined. Then CBF images were transformed to Talairach's standard space, and each pixel value of an individual's image set was normalized to the mean value of the sensorimotor area. Based on the CBF images of 20 normal volunteers, normative mean and standard deviation (SD) CBF images were constructed. Then, each pixel value of the axial CBF images in 28 patients with probable AD and 10 further normal volunteers was converted to a Z score (Z = [normal mean - individual value]/normal SD). A Z map, showing pixels exceeding a threshold of Z score > 2 on MRI of standardised anatomical space was demonstrated. These 38 Z maps were interpreted by four radiologists. When regions in the temporoparietal area were found with Z scores > 2, the subject was diagnosed as having AD. A receiver operating characteristic (ROC) analysis was performed to compare the conventional CBF images and Z maps. The diagnostic performance of the Z map was superior to that of visual inspection of conventional CBF images (mean areas under the ROC curve of the four radiologists were 0.946 and 0.584, respectively). These results indicate that a Z map obtained in this way is superior to conventional PET for diagnosing AD. (orig.)

  20. Remote processing, delivery and injection of H2[15O] produced from a N2/H2 gas target using a simple and compact apparatus.

    Science.gov (United States)

    Ferrieri, R A; Alexoff, D L; Schlyer, D J; Wolf, A P

    1994-12-01

    We report here a simple apparatus for remote trapping and processing of H2[15O] produced from the N2/H2 target. The system performs a three step operation for H2[15O] delivery at the PET imaging facility which includes the following: (i) collecting the radiotracer in sterile water; (ii) adjusting preparation pH through removal of radiolytically produced ammonia, while at the same time adjusting solution isotonicity; and (iii) delivery of the radiotracer preparation to the injection syringe in a sterile and pyrogen-free form suitable for human studies. The processing apparatus is simple, can be remotely operated and fits inside a Capintec Dose Monitoring Chamber for direct measurement of accumulated radioactivity. Using this system, 300 mCi of H2[15O] (15 microA of 8 MeV D+ on target) is transferred from target through 120 m x 3.18 mm o.d. Impolene tubing to yield 100 mCi of H2[15O] which is isotonic, neutral and suitable for human studies. A remote hydraulically driven system for i.v. injection of the H2[15O] is also described. The device allows for direct measurement of syringe dose while filling, and for easy, as well as safe transport of the injection syringe assembly to the patient's bedside via a shielded delivery cart. This cart houses a hydraulic piston that allows the physician to "manually" inject the radiotracer without directly handling the syringe. PMID:7894394

  1. Evaluation of endothelium-dependent myocardial perfusion reserve in healthy smokers; cold pressor test using H215O PET

    International Nuclear Information System (INIS)

    Much evidence suggests long-term cigarette smoking alters coronary vascular endothelial response. In this study, we applied nonnegative matrix factorization (NMF), an unsupervised learning algorithm, to CO-less H215O-PET to investigate coronary endothelial dysfunction caused by smoking noninvasively. This study enrolled eighteen young male volunteers consisting of 9 smokers (23.8±1.1 yr; 6.6±2.5 pack-years) and 9 nonsmokers (23.8±2.9 yr). They do not have any cardiovascular risk factor or disease history. Myocardial H215O-PET was performed at rest, during cold (5.deg.C) pressor stimulation and during adenosine infusion. Left ventricular blood pool and myocardium were segmented on dynamic PET data by NMF method. Myocardial blood flow (MBF) was calculated from input and tissue functions by a single compartmental model with correction of partial volume and spillover effects. There were no significant difference in resting MBF between the two groups (Smokers: 1.43 0.41ml/g/min and non-smokers: 1.37±0.41 ml/g/min; p = NS). during cold pressor stimulation, MBF in smokers was significantly lower than that in non-smokers (1.25±0.34 ml/g/min vs 1.59±0.29 ml/g/min ; p = 0.019). The difference in the ratio of cold pressor MBF to resting MBF between the two groups was also significant (p=0.024; 90±24% in smokers and 122±28% in non-smokers.). During adenosine infusion, however, hyperemic MBF did not differ significantly between smokers and non-smokers (5.81±1.99 ml/g/min vs 5.11±1.31 ml/g/min ; p=NS). In smokers, MBF during cold pressor stimulation was significantly lower compared with nonsmokers, reflecting smoking-induced endothelial dysfunction. However, there was no significant difference in MBF during adenosine-induced hyperemia between the two groups

  2. X-ray Lβ215 emission spectrum of Ru in Ru(NH3)6Cl3

    International Nuclear Information System (INIS)

    One of the broader applications of synchrotron radiation has been to EXAFS studies for material structure determination, i.e., for an analysis of x-ray absorption over an extended energy region beyond a core ionization limit. Studies of the near edge structure (XANES) give a different type of information, characteristic of the local symmetry and electronic configuration of the absorbing atom. This type of information is reflected also in the x-ray emission spectra, in particular for transitions involving the valence levels. Examination of the near edge absorption or the emission spectrum does not require an instrument capable of scanning a wide energy range with high counting statistics, as does EXAFS; the needs are rather for good resolution and a reliable calibration of the energy scale. Some of the problems of near edge spectra were particularly evident in our investigation of Ru-Lβ215 emission from Ru(NH3)6Cl3. The Ru-Lβ215 emission was measured with a laboratory Rowland circle x-ray spectrometer with a curved quartz (1010) crystal (radius = 22 inches) in a fixed position appropriate to the energy range, and a position sensitive detector which can be positioned along the Rowland circle. The Ru spectrum was excited mainly by Sn-L/sub α/ primary radiation from a Sn anode in a demountable x-ray tube operating at 13 kV and 120 mA. The resolution of the instrument in this region is 1.5 eV. An accurate calibration of the energy scale was conveniently obtained by measuring a reference x-ray emission line in the same instrumental configuration. In the present case the Pd-L/sub α/ emission line at 2838 eV was used to establish the energy scale. The energy dispersion of the instrument was determined from the Cl-K/sub β/ emission spectrum of CH3Cl between 2810 eV and 2830 eV and Pd-Lα12 and extrapolated to the energy region of the recorded emission spectrum. 6 references, 1 figure

  3. Characteristics of Distribution of 215 Acinetobacter Pneumonia and Drug Susceptibility Analysis in Respiratory Ward%215株致肺炎不动杆菌的分布特点与药敏分析

    Institute of Scientific and Technical Information of China (English)

    周煦; 李文朴; 李榜龙

    2009-01-01

    [Objective] To investigate the distribution of Acinetobacter pneumonia,drug susceptibility and its relationship with diseases of pneumonia. [Methods] All the Acinetobacter isolated from sputum from January 2000 to December 2007 were analyzed retrospectively. [Results] All 215 Acinetobacter isolates were collected, which contained 132 baumanii(61.4%), accounting to 14.3% of the total of sputum culture positive and 16.4% of negative bacilli. The number of Acinetobacter isolated from patients with lung underlying diseases was 177(82.3%). The result of drug susceptibility suggested that sensitive antibacterials were Cefoperazone/ sulbactam ,Meropenem,Cefepime and Levofloxacin, and resistant antibacterials were Aztreonam, Mezlocillin and Amphemycin. The drug susceptibility between 132 baumanii and 83 other Acinetobacter had significant difference(P<0.05). The results of Acinetobacter strain sensitivity whether or not isolated from the patients using respirator had significant differences(P<0.05). [Conclusion] Acinetobacter is the fundamental composition of lower respiratory tract bacterial infection,and Acinetobacter baumanii is the main. The drug susceptibility is obviously different between baumanii and other Acinetobacter. Acinetobacter is resistant to antibiotics widely and also related to respirator and lung underlying diseases. The characteristics of Acinetobacter infection is prone to patients with lung underlying diseases and is not only the main pathogenic bacteria of hospital infection,but also can cause the patients with lung underlying diseases to suffer from the community acquired pneumonia.%[目的]了解本院住院患者肺炎不动杆菌的分布、与疾病的关系及药物敏感情况.[方法]对本院2000年1月至2007年12月本院肺炎住院患者痰或支气管分泌物标本不动杆菌培养阳性结果结合病历进行回顾性统计分析.[结果]共分离出不动杆菌215株,占总分离菌株的14.3%(215/1503),革兰阴性杆菌的16.4%(215

  4. Demonstration of decreased posterior cingulate perfusion in mild Alzheimer's disease by means of H215O positron emission tomography

    International Nuclear Information System (INIS)

    Although decreased posterior cingulate metabolism in Alzheimer's disease (AD) has been previously reported, there have been no reports on posterior cingulate perfusion. In this study we evaluated posterior cingulate perfusion as a relative value using statistical parametric maps (SPMs) and as an absolute value using conventional region of interest (ROI) settings. Twenty-eight subjects, including 14 patients with mild AD (mean age: 66.4±12.1 years) and 14 normal controls (65.9±7.3 years) were studied. Regional cerebral blood flow (CBF) was measured with H215O and positron emission tomography (PET). In the SPM analysis, the left posterior cingulate and left parietotemporal CBFs were significantly decreased in the patients with mild AD (P<0.001). At a lower statistical threshold (P<0.05), the right posterior cingulate and right parietotemporal CBFs were also significantly decreased in the AD patients. In the ROI studies, the left parietal and posterior cingulate CBFs in the patients with mild AD were significantly lower than those of the normal controls by analysis of variance and post-hoc Scheffe's test (P<0.001). We conclude that posterior cingulate perfusion is decreased in mild AD, reflecting the pathological changes and metabolic reduction in the posterior cingulate gyrus that have previously been reported to occur in mild AD. (orig.). With 1 fig., 2 tabs

  5. Comparison of rCBF between patients with medial temporal lobe epilepsy and normal controls using H215O PET

    International Nuclear Information System (INIS)

    The aim of this study was to identify the brain areas whose regional cerebral blood flow (rCBF) was changed in medial temporal lobe epilepsy (mTLE) using H215O-PET. 12 patients with mTLE (6 left, 6 right mTLE) and 6 normal controls were scanned during a fixation baseline period and a sensory-motor condition where subjects pressed a button to an upward arrow. A voxel-based analysis using SPM99 software was performed to compare the patient groups with the normal controls for the rCBF during fixation baseline period and for relative changes of rCBF during the sensory-motor task relative to fixation. Duirng the fixation baseline, a significant reduction of rCBF was found posterior insula bilaterally and right frontopolar regions in right mTLE patients compared to the normal controls. In left mTLE patients, the reduction was found in left frontopolar and temporal regions. During the sensory-motor task, rCBF increase over the fixation period, was reduced in left frontal and superior temporal regions in the right mTLE patients whereas in various areas of right hemisphere in left mTLE patients, relative to normal controls. However, the increased rCBF was also found in the left inferior parietal and anterior thalamic/fornix regions in both right and left mTLE patients compared to normal controls. Epilepsy induced changes were found not only in relative increase/ decrease of rCBF during a simple sensory-motor control condition relative to a fixation rest condition but also in the relative rCBF distribution during the rest period

  6. Clinical outcome of 215 transmucosal implants with a conical connection: a retrospective study after 5-year follow-up.

    Science.gov (United States)

    Lopez, M A; Andreasi Bassi, M; Confalone, L; Gaudio, R M; Lombardo, L; Lauritano, D

    2016-01-01

    The purpose of this retrospective clinical study was to evaluate the survival rate (i.e. SVR – fixtures still in place at the end of the observation period) and success rate (i.e. SCR - bone resorption around implant neck) of an implant system characterized by cylindrical and tapered implants, both types of implant being equipped with a conical connection with an internal octagon (COC), both implant types having a 1.8 mm smooth neck, positioned above the bone crest level. A total of 65 subjects received 215 COCs between January 1996 and October 2011. All COCs were placed and restored by three experienced dental surgeons. The mean follow-up was 84±44 months. The patients involved in the study were both male (30) and female (35), of whom 30 were smokers (less than 20 cigarettes/day) and none was diabetic. The implants differed in terms of diameter and length, and were inserted both in the mandible (97) and in the maxilla (118). Sixty-seven implants were single tooth rehabilitations, and 148 prosthetic bridges. Fourteen had guided bone regeneration (GBR), and 10 were placed in post-extractive sites. Forty of the implants were provided with passing-screw abutments and 175 with full-screw abutments. The data were analyzed using descriptive statistics. None of the implants failed before prosthetic restoration, resulting in an SVR=100% after loading. The radiographic and clinical data revealed well-maintained, hard and soft tissue around the COCs, with an SCR=92.6%. Cox regression analyses did not detect any variables with statistical impact on the clinical outcome. In conclusion, Shiner XT implants are reliable tools for oral rehabilitation. PMID:27469549

  7. p53 nuclear accumulation and ERα expression in ductal hyperplasia of breast in a cohort of 215 Chinese women

    Directory of Open Access Journals (Sweden)

    Mao Xiao-yun

    2010-08-01

    Full Text Available Abstract Introduction Women with ductal hyperplasia including usual ductal hyperplasia (UDH and atypical ductal hyperplasia (ADH have an increased risk of developing invasive ductal carcinoma (IDC of breast. The importance of several molecular markers in breast cancer has been of considerable interest during recent years such as p53 and estrogen receptor alpha (ERα. However, p53 nuclear accumulation and ERα expression have not been assessed in ductal hyperplasia co-existing with ductal carcinoma in situ (DCIS or IDC versus pure ductal hyperplasia without DCIS or IDC. Materials and methods We investigated p53 nuclear accumulation and ERα expression in breast ductal hyperplasia in a cohort of 215 Chinese women by immunohistochemistry (IHC, which included 129 cases of pure ductal hyperplasia, 86 cases of ductal hyperplasia co-existing with DCIS (41 cases or IDC (45 cases. Results Nuclear p53 accumulation was identified in 22.8% of ADH (31/136, 41.5% of DCIS (17/41 and 42.2% of IDC (19/45, and no case of UDH (0/79. No difference in nuclear p53 accumulation was observed between pure ADH and ADH co-existing with DCIS (ADH/DCIS or IDC (ADH/IDC (P > 0.05. The positive rate of ERα expression was lower in ADH (118/136, 86.8% than that in UDH (79/79, 100% (P P P P Conclusions Different pathological types of ductal hyperplasia of breast are accompanied by diversity in patterns of nuclear p53 accumulation and ERα expression. At least some pure ADH is molecularly distinct from ADH/CIS or ADH/IDC which indicated the two types of ADH are molecularly distinct entities although they have the same morphological appearance.

  8. EST data: 215 [RED

    Lifescience Database Archive (English)

    Full Text Available CB0966 D22402 AU102142 DPlate 003 G03 5' AAG GTA CCG AAT TAT CAA TC 3' 5' TCA TTC TGG ACT GAA TG ... A AC 3' >AB019327_1(AB019327|pid:g3811007) Daucus ... carota mRNA for NADP specific isocitrate dehydroge ...

  9. Process for producing astatine-211 for radiopharmaceutical use

    International Nuclear Information System (INIS)

    A one-step chemical manipulation is described in combination with a distillation and collection process for producing At-211 comprising; a. providing a target of irradiated Bismuth coated to a predetermined thickness of a backing member, b. providing a vapor-producing still operably connected with a condenser that has a water cooled condensate collector formed of a dry silica gel mesh maintained at a temperature above the freezing point of water, and providing an effluent gas filter that is operably connected to receive effluent gas from the condenser, c. heating the target in the still at a temperature in the range of about 6300-6800C for a time period in the range of 50 to 80 minutes, to evole At-211 vapor from the target, c. providing a dry carrier gas having an oxygen concentration that is sufficient to form Bi/sub 2/O/sub 3/ thereby to essentially preclude vaporization of Bi metal, passing the carrier gas through the still to carry the At-211 vapor to the condenser, and to carry effluent from the condenser to the effluent gas filter, e. eluting At-211 from the condensate collector of the condenser with a controlled volume of eluent containing predetermined solvents that are compatible with a given desired radiopharmaceutical procedure, and f. collecting the At-211 in the controlled volume of eluent for use in the given radiopharmaceutical procedure

  10. CFTR depletion results in changes in fatty acid composition and promotes lipogenesis in intestinal Caco 2/15 cells.

    Directory of Open Access Journals (Sweden)

    Geneviève Mailhot

    Full Text Available BACKGROUND: Abnormal fatty acid composition (FA in plasma and tissue lipids frequently occurs in homozygous and even in heterozygous carriers of cystic fibrosis transmembrane conductance regulator (CFTR mutations. The mechanism(s underlying these abnormalities remained, however, poorly understood despite the potentially CFTR contributing role. METHODOLOGY/PRINCIPAL FINDINGS: The aim of the present study was to investigate the impact of CFTR depletion on FA uptake, composition and metabolism using the intestinal Caco-2/15 cell line. shRNA-mediated cftr gene silencing induced qualitative and quantitative modifications in FA composition in differentiated enterocytes as determined by gas-liquid chromatography. With the cftr gene disruption, there was a 1,5 fold increase in the total FA amount, largely attributable to monounsaturated and saturated FA compared to controls. The activity of delta-7 desaturase, estimated by the 16:1(n-7/16:0, was significantly higher in knockdown cells and consistent with the striking elevation of the n-7 FA family. When incubated with [14C]-oleic acid, CFTR-depleted cells were capable of quick incorporation and export to the medium concomitantly with the high protein expression of L-FABP known to promote intracellular FA trafficking. Accordingly, lipoprotein vehicles (CM, VLDL, LDL and HDL, isolated from CFTR knockdown cells, exhibited higher levels of radiolabeled FA. Moreover, in the presence of [14C]-acetate, knockdown cells exhibited enhanced secretion of newly synthesized phospholipids, triglycerides, cholesteryl esters and free FA, thereby suggesting a stimulation of the lipogenic pathway. Conformably, gene expression of SREBP-1c, a key lipogenic transcription factor, was increased while protein expression of the phosphorylated and inactive form of acetylCoA carboxylase was reduced, confirming lipogenesis induction. Finally, CFTR-depleted cells exhibited lower gene expression of transcription factors (PPARalpha

  11. [Characteristics and influence of different clinical forms on the development and prognosis of carotid sinus syndrome. Apropos of 215 cases].

    Science.gov (United States)

    Graux, P; Carlioz, R; Guyomar, Y; Lemaire, N; Rihani, R; Cornaert, P; Dutoit, A; Croccel, L

    1995-07-01

    The carotid sinus syndrome is a well-known cause of syncope: the cardio-inhibitory forms are the easiest to diagnose and probably the easiest to treat. However, the vasodepressive forms are as common but their outcome is mainly unknown. Eight hundred and fifty-three patients underwent endocavitary electrophysiological studies with invasive blood pressure measurement for unexplained syncope between October 1984 and January 1990. A carotid sinus syndrome was diagnosed in 215 cases. Fifty-two patients (24.2%) had a cardio-inhibitory form (ventricular standstill > or = 3 s during carotid sinus massage), 40 (18.6%) had a pure vasodepressive form (isolated fall of systolic blood pressure > 50 mmHg during massage) and 123 patients (57.2%) had a mixed form. The average age was 74.1 +/- 9.7 years with no difference between the different forms. A number of parameters was different on the cardio-inhibitory and vasodepressive forms: the number of men (75.6 vas 24.4%; p < 0.05) and the number of syncopes (83.3 vs 60%; p < 0.02) were greater in the cardio-inhibitory form; the vasodepressive forms were more often associated with a history of transient ischaemic attacks (15 vs 0%), a poor cardiovascular status (hypertension: 47.5 vs 15.7%; p < 0.01), coronary artery disease (47.5 vs 25.5%; p < 0.05), cardiac failure (27.5 vs 11.7%; p < 0.05), induction of sustained supraventricular tachycardia (50 vs 23.5%; p < 0.05) and a greater pacemaker effect (53.6 vs 34.8 mmHg; p < 0.01); of the 191 patients (84.9% of the population) followed up for an average of 21.2 months, 168 received treatment: implantation of a cardiac pacemaker in 108 patients, reduction of antihypertensive and/or potentially bradycardia-inducing drugs in 30 patients, prescription of antiarrhythmic therapy, in 30 patients.(ABSTRACT TRUNCATED AT 250 WORDS) PMID:7487332

  12. Drug-resistance mutations number and K70R or T215Y/F substitutions predict treatment resumption during guided treatment interruptions.

    Science.gov (United States)

    Darwich, Laila; Esteve, Anna; Ruiz, Lidia; Paredes, Roger; Bellido, Rocio; Cabrera, Cecilia; Romeu, Joan; Bofill, Margarita; Clotet, Bonaventura; Martinez-Picado, Javier

    2008-05-01

    The role of antiretroviral history and genotypic resistance information as predictors of the first treatment interruption (TI) length in a CD4(+) cell count and plasma viremia-guided TI study (GTI) was assessed. Drug-resistance mutations (DRMs) were monitored in chronically HIV-1-infected subjects who underwent GTI. Patients were retrospectively classified into those who received monotherapy or dual therapy prior to HAART (pre-HAART group, n = 44) or directly initiated HAART (HAART group, n = 43). DRMs were assessed by population-based sequencing of proviral DNA at baseline and plasma RNA monthly during TI up to 180 weeks. Univariate and multivariate Cox's proportional hazard models were used to determine time off therapy predictors. The emergence of viruses with DRMs during TI was 5.1-fold more likely in pre-HAART than in HAART patients. The presence of DRMs in proviral DNA or plasma RNA was associated with shorter time off therapy. An accumulation of three or more DRMs duplicated the risk of restarting therapy with respect to having one or two mutations. Regardless of the number of DRMs, the presence of K70R or T215F/Y predicted the shortest TI time. Multivariate analyses adjusted by nadir CD4(+) counts supported the presence of DRMs in plasma HIV-1 RNA, and specifically the K70R or T215F/Y, as potent predictors of time off therapy. A history of monotherapy or dual therapy, accumulation of three or more key DRMs in the HIV-1 polymerase, and/or the presence of substitutions K70R or T215F/Y were associated with shorter time off therapy during GTI. A genotypic profile could provide clinicians with a predictive tool for time off therapy when TI is required in patients with suppressed viremia in whom nadir CD4(+) count is not available. PMID:18462084

  13. Non-motor symptoms in a Flanders-Belgian population of 215 Parkinson’s disease patients as assessed by the Non-Motor Symptoms Questionnaire

    OpenAIRE

    Crosiers, David; Pickut, Barbara; Theuns, Jessie; De Deyn, Peter Paul; Van Broeckhoven, Christine; Martinez-Martin, Pablo; Chaudhuri, K. Ray; Cras, Patrick

    2012-01-01

    Background: Non-motor symptoms (NMS) in Parkinson’s disease (PD) are frequent, increase the patients’ disability and have an important negative impact on their quality of life. Methods: We used a Dutch translation of the Non-Motor Symptoms Questionnaire (NMSQuest) to identify NMS in a population of 215 Belgian PD patients. Results: A median number of 8 NMS was reported per patient. Urinary urgency (59.2 %), nocturia (56.9 %), insomnia (45.8 %), attention problems (45.5 %) and orthostatism (41...

  14. Impactos de atropelamentos de animais silvestres no trecho da rodovia SP-215 confrontante ao Parque Estadual de Porto Ferreira – Porto Ferreira, SP (Nota Científica. Impacts roadkills mortality of wild animals in the area of SP-215 highway alongside Porto Ferreira State Park – Porto Ferreira, SP (Scientific Note.

    Directory of Open Access Journals (Sweden)

    Sonia Aparecida de SOUZA

    2010-12-01

    Full Text Available No presente trabalho foi realizado o monitoramento dos atropelamentos de animais silvestres na rodovia SP–215 no trecho confrontante ao Parque Estadual de Porto Ferreira. Em seis anos foram registrados 72 indivíduos, sendo 17 espécies de mamíferos, 10 de aves, quatro de répteis, uma de anfíbio e três indivíduos não identificados. Dentre esses, lobo-guará Chrysocyon brachyurus, jaguatirica Leopardus pardalis e cuíca-lanosa Caluromys lanatus se encontram na lista das espécies ameaçadas de extinção do Estado de São Paulo. A partir do conhecimento das espécies atingidas, faz-se necessário o desenvolvimento de estudos e propostas de implantação de medidas mitigadoras à presença da rodovia SP–215 para a conservação da fauna.This paper presents the data collected through the monitoring of roadkills on SP–215 highway in the area alongside Porto Ferreira State Park. During six years, 72 roadkills were recorded, including 17 species of mammals, 10 of birds, five of reptiles, one of amphibians and three unidentified individuals. Among those species, maned wolf Chrysocyon brachyurus, ocelot Leopardus pardalis, and Western woolly opossum Caluromys lanatus are included in the threatened species list of the state of São Paulo. After finding out which species are affected, it is necessary to develop studies and proposals for implementing effective mitigation measures for the presence of SP–215 highway in the area in order to preserve the local fauna.

  15. Die sogenaamde Bybelse kultuurmandaat (Gen. 1:28 en 2:15 en ontwikkeling ’n Ou-Testamentiese perspektief

    Directory of Open Access Journals (Sweden)

    H.F. van Rooy

    1996-03-01

    Full Text Available The so-called Biblical cultural mandate (Gen. 1:28 and 2:15 and development - a perspective from the Old TestamentIn the Reformed tradition Genesis 1:28 and 2:15 are combined and regarded as the so-called "cultural mandate", This so-called mandate is seen in traditional Reformed circles as the basis of man's responsibility to cultivate nature thus transforming nature into culture. This traditional view of the "cultural mandate ”is questioned in some circles, while other scholars link the present ecological crisis to this traditional view of the "cultural mandate". After a discussion of different evaluations of the "cultural mandate" the hermeneutical problem relating to the interpretation of the relevant material from Genesis 1 and 2 is discussed. This is followed by a discussion of different readings of the texts, viz., traditional Reformed readings, historical critical readings, an anti-cultural reading and an ecological reading. The texts are then interpreted from the perspective of a contemporary South Africa. In conclusion some implications of the discussion which could be developed within the South Africa n context are indicated. Human development and job creation receive the main emphasis.

  16. Heating induced structural and chemical behavior of KD2PO4 in the 25 °C–215 °C temperature range

    International Nuclear Information System (INIS)

    We have used powder x-ray diffraction (XRD) to investigate the structural and chemical modifications undergone by KD2PO4 (DKDP) upon heating from room temperature to 215 °C. Full-profile (Le Bail) analysis of our temperature-resolved data shows no evidence of polymorphic structural transitions or deuterium–hydrogen isotope exchange occurring below Ts = 185 °C. The lattice parameters of DKDP vary smoothly upon heating to Ts and are 0.2% to 0.6% greater than those of its isostructural hydrogenated counterpart KH2PO4 (KDP). In addition, XRD isotherms collected at Ts demonstrate the structural and chemical stability of the title compound at this temperature over a 10.5 h time period. Upon further heating, however, the tetragonal DKDP phase becomes unstable, as evidenced by its transition to a monoclinic DKDP modification and eventual chemical decomposition via dehydration. - Highlights: • Structural and chemical behavior of KD2PO4 is investigated upon heating to 215 °C • No polymorphic transitions or deuterium-hydrogen isotope exchange below Ts = 185 °C • KD2PO4 is structurally and chemically stable at Ts over a 10.5 h time period • KD2PO4 chemically decomposes via dehydration upon heating above Td = 195 °C

  17. Up- and down-conversion luminescence in the oxyfluoride glass ceramics containing Ba2+1.5xYb1−xF7:Tb3+ nanocrystals

    International Nuclear Information System (INIS)

    Transparent oxyfluoride borosilicate glass ceramics containing Ba2+1.5xYb1−xF7:Tb3+ nanocrystals were successfully prepared by a melt-quenching method with subsequent heat treatment. The precipitated crystalline phase in the glass matrix changed gradually from BaF2 to Ba2+1.5xYb1−xF7 with the increase of YbF3 content, which was confirmed by the results of XRD, HRTEM and EDX measurements. The ultraviolet and visible up-conversion and near-infrared quantum cutting down-conversion emissions were observed and interpreted. These materials could be used to modify the solar spectrum and enhance the silicon solar cell efficiency by the up-conversion and down-conversion luminescence of Tb3+–Yb3+ couples in the oxyfluoride borosilicate glass ceramics. -- Highlights: ► Oxyfluoride glass ceramics containing Ba2+1.5xYb1−xF7:Tb nanocrystals were prepared. ► The precipitated crystal phase changed from BaF2 to Ba2+1.5xYb1−xF7. ► Strong up-conversion and down-conversion emissions were observed and interpreted.

  18. Up- and down-conversion luminescence in the oxyfluoride glass ceramics containing Ba{sub 2+1.5x}Yb{sub 1-x}F{sub 7}:Tb{sup 3+} nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Xin, Fengxia [College of Materials Science and Engineering, China Jiliang University, Hangzhou 310018 (China); Zhao, Shilong, E-mail: shilong_zhao@hotmail.com [College of Materials Science and Engineering, China Jiliang University, Hangzhou 310018 (China); Jia, Guohua; Huang, Lihui; Deng, Degang; Wang, Huanping [College of Materials Science and Engineering, China Jiliang University, Hangzhou 310018 (China); Xu, Shiqing, E-mail: sxucjlu@hotmail.com [College of Materials Science and Engineering, China Jiliang University, Hangzhou 310018 (China)

    2012-11-15

    Transparent oxyfluoride borosilicate glass ceramics containing Ba{sub 2+1.5x}Yb{sub 1-x}F{sub 7}:Tb{sup 3+} nanocrystals were successfully prepared by a melt-quenching method with subsequent heat treatment. The precipitated crystalline phase in the glass matrix changed gradually from BaF{sub 2} to Ba{sub 2+1.5x}Yb{sub 1-x}F{sub 7} with the increase of YbF{sub 3} content, which was confirmed by the results of XRD, HRTEM and EDX measurements. The ultraviolet and visible up-conversion and near-infrared quantum cutting down-conversion emissions were observed and interpreted. These materials could be used to modify the solar spectrum and enhance the silicon solar cell efficiency by the up-conversion and down-conversion luminescence of Tb{sup 3+}-Yb{sup 3+} couples in the oxyfluoride borosilicate glass ceramics. -- Highlights: Black-Right-Pointing-Pointer Oxyfluoride glass ceramics containing Ba{sub 2+1.5x}Yb{sub 1-x}F{sub 7}:Tb nanocrystals were prepared. Black-Right-Pointing-Pointer The precipitated crystal phase changed from BaF{sub 2} to Ba{sub 2+1.5x}Yb{sub 1-x}F{sub 7}. Black-Right-Pointing-Pointer Strong up-conversion and down-conversion emissions were observed and interpreted.

  19. Atomic and electronic structures of neutral and charged Pbn clusters (n=2-15): Theoretical investigation based on density functional theory

    Science.gov (United States)

    Rajesh, Chinagandham; Majumder, Chiranjib

    2007-06-01

    The geometric and electronic structures of the Pbn+ clusters (n=2-15) have been investigated and compared with neutral clusters. The search for several low-lying isomers was carried out under the framework of the density functional theory formalism using the generalized gradient approximation for the exchange correlation energy. The wave functions were expanded using a plane wave basis set and the electron-ion interactions have been described by the projector augmented wave method. The ground state geometries of the singly positively charged Pbn+ clusters showed compact growth pattern as those observed for neutrals with small local distortions. Based on the total energy of the lowest energy isomers, a systematic analysis was carried out to obtain the physicochemical properties, viz., binding energy, second order difference in energy, and fragmentation behavior. It is found that n =4, 7, 10, and 13 clusters are more stable than their neighbors, reflecting good agreement with experimental observation. The chemical stability of these clusters was analyzed by evaluating their energy gap between the highest occupied and lowest unoccupied molecular orbitals and adiabatic ionization potentials. The results revealed that, although Pb13 showed higher stability from the total energy analysis, its energy gap and ionization potential do not follow the trend. Albeit of higher stability in terms of binding energy, the lower ionization potential of Pb13 is interesting which has been explained based on its electronic structure through the density of states and electron shell filling model of spherical clusters.

  20. Exploring the dust content of SDSS DR7 damped Lyman alpha systems at 2.15$\\le z_{ab}< $5.2

    CERN Document Server

    Khare, Pushpa; York, Donald G; Lundgren, Britt; Kulkarni, Varsha P

    2011-01-01

    We have studied a sample of 1084 intervening absorption systems with 2.15$\\le z_{ab}\\le$5.2, having log(N$_{\\rm HI}$) $>$ 20.0 in the spectra of QSOs in Sloan Digital Sky Survey (SDSS) data release 7 (DR7), with the aim of understanding the nature and abundance of the dust and the chemical abundances in the DLA absorbers. Composite spectra were constructed for the full sample and several subsamples, chosen on the basis of absorber and QSO properties. Average extinction curves were obtained for the samples by comparing their geometric mean composite spectra with those of two samples of QSOs, matching in z$_{em}$ and i magnitude with the DLA sample, one sample without any absorbers along their lines of sight and the other without any DLAs along their lines of sight irrespective of the presence of other absorption systems. While the average reddening in the DLA sample is small, we find definite evidence for the presence of dust in subsamples based on absorber properties, in particular the strength of metal absor...

  1. SPECTRUM OF CERVICAL LESIONS IN CIMS, BILASPUR: A 5 YEAR RETROSPECTIVE STUDY OF 215 CASES IN A TERTIARY HOSPITAL OF CENTRAL INDIA

    Directory of Open Access Journals (Sweden)

    Sadhna

    2015-10-01

    Full Text Available BACKGROUND AND OBJEC TIVE: Cancer of the cervix is a leading cause of morbidity and mortality among women W orld W ide. Therefore to curb the disease there is need of awareness of this disease. This study is aimed to categorize the premalignant and malignant lesions at the earliest, to reduce the mortality and morbidity. It also aimed to know the incidence of malignancies at our set up and to calculate distribution of patient in relation to parity and symptoms. DESIGN AND SETTING: Study included 215 patients with complain of white dis charge per vagina, per vaginal bleeding and backache attending the gynecology OPD over a period of 05 years. PATIENT AND METHODS: Patients were subjected to cervical biopsy and biopsies were sent to pathology department. Detailed clinical history, age, age at marriage, parity and socio - economic status was obtained. RESULT: Result were classified histopathological l y as inflammatory lesions 70 cases, polypoidal lesion were 30, LSIL accounted for 32 cases and HSIL were 20 cases and 30 were malignant lesions. U nder malignant category moderately differentiated squamous cell carcinoma was the commonest. Maximum numbers of patients were subjected to cervical biopsies in 3 rd decade of life. Malignancies were common in 3 rd & 4 th decade of life. Most of the cases were of parity 4. CONCLUSION : Tissue biopsy is a valuable diagnostic procedure on which surgeons and radiologists still rely.

  2. Wavelength stabilized 785 nm DBR-ridge waveguide lasers with an output power of up to 215 mW

    International Nuclear Information System (INIS)

    Wavelength stabilized distributed Bragg reflector (DBR) diode lasers at an emission wavelength of 785 nm will be presented. The devices have a 14 nm thick GaAsP single quantum well as active layer, which is embedded in Al0.65Ga0.35As waveguide layers and Al0.7Ga0.3As cladding layers. The DBR structures are realized as deeply etched tenth order gratings using I-line wafer stepper lithography. The devices have a stripe width of 2.2 µm and a cavity length of 3 mm including a DBR grating with a length of 500 µm. The devices are mounted p-side up on C-mounts. At a temperature of 25 °C a continuous wave output power of 215 mW and a conversion efficiency of 28% are measured. Up to 140 mW single mode operation with a small tuning range below 190 pm is observed. At 50 mW an aging test was performed showing reliable operation over 1000 h. (paper)

  3. Surgical skill experience of 215 cases of pterygium treated by autologous corneal limbal stem cell transplantation%215例自体角膜缘干细胞移植治疗翼状胬肉手术技巧体会

    Institute of Scientific and Technical Information of China (English)

    潘勇; 葛军

    2014-01-01

    目的:探讨自体角膜缘干细胞移植治疗翼状胬肉手术技巧。方法回顾我院2006年8月至2013年8月采用自体角膜缘干细胞移植治疗翼状胬肉手术215例(267眼),对手术效果进行临床分析。结果术后随访1~3年,212例(264眼)治愈无复发,占98.9%,3例(3眼)复发,占1.1%。结论自体角膜缘干细胞移植治疗翼状胬肉手术疗效显著,复发率低,非常适合在各级医院推广。%Objective To investigate the surgical skill of autologous corneal limbal stem cell transplantation for the treatment of pterygium. Methods The medical records of 267 eyes of 215 patients who underwent autologous corneal limbal stem cell transplantation for pterygium in our hospital during Aug 2006 and Aug 2013 was reviewed. A clinical analysis was made on the effect of the treatment. Results Patients were followed up for 1-3 years. 264 eyes of 212 patients (98.9%) were cured without recurrence, while only 3 eyes of 3 patients (1.1%) recurred. Conclusion Autologous corneal limbal stem cell transplantation is an effective treatment for pterygium and has a low recurrence rate. It is very suitable for being popularized in varied levels of hospitals.

  4. Postoperative treatment of glioblastoma multiforme with radiation therapy plus concomitant and adjuvant temozolomide : A mono-institutional experience of 215 patients

    Directory of Open Access Journals (Sweden)

    Pramod Kumar Julka

    2013-01-01

    Full Text Available Objective: To study the clinical results and prognostic factors of patients with glioblastoma multiforme (GBM treated by postoperative radiation therapy (PORT and concomitant temozolomide followed by adjuvant temozolomide. Methods: From 2005 to 2008, 215 patients (median age 48 years with GBM were treated with PORT plus temozolomide chemotherapy. Radiation therapy (RT was employed with a dose of 60 Gy in 30 fractions over 6 weeks by conventional fractionation with concomitant temozolomide (75 mg/m 2 /day. Adjuvant therapy consisted of 6 cycles of temozolomide (150 mg/m 2 for 5 days, 28 days cycle. The primary end point of the study was overall survival (OS, and the secondary end points were progression free survival (PFS and toxicity. OS was determined with respect to different variables to study the prognostic significance. Results: Median follow up was 11 months (range 2-50 months. Median OS and PFS were 13 months and 11 months respectively. The 1-year and 2-year OS was 44% and 18% respectively. There was no statistical significant impact of age, sex, KP score, anatomical location and extent of surgery. Presentation without seizures (on univariate analysis and 6 cycles of adjuvant temozolomide therapy (on univariate as well as multivariate analysis were found significant prognostic factors. Sixteen patients developed grade III-IV neutropenia/thrombocytopenia during the course of RT. Conclusion: Our results authenticate the role of concomitant and adjuvant temozolomide chemotherapy in combination with PORT for the management of GBM patients. We strongly recommend complete 6 cycle of adjuvant temozolomide since it significantly improved the survival in our study.

  5. No association between exposure to perfluorinated compounds and congenital cryptorchidism: a nested case-control study among 215 boys from Denmark and Finland.

    Science.gov (United States)

    Vesterholm Jensen, Dorte; Christensen, Jeppe; Virtanen, Helena E; Skakkebæk, Niels E; Main, Katharina M; Toppari, Jorma; Veje, Christine W; Andersson, Anna-Maria; Nielsen, Flemming; Grandjean, Philippe; Jensen, Tina Kold

    2014-01-01

    Geographical differences in the occurrence of diseases in male reproductive organs, including malformation in reproductive tract, between Denmark and Finland have been reported. The reason for these differences is unknown, but differences in exposure to chemicals with endocrine-disrupting abilities have been suggested. Among these chemicals are perfluoro-alkylated substances (PFASs), a group of water- and grease-repellent chemicals used in outdoor clothes, cookware, food packaging, and textiles. In this study, we, therefore, investigated differences in PFAS exposure levels between Denmark and Finland and the association between cord blood PFAS levels and congenital cryptorchidism. Boys from a joint ongoing prospective birth cohort study were included. We analyzed PFAS levels in cord blood serum samples collected from 29 Danish boys with congenital cryptorchidism, 30 healthy Danish matched controls recruited from 1997 to 2001, 30 Finnish cases, and 78 Finnish healthy matched controls recruited from 1997 to 1999. Additionally, 48 Finnish cases recruited from 2000 to 2002 were included. Perfluorooctanoic acid (PFOA) and perfluorooctanesulfonic acid (PFOS) were detected in all the 215 Danish and Finnish cord blood samples with significantly higher levels being observed in the Danish samples (medians: PFOA, 2.6 ng/ml and PFOS, 9.1 ng/ml) than in the Finnish samples (medians: PFOA, 2.1 ng/ml and PFOS, 5.2 ng/ml). We found no associations between cord blood PFOA and PFOS levels and congenital cryptorchidism after adjustment for confounders. Our data indicate that women in Denmark and Finland are generally exposed to PFOA and PFOS but there are differences in exposure levels between countries. We found no statistically significant association between cord blood PFOA and PFOS levels and congenital cryptorchidism; however, our study was small and larger studies are warranted. PMID:24218628

  6. Pollen stratigraphy, vegetation and climate history of the last 215 ka in the Azzano Decimo core (plain of Friuli, north-eastern Italy)

    Science.gov (United States)

    Pini, R.; Ravazzi, C.; Donegana, M.

    2009-06-01

    The pollen record of the long succession of marine and continental deposits filling the subsident north-Adriatic foredeep basin (NE Italy) documents the history of vegetation, the landscape evolution and the climate forcing during the last 215 ka at the south-eastern Alpine foreland. The chronology relies on several 14C determinations as well as on estimated ages of pollen-stratigraphical and sea-level event tie-points derived from comparison with high-resolution marine records, speleothemes and ice cores. Mixed temperate rainforests persisted throughout MIS 7a-7c, being replaced by conifer forests after the local glacioeustatic regression during early MIS 6. The Alpine piedmont facing the Adriatic foredeeep was glaciated at the culmination of the penultimate glaciation, as directly testified by in situ fluvioglacial aggradation related to the building of a large morainic amphitheatre. The pollen record allows correlation with other European records and with the IRD from N-Atlantic and off Iberia, thus the duration of the penultimate glacial culmination at the southalpine fringe is estimated less than 13 ka between 148 ± 1 and >135 ka. The site was not reached by the Last Interglacial maximum sea transgression and enregistered a typical, though incomplete, Eemian forest record, lacking Mediterranean evergreen trees. A complex sequence of stadial-interstadial episodes is reconstructed during the Early and Middle Würm: major xerophyte peaks match IRD maxima occurred during Heinrich events in deep-sea cores offshore Iberia and in the N-Atlantic and allows to frame lumps of interstadial phases, marked by Picea peaks, each one including several DO warm events. Broad-leaved thermophilous forests disappeared from the north-eastern plain of Italy at the end of the Early Würm, whereas reduced populations of Abies and Fagus probably sheltered even during the Last Glacial Maximum. A renewed fluvioglacial in situ deposition between 30.4 ± 0.4 and 21.6 ± 0.5 ka cal BP sets

  7. Mimicry of a 21.5 kDa myelin basic protein peptide by a Maedi Visna virus polymerase peptide does not contribute to the pathogenesis of encephalitis in sheep.

    Science.gov (United States)

    Davies, J M; Watt, N J; Torsteinsdottir, S; Carnegie, P R

    1996-12-01

    Epitope mimicry is the theory that an infectious agent such as a virus causes pathological effects via mimicry of host proteins and thus elicits a cross-reactive immune response to host tissues. Weise and Carnegie (1988) found a region of sequence similarity between the pol gene of the Maedi Visna virus (MVV), which induces demyelinating encephalitis in sheep, and myelin basic protein (MBP), which is known to induce experimental allergic encephalitis (EAE) in laboratory animals. In this study, cross-reactions between sera raised in sheep against synthetic peptides of MVV (TGKIPWILLPGR) and 21.5 kDa MBP (SGKVPWLKPGR) were demonstrated using enzyme-linked immunosorbant assay (ELISA) and thin layer chromatography (TLC) immunoprobing. The antibody responses of MVV-infected sheep were investigated using ELISA against the peptides, and MBP protein, immunoprobing of the peptides on TLC plates and Western blotting against MBP. Slight significant reactions to the 21.5 kDa MBP peptide (P plates. On the Western blots, eight of the 23 sheep with Visna had serum reactivity to MBP. This slight reaction to MBP in MVV-infected sheep is of interest because of the immune responses to MBP evident in multiple sclerosis and EAE, but its relevance in Visna is limited since no correlation with disease severity was observed. The cell-mediated immune responses of MVV-infected sheep against similar peptides was assessed. The peptides did not stimulate proliferation of peripheral blood lymphocytes of MVV-infected sheep. Since the MVV peptide was not recognised by antibodies or T lymphocytes from MVV-infected and encephalic sheep, it was concluded that epitope mimicry of this 21.5 kDa MBP peptide by the similar MVV pol peptide was not contributing to the immunopathogensis of Visna. The slight antibody response to MBP and the MBP peptide can be attributed to by-stander effects of the immunopathology of MVV-induced encephalitis. PMID:9014312

  8. ANÁLISIS JURÍDICO PARA DETERMINAR LA VIOLACIÓN A LOS PRINCIPIOS DE; CONSTITUCIONALIDAD, LEGALIDAD Y SEGURIDAD, EN EL ARTÍCULO 215 DE LA LEY DEL IMPUESTO SOBRE LA RENTA

    OpenAIRE

    Martha Luisa Puente Esparza; J. Humberto González Álvarez

    2011-01-01

    El objetivo de esta investigación fue determinar si las disposiciones fiscales del artículo 215 de la Ley del Impuesto sobre la Renta (LISR), sobre precios de transferencia a las empresas partes relacionadas, a las cuales les indica que deberán apegarse a la Guía de la Organización para la Cooperación y el Desarrollo Económico (OCDE), violentan los principios de constitucionalidad, legalidad y seguridad. Es un estudio documental, descriptivo, analizando el aspecto jurídico.

  9. The Generalization of the Kinetic Equations and the Spectral Conductivity Function to Anisotropic Systems: Case T-Al72.5Mn21.5Fe6 Complex Metallic Alloy

    OpenAIRE

    Popčević, Petar; Batistić, Ivo; Tutiš, Eduard; Velebit, Kristijan; Heggen, Marc; Feuerbacher, Michael

    2010-01-01

    Electrical conductivity, σ, and thermoelectric power, S, of the monocrystalline T-Al72.5Mn21.5Fe6 complex metallic alloy have been investigated in the temperature range from 2 to 300 K. The crystallographic-direction-dependent measurements were performed along the [0 0 1], [0 1 0] and [1 0 0] directions of the orthorhombic unit cell, where the stacking direction is along the [0 1 0] direction. The electrical conductivity exhibits a very small anisotropy, and in all directions shows the non-me...

  10. Muon-Spin Rotation Measurements of an Unusual Vortex-Glass Phase in the Layered Superconductor Bi2.15Sr1.85CaCu2O8+δ

    OpenAIRE

    Heron, David Owen Goudie; Ray, Soumya Jyoti; Lister, Stephen Joseph Shelford; Aegerter, C. M.; Keller, H.; Kes, P.H.; Menon, G. I.; Lee, Stephen Leslie

    2013-01-01

    Muon-spin rotation measurements, performed on the mixed state of the classic anisotropic superconductor Bi2.15Sr1.85CaCu2O8+δ, obtain quantities directly related to two- and three-body correlations of vortices in space. A novel phase diagram emerges from such local probe measurements of the bulk, revealing an unusual glassy state at intermediate fields which appears to freeze continuously from the equilibrium vortex liquid but differs both from the lattice and the conventional high-field vort...

  11. Angular dependence of the disorder crossover in the vortex lattice of Bi{sub 2.15}Sr{sub 1.85}CaCu{sub 2}O{sub 8+{delta}} by muon spin rotation and torque magnetometry

    Energy Technology Data Exchange (ETDEWEB)

    Aegerter, C.M.; Hofer, J.; Savic, I.M.; Keller, H. [Physik-Institut der Universitaet Zuerich, CH-8057 Zuerich (Switzerland); Lee, S.L.; Ager, C. [School of Physics and Astronomy, University of St. Andrews, St. Andrews, Fife KY169SS (United Kingdom); Lloyd, S.H.; Forgan, E.M. [School of Physics and Space Research, University of Birmingham, Birmingham B15 2TT (United Kingdom)

    1998-01-01

    Using the techniques of muon spin rotation and torque magnetometry, we investigate the crossover field B{sub cr} in Bi{sub 2.15}Sr{sub 1.85}Ca{sub 1}Cu{sub 2}O{sub 8+{delta}} at which the vortex lattice becomes disordered along the field direction. It is found that B{sub cr} scales as the projection of the applied field along the perpendicular to the superconducting planes. This has the implication that a field large enough to give a disordered lattice when applied perpendicular to the planes, can give a well-ordered vortex-line lattice for angles of the field to the c axis greater than a critical value. {copyright} {ital 1998} {ital The American Physical Society}

  12. Oceanographic profile data collected from sound velocimeter - moving vessel profiler casts aboard BLAKE as part of project OPR-J377-KR2-15 in the Gulf of Mexico from 2015-06-03 to 2015-10-30 (NCEI Accession 0139358)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0139358 includes physical and profile data collected aboard the BLAKE during project OPR-J377-KR2-15 in the Gulf of Mexico from 2015-06-03 to...

  13. Evaluation of a Wet Chemistry Method for Isolation of Cyclotron Produced [211At]Astatine

    Directory of Open Access Journals (Sweden)

    Shigeki Watanabe

    2013-09-01

    Full Text Available A “wet chemistry” approach for isolation of 211At from an irradiated bismuth target is described. The approach involves five steps: (1 dissolution of bismuth target in conc. HNO3; (2 removal of the HNO3 by distillation; (3 dissolution of residue in 8 M HCl; (4 extraction of 211At from 8 M HCl into DIPE; and (5 extraction of 211At from DIPE into NaOH. Results from 55 “optimized” 211At isolation runs gave recovery yields of approximately 78% after decay and attenuation corrections. An attenuation-corrected average of 26 ± 3 mCi in the target provided isolated (actual yields of 16 ± 3 mCi of 211At. A sixth step, used for purification of 211At from trace metals, was evaluated in seven runs. In those runs, isolated 211At was distilled under reductive conditions to provide an average 71 ± 8% recovery. RadioHPLC analyses of the isolated 211At solutions, both initial and after distillation, were obtained to examine the 211At species present. The primary species of 211At present was astatide, but astatate and unidentified species were also observed. Studies to determine the effect of bismuth attenuation on 211At were conducted to estimate an attenuation factor (~1.33 for adjustment of 211At readings in the bismuth target.

  14. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  15. Astatination of nanoparticles containing silver as possible carriers of 211At

    Czech Academy of Sciences Publication Activity Database

    Lebeda, Ondřej; Kučka, Jan; Hrubý, Martin; Koňák, Čestmír; Kozempel, Ján

    2006-01-01

    Roč. 64, - (2006), s. 201-206. ISSN 0969-8043 R&D Projects: GA AV ČR KJB4048302; GA AV ČR KJB4050408 Institutional research plan: CEZ:AV0Z1048901 Keywords : nanoparticles * 211AT * Atalpha particle therapy Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.924, year: 2006

  16. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  17. Molecular dynamics simulation and free energy landscape methods in probing L215H, L217R and L225M βI-tubulin mutations causing paclitaxel resistance in cancer cells.

    Science.gov (United States)

    Tripathi, Shubhandra; Srivastava, Gaurava; Sharma, Ashok

    2016-08-01

    Drug resistance poses a threatening challenge for mankind, as the development of resistance to already well-established drugs causes serious therapeutic problems. Resistance to paclitaxel (Ptxl), a complex diterpenoid working as microtubule stabilizer, is one such issue in cancer treatment. Microtubule stabilizer drugs, stabilises microtubules upon binding to β-tubulin subunit of tubulin heterodimer thus causing mitotic arrest leading to death of cancer cell. Leucine point mutations viz. L215H, L217R, and L225M were reported for Ptxl resistance in various cancers. In the current study, molecular mechanism of these resistance causing mutations was explored using molecular docking, molecular dynamics (MD) simulation, binding energy estimation (MMPBSA), free energy decomposition, principle component analysis (PCA) and free energy landscape (FEL) methods. A total of five systems including unbound βI-tubulin (Apo), docked wild+Ptxl, L215H+Ptxl, L217R+Ptxl and L225M+Ptxl were prepared, and 50 ns MD simulation was performed for each system. Binding energy estimation indicated that leucine mutation reduces the binding affinity of Ptxl in mutant types (MTs) as compared to wild type (WT). Further, in contrast to WT Ptxl interactions with the M-loop (PHE270-VAL286), S6-S7 loop and H9-H10 were significantly altered in MTs. Results showed that in MTs, Ptxl had weak interaction with M-loop residues, while having strong affinity with S6-S7 loop and H6-H7 loop. Moreover, PCA and FEL analysis revealed that M-loop flexible region (THR274-LEU284) was strongly bound with Ptxl in WT preventing its flexible movement and the causing factor for microtubule stabilization. In MTs due to poor interaction with Ptxl, M-loop flexible region retains its flexibility, therefore unable to stabilize microtubule. This study will give an insight into the importance of M-loop flexible region interaction with Ptxl for microtubule stabilization. In addition, it clearly provides the molecular basis of

  18. No difference in brain activation during cognitive performance between ecstasy (3,4-methylenedioxymethamphetamine) users and control subjects: a [H2(15)O]-positron emission tomography study.

    Science.gov (United States)

    Gamma, A; Buck, A; Berthold, T; Vollenweider, F X

    2001-02-01

    The long-term use of the serotonin-releaser and uptake-inhibitor 3,4-methylenedioxymethamphetamine (MDMA, "Ecstasy") has been associated with memory impairments and increased liability to depressive mood and anxiety attacks. It is unclear, however, whether these psychologic deviations are reflected in alterations of the underlying neurophysiologic substrate. The authors compared mood and regional cerebral blood flow (rCBF) profiles between regular polytoxic Ecstasy users and Ecstasy-naive controls. Brain activity as indexed by rCBF was measured during cognitive activation by an attentional task using positron emission tomography and [H2(15)O]. Mood was assessed by means of the Hamilton Rating Scale for Depression (HAM-D) and the EWL Mood Rating Scale. Statistical parametric mapping revealed that brain activity did not differ between the two groups. Both groups also performed equally on the cognitive task requiring sustained attention. However, significantly higher levels of depressiveness as determined by the HAM-D and EWL scales were found in Ecstasy-using subjects. These data indicate that, despite differences in mood, polytoxic Ecstasy users do not differ from Ecstasy-naive controls in terms of local brain activity. Heightened depressiveness in the Ecstasy group was consistent with results from previous studies and could be related to serotonergic hypofunction resulting from repeated MDMA consumption. However, this study cannot exclude the possibility that the observed differences are preexisting rather than a result of Ecstasy use. PMID:11199950

  19. Paleomagnetism of Basaltic Lava Flows in Coreholes ICPP 213, ICPP-214, ICPP-215, and USGS 128 Near the Vadose Zone Research Park, Idaho Nuclear Technology and Engineering Center, Idaho National Engineering and Environmental Laboratory, Idaho

    Science.gov (United States)

    Champion, Duane E.; Herman, Theodore C.

    2003-01-01

    A paleomagnetic study was conducted on basalt from 41 lava flows represented in about 2,300 ft of core from coreholes ICPP-213, ICPP-214, ICPP-215, and USGS 128. These wells are in the area of the Idaho Nuclear Technology and Engineering Center (INTEC) Vadose Zone Research Park within the Idaho National Engineering and Environmental Laboratory (INEEL). Paleomagnetic measurements were made on 508 samples from the four coreholes, which are compared to each other, and to surface outcrop paleomagnetic data. In general, subhorizontal lines of correlation exist between sediment layers and between basalt layers in the area of the new percolation ponds. Some of the basalt flows and flow sequences are strongly correlative at different depth intervals and represent important stratigraphic unifying elements. Some units pinch out, or thicken or thin even over short separation distances of about 1,500 ft. A more distant correlation of more than 1 mile to corehole USGS 128 is possible for several of the basalt flows, but at greater depth. This is probably due to the broad subsidence of the eastern Snake River Plain centered along its topographic axis located to the south of INEEL. This study shows this most clearly in the oldest portions of the cored sections that have differentially subsided the greatest amount.

  20. Diffuse phase transition and impedance spectroscopy analysis of Ba2.15- x Na0.7+ x Nb5- x W x O15 ( x = 0.25) ferroelectric ceramic

    Science.gov (United States)

    Neqali, A.; Belboukhari, A.; Bensaid, H.; El Bouari, A.; Bih, L.; Alimoussa, A.; Habouti, S.; Mezzane, D.

    2016-06-01

    A new rare earth ferroelectric tetragonal tungsten bronze compound with general formula Ba2.15- xNa0.7+ xNb5- xWxO15 ( x = 0.25) was elaborated as ceramic and investigated using X-ray diffraction and dielectric measurements. The results show a tetragonal phase with the space group P4bm. Special emphasis was done to characterize diffuse phase transition (DPT) that occurs close to 472 °C. Using dielectric measurements in a frequency range of (10 Hz-1 MHz) and in a temperature range (25-550 °C), we have shown that the real part of the permittivity close to DPT is well described by Santos-Eiras phenomenological model. Space charge polarization, relaxation phenomena and free charges conductivity have been analyzed using dielectric, impedance spectroscopy and Nyquist plots showed non-Debye (polydispersive) type relaxation. In paraelectric phase, the Arrhenius activation energies were determined. Frequency dependence of ac conductivity at different temperatures follows the Jonscher's universal law (Jonscher et al. in J Mater Sci 20:4431, 1985).

  1. Effect of Sol-Gel Ageing Time on Three Dimensionally Ordered Macroporous Structure of 80SiO2-15CaO-5P2O5 Bioactive Glasses

    Directory of Open Access Journals (Sweden)

    Thanida CHAROENSUK

    2014-04-01

    Full Text Available Three dimensionally ordered macroporous bioactive glasses (3DOM-BGs, namely 80SiO2-15CaO-5P2O5, were synthesized by sol-gel method. PMMA colloidal crystals and non-ionic block copolymers P123 were used as cotemplates. The amorphous 3DOM-BGs had skeletal walls enclosing macropores. Such structure resulted from octahedral and tetrahedral holes of the face-centered cubic (fcc closest packed PMMA templates and windows interconnecting through macropores network. The thicknesses of the walls were around 50 nm – 80 nm and the windows were 90 nm – 110 nm in diameter. These wall thickness is increased by with an increase in ageing time up to 24 h and  then gradually reduced with further increase in aging time. Vibration bands of Si–O–Si and P–O were evident in infrared spectra which are in agreement with EDS spectra indicating Si, P and Ca compositions. After in vitro bioactivity testing by soaking 3DOM-BGs in simulated body fluid at 37 °C, the crystallization of amorphous calcium phosphate layers compatible to the bone component of hydroxyl carbonate apatite were rapidly formed within 3 h. These results indicated that these 3DOM-BGs resembled ideal bone implant materials.DOI: http://dx.doi.org/10.5755/j01.ms.20.1.4755

  2. Radioimmunotherapy for first-line and relapse treatment of aggressive B-cell non-Hodgkin lymphoma: an analysis of 215 patients registered in the international RIT-Network

    International Nuclear Information System (INIS)

    Very few reliable clinical data about the use of radioimmunotherapy in aggressive B-cell lymphoma exist. Patients with aggressive B-cell lymphoma registered in the international RIT-Network were analysed with regard to prior treatment, response and side effects. The RIT-Network is a web-based registry that collects observational data from radioimmunotherapy-treated patients with malignant lymphoma across 13 countries. This analysis included 215 with aggressive B-cell lymphoma out of 232 patients registered in the RIT-Network. Histological subtypes were as follows: 190 diffuse large B-cell, 15 primary mediastinal, 9 anaplastic large cell, and 1 intravascular lymphoma. The median age of the patients was 62 years (range 17 - 88), with 27 % above the age of 70 years. Radioimmunotherapy was mainly used as consolidation after first-line or second-line chemotherapy (56.1 %), as part of third-line to eighth-line therapy for relapse (16.4 %), and in refractory disease (12.2 %). Grade IV neutropenia and thrombopenia and grade III anaemia were observed. The median time to recovery of blood count was 81 days (range 0 - 600 days). The overall response rate was 63.3 %. The complete response rate was 76.4 % in patients treated as part of first-line therapy, and 44.3 % in patients with relapse. Mean overall survival in first-line therapy patients was 32.7 months and 14.0 months in patients with relapse or refractory disease, respectively. Most patients with aggressive B-cell lymphoma in the RIT-Network received radioimmunotherapy as consolidation after first-line therapy with excellent complete remission and overall survival rates compared to published data. In relapsed aggressive B-cell lymphoma, radioimmunotherapy is a safe and feasible treatment leading to satisfactory response rates with acceptable toxicity. (orig.)

  3. Radioimmunotherapy for first-line and relapse treatment of aggressive B-cell non-Hodgkin lymphoma: an analysis of 215 patients registered in the international RIT-Network

    Energy Technology Data Exchange (ETDEWEB)

    Hohloch, Karin; Lankeit, H.K.; Truemper, L. [Georg August University, Hematology and Oncology, Goettingen (Germany); Zinzani, P.L. [University of Bologna, Institute of Hematology and Medical Oncology ' ' L. e A. Seragnoli' ' , Bologna (Italy); Scholz, C.W. [Charite, University Berlin, Hematology, Oncology and Tumor Immunology, Berlin (Germany); Lorsbach, M.; Windemuth-Kieselbach, C. [Alcedis GmbH, Giessen (Germany)

    2014-08-15

    Very few reliable clinical data about the use of radioimmunotherapy in aggressive B-cell lymphoma exist. Patients with aggressive B-cell lymphoma registered in the international RIT-Network were analysed with regard to prior treatment, response and side effects. The RIT-Network is a web-based registry that collects observational data from radioimmunotherapy-treated patients with malignant lymphoma across 13 countries. This analysis included 215 with aggressive B-cell lymphoma out of 232 patients registered in the RIT-Network. Histological subtypes were as follows: 190 diffuse large B-cell, 15 primary mediastinal, 9 anaplastic large cell, and 1 intravascular lymphoma. The median age of the patients was 62 years (range 17 - 88), with 27 % above the age of 70 years. Radioimmunotherapy was mainly used as consolidation after first-line or second-line chemotherapy (56.1 %), as part of third-line to eighth-line therapy for relapse (16.4 %), and in refractory disease (12.2 %). Grade IV neutropenia and thrombopenia and grade III anaemia were observed. The median time to recovery of blood count was 81 days (range 0 - 600 days). The overall response rate was 63.3 %. The complete response rate was 76.4 % in patients treated as part of first-line therapy, and 44.3 % in patients with relapse. Mean overall survival in first-line therapy patients was 32.7 months and 14.0 months in patients with relapse or refractory disease, respectively. Most patients with aggressive B-cell lymphoma in the RIT-Network received radioimmunotherapy as consolidation after first-line therapy with excellent complete remission and overall survival rates compared to published data. In relapsed aggressive B-cell lymphoma, radioimmunotherapy is a safe and feasible treatment leading to satisfactory response rates with acceptable toxicity. (orig.)

  4. 22 CFR 215.14 - Specific exemptions.

    Science.gov (United States)

    2010-04-01

    ... Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT REGULATIONS FOR IMPLEMENTATION OF PRIVACY ACT OF... identity of a source who furnished information to the Government under an express promise that the identity... implied promise that the identity of the source would be held in confidence; (3) Maintained in...

  5. 49 CFR 215.103 - Defective wheel.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Freight Car Components Suspension System..., is 11/2 inches, or more; (c) The thickness of a rim of a wheel on the car is 11/16 of an inch, or less; (d) A wheel rim, flange, plate, or hub area on the car has a crack or break; (e) A wheel on...

  6. 7 CFR 215.14 - Nondiscrimination.

    Science.gov (United States)

    2010-01-01

    .... When different types of milk are served to children, (a) a uniform price for each type of milk served... Department's agreements with State agencies, the State agencies' agreements with School Food Authorities and child-care institutions and the FNSRO agreements with School Food Authorities administering...

  7. 7 CFR 215.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... part, the term: 7 CFR part 3015 means the Uniform Federal Assistance Regulations published by the... miscellaneous Department requirements. 7 CFR part 3016 means the Department's Uniform Administrative... purchase price paid by the school or child care institution to the milk supplier for milk delivered to...

  8. 40 CFR 46.215 - Enforcement.

    Science.gov (United States)

    2010-07-01

    ... the cost of the activity or action not in compliance; (3) Wholly or partly terminate the fellowship... will provide you an opportunity for hearing, appeal, or other administrative proceeding to which you... implementing regulations (2 CFR part 1532)....

  9. 24 CFR 91.215 - Strategic plan.

    Science.gov (United States)

    2010-04-01

    ... jurisdiction will provide affordable housing as defined in 24 CFR 92.252 for rental housing and 24 CFR 92.254... public housing agency is designated as “troubled” by HUD under 24 CFR part 902, the jurisdiction must... the use of the CDBG funds in the revitalization area(s) as described in 24 CFR part 570, subpart...

  10. 12 CFR 215.4 - General prohibitions.

    Science.gov (United States)

    2010-01-01

    ... preference to any insider of the member bank over other employees of the member bank and, in the case of extensions of credit to an insider of its affiliates, does not give preference to any insider of its... bank charges the executive officer or director the same fee charged any other customer of the bank...

  11. 2 CFR 215.22 - Payment.

    Science.gov (United States)

    2010-01-01

    ...) Payment methods shall minimize the time elapsing between the transfer of funds from the United States.... Payment methods of State agencies or instrumentalities shall be consistent with Treasury-State CMIA agreements or default procedures codified at 31 CFR part 205. (b) Recipients are to be paid in...

  12. Case 215: voriconazole-induced periostitis.

    Science.gov (United States)

    Tailor, Tina D; Richardson, Michael L

    2015-03-01

    History A 74-year-old woman presented with multifocal bone pain, including pain in multiple ribs, bilateral shoulders, and bilateral hips. The pain began several months before presentation and was quite severe, ultimately necessitating control with narcotics. At examination, strength in both lower extremities was slightly reduced, sensation and reflexes were intact, and range of motion was full, though painful. There were no notable constitutional symptoms of fever or weight loss. Laboratory work-up was remarkable for elevated alkaline phosphatase level (277 U/L [4.6 mkat/L]). The patient had undergone left lung transplantation 8 years prior for pulmonary fibrosis. A thorough pulmonary work-up for the cause of fibrosis, which included gathering an exposure, occupational, allergy, and previous infectious history, and a rheumatoid work-up were negative. The patient's posttransplantation course was complicated by bronchiolitis obliterans from chronic rejection and by recent pulmonary embolism, for which she was undergoing anticoagulation therapy at the time of presentation. Additionally, the patient experienced repeated pulmonary infections with Aspergillus, leading to multiple hospitalizations and long-term antifungal prophylaxis with voriconazole. A bone scan from an outside hospital was reviewed, and further imaging was performed. PMID:25710343

  13. 49 CFR 215.105 - Defective axle.

    Science.gov (United States)

    2010-10-01

    ... plain bearing journal on the axle, or the fillet on the axle, has— (1) A ridge; (2) A depression; (3) A... conjunction with a plain bearing, has an end collar that is broken or cracked; (d) A journal on the car...

  14. 24 CFR 200.215 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... Officer. (See § 200.224) (e) Principal. (1) An individual, joint venture, partnership, corporation, trust... includes: (i) Any affiliates of a principal; (ii) if the principal is a partnership, all general partners, and each limited partner having a 25 percent or more interest in the partnership; (iii) if...

  15. 12 CFR 215.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... any corporation, partnership, trust (business or otherwise), association, joint venture, pool syndicate, sole proprietorship, unincorporated organization, or any other form of business entity not... that person or the funds or services of which will benefit that person. (o) Subsidiary has the...

  16. 20 CFR 627.215 - Relocation.

    Science.gov (United States)

    2010-04-01

    ... skill training, on-the-job training, or company-specific assessments of job applicants or employees, for... original location. (c) For the purposes of this section, relocating establishment means a business entity... review should include names under which the establishment does business, including...

  17. 32 CFR 215.4 - Legal considerations.

    Science.gov (United States)

    2010-07-01

    ... national entity under the Federal Constitution—to insure the preservation of public order and the carrying.... (a) Under the Constitution and laws of the United States, the protection of life and property and the... necessary authority to enforce the laws. The Federal Government may assume this responsibility and...

  18. Effect of LuF3 on Stability and Infrared Property of 20GaF3-15InF3-20CdF2-15ZnF2-20PbF2-10SnF2 Glass%Lu3+掺杂对20GaF3-15InF3-20CdF2-15ZnF2-20PbF2-10SnF2玻璃抗析晶能力和红外吸收边的影响

    Institute of Scientific and Technical Information of China (English)

    朱基千; 李志国; 贺芸芬; 唐高; 白朝颖

    2005-01-01

    以20GaF3-15InF3-20CdG2-15ZnF2-20PbF2-10SnF2氟化镓玻璃为基玻璃,用LuF3替代等摩尔含量的PbF2,以改善玻璃的抗析晶能力.用差示扫描量热法研究了LuF3含量对玻璃热性能和抗析晶能力的影响,用红外透过光谱研究了LuF3含量对玻璃透红外性能的影响.结果表明:在玻璃中掺入摩尔分数为2%的LuF3可以获得最佳的抗析晶能力;LuF3的掺入对玻璃的透红外性能稍有影响,红外截止波长的变化范围仅在10.1μm~10.9μm之间.

  19. 48 CFR 215.404-75 - Fee requirements for FFRDCs.

    Science.gov (United States)

    2010-10-01

    ...) that relates to DoD contracted effort; (2) Facilities capital acquisition plans; (3) Working capital funding as assessed on operating cycle cash needs; and (4) Provision for funding unreimbursed costs...

  20. 49 CFR 25.215 - Membership practices of certain organizations.

    Science.gov (United States)

    2010-10-01

    ... education. (b) YMCA, YWCA, Girl Scouts, Boy Scouts, and Camp Fire Girls. These Title IX regulations do not apply to the membership practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the Boy Scouts, and Camp Fire Girls. (c) Voluntary...

  1. 31 CFR 28.215 - Membership practices of certain organizations.

    Science.gov (United States)

    2010-07-01

    ... higher education. (b) YMCA, YWCA, Girl Scouts, Boy Scouts, and Camp Fire Girls. These Title IX regulations do not apply to the membership practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the Boy Scouts, and Camp Fire Girls....

  2. 32 CFR 196.215 - Membership practices of certain organizations.

    Science.gov (United States)

    2010-07-01

    ... students in attendance at institutions of higher education. (b) YMCA, YWCA, Girl Scouts, Boy Scouts, and Camp Fire Girls. These Title IX regulations do not apply to the membership practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the...

  3. 45 CFR 2555.215 - Membership practices of certain organizations.

    Science.gov (United States)

    2010-10-01

    ... students in attendance at institutions of higher education. (b) YMCA, YWCA, Girl Scouts, Boy Scouts, and Camp Fire Girls. These Title IX regulations do not apply to the membership practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the...

  4. 22 CFR 146.215 - Membership practices of certain organizations.

    Science.gov (United States)

    2010-04-01

    ... education. (b) YMCA, YWCA, Girl Scouts, Boy Scouts, and Camp Fire Girls. These Title IX regulations do not apply to the membership practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the Boy Scouts, and Camp Fire Girls. (c) Voluntary...

  5. 43 CFR 41.215 - Membership practices of certain organizations.

    Science.gov (United States)

    2010-10-01

    ... higher education. (b) YMCA, YWCA, Girl Scouts, Boy Scouts, and Camp Fire Girls. These Title IX regulations do not apply to the membership practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the Boy Scouts, and Camp Fire Girls....

  6. 10 CFR 5.215 - Membership practices of certain organizations.

    Science.gov (United States)

    2010-01-01

    ... consists primarily of students in attendance at institutions of higher education. (b) YMCA, YWCA, Girl... practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the Boy Scouts, and Camp Fire Girls. (c) Voluntary youth service organizations....

  7. 10 CFR 1042.215 - Membership practices of certain organizations.

    Science.gov (United States)

    2010-01-01

    ..., YWCA, Girl Scouts, Boy Scouts, and Camp Fire Girls. These Title IX regulations do not apply to the membership practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the Boy Scouts, and Camp Fire Girls. (c) Voluntary youth service...

  8. 28 CFR 54.215 - Membership practices of certain organizations.

    Science.gov (United States)

    2010-07-01

    ... higher education. (b) YMCA, YWCA, Girl Scouts, Boy Scouts, and Camp Fire Girls. These Title IX regulations do not apply to the membership practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the Boy Scouts, and Camp Fire Girls....

  9. 22 CFR 229.215 - Membership practices of certain organizations.

    Science.gov (United States)

    2010-04-01

    ... education. (b) YMCA, YWCA, Girl Scouts, Boy Scouts, and Camp Fire Girls. These Title IX regulations do not apply to the membership practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the Boy Scouts, and Camp Fire Girls. (c) Voluntary...

  10. 15 CFR 8a.215 - Membership practices of certain organizations.

    Science.gov (United States)

    2010-01-01

    ... higher education. (b) YMCA, YWCA, Girl Scouts, Boy Scouts, and Camp Fire Girls. These Title IX regulations do not apply to the membership practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the Boy Scouts, and Camp Fire Girls....

  11. 14 CFR 1253.215 - Membership practices of certain organizations.

    Science.gov (United States)

    2010-01-01

    ... higher education. (b) YMCA, YWCA, Girl Scouts, Boy Scouts, and Camp Fire Girls. These Title IX regulations do not apply to the membership practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the Boy Scouts, and Camp Fire Girls....

  12. 6 CFR 17.215 - Membership practices of certain organizations.

    Science.gov (United States)

    2010-01-01

    ... higher education. (b) YMCA, YWCA, Girl Scouts, Boy Scouts, and Camp Fire Girls. These Title IX regulations do not apply to the membership practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the Boy Scouts, and Camp Fire Girls....

  13. 29 CFR 36.215 - Membership practices of certain organizations.

    Science.gov (United States)

    2010-07-01

    ... consists primarily of students in attendance at institutions of higher education. (b) YMCA, YWCA, Girl... practices of the Young Men's Christian Association (YMCA), the Young Women's Christian Association (YWCA), the Girl Scouts, the Boy Scouts, and Camp Fire Girls. (c) Voluntary youth service organizations....

  14. AB215. Penis transplant: a long way to success

    OpenAIRE

    Li, Jinhong; Yuan, Jiuhong

    2016-01-01

    Objective Transplant seems to be an ideal and mature treatment for some late-stage diseases. The first penis transplant operation was performed in China about 9 years ago and recently, a piece of news reporting another successful penis transplant in South Africa had spread throughout the world. Overall, penis transplant was seldom reported. Methods PubMed, ISI Web of Science and Google Scholar databases (until January 2016) were searched for relevant publications on penis transplant. Results ...

  15. Dicty_cDB: VFB215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available c, DNA sequence. 80 7e-11 1 AW649196 |AW649196.1 EST327650 tomato germinating seedlings, TAMU Lycopersico... 4e-09 1 BE459798 |BE459798.1 EST415090 tomato developing/immature green fruit Lycopersico...ba histolytica Sheared DNA Entamoeba histolytica genomic, DNA sequence. 80 1e-17 3 BI921109 |BI921109.1 EST541012 tomato callus Lyco...ideum calreticulin mRNA, complete cds. 1122 0.0 2 BD248385 |BD248385.1 Gene participating in tolerance again...n esculentum cDNA clone cLEM8G13, mRNA sequence. 74 4e-09 1 BE435540 |BE435540.1 EST406618 tomato breaker fruit, TIGR Lyco

  16. 48 CFR 52.215-14 - Integrity of Unit Prices.

    Science.gov (United States)

    2010-10-01

    ...: acquisitions at or below the simplified acquisition threshold in FAR Part 2; construction or architect-engineer...; commercial items; and petroleum products. (End of clause) Alternate I (OCT 1997). As prescribed in...

  17. 48 CFR 1352.215-75 - Evaluation criteria.

    Science.gov (United States)

    2010-10-01

    ... criteria. As prescribed in 48 CFR 1315.204-570(b)(2) and (3), insert the following provision: Evaluation... customer satisfaction. The Government reserves the right to assess the past performance of...

  18. AB215. Penis transplant: a long way to success

    Science.gov (United States)

    Li, Jinhong; Yuan, Jiuhong

    2016-01-01

    Objective Transplant seems to be an ideal and mature treatment for some late-stage diseases. The first penis transplant operation was performed in China about 9 years ago and recently, a piece of news reporting another successful penis transplant in South Africa had spread throughout the world. Overall, penis transplant was seldom reported. Methods PubMed, ISI Web of Science and Google Scholar databases (until January 2016) were searched for relevant publications on penis transplant. Results Penile defects caused by various reasons and transsexual persons might be an ideal graft recipient for penis transplant. Graft donor might be confined to some volunteer organ donors or male-to-female transsexual persons. Although for patients with penis defects, penis replantation, penis reconstruction and penis lengthening were widely used, those treatments were often accompanied with shortcomings such as multiple operations, nerve/vascular damage and limited ischemic time. In penis transplant, except for anatomical technical skills, functional issues should also be addressed. Penis transplant required not only a successful urination but also a well erectile function. Experience of several penis replantation operations of amputated penis in our hospital showed that the anastomoses of blood vessels (deep/dorsal artery, superficial/deep dorsal vein) with microsurgical technique could ensure its survival. Meanwhile, well dorsal nerves repair could make the erectile function rehabilitation possible. Similarly, penis transplant also required above repair of blood vessels and nerves. Besides, penis transplant needed further care to avoid allograft rejection just like other transplants. However, at present, no guidelines could be referred for the application of immunosuppression drugs in penis transplants. Unlike kidney transplants, which require only anastomoses of vessels, penis transplants need skin and nerve repair. Thus, immunosuppressants should refer to some composite tissue transplants such as face/hand transplants. Penis transplant prompted much ethical discussion and also brought some psychological concerns for recipients and his partners. Ethical/Psychological issues were also a key point for successful transplant operations. Conclusions Penis transplant should be performed in collaboration with surgeons, anesthetists, nurses, psychologists and ethicists. Since some concerns about functional issues, immunosuppression-related problems and ethical/psychological concerns, the application of penis transplant was often limited. However, when all the problems are solved, penis transplant will be a new ideal option and I believe it will come in the near future.

  19. 4 CFR 21.5 - Protest issues not for consideration.

    Science.gov (United States)

    2010-01-01

    ... time limits set forth in § 21.2. (f) Protests which lack a detailed statement of the legal and factual... business size standards and North American Industry Classification System (NAICS) standards. Challenges...

  20. 25 CFR 215.24 - Books and accounts.

    Science.gov (United States)

    2010-04-01

    ... OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEAD AND ZINC MINING OPERATIONS AND... lead and zinc concentrates produced, and of all ore and concentrates sold and to whom sold, the weight, assay value, moisture content, base price, dates, penalties, and price received, and the percentage...

  1. 24 CFR 572.215 - Implementation grants-eligible activities.

    Science.gov (United States)

    2010-04-01

    ... related to implementing the affirmative fair housing marketing strategy required under § 572.110. (k...) Homebuyer outreach and selection. Reasonable and necessary costs of marketing the program to...

  2. 50 CFR 600.215 - Council nomination and appointment procedures.

    Science.gov (United States)

    2010-10-01

    ... fishing; (iii) Leadership in a state, regional, or national organization whose members participate in a..., journalism, writing, consulting, practicing law, or researching matters related to fisheries,...

  3. 12 CFR 215.3 - Extension of credit.

    Science.gov (United States)

    2010-01-01

    ... bank for its own protection for: (i) Accrued interest; or (ii) Taxes, insurance, or other expenses... to the general public; (6) Indebtedness of $5,000 or less arising by reason of an interest-bearing...-interest-bearing deposits to the credit of a bank are not considered loans, advances, or extensions...

  4. 12 CFR 215.1 - Authority, purpose, and scope.

    Science.gov (United States)

    2010-01-01

    ... executive officer, director, or principal shareholder of the member bank, of any company of which the member... of credit made to an executive officer, director, or principal shareholder of a bank (or to a related interest of such person) by a correspondent bank also are subject to restrictions set forth in 12...

  5. 46 CFR 10.215 - Medical and physical requirements.

    Science.gov (United States)

    2010-10-01

    ... infarctions, psychiatric disorders, and convulsive disorders. (2) Food handlers are not required to submit to... complete annual medical exams and, unless exempt per 46 CFR 16.220, pass annual chemical tests for... conducted by a licensed medical doctor in accordance with the physical exam requirements in 46 CFR...

  6. 48 CFR 1352.215-76 - Cost or pricing data.

    Science.gov (United States)

    2010-10-01

    ... pricing data. As prescribed in 48 CFR 1315.204-570(b)(4), insert the following provision: Cost or Pricing... Statement of Work. A brief definition of the education and experience requirements which qualify an employee....—should be discussed. (3) Overhead Costs. Generally, the offeror's accounting system and...

  7. Dicty_cDB: VSI215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Translated Amino Acid sequence ex*c*rtrrrrsrrrgrrttrrrrr*k**rin*rsrrrfprtpirn*shtkr*rfr*thf wllcftrr*lhclwf...GXTXNPXEIGGTSXEXQXKXXLVLQQNGNXERLSXFXPDXGPNKKN Frame B: ex*c*rtrrrrsrrrgrrttrrrrr*k**rin*rsrrrfprtpirn*shtkr*rfr*thf wllcftr

  8. 18 CFR 2.15 - Specified reasonable rate of return.

    Science.gov (United States)

    2010-04-01

    ... calculated annually based on current capital ratios developed from an average of 13 monthly balances of... in the Commission's Uniform System of Accounts. The cost rate for such ratios shall be the weighted average cost of long-term debt and preferred stock for the year, and the cost of common equity shall...

  9. 48 CFR 215.404-71-5 - Cost efficiency factor.

    Science.gov (United States)

    2010-10-01

    ...) Subcontractor cost reduction efforts; (7) The contractor's effective incorporation of commercial items and... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY...

  10. 48 CFR 1552.215-71 - Evaluation factors for award.

    Science.gov (United States)

    2010-10-01

    ... combined are significantly more important than cost or price. (b) Evaluation factors and significant subfactors to determine quality of product or service: (End of provision) Evaluation Factors for Award (AUG... significantly less important than cost or price. (b) Evaluation factors and significant subfactors to...

  11. 20 CFR 725.215 - Determination of dependency; surviving spouse.

    Science.gov (United States)

    2010-04-01

    ... miner's desertion or other reasonable cause; or (d) The individual is the natural parent of the miner's..., and as a direct result of the bodily injuries and independently of all other causes, dies not later.... In no event will the death of an individual resulting from violent and external causes be...

  12. 2 CFR 215.21 - Standards for financial management systems.

    Science.gov (United States)

    2010-01-01

    ... codified at 31 CFR part 205, “Withdrawal of Cash from the Treasury for Advances under Federal Grant and... obtained from companies holding certificates of authority as acceptable sureties, as prescribed in 31 CFR... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Standards for financial management...

  13. 33 CFR 104.215 - Vessel Security Officer (VSO).

    Science.gov (United States)

    2010-07-01

    ... have general knowledge, through training or equivalent job experience, in the following: (1) Those... reporting of accidents; (C) Proper usage of protective equipment and general knowledge of procedures for... regulations specified in 46 CFR Subchapter B; (iv) Successfully complete a Coast Guard-accepted VSO course;...

  14. 34 CFR 682.215 - Income-based repayment plan.

    Science.gov (United States)

    2010-07-01

    ... poverty guideline for the borrower's family size; or (ii) For a married borrower who files a joint Federal... for the borrower's family size. (5) Poverty guideline refers to the income categorized by State and family size in the poverty guidelines published annually by the United States Department of Health...

  15. 48 CFR 215.304 - Evaluation factors and significant subfactors.

    Science.gov (United States)

    2010-10-01

    ... university and minority institution performance of the contract, whether as a joint venture, teaming... U.S.C. 2436, consider the purchase of capital assets (including machine tools) manufactured in the... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY...

  16. 48 CFR 215.404-71-4 - Facilities capital employed.

    Science.gov (United States)

    2010-10-01

    ... Forms CASB-CMF and cost of money factors (48 CFR 9904.414 and FAR 31.205-10); and (2) DD Form 1861... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION...D. Indicators are— (A) Allocations of capital apply predominantly to commercial item lines;...

  17. 48 CFR 252.215-7002 - Cost estimating system requirements.

    Science.gov (United States)

    2010-10-01

    ... applied; (2) Produces verifiable, supportable, and documented cost estimates that are an acceptable basis... the cost estimating system to the ACO on a timely basis. (e) Estimating system deficiencies. (1) The... historical costs, and other analyses used to generate cost estimates. (b) General. The Contractor...

  18. 48 CFR 215.404-71-2 - Performance risk.

    Science.gov (United States)

    2010-10-01

    ... incentive range when contract performance includes the introduction of new, significant technological innovation. Use the technology incentive range only for the most innovative contract efforts. Innovation may... reliability, or reduced costs; or (B) New products or systems that contain significant technological...

  19. Dicty_cDB: SSM215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .002 1 AU176207 |AU176207.1 Penaeus japonicus cDNA forward end of clone:PJV601. 54 0.002 1 BX323881 |BX32388...AU175995.1 Penaeus japonicus cDNA forward end of clone:PJV77. 54 0.002 1 dna update 2003. 8.12 Homology vs P

  20. 48 CFR 2152.215-70 - Contractor records retention.

    Science.gov (United States)

    2010-10-01

    ... MANAGEMENT, FEDERAL EMPLOYEES GROUP LIFE INSURANCE FEDERAL ACQUISITION REGULATION CLAUSES AND FORMS... make available all records applicable to a contract term that support the annual financial report for...

  1. Dicty_cDB: CHI215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vflyqmmqih*kqvqevqlfwkilf*e kr*lilimkefqkelfmqeeqelmviffliriivn*qkqis*vnkirkhqfsfvyqqfkd qedqliqfvtfmdll*nsil...f*e kr*lilimkefqkelfmqeeqelmviffliriivn*qkqis*vnkirkhqfsfvyqqfkd qedqliqfvtfmdll*nsil...CAAAAANA sequence update 2002.10.25 Translated Amino Acid sequence y*f*snkk*irn*nnlknskqmiriqfiqqqil...KTIAFGGSVSVIKELLRLPQDRGLLLGNGYKDITEQFFYSLAHHRVWERESKVSKI PAKX Frame B: y*f*snkk*irn*nnlknskqmiriqfiqqqilvflyqmmqih*kqvqevqlfwkil...asvfysrckfiprfctcskdgtte*nanw gevlmilfmisvd*nqrvliayyg*cqivvsqfh--- ---*yvst*keshhrri

  2. Dicty_cDB: VSA215 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available osome IV cosmid 9934. 46 0.15 2 AI775835 |AI775835.1 EST256935 tomato resistant, Cornell Lycopersicon escule...21334 tomato flower buds 3-8 mm, Cornell University Lycopersicon esculentum cDNA clone cTOB10G7 5', mRNA seq

  3. A study of the higher excitation levels of 11B via the 10B(n,n)10B and 10B(n,n')10B*(0.72, 1.74, 2.15, 3.59, 4.77 MeV) reactions

    International Nuclear Information System (INIS)

    As part of the study of the higher energy-level structure of 11B, cross sections for elastic and inelastic scattering of neutrons from isotopically enriched 10B samples have been measured for incident neutron energies from 3.03 MeV to 6.45 MeV in 250 keV increments and from 7.02 MeV to 12.01 MeV in 500 keV increments. Inelastic angular distributions for scattering to the states in parentheses in 10B have been measured from the indicated energy up to 12.01 MeV; (0.718) from 3.02 MeV; (1.74) from 3.27 MeV; (2.15) from 3.77 MeV; (3.59) from 5.52 MeV; (4.77) from 7.02 MeV. The measurements at 3.02, 3.51, 4.02, and 4.51 MeV were done at nine laboratory angles from 20/degree/ to 158/degree/ in 17.5/degree/ increments with a sample that is isotopically 95.86% 10B. All other distributions measured scattering at 11 laboratory angles from 18/degree/ to 158/degree/ in 15/degree/ increments from a sample that is isotopically 99.49% 10B. The data are corrected for air scattering, sample attenuation, minor isotope impurity, multiple scattering, and elastic and inelastic scattering from the sample of the neutron source continuum and contaminants. An eight-channel, multilevel R-matrix analysis was performed on the data. Level energies, spins, and parities were deduced for twelve levels above 13 MeV excitation in 11B. Only two definite and three tentative assignments for T = /1/2/ levels had been made previously above 13 MeV. The two definite levels were confirmed. Good agreement between the data and the R-matrix calculation in all analyzed channels was obtained for the proposed structure. 122 refs., 40 figs., 7 tabs

  4. 78 FR 65453 - Hazardous Materials: Corrections and Response to Administrative Appeals (HM-215K, HM-215L, HM...

    Science.gov (United States)

    2013-10-31

    ... required periodic retest. In addition, we provided a table to clearly identify the retention requirements... incorporate a special permit with a longstanding history of safety into the HMR, and included a response to a...'' in the Hazardous Materials Table (HMT). SAAMI notes that there was no discussion of this change...

  5. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  6. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE,CERN

    OpenAIRE

    Rothe, Sebastian

    2012-01-01

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spec...

  7. Inactivation of human osteosarcoma cells in vitro by {sup 211}At-TP-3 monoclonal antibody: Comparison with astatine-211 and external-beam X rays

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, R.H. [Univ. of Oslo (Norway)]|[Institute for Cancer Research, Oslo (Norway); Bruland, O.S. [Institute for Cancer Research, Oslo (Norway); Hoff, P.; Alstad, J. [Univ. of Oslo (Norway); Lindmo, T. [Institute for Cancer Research, Oslo (Norway); Rofstad, E.K. [Norwegian Institute of Technology, Trondheim (Norway)

    1994-08-01

    The potential usefulness of {alpha}-particle radioimmunotherapy in the treatment of osteosarcoma was studied in vitro by using the monoclonal antibody TP-3 and cells of three human osteosarcoma cell lines (OHS, SAOS and KPDX) differing in antigen expression. Cell survival curves were established after treatment with (a) {sup 211}At-TP-3 of different specific activities, (b) {sup 211}At-labeled bovine serum albumin (BSA), (c) free {sup 211}At and (d) external-beam X rays. The three osteosarcoma cell lines showed similar survival curves, whether treated with external-beam X rays, {sup 211}At-BSA or free {sup 211}At. The D{sub o}`s were lower for free {sup 211}At than for {sup 211}At-BSA. The survival curves for {sup 211}At-TP-3 treatment, on the other hand, differed significantly among the cell lines, suggesting that sensitivity to {sup 211}At-TP-3 treatment was governed by cellular properties other than sensitivity to external-beam X rays. The cellular property most important for sensitivity to {sup 211}At-TP-3 treatment was the antigen expression. Cell inactivation after {sup 211}At-TP-3 treatment increased substantially with increasing specific activity of the {sup 211}At-TP-3. At high specific activities, the cytotoxic effect of {sup 211}At-TP-3 was significantly higher than that of {sup 211}At-BSA. In conclusion, {sup 211}At-TP-3 has the potential to give clinically favorable therapeutic ratios in the treatment of osteosarcoma. 39 refs., 5 figs., 2 tabs.

  8. Johannes Bellmann: John Dewey naturalistische Pädagogik. Argumentationskontexte, Traditionslinien. Paderborn u.a.: Schöningh 2007. 215 S., EUR 28,00. Fritz Bohnsack: John Dewey. Ein pädagogisches Portrait. Weinheim/Basel: Beltz 2005. 137 S., EUR 14,90. Martin Hartmann: Die Kreativität der Gewohnheit. Grundzüge einer pragmatistischen Demokratietheorie: Frankfurt a.M./New York: Campus 2003. 338 S., EUR 34,90. Klaus Prange (Hrsg.): Herbart und Dewey. Pädagogische Paradigmen im Vergleich. Jena: IKS Edition Paideia 2006. 165 S., EUR 19,80. Douglas J. Simpson: John Dewey. New York u.a.: Peter Lang Primer 2006. 159 S., EUR 16,80. Robert Wentz: Demokratie am Scheideweg. Die Aktualität der Sozialphilosophie John Deweys für eine kritische Gesellschaftstheorie. Berlin: wvb 2006. 228 S., EUR 27,00. [Sammelrezension

    OpenAIRE

    Brumlik, Micha

    2008-01-01

    Sammelrezension zu: Johannes Bellmann: John Dewey naturalistische Pädagogik. Argumentationskontexte, Traditionslinien. Paderborn u.a.: Schöningh 2007. 215 S., EUR 28,00. Fritz Bohnsack: John Dewey. Ein pädagogisches Portrait. Weinheim/Basel: Beltz 2005. 137 S., EUR 14,90. Martin Hartmann: Die Kreativität der Gewohnheit. Grundzüge einer pragmatistischen Demokratietheorie: Frankfurt a.M./New York: Campus 2003. 338 S., EUR 34,90. Klaus Prange (Hrsg.): Herbart und Dewey. Pädagogische Paradigmen i...

  9. 47 CFR 73.215 - Contour protection for short-spaced assignments.

    Science.gov (United States)

    2010-10-01

    ... station pursuant to 47 CFR 73.211(b)(3): 6 kW ERP/240 meters HAAT—Class A 25 kW ERP/150 meters HAAT—Class B1 50 kW ERP/472 meters HAAT—Class B (b) Applicants requesting short-spaced assignments pursuant to... achieved: (1) The ERP and antenna HAAT of the proposed station in the direction of the contours of...

  10. 48 CFR 52.215-1 - Instructions to Offerors-Competitive Acquisition.

    Science.gov (United States)

    2010-10-01

    ... its proposal. In writing, writing, or written means any worded or numbered expression that can be read... installation, or oral testimony or statements of Government personnel. (iv) If an emergency or unanticipated... before award. Oral proposals in response to oral solicitations may be withdrawn orally. If...

  11. PS2-15: Coding for Obesity in a Health Plan Claims Database

    OpenAIRE

    Shainline, Michael; Carter, Shelley; Von Worley, Ann; Gunter, Margaret

    2010-01-01

    Background and Aims: The Centers for Disease Control estimated the obesity rate in New Mexico for 2008 to be 25.2%. Sources estimate the following associations between obesity and type 2 diabetes (80%); cardiovascular disease (70%); hypertension (26 %). Yet obesity is infrequently coded as a secondary diagnosis among providers submitting claims. This study examines the frequency with which obesity is documented on claims forms, the relationship between age, gender, and obesity coding, and the...

  12. Towards the ictalurid catfish transcriptome: generation and analysis of 31,215 catfish ESTs

    OpenAIRE

    Dunham Rex; Muir William; Liu Lei; Turan Cemal; Simmons Micah; Serapion Jerry; Somridhivej Benjaporn; Nandi Samiran; Kucuktas Huseyin; Xu Peng; Baoprasertkul Puttharat; He Chongbo; Feng Jinian; Wang Shaolin; Peatman Eric

    2007-01-01

    Abstract Background EST sequencing is one of the most efficient means for gene discovery and molecular marker development, and can be additionally utilized in both comparative genome analysis and evaluation of gene duplications. While much progress has been made in catfish genomics, large-scale EST resources have been lacking. The objectives of this project were to construct primary cDNA libraries, to conduct initial EST sequencing to generate catfish EST resources, and to obtain baseline inf...

  13. 48 CFR 52.215-15 - Pension adjustments and asset reversions.

    Science.gov (United States)

    2010-10-01

    ... CAS, the amount measured, assigned, and allocated in accordance with 48 CFR 9904.413-50(c)(12), except the numerator of the fraction at 48 CFR 9904.413-50(c)(12)(vi) shall be the sum of the pension plan... regulations (48 CFR Chapter 99), the amount measured, assigned, and allocated in accordance with 48 CFR...

  14. 21 CFR 1404.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-04-01

    ... individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et seq., those benefits are not...

  15. 29 CFR 98.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-07-01

    ... responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the...

  16. 31 CFR 19.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-07-01

    ... entitlement without regard to the individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et...

  17. 5 CFR 919.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-01-01

    ... an individual as a personal entitlement without regard to the individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social...

  18. 2 CFR 180.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-01-01

    ... individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et seq., those benefits are not...

  19. 7 CFR 3017.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-01-01

    ... responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the...

  20. 41 CFR 105-68.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-07-01

    ... an individual as a personal entitlement without regard to the individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social...

  1. 34 CFR 85.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-07-01

    ... individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security...: E.O. 12549 (3 CFR, 1986 Comp., p. 189); E.O 12689 (3 CFR, 1989 Comp., p. 235); 20 U.S.C. 1082,...

  2. 29 CFR 1471.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-07-01

    ... entitlement without regard to the individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et...

  3. Basic Chemical Precipitation Softening. Training Module 2.215.2.77.

    Science.gov (United States)

    McMullen, L. D.

    This document is an instructional module package prepared in objective form for use by an instructor familiar with chemical precipitation softening. Included are objectives, an instructor guide, student handouts and transparency masters. This is the first level of a three module series and is designed for students with little or no operating…

  4. 22 CFR 1006.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-04-01

    ... international organization; (3) An entity owned (in whole or in part) or controlled by a foreign government; or... or disaster. (e) A permit, license, certificate, or similar instrument issued as a means to...

  5. 22 CFR 1508.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-04-01

    ... international organization; (3) An entity owned (in whole or in part) or controlled by a foreign government; or... emergency or disaster. (e) A permit, license, certificate, or similar instrument issued as a means...

  6. 22 CFR 208.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-04-01

    ... individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et seq., those benefits are not...

  7. 48 CFR 1552.215-72 - Instructions for the Preparation of Proposals.

    Science.gov (United States)

    2010-10-01

    ... to reflect the Government's estimate of the offeror's probable costs. Any inconsistency, whether real... include the effective date of the base rates and the policy on salary reviews (e.g. anniversary date of employee or salary reviews for all employees on a specific date). (vi) State whether any additional...

  8. Self-biased 215 MHz magnetoelectric NEMS resonator for ultra-sensitive DC magnetic field detection.

    Science.gov (United States)

    Nan, Tianxiang; Hui, Yu; Rinaldi, Matteo; Sun, Nian X

    2013-01-01

    High sensitivity magnetoelectric sensors with their electromechanical resonance frequencies DC magnetic fields. This magnetoelectric NEMS resonator showed a high quality factor of 735, and strong magnetoelectric coupling with a large voltage tunable sensitivity. The admittance of the magnetoelectric NEMS resonator was very sensitive to DC magnetic fields at its electromechanical resonance, which led to a new detection mechanism for ultra-sensitive self-biased RF NEMS magnetoelectric sensor with a low limit of detection of DC magnetic fields of ~300 picoTelsa. The magnetic/piezoelectric heterostructure based RF NEMS magnetoelectric sensor is compact, power efficient and readily integrated with CMOS technology, which represents a new class of ultra-sensitive magnetometers for DC and low frequency AC magnetic fields. PMID:23760520

  9. 40 CFR 92.215 - Maintenance of records; submittal of information; right of entry.

    Science.gov (United States)

    2010-07-01

    ... procedures, and to verify correlation or calibration of test equipment; (ii) To inspect and make copies of..., copying, interpretation and translation services, the making available on request of personnel of...

  10. 14 CFR 1274.215 - Federal and federally funded construction projects.

    Science.gov (United States)

    2010-01-01

    ... Administrator for Procurement may exempt a construction project from this policy if, as of February 17, 2001— (1... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Federal and federally funded construction... construction projects. (a) In accordance with E.O. 13202 of February 17, 2001, “Preservation of...

  11. 48 CFR 2052.215-79 - Contract award and evaluation of proposals.

    Science.gov (United States)

    2010-10-01

    ... specified in paragraph * below. These factors are listed in their relative order of importance. (b) The... completeness, reasonableness, and as a measure of effective management of the effort. * To be incorporated into... risk to the Government. (i) If a cost realism analysis is performed, cost realism may be considered...

  12. TRANSX-2.15, Neutron Gamma Particle Transport Tables from MATXS Format Cross-Sections

    International Nuclear Information System (INIS)

    1 - Description of program or function: TRANSX is a computer code that reads nuclear data from a library in MATXS format and produces transport tables compatible with many discrete-ordinates (SN) and diffusion codes. Tables can be produced for neutron, photon, charged-particle, or coupled transport. Options include adjoint tables, mixtures, homogeneous or heterogeneous self-shielding, group collapse, homogenization, thermal up-scatter, prompt or steady-state fission, transport corrections, elastic removal corrections, and flexible response function edits. 2 - Method of solution: TRANSX reads through the materials in a MATXS library and accumulates the cross sections into a transport table using the user's mix instructions. At the same time, response function edit cross sections are accumulated using the user's edit instructions. They can thus be any linear combination of the cross sections available in the library. When the table is complete, it is written out in the desired format. Output options include DTF-style card images, FIDO, ISOTXS, and the binary group-ordered GOXS format. Self-shielding is handled using the background cross section method. Heterogeneity options include homogeneous mixtures, escape using mean chord, lattices of cylinders by the Bell or Sauer approximations, and reflected or periodic slab cell by the bell or E3 approximations. 3 - Restrictions on the complexity of the problem: Only narrow- resonance self-shielding is available in this version. This may affect accuracy for thermal problems

  13. 48 CFR 215.407-5-70 - Disclosure, maintenance, and review requirements.

    Science.gov (United States)

    2010-10-01

    ..., apply the disclosure, maintenance, and review requirements to large business contractors meeting the..., maintenance, and review requirements to large business contractors under paragraph (b)(2)(ii) of this... systems, where appropriate; (xii) Requires management review including verification that the...

  14. Synthesis and NMR characterization of (15N)taurine [2-(15N)aminoethanesulfonic acid

    International Nuclear Information System (INIS)

    The title compound was prepared in three steps with 55% overall yield starting from potassium (15N)phthalimide. The synthetic route involved reaction with 1,2-dibromoethane, hydrolysis of the resulting N-(2-bromoethyl) (15N)phthalimide with HBr and treatment of the 2-bromoethyl(15N)amine thus formed with sodium sulphite. The product was characterized by 13C, 1H and 15N NMR spectroscopy. The absolute coupling constants of 15N with the 13C nuclei and the non-exchanging protons were determined and an unambiguous assignment of the proton signals obtained. (author)

  15. 24 CFR 598.215 - What are the purpose and content of the strategic plan?

    Science.gov (United States)

    2010-04-01

    ... segments of the community, including the political and governmental leadership, community groups, local..., technical, human, cultural, educational, leadership, volunteerism, communications, transportation and..., Environmental Cleanup Cost Deduction (i.e., “Brownfields Tax Incentive”), and the Work Opportunity Tax...

  16. 40 CFR 94.215 - Maintenance of records; submittal of information; right of entry.

    Science.gov (United States)

    2010-07-01

    ... family for which the manufacturer fails to retain the records required in this section or to provide such... material not translated into the English language need not be submitted unless specifically requested by... influence exhaust emissions will be representative of production engines and that either: all components...

  17. 29 CFR 215.3 - Employees represented by a labor organization.

    Science.gov (United States)

    2010-07-01

    ... to a state administrative agency or designated recipient that will pass assistance through to subrecipients, the Department will refer and process each subrecipient's respective portion of the project in accordance with this section. If a state administrative agency or designated recipient has...

  18. 31 CFR 215.3 - Procedures for entering into a Withholding Agreement.

    Science.gov (United States)

    2010-07-01

    ... Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE WITHHOLDING OF..., Federal Finance, Financial Management Service, Department of the Treasury, 401 14th Street, SW... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Procedures for entering into...

  19. 48 CFR 1552.215-73 - General financial and organizational information.

    Science.gov (United States)

    2010-10-01

    ... Number: (d) Individual(s) to contact re. this proposal: (e) Cognizant Government: Audit Agency: Address...-reimbursement type prime contracts and subcontracts $____ Government fixed-price prime contracts and... prime contracts, subcontractors under Government prime contracts, and modifications (except when...

  20. 7 CFR 215.13a - Determining eligibility for free milk in child-care institutions.

    Science.gov (United States)

    2010-01-01

    ... to prevent the overt identification of children receiving free milk. (4) A hearing procedure... at or below 185 percent of the Federal poverty level); or (iv) A third party contractor assisting in... 7 Agriculture 4 2010-01-01 2010-01-01 false Determining eligibility for free milk in...

  1. 48 CFR 2052.215-78 - Travel approvals and reimbursement-Alternate 1.

    Science.gov (United States)

    2010-10-01

    ... expenditure for travel may not exceed ___ * ___ without the prior approval of the contracting officer. (b) All... institutional policy to the degree that the limitations of Office of Management and Budget (OMB) guidance are... Local Governments; OMB Circular A-122, Cost Principles for Nonprofit Organizations; and OMB Circular...

  2. 32 CFR 215.9 - Providing military resources to civil authorities.

    Science.gov (United States)

    2010-07-01

    ... renewal of outstanding loans, may be denied at any level in the chain of command down to and including... the General Counsel of the DoD, the Assistant Secretary of Defense (Installations and Logistics), and... the handling of requests for DoD facilities, personnel, equipment, or supplies, received...

  3. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (215-0611-272217)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  4. SU-E-T-215: Interactive Dose Shaping: Proof of Concept Study for Six Prostate Patients

    International Nuclear Information System (INIS)

    Purpose: To provide a proof of concept study for IMRT treatment planning through interactive dose shaping (IDS) by utilising the respective tools to create IMRT treatment plans for six prostate patients. Methods: The IDS planning paradigm aims to perform interactive local dose adaptations of an IMRT plan without compromising already established valuable dose features in real-time. Various IDS tools are available in our in-house treatment planning software Dynaplan and were utilised to create IMRT treatment plans for six patients with an adeno-carcinoma of the prostate. The sequenced IDS treatment plans were compared to conventionally optimised clinically approved plans (9 beams, co-planar). The starting point consisted of open fields. The IDS tools were utilised to sculpt dose out of the rectum and bladder. For each patient, several IDS plans were created, with different trade-offs between organ sparing and target coverage. The reference dose distributions were imported into Dynaplan. For each patient, the IDS treatment plan with a similar or better trade-off between target coverage and OAR sparing was selected for plan evaluation, guided by a physician. Pencil beam dose calculation was performed on a grid with a voxel size of 1.95×1.95×2.0 mm3. D98%, D2%, mean dose and dose-volume indicators as specified by Quantec were calculated for plan evaluation. Results: It was possible to utilise the software prototype to generate treatment plans for prostate patient geometries in 15–45 minutes. Individual local dose adaptations could be performed in less than one second. The average differences compared to the reference plans were for the mean dose: 0.0 Gy (boost) and 1.2 Gy (CTV), for D98%: −1.1 Gy and for D2%: 1.1 Gy (both target volumes). The dose-volume quality indicators were well below the Quantec constraints. Conclusion: Real-time treatment planning utilising IDS is feasible and has the potential to be implemented clinically. Research at The Institute of Cancer Research is supported by Cancer Research UK under Programme C46/A10588

  5. XTACC3-XMAP215 association reveals an asymmetric interaction promoting microtubule elongation

    DEFF Research Database (Denmark)

    Mortuza, Gulnahar B.; Cavazza, Tommaso; Garcia-Mayoral, Maria Flor;

    2014-01-01

    chTOG is a conserved microtubule polymerase that catalyses the addition of tubulin dimers to promote microtubule growth. chTOG interacts with TACC3, a member of the transforming acidic coiled-coil (TACC) family. Here we analyse their association using the Xenopus homologues, XTACC3 (TACC3) and XM...

  6. 42 CFR 405.215 - Confidential commercial and trade secret information.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Confidential commercial and trade secret... trade secret information. To the extent that CMS relies on confidential commercial or trade secret... with Federal law....

  7. Shelf-Life of ɛ-Lysyl-3-(Trimethylstannyl)Benzamide Immunoconjugates, Precursors for 211At Labeling of Antibodies

    OpenAIRE

    Aneheim, Emma; Halleröd, Jenny; Albertsson, Per; Jensen, Holger; Holgersson, Stellan; Lindegren, Sture

    2015-01-01

    Astatine-211 is possibly the most promising radionuclide for targeted α-particle therapy when it comes to the treatment of occult disseminated cancer. Preclinical research has proven effective, and patient studies have been initiated based on these results. However, a lack of production capacity and the complex radiochemistry of 211At are major obstacles for research and prospective clinical applications. In the present study, astatination of immunoconjugates, already prepared well in advance...

  8. 48 CFR 1452.215-71 - Use and Disclosure of Proposal Information-Department of the Interior.

    Science.gov (United States)

    2010-10-01

    ...) “Trade Secret” means an unpatented, secret, commercially valuable plan, appliance, formula, or process... trade commodities. (2) “Confidential commercial or financial information” means any business information... Information Act, 5 U.S.C. 552. Exemptions from mandatory disclosure which may be applicable to...

  9. The Arizona Radio Observatory 1 mm Spectral Survey of IRC (plus)10216 and VY Canis Majoris (215-285 GHz)

    Science.gov (United States)

    Tenenbaum, E. D.; Dodd, J. L.; Milam, S. N.; Woolf, N. J.; Ziurys, L. M.

    2010-01-01

    A low noise (1(sigma) rms approx. 3 mK) 1. nun spectral survey (214.5-285.5 GHz) of the oxygen-rich supergiant VY Canis Majoris and the carbon-rich asymptotic giant branch star IRC +10216 has been conducted using the Arizona Radio Observatory's 10 m Submillimeter Telescope. Here the complete data set is presented. This study, carried out with a new ALMA-type receiver, marks the first continuous band scan of an O-rich circumstellar envelope, and the most sensitive survey to date of IRC +10216. In VY CMa, 130 distinct molecular lines were detected, 14 of which cannot be identified; in IRC +10216, 717 lines were observed, with 126 features remaining unidentified. In the 1 mm bands of VY CMa and IRC +10216, emission is present from 18 and 32 different chemical compounds, respectively, with 10 species common to both sources. Many narrow emission lines were observed in both circumstellar shells, arising from vibrationally excited molecules and from refractory-containing species. Line profiles in VY CMa also exhibit a variety of different shapes, caused by the complex, asymmetric outflow of this object. The survey highlights the fact that C-rich and O-rich circumstellar envelopes are chemically interesting, and both are sources of new interstellar molecules. The high number of unidentified lines and the unreliable, rest frequencies for known species such as NaCN indicate the need for additional laboratory spectroscopy studies.

  10. 20 CFR 645.215 - What must a WtW operating entity that serves noncustodial parent participants do?

    Science.gov (United States)

    2010-04-01

    ... and children who may be at risk of domestic violence, the operating entity must consult with domestic violence prevention and intervention organizations in the development of its WtW project serving... that good cause exists to extend this period. This extension may not extend to a date more than...

  11. “Remotion” Total Wrist Arthroplasty: Preliminary Results of a Prospective International Multicenter Study of 215 Cases

    DEFF Research Database (Denmark)

    Herzberg, Guillaume; Boeckstyns, Michel Ernest Henri; Sorensen, Allan Ibsen;

    2012-01-01

    This study reports the current results of an international multicenter study of one last generation total wrist arthroplasty (TWA) ("ReMotion," Small Bone Innovation, Morristown, PA). The two first authors (G.H. and M.B.) built a Web-based prospective database including clinical and radiological ...

  12. Regional cerebral blood flow during light sleep--a H(2)(15)O-PET study

    DEFF Research Database (Denmark)

    Kjaer, Troels W; Law, Ian; Wiltschiøtz, Gordon;

    2002-01-01

    there was a relative flow increase in the occipital lobes and a relative flow decrease in the bilateral cerebellum, thebilateral posterior parietal cortex, the right premotor cortex and the left thalamus. Hypnagogic experiences seemed not to be associated with any relative flow changes. The topography...... of the occipital activation during stage-1 sleep supports a hypothesis of this state being a state of imagery. The rCBF decreases in premotor cortex, thalamus and cerebellum could be indicative of a general decline in preparedness for goal directed action during stage-1 sleep. Stage-1 sleep seems...

  13. Oahu Hyperspectral Imagery 2000 (215-0611-332211) - Visual Interpretation from Remote Sensing Imagery Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...

  14. SU-E-J-215: Onboard Split PET Including the Effects of Attenuation, Scatter, and Random Events

    International Nuclear Information System (INIS)

    Purpose: Positron emission tomography (PET) using split PET geometry was investigated as an on-board system for functional imaging and PET marker tracking, specifically with tomotherapy. The open dual ring PET would allow measurement of both inter and intra-fractional variation, improving the delineation of tumor volume at any stage in the radiation treatment delivery process. We present results from data obtained using Monte Carlo simulations including the effects of attenuation, random events, and scatter. Methods: PET design was accomplished via Monte Carlo simulations with GATE, the Geant4 Application for Emission Tomography. Images were reconstructed using Software for Image Reconstruction (STIR) with a fully 3D ordered subset expectation maximization (OSEM) image reconstruction technique. Results: Monte Carlo simulations of the split PET geometry indicate that including physical factors that degrade image quality such as attenuation, random events, and scatter still prove the feasibility of near real-time PET for both inter and intra-fractional radiation delivery. The image quality of scan times under 1 minute reveals that it is possible to utilize PET scanning and reconstruction during the treatment session intrafractionally. GATE also simulates the depth information but does not correct obliqueness of the path of line of response so the data is much more realistic than the data obtained with ray tracing. Conclusion: Onboard split PET with TomoTherapy can generate quality images under 1 minute scan times without the need to correct for attenuation, scatter, random events, or depth information of the interaction

  15. 8 CFR 215.8 - Requirements for biometric identifiers from aliens on departure from the United States.

    Science.gov (United States)

    2010-01-01

    ... attendants, servants, or personal employees of accredited officials), G-1, G-2, G-3, G-4, NATO-1, NATO-2, NATO-3, NATO-4, NATO-5, or NATO-6 visas, and certain Taiwan officials who hold E-1 visas and members...

  16. Structure and torsional dynamics of the water octamer from THz laser spectroscopy near 215 μm.

    Science.gov (United States)

    Cole, William T S; Farrell, James D; Wales, David J; Saykally, Richard J

    2016-06-01

    Clusters of eight water molecules play an important role in theoretical analysis of aqueous structure and dynamics but have proven to be challenging experimental targets. Here we report the high-resolution spectroscopic characterization of the water octamer. Terahertz (THz) vibration-rotation-tunneling (VRT) spectroscopy resolved 99 transitions with 1 part per million precision in a narrow range near 46.5 wave numbers, which were assigned to the h16 octamer via detailed isotope dilution experiments. Fitting to a semi-rigid symmetric top model supports predictions of two coexisting cuboidal structures and provides precise values for the changes in their rotational constants. Comparison with theory and previous spectroscopic data provides a characterization of the two structures and the observed torsional vibration and supports the prediction that the D2d symmetry structure is lower in energy than the S4 isomer. PMID:27257252

  17. 12 CFR 215.9 - Disclosure of credit from member banks to executive officers and principal shareholders.

    Science.gov (United States)

    2010-01-01

    ... individual for the purposes of determining principal shareholder status. (2) Related interest means: (i) Any... definitions apply: (1) Principal shareholder of a member bank means any person other than an insured bank, or... includes a person that controls a principal shareholder (e.g., a person that controls a bank...

  18. 16 CFR 2.15 - Orders requiring witnesses to testify or provide other information and granting immunity.

    Science.gov (United States)

    2010-01-01

    ... Bureaus of Competition and Economics, the Bureau Director, Deputy Directors and Associate Directors of the... essential to serve the interests of justice. Such appeals shall be made on the record and shall be in...

  19. 19 Urban Questions: Teaching in the City. Second Edition. Counterpoints: Studies in Postmodern Theory of Education, Vol. 215

    Science.gov (United States)

    Steinberg, Shirley R., Ed

    2010-01-01

    The second edition of "19 Urban Questions: Teaching in the City" adds new questions to those in the original volume. Continuing the developing conversation in urban education, the book is provocative in style and rich in detail. Emphasizing the complexity of urban education, Shirley R. Steinberg and the authors ask direct questions about what…

  20. Oahu Hyperspectral Imagery 2000 (215-0611-272217) - Visual Interpretation from Remote Sensing Imagery Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...

  1. U.S. comments on co-chairmen WG.2/15, chapter 7-A assurance of supply

    International Nuclear Information System (INIS)

    The U.S. delegation proposes revision in chapter 7 regarding assurance of supply, to reflect that alternative suppliers now exist to provide an assured supply, and that for most countries national enrichment facilities would not be practical or economic. The paper also argues that the spread of national facilities could increase proliferation risks. The revised text also argues that, because enrichment is highly capital-intensive, consumers should not expect significant surplus capacity at any given time, and should not interpret the absence of surplus capacity as an indication of lack of assurance in supply. Options which increase a consumer's flexibility in meeting enrichment needs are reviewed

  2. NOAA GeoTIFF - 9m Multibeam Bathymetry (Sun Illuminated - Azimuth 215 degrees), Puerto Rico (Tourmaline Bank) - Project NF-08-04, UTM 19N NAD83

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This georeferenced RGB image represents 9 meter resolution bathymetry of a selected portion of seafloor around Tourmaline Bank, Puerto Rico. This image is also...

  3. Differentiation of peptide molecular recognition by phospholipase C gamma-1 Src homology-2 domain and a mutant Tyr phosphatase PTP1bC215S.

    OpenAIRE

    Maclean, D; Sefler, A. M.; Zhu, G.; Decker, S J; Saltiel, A R; J. Singh; McNamara, D.; Dobrusin, E M; Sawyer, T K

    1995-01-01

    Activated epidermal growth factor receptor (EGFR) undergoes autophosphorylation on several cytoplasmic tyrosine residues, which may then associate with the src homology-2 (SH2) domains of effector proteins such as phospholipase C gamma-1 (PLC gamma-1). Specific phosphotyrosine (pTyr)-modified EGFR fragment peptides can inhibit this intermolecular binding between activated EGFR and a tandem amino- and carboxy-terminal (N/C) SH2 protein construct derived from PLC gamma-1. In this study, we furt...

  4. Systemic Delivery of Small Interfering RNA Targeting the Interleukin-2/15 Receptor β Chain Prevents Disease Progression in Experimental Arthritis

    OpenAIRE

    Tiantian Zhang; Xuehua Bai; Xiaohua Mao

    2013-01-01

    The role of interleukin (IL)-15 in the pathogenesis of rheumatoid arthritis (RA) is well established; however, systemic knockdown of IL-15 receptor (IL-15R) for reduction in inflammation at local sites has not been demonstrated. In this study, the therapeutic effect of intravenously administered siRNA targeting the β chain of IL-15R which is shared by the receptor for IL-2 was examined in rats with adjuvant-induced arthritis (AA). Polyethylenimine (PEI)-complexed siRNA nanoparticles could eas...

  5. The plant cytoskeleton: recent advances in the study of the plant microtubule-associated proteins MAP-65, MAP-190 and the Xenopus MAP215-like protein, MOR1.

    Science.gov (United States)

    Hussey, Patrick J; Hawkins, Timothy J; Igarashi, Hisako; Kaloriti, Despina; Smertenko, Andrei

    2002-12-01

    The microtubule cytoskeleton is a dynamic filamentous structure involved in many key processes in plant cell morphogenesis including nuclear and cell division, deposition of cell wall, cell expansion, organelle movement and secretion. The principal microtubule protein is tubulin, which associates to form the wall of the tubule. In addition, various associated proteins bind microtubules either to anchor, cross-link or regulate the microtubule network within cells. Biochemical, molecular biological and genetic approaches are being successfully used to identify these microtubule-associated proteins (MAPs) in plants, and we describe recent progress on three of these proteins. PMID:12516862

  6. 77 FR 20408 - [FWS-R9-MB-2011-N215; 91400-5110-0000-7B; 91400-9410-0000-7B

    Science.gov (United States)

    2012-04-04

    ... nongovernmental organizations that represent conservation organizations, sportsmen's and women's organizations... Partnerships to Increase Board. Capacity. 12-021........ Trailblazer Adventure U.S. Sportsman 40,000.00...

  7. SOLVENT HOLD TANK SAMPLE RESULTS FOR MCU-14-135/136 AND MCU-14-214/215/216: FEBRUARY AND MARCH 2014 MONTHLY SAMPLES

    Energy Technology Data Exchange (ETDEWEB)

    Fondeur, F.; Taylor-Pashow, K.

    2014-06-30

    SRNL received two sets of SHT samples (MCU-14-135-136 in February 2014 and MCU-14-214-216 in March 2014) for analysis. The samples were analyzed for composition. As with the previous solvent sample results, these analyses indicate that the solvent does not require Isopar® L trimming at this time. However, the addition of TiDG (suppressor) to the blended solvent is recommended. Evidence of possible (slight) isomerization of the solvent, probably Isopar®L or TiDG degradation products, was observed.

  8. Immunohistochemical changes in the expression of HSP27 in exercised human vastus lateralis muscle”. Acta Physiologica (Oxf). 194(3): 215-22, 2008

    DEFF Research Database (Denmark)

    Folkesson, Mattias; Mackey, A L; Holm, Lars;

    2008-01-01

    27 protein in muscle fibres from five of nine subjects. The number of fibres with accumulation of HSP27 in RE ranged from 0% to 32% with a mean of 6.3% of the total number of fibres. CONCLUSION: We conclude that this rapid HSP27 protein relocation after RE is an important player in the cellular...... remodelling of human muscle fibres in response to exercise involving high-force contractions, but not in response to endurance exercises....

  9. Comparative Spectra of Oxygen-Rich Versus Carbon-Rich Circumstellar Shells: VY Canis Majoris and IRC(plus)10216 at 215-285 GHz

    Science.gov (United States)

    Tenebaum, E. D.; Dodd, J. L.; Milam, S. N.; Woolf, N. J.; Ziurys, L. M.

    2010-01-01

    A sensitive (1sigma rms at 1 MHz resolution approx.3 mK) 1 mm spectral line survey (214.5-285.5 GHz) of VY Canis Majoris (VY CMa) and IRC +10216 has been conducted to compare the chemistries of oxygen- and carbon-rich circumstellar envelopes. This study was carried out using the Submillimeter Telescope of the Arizona Radio Observatory with a new Atacama Large Millimeter Array type receiver. This survey is the first to chemically characterize an O-rich circumstellar shell at millimeter wavelengths. In VY CMa, 128 emission features were detected arising from 18 different molecules; and in IRC +10216, 720 lines were observed, assigned to 32 different species. The 1 mm spectrum of VY CMa is dominated by SO, and SiS; in IRC +10216, C4H and SiC2 are the most recurrent species. Ten molecules were common to both sources: CO, SiS, SiO, CS, CN, HCN, HNC, NaCl, PN, and HCO(+). Sulfur plays an important role in VY CMa, but saturated/ unsaturated carbon dominates the molecular content of IRC +102.16, producing CH2NH, for example. Although the molecular complexity of IRC +10216 is greater, VY CMa supports a unique "inorganic" chemistry leading to the oxides PO, AlO, and AlOH. Only diatomic and triatomic compounds were observed in VY CMa, while species with four or more atoms are common in IRC +10216, reflecting carbon's ability to form multiple strong bonds, unlike oxygen. In VY CMa, a new water maser (v2 = 2) has been found, as well as vibrationally excited NaCl. Toward IRC +10216, vibrationally excited CCH was detected for the first time.

  10. SU-E-J-215: Towards MR-Only Image Guided Identification of Calcifications and Brachytherapy Seeds: Application to Prostate and Breast LDR Implant Dosimetry

    International Nuclear Information System (INIS)

    Purpose: To identify and analyze the appearance of calcifications and brachytherapy seeds on magnitude and phase MRI images and to investigate whether they can be distinguished from each other on corrected phase images for application to prostate and breast low dose rate (LDR) implant dosimetry. Methods: An agar-based gel phantom containing two LDR brachytherapy seeds (Advantage Pd-103, IsoAid, 0.8mm diameter, 4.5mm length) and two spherical calcifications (large: 7mm diameter and small: 4mm diameter) was constructed and imaged on a 3T Philips MR scanner using a 16-channel head coil and a susceptibility weighted imaging (SWI) sequence (2mm slices, 320mm FOV, TR/ TE= 26.5/5.3ms, 15 degree flip angle). The phase images were unwrapped and corrected using a 32×32, 2D Hanning high pass filter to remove background phase noise. Appearance of the seeds and calcifications was assessed visually and quantitatively using Osirix (http://www.osirix-viewer.com/). Results: As expected, calcifications and brachytherapy seeds appeared dark (hypointense) relative to the surrounding gel on the magnitude MRI images. The diameter of each seed without the surrounding artifact was measured to be 0.1 cm on the magnitude image, while diameters of 0.79 and 0.37 cm were measured for the larger and smaller calcifications, respectively. On the corrected phase images, the brachytherapy seeds and the calcifications appeared bright (hyperintense). The diameter of the seeds was larger on the phase images (0.17 cm) likely due to the dipole effect. Conclusion: MRI has the best soft tissue contrast for accurate organ delineation leading to most accurate implant dosimetry. This work demonstrated that phase images can potentially be useful in identifying brachytherapy seeds and calcifications in the prostate and breast due to their bright appearance, which helps in their visualization and quantification for accurate dosimetry using MR-only. Future work includes optimizing phase filters to best identify and delineate seeds and calcifications

  11. 47 CFR 68.215 - Installation of other than “fully protected” system premises wiring that serves more than four...

    Science.gov (United States)

    2010-10-01

    ... supervisor's full name, business address and business telephone number. (2) The name of the registrant(s) (or...) when placement and connection of the wiring will take place. (5) The business affiliation of the... instrument may be associated directly or indirectly with the line or loop to perform this test if one is...

  12. Extension of the Liège Intranuclear Cascade Model to the 2-15 GeV Incident Energy Range

    OpenAIRE

    Pedoux, Sophie

    2011-01-01

    The Liège Intra-Nuclear Cascade model (INCL4) has been shown to be quite successful for the description of spallation reactions. However its validity domain is limited to an upper incident energy of ~2 GeV, because inelastic elementary processes are restricted to the excitation and de-excitation of the Delta resonance. In this thesis, the INCL4 model is extended to higher incident energy. This is realised by including other inelastic elementary collisions, direct multipion production in ele...

  13. Influence of channeling on scattering of 2-15 GeV/c protons, π+, and π- incident on Si and Ge crystals

    International Nuclear Information System (INIS)

    The channeling effect has a dramatic influence on scattering phenomena for GeV particles. Multiple scattering for positive particles is strongly reduced for incident directions close to the crystal axes and planes, resulting in a very high transmitivity along such directions, whereas negative particles experience increased multiple scattering along these directions. Correlated scattering from the atoms in atomic rows results in ring-shaped intensity distributions ('dough-nuts') on the exit side which exist even for incident angles far beyond the critical angle for channeling. For such angles, we find a strongly increased multiple scattering for both positive and negative particles. The yield from close-encounter processes such as wide-angle scattering and nuclear reactions is reduced to below 10% of normal yield for positive, channeled particles, whereas the yield is increased for negative particles. The measured dechanneling is found to be small even for a 4 mm thick Ge crystal. These results seem to agree fairly well with theoretical calculations based on a diffusion model. Computer calculations from a binary-collision model are in good agreement with experimental results. Also, blocking effects are measured and agree fairly well with the dips obtained for close-encounter processes. (orig.)

  14. Comparative Spectra of Oxygen-Rich vs. Carbon-Rich Circumstellar Shells: VY Canis Majoris and IRC+10216 at 215-285 GHz

    CERN Document Server

    Tenenbaum, E D; Milam, S N; Woolf, N J; Ziurys, L M

    2010-01-01

    A sensitive (1{\\sigma} rms at 1 MHz resolution ~3 mK) 1 mm spectral line survey (214.5-285.5 GHz) of VY Canis Majoris (VY CMa) and IRC+10216 has been conducted to compare the chemistries of oxygen and carbon-rich circumstellar envelopes. This study was carried out using the Submillimeter Telescope (SMT) of the Arizona Radio Observatory (ARO) with a new ALMA-type receiver. This survey is the first to chemically characterize an O-rich circumstellar shell at millimeter wavelengths. In VY CMa, 128 emission features were detected arising from 18 different molecules, and in IRC+10216, 720 lines were observed, assigned to 32 different species. The 1 mm spectrum of VY CMa is dominated by SO2 and SiS; in IRC +10216, C4H and SiC2 are the most recurrent species. Ten molecules were common to both sources: CO, SiS, SiO, CS, CN, HCN, HNC, NaCl, PN, and HCO+. Sulfur plays an important role in VY CMa, but saturated/unsaturated carbon dominates the molecular content of IRC+10216, producing CH2NH, for example. Although the mol...

  15. Paramêtros cinéticos do pico termoluminescente em 215ºC do espodumênio lilás

    OpenAIRE

    Oliveira, Raquel Aline Pessoa; Lima, Leonardo Lelis de; Lalic, Susana de Souza; Lima, Adilmo Francisco de

    2008-01-01

    O uso da termoluminescência (TL) na dosimetria da radiação ou da datação geológica requer o conhecimento das propriedades TL do material. Além dos cuidados necessários durante os experimentos, é de suma importância o conhecimento da forma da curva de emissão e da resposta em função da dose, conhecimento esse que pode ser apresentado na forma de modelo teórico capaz de prever resultados e também fornecer explicações no que tange a estrutura interna do material e tempo de vida do mesmo. E...

  16. Characterization of osteoclasts from patients harboring a G215R mutation in ClC-7 causing autosomal dominant osteopetrosis type II

    DEFF Research Database (Denmark)

    Henriksen, Kim; Gram, Jeppe; Schaller, Sophie;

    2004-01-01

    , the morphology, and the expression of markers, such as cathepsin K and tartrate-resistant acid phosphatase. When mature ADOII osteoclasts were investigated on mineralized bone, they degraded the bone material, however only to 10 to 20% of the level in controls. We show by acridine orange, that the...

  17. SU-E-J-215: Towards MR-Only Image Guided Identification of Calcifications and Brachytherapy Seeds: Application to Prostate and Breast LDR Implant Dosimetry

    Energy Technology Data Exchange (ETDEWEB)

    Elzibak, A; Fatemi-Ardekani, A; Soliman, A; Mashouf, S; Safigholi, H; Ravi, A; Morton, G; Song, WY [Sunnybrook Health Sciences Centre, University of Toronto, Toronto, Ontario (Canada); Han, D [Sunnybrook Health Sciences Centre, University of Toronto, Toronto, Ontario (Canada); University of California, San Diego, La Jolla, CA (United States)

    2015-06-15

    Purpose: To identify and analyze the appearance of calcifications and brachytherapy seeds on magnitude and phase MRI images and to investigate whether they can be distinguished from each other on corrected phase images for application to prostate and breast low dose rate (LDR) implant dosimetry. Methods: An agar-based gel phantom containing two LDR brachytherapy seeds (Advantage Pd-103, IsoAid, 0.8mm diameter, 4.5mm length) and two spherical calcifications (large: 7mm diameter and small: 4mm diameter) was constructed and imaged on a 3T Philips MR scanner using a 16-channel head coil and a susceptibility weighted imaging (SWI) sequence (2mm slices, 320mm FOV, TR/ TE= 26.5/5.3ms, 15 degree flip angle). The phase images were unwrapped and corrected using a 32×32, 2D Hanning high pass filter to remove background phase noise. Appearance of the seeds and calcifications was assessed visually and quantitatively using Osirix (http://www.osirix-viewer.com/). Results: As expected, calcifications and brachytherapy seeds appeared dark (hypointense) relative to the surrounding gel on the magnitude MRI images. The diameter of each seed without the surrounding artifact was measured to be 0.1 cm on the magnitude image, while diameters of 0.79 and 0.37 cm were measured for the larger and smaller calcifications, respectively. On the corrected phase images, the brachytherapy seeds and the calcifications appeared bright (hyperintense). The diameter of the seeds was larger on the phase images (0.17 cm) likely due to the dipole effect. Conclusion: MRI has the best soft tissue contrast for accurate organ delineation leading to most accurate implant dosimetry. This work demonstrated that phase images can potentially be useful in identifying brachytherapy seeds and calcifications in the prostate and breast due to their bright appearance, which helps in their visualization and quantification for accurate dosimetry using MR-only. Future work includes optimizing phase filters to best identify and delineate seeds and calcifications.

  18. 31 CFR 535.215 - Direction involving other properties in which Iran or an Iranian entity has an interest held by...

    Science.gov (United States)

    2010-07-01

    ... based upon the International Emergency Economic Powers Act. (b) Any properties subject to a valid... possessors of the properties were required to pay such costs by contract or applicable law on January...

  19. Shelf-life of ɛ-lysyl-3-(trimethylstannyl)benzamide immunoconjugates, precursors for 211At labeling of antibodies

    DEFF Research Database (Denmark)

    Aneheim, Emma; Halleröd, Jenny; Albertsson, Per;

    2015-01-01

    Astatine-211 is possibly the most promising radionuclide for targeted α-particle therapy when it comes to the treatment of occult disseminated cancer. Preclinical research has proven effective, and patient studies have been initiated based on these results. However, a lack of production capacity ...

  20. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  1. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    International Nuclear Information System (INIS)

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons

  2. Separation of 211At from irradiated bismuth target and labelling of a model protein

    International Nuclear Information System (INIS)

    Astatine-211 is a promising radionuclide for therapeutic use in nuclear medicine. An efficient method (70%) for radiochemical separation from the irradiated Bi-target has been described. The level of Bi contamination in the purified 2'11At-solution was estimated. Finally labelling of a model protein has been tried. (author). 14 refs

  3. Efeito da implantação de rodovias no cerrado brasileiro sobre a fauna de vertebrados - DOI: 10.4025/actascibiolsci.v28i3.215 Effect of the implantation of roads in the brazilian cerrado on the fauna of vertebrates - DOI: 10.4025/actascibiolsci.v28i3.215

    Directory of Open Access Journals (Sweden)

    Zara Faria Sobrinha Guimarães

    2007-11-01

    Full Text Available A fragmentação de hábitat causada pela ação humana vem sendo um dos grandes desafios para a biologia da conservação. A construção de estradas é um mecanismo de fragmentação de alto impacto, removendo a cobertura vegetal original, gerando efeito de borda e alterando a função e estrutura da paisagem, em contraste com a necessidade e o alto valor econômico imposto pela sociedade humana. Neste sentido, este estudo teve como objetivo avaliar o impacto da estrada na comunidade de fauna silvestre do Parque Altamiro de Moura Pacheco associada à presença da rodovia (BR-153/GO-060. Durante um ano de pesquisa, foram registrados 141 animais mortos por atropelamento. Os resultados do presente estudo, conduzido de Agosto/2003 a Julho/2004, foram comparados e analisados com estudo feito entre os anos de 1996 e 1997, tanto ao nível de carcaças encontradas quanto ao nível de ambiente. De acordo com os dados apresentados, reforça-se a necessidade de haver um melhor planejamento ao construir estradas, principalmente próximos a ambientes preservados ou unidades de conservação.The fragmentation of habitat caused by the action human being is comes one of the great challenges for the biology of the conservation. The construction of roads is a mechanism of the fragmentation of high impact, removing the original vegetablel covering, generating edge effect and modifying the function and structure of the landscape, in contrast with the necessity and the high economic value tax for the society human being. In this direction, this study it had as objective to evaluate the impact of the road in the community of wild fauna of the Park Altamiro de Moura Pacheco associated with the presence of the road (BR-153/GO-060. During one year of research, they had been registered 141 animals died for running over The results of the present study, lead of Agosto/2003 the Julho/2004, had been compared and analyzed with made study it enters the years of 1996 and 1997, as much the level of finded species how much the environment level. In accordance with the presented data, it is strengthened necessity to have one better planning when constructing roads, mainly next the preserved environments or units to conservation.

  4. Neutron Flux Depression in the UO{sub 2}-PuO{sub 2}(15 to 30%) Fuel Rods from IVO-FR2-Vg7-Irradiation Experiment; Depresion de flujo neutronico en las barras combustibles de UO2-PuO2(15 al 30%) del experimento de irradiacion IVO-FR2-Vg7

    Energy Technology Data Exchange (ETDEWEB)

    Lopez, J.; Fernandez, J. L.

    1983-07-01

    The thermal-neutron flux depression within a fuel rod has a great influence in the radial temperature profile of the rod, especially for high enrichment fuel. For this reason, a study was made about the UO{sub 2}-PUO{sub 2} (15 to 30% PUO{sub 2}) fuel pins for the KfK-JEN joint irradiation program IVO, in the FR2 reactor. Different methods (diffusion, Bonalumi, successive generations) were compared and a new approach (parabolic approximation) was developed. (Author) 22 refs.

  5. Hurdles for a Broader Use of 211At and for the Synthesis of 211At-Labelled Radiopharmaceuticals at High Activities for Clinical Use

    International Nuclear Information System (INIS)

    One of the key impediments to the use of 211At is the very well known deleterious effect of high radiation fields caused by its alpha particles on the synthesis of 211At-labelled radiopharmaceuticals. This is problematic because radiolysis-mediated effects can produce diminishing efficiency of electrophilic astatination reactions due to increasing deposition of radiation dose with increasing activities and with the passage of the time. Astatine-211 has chemical properties that permit complex labelling strategies and a longer half-life than 213Bi that makes it more suitable when the targeting molecule does not gain immediate access to the tumour cells. The first clinical evaluation was published in 2001 [2] in patients with brain tumour. Although this study circumvents many of the challenges to entering clinical studies with 211At and many obstacles had to be surmounted before clinical studies could be initiated, several problems were encountered in maintaining efficient labelling with escalating radiation dose of α-particle even with fresh 211At elution [3]. Astatine-211 also has an additional hurdle to overcome before to its clinical application in labelled radiopharmaceuticals related with its production and distribution. Among the potential group of promising α- emitter it is the only one produced by cyclotrons, but due to the scarcity of cyclotrons equipped with 25−30 MeV α-particle beams, it will of necessity be utilized in distant locations from the site of production. It presents a major chemical challenge because the diminishing efficiency of electrophilic astatination reactions with the passage of the time is well known, a problem likely related to the radiolysis produced by the high LET (linear energy transfer) meaning that large amounts of energy are deposited in a highly localized manner. This problem has been most comprehensively investigated to understand and evaluate the role of the radiolysis effects of astatine alpha particles in the synthesis

  6. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  7. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita

    2011-01-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  8. Radiopharmaceutical Chemistry of Targeted Radiopharmaceutics. Synthesis of 211At-Labeled Radiopharmaceuticals at High Activities for Clinical Use

    International Nuclear Information System (INIS)

    Targeted α-particle radiotherapy is an appealing approach to cancer treatment because of the potential for delivering curative doses of radiation to tumor with minimal damage to normal tissue due to a range equivalent to only a few cell diameters. Compared with β-emitters they have significant advantages from a radiobiological perspective. The LET of 211At α-particles is more than 400 times higher than the β-particles emitted by 90Y, in addition the distance between ionizing events is almost the same as that between the two strands of DNA, yielding a high probability of creating non-repairable DNA damage. It gives the ability to kill cancer cells not compromised by hypoxia, dose rate effects or cell cycle position, enhancing their attractiveness for targeted radiotherapy. However, translation of the concept to the clinic has been slow, many obstacles had to be surmounted before clinical studies could be initiated, the first clinical evaluation of a 211At- labeled mAb was made in 2001. This study circumvents many of the challenges to entering clinical studies with 211At. But several problems were encountered in maintaining efficient labeling with escalating radiation dose of alpha-particle likely related to radiolysis. The impact of the radiolysis produced by the α-particle over the labeling chemistry is much higher in comparison with typical β-emitters due to a deposition of energy in the solvent in a highly localized manner two orders of magnitude per unit volume higher than 90Y or 131I. Due to these difficulties a comprehensive basic science study about the radiolytic effects of astatine alpha-particles over the synthesis of 211At-labeled radiopharmaceuticals was carried out. Its main goal was overcoming the problem of the synthesis of 211At-labeled radiopharmaceuticals at the high activities necessaries for therapy and also to extend the shelf life of astatine elutions. Briefly this study held several steps, the first one was to study the role of solvent

  9. Comment on "Stoll H. et al. (2015): Interpretation of orbital scale variability in mid-latitude speleothem δ18O: Significance of growth rate controlled kinetic fractionation effects. Quat. Sci. Rev. 127, 215-228"

    Science.gov (United States)

    Dreybrodt, Wolfgang

    2016-06-01

    Stoll et al. (2015) have recently proposed that kinetic growth rate dependence of the oxygen isotope fractionation factor imprints an 18O isotope signal into the calcite precipitated to stalagmites. In their work growth rates of five stalagmites are related to negative offsets of δ18O from its equilibrium value. They report: "In the stalagmites contemplated here, growth rates of 4 - 80 μm year-1are equivalent to deposition rates of 3.4·10-9to 6.9·10-8 mol m-2 s-1assuming a density of calcite of 2.71 g/cm3."

  10. Report made on the behalf of the Commission of foreign affairs, defence and armed forces on the bill project authorizing the ratification of the international convention for the repression of acts of nuclear terrorism - Nr 215

    International Nuclear Information System (INIS)

    In a first part, this report recalls that the terrorist threat has already been addressed by texts which have been negotiated within the United Nations. It describes how the content of the convention has been elaborated while taking into account existing conventions related to nuclear issues. It outlines that this text is the fruit of the efforts made by a special committee created by the U N, and by the Lyons-Rome group within the G8. The second part comments how this convention is based on other conventions already ratified by France, notably the conventions of 1980 and 1997 on the physical protection of nuclear material. It outlines the important progress contained by this convention regarding incriminations of acts of nuclear terrorism and their crackdown

  11. From Soft Power to Economic Diplomacy? A Comparison of the Changing Rationales and Roles of the U. S. and Canadian Federal Governments in International Education. Research & Occasional Paper Series: CSHE.2.15

    Science.gov (United States)

    Trilokekar, Roopa Desai

    2015-01-01

    Through a historical and comparative analysis of international education policy development in Canada and the U.S., this paper will map the similarities and differences in the two countries. It will highlight the contributions and challenges of the government's involvement in international education (IE) in the two federal states and in…

  12. No evidence of a higher 10 year period prevalence of diabetes among 77,885 twins compared with 215,264 singletons from the Danish birth cohorts 1910-1989

    DEFF Research Database (Denmark)

    Petersen, Inge; Nielsen, Morten Frost; Beck-Nielsen, Henning; Christensen, Kaare

    2011-01-01

    AIMS/HYPOTHESIS: Previous Danish twin studies have found a highly increased risk of precursors of type 2 diabetes as well as a higher prevalence of type 2 diabetes among twins compared with singletons. Likewise, small-scale studies of Danish twins have shown that monozygotic twins have a higher r...

  13. Study of the Quasielastic {sup 3}He(e,e{prime}p) Reaction at Q{sup 2}=1.5 (GeV/c){sup 2} up to Missing Momenta of 1 GeV/c

    Energy Technology Data Exchange (ETDEWEB)

    Marat Rvachev

    2003-09-01

    As a part of the E89044 experiment at Hall A of Jefferson Lab, we have studied the quasielastic {sup 3}He(e,e{prime}p) reaction in perpendicular coplanar kinematics, with energy and momentum transfer by the electron fixed at 837 MeV and 1500 MeV/c respectively, at three beam energies of 1255, 1954 and 4807 MeV. {sup 3}He(e,e{prime}p)D and {sup 3}He(e,e{prime}p)pn cross sections and distorted spectral functions were measured up to missing momenta of 1000 MeV/c, and, for the three-body breakup channel, up to missing energy of 30 MeV. The A{sub TL} asymmetry, R{sub T} and R{sub TL} response functions, and the combination R{sub L} + R{sub TT}V{sub TT}/V{sub L} of response functions were separated for the {sup 3}He(e,e{prime}p)D reaction channel up to missing momenta of 550 MeV/c. In the low missing momentum regime, measured {sup 3}He(e,e{prime}p)D cross sections agree with available calculations based on variational ground state wave functions, and disagree with calculations based on Faddeev-type ground state wave functions. For missing momenta from 100 to 740 MeV/c, strong final state interaction effects, in general consistent with Glauber-type and diagrammatic calculations, are observed. On a finer detail, meson exchange currents, isobaric currents and dynamical relativistic effects might be isolated with further theoretical work, in view of remaining disagreements between available calculations and the measurements. For missing momenta from 740 to 1000 MeV/c, measured {sup 3}He(e,e{prime}p)D cross sections are more than an order of magnitude greater than predicted by available theories. Further theoretical work is needed for understanding the nature of processes in this region.

  14. Nr 215 - Report made on the behalf of the Foreign affairs, defence and armed forces Commission on the bill project authorizing the approval of the International Convention for the Repression of Acts of Nuclear Terrorism

    International Nuclear Information System (INIS)

    This report first recalls that the suppression of terrorist threat has already been the object of several texts negotiated under the aegis of UNO, that the current convention has been elaborated by taking existing conventions related to nuclear into account, and that this convention is the result of efforts made by the special committee created by the UNO and the G8 'Lyon-Rome' group. In a second part, the author shows that this text is based on conventions already ratified by France. As shown in a table containing the convention articles and the associated obligations for states after ratification, this agreement contains important progresses in terms of incriminations of acts of nuclear terrorism and their suppression

  15. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    International Nuclear Information System (INIS)

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on 211At and 124I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[211At]astato-2'-deoxyuridine (AUdR) and N-succinimidyl-4-[211At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [124I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[124I]iodo-2'-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for radioiodination of macromolecules

  16. 211At production and recovery: first results of a new start

    International Nuclear Information System (INIS)

    Full text: 211At is the only alpha-emitting isotope which can be introduced into organic molecular structures by covalent chemical binding and possesses superior decay characteristics for therapeutic applications when compared with other alpha emitters. However, its production requires a minimum of 27,5 MeV alpha-particles, which are relatively rarely available. In view of the revival of alpha-therapy approaches a production of 211At has been set up at the MHH cyclotron (MC-35). The first aim of this project was to establish a target- and work-up-system for the reliable production of several ten MBq-quantities of 211At for animal- and cell-research. An aluminum-target-system holds a 1.3 cm diameter Bi-disc of 0.25 mm thickness. The disk is pressed onto a the aluminum backing with 2 tons/cm2. The front is covered with a 125 μm Al foil, cooled by a He jet which is separated from the vacuum by a 250 μm Ti foil. Starting with 27.5 MeV alpha-particles the resulting target-energy is 25 MeV. This relatively low energy is chosen to avoid any contamination with 210At and 210Po in the first experimental period. A beam current of 10 μA for 15 min (9 mCoulomb) yields 16.4 MBq 211At theoretically. Astatine is recovered from the target by a dry distillation technique, using various gases as a transport support-medium. The small all-quartz distillation-apparatus is heated up to 900 oC. Astatine is recovered in a small cool able vessel containing various trapping media. Distillation and trapping can be monitored with small radioactivity monitors. The whole system fits in a cubical 0.5 m glove box. Continuous monitoring of the distillation process allowed to optimize the heating rate, the transport support-medium and its flow-rate. Various trapping solutions were tested for their efficiency. Different beam dispersion in the target seems to influence the release and distillation of astatine from the molten bismuth-target. Two different release patterns were observed. The first

  17. 5 CFR Appendix B to Part 581 - List of Agents Designated To Facilitate the Service of Legal Process on Federal Employees

    Science.gov (United States)

    2010-01-01

    ..., VA Regional Office, 5000 Wissahickon Avenue, P.O. Box 13399, Philadelphia, PA 19101, (215) 951-5534... Liaison, VA Regional Office, 5000 Wissahickon Avenue, P.O. Box 13399, Philadelphia, PA 19101, (215)...

  18. Inclusive measurement of (p,πsup(-)xn) double charge exchange reactions on bismuth from threshold to 800 MeV

    International Nuclear Information System (INIS)

    The energy dependence of the total angle-integrated cross section for the production of astatine isotopes from (p,πsup(-)xn) double charge exchange reactions on bismuth (sup(209)Bi) was measured from 120 to 800 MeV using activation and radiochemical techniques. Chemical yields were estimated by direct radioassaying of sup(211)At activity in thin (approximately 1 mg/cmsup(2)), irradiated bismuth targets. Calculations of the contributions of secondary (2-step) reactions to these measured astatine yields were performed, based partially upon the observed sup(211)At activity although even at the highest energies, the contribution to products lighter than sup(207)At was negligible. These data for products with as many as 7 neutrons removed from the doubly coherent product (sup(210)At) display nearby gaussian shapes for the mass distributions of the astatine residues with the maximum occurring for about sup(204)At. The most probable momentum transfer deduced from these distributions for the initial πsup(-) production step was 335 MeV/c. The observed excitation functions display a behaviour similar to that observed for the yield of sup(210)Po from a (p,πsup(O)) reaction on sup(209)Bi, but radically different from that observed for inclusive πsup(-) reactions on a heavy nucleus. These data are discussed in terms of recent theoretical approaches to negative pion production from bismuth. In addition, a simple, schematic model is developed to treat the rapidly decreasing percentage of the total inclusive πsup(-) emission which is observed for this double charge exchange reaction. This model reflects the capacity of a nucleus to a source of internal energetic protons

  19. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    OpenAIRE

    BAYRAM, Ali

    1998-01-01

    In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 1...

  20. Human radiation studies: Remembering the early years: Oral history of Dr. Patricia Wallace Durbin, Ph.D., conducted November 11, 1994

    International Nuclear Information System (INIS)

    This report is a transcript of an interview of Dr. Patricia Wallace Durbin by representatives of the US DOE Office of Human Radiation Research. Dr. Durbin was selected for this interview because of her knowledge of the human plutonium injections and her recollections of key figures, especially Joseph Hamilton. After a brief biographical sketch Dr. Durbin discusses her loss of research funding from DOE, her recollections concerning research into strontium metabolism as part of Project Sunshine, her recollections relating to the rationale for studies of human metabolism of radionuclides, her remembrances of Dr. Hamilton's Astatine and Plutonium research, and her experiences in gathering archival records concerning these researches

  1. « Communities in Place and Communities in Space. Globalization and Féminism in Iran », in : Parvin Alizadeh, ed., The Economy of Iran: Dilemmas of an Islamic State. London - New York, Tauris, 2002, pp. 215-224.

    OpenAIRE

    Ladier-Fouladi, Marie

    2006-01-01

    Dans cet article, l’A. propose de montrer en premier lieu qu’en dépit de la politique discriminatoire de la République islamique, le statut de la femme s’est amélioré depuis 1979. En second lieu, il tente de déterminer les facteurs à l’origine de cette évolution. Pour l’A., la diffusion de l’école à une échelle géographique de plus en plus étendue et notamment l’accroissement du niveau d’instruction scolaire des femmes d’une part, et la globalisation, d’autre part, constituent les deux facteu...

  2. « Sexuality, Rights and Islam: Competing Gender Discourses in Postrevolutionary Iran », in : Lois Beck & Guity Nashat, dirs., Women in Iran. From 1800 to the Islamic Republic. Urbana & Chicago, University of Illinois Press, 2004, pp. 204-215.

    OpenAIRE

    Kian-Thiébaut, Azadeh

    2007-01-01

    L’A. divise les discours religieux existants en Iran sur les femmes en traditionaliste, néo-traditionaliste et moderniste. Les questions de l’égalité entre les sexes et les droits des femmes sont absentes du premier discours centré sur la différence entre les sexes (représenté notamment par l’Ayatollah Meshkini, président de l’Assemblée des Experts). Le deuxième (fondé notamment sur les enseignements de l’Ayatollah Mottahari) est sensible aux débats sur le genre et aux critiques formulées par...

  3. 宁夏城市居民营养素摄入量与代谢综合征相关危险因素调查及分析%Relationship between dietary patterns and metabolic syndrome among urban populations in Ningxia, China . Journal of Zhejiang University (Agric . & Life Sci .), 2013,39(2):215-221

    Institute of Scientific and Technical Information of China (English)

    李宏宇; 张娜; 李琳; 陶秀娟; 杨建军; 张毓洪; 赵燚

    2013-01-01

    Summary It is well documented that the role of dietary composition in relation to the development of metabolic syndrome ( MS) remains inconclusive . Several studies on the relationship between MS and energy intake have suggested that the macronutrient composition of the diet ( proteins , fats , carbohydrates) may play an important contributing role to MS in adults . So , this study aims to investigate the possible relationship between MS and energy intake , percentage energy intake from macronutrients among urban populations in Ningxia , China . According to different economic levels from 2011 to 2012 , 2 465 subjects ( age:18‐75 years) were selected using stratified cluster random sampling in Yinchuan , Wuzhong , Zhongwei , Guyuan , and Shizuishan in Ningxia , China . Dietary intake was assessed using 24‐h food records and a validated food frequency questionnaire . Body mass , height , waist circumference , blood pressure , triglyceride ( TG ) , high‐density lipoprotein cholesterol ( HDL‐C ) , and blood glucose were measured . Logistic regression models were adjusted for age , smoking , drinking , and physical activity factors . The results showed that there were 647 MS cases in all subjects . According to the diagnosis criteria of MS , the incidence of MS was 26 .2% ( men:281 cases (25% ) ;women:366 cases ( 27 .3% ) ) , no significant difference in sex composition ( P>0 .05) . As a way of lifestyle , there was no significant difference in smoking , drinking , exercise between MS group and control group ( P>0 .05) ;significant difference was found in tertian dietary intake of protein and fat energy percentage between MS group and control group ( P0.05);MS组与对照组间吸烟、饮酒、锻炼等生活方式构成的差异无统计学意义( P>0.05);MS组与对照组间日膳食摄入蛋白质及脂肪能量百分比差异有统计学意义( P<0.05);MS组与对照组间的体质指数、腰围、收缩压、舒张压、空腹血糖、胆固醇、甘油三酯、高密度脂蛋白差异有统计学意义( P<0.05). Logistic多因素分析表明,蛋白质、脂肪及碳水化合物的能量占总摄入能量的百分比过多是城市居民代谢综合征的重要危险因素,其中高蛋白质组:相对危险程度比值比( odds ratio , OR)=1.417;高脂肪组:OR=1.647;高碳水化合物组:OR=1.810;因此,应采取膳食营养干预措施来有效预防MS .

  4. Dicty_cDB: Contig-U08414-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gtcgttgnattatctaca 70 Query: 71 acttttctttcnccnactgttgaattaaccgtncaactcaataatgatgattcttcaact 130 |||||||||||...||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 71 acttttctttcnccnactgtt...|||||||||||||||||| Sbjct: 275 aaattaggaagtgcacctttgataaatcaattctaaanncngtcgttgnattatctacaa 216 Query: 72 cttttctttcnccna...|||||||||||||| Sbjct: 215 cttttctttcnccnactgttgaattaaccgtncaactcaataatgatgattcttcaactc 156 Query: 132 atacca

  5. Protein (Viridiplantae): 357448019 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available :12299 3880:12299 14 kDa proline-rich protein DC2.15 Medicago truncatula MGLKGVGSIFILFLHLIFVSTLVSAKSAPRRPPPPPQVTCSSTPPPVVAPSTPPSTPP...ITVAPSTSPVAVDPTTLPPSTPPSTPPTSTPPNVVAPSTPPPSTPPFTTPPTVAPSTPPLVHAPSTPPPSTPPSTPP...TAIAPSTPQVVIDPTTLPPSTTHSTPPSVDAPSSPPSTPPTTVAPSTPPSLVDPTTPPPSTPPSTPPPVHDPSTPPSTPPIAVAPSTPPSVVNPTIPPPSTPPTTPPPNPRTPP...TNPRTPPTNPRTPPTTPPPNPRTPPTTPPTNPRTPPKNPMTPPTIPPPNPRTPPTTLPPNPRTPPTTPPANPRTPPTRPPTNPRTPPTTSPPNPRTPPTNPMTPP...TTPPANPRTPPTTPPTNPRTPPTTPPTNPRTPPTTPPPNPRTPPTNPMKPPTTPPPNPMTPPSTPPPNPRTPPTTPSPNPRTPP

  6. Protein (Viridiplantae): 356514232 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3847:61 PREDICTED: 14 kDa proline-rich protein DC2.15-like Glycine max MGSKTRSSLAIFLTVNILFFALVSACGTCPSPTPRHKHKPVKPSPSGGSGGSGGSGGSGG...SGGSGGSGGSGGSGGSGGSGGSGGSGASCPRDALKLGVCANVLNGLLNVTLGQPPVTPCCSLLNGLVDLEAAVCLCTALKANILGINLNLPISLSLLLNVCSRNAPRDFQCA ...

  7. Barbara Fuchs & Emily Weissbourd (eds., Representing Imperial Rivalry in the Early Modern Mediterranean (Toronto: Toronto University Press, 2015

    Directory of Open Access Journals (Sweden)

    Viviana Tagliaferri

    2016-03-01

    Full Text Available Book review of: Barbara Fuchs, Emily Weissbourd (eds., Representing Imperial Rivalry in the Early Modern Mediterranean, (Toronto: Toronto University Press, 215, pp. 296, ISBN 9781442619272.

  8. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    Directory of Open Access Journals (Sweden)

    Ali BAYRAM

    1998-03-01

    Full Text Available In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 10, 50 and 259 mm/min. Strength properties of dual-phase steels were investigated depending on annealing temperature, ratio of martensite and loading rate.

  9. A route for polonium 210 production from alpha-particle irradiated bismuth-209 target

    International Nuclear Information System (INIS)

    A method is proposed for production of polonium-210 via the 209Bi(α,3n)210 At nuclear reaction. Bombardment of a bismuth-209 target was performed with a 37 MeV alpha-particle beam that leads to the production of astatine-210 (T1/2 = 8.1 h), which decays to polonium-210. It is purified from the bismuth target matrix by employing liquid-liquid extraction using tributyl phosphate (TBP) in para-xylene from 7 M hydrochloric acid. Back extraction of polonium-210 was performed by 9 M nitric acid. This method allows to purify a tracer amount of Po-210 (2.6 x 10-13 mol) from macroscopic amount of Bi (2.8 x 10-2 mol).

  10. Effective bond orders from two-step spin–orbit coupling approaches: The I{sub 2}, At{sub 2}, IO{sup +}, and AtO{sup +} case studies

    Energy Technology Data Exchange (ETDEWEB)

    Maurice, Rémi, E-mail: remi.maurice@subatech.in2p3.fr; Montavon, Gilles [SUBATECH, CNRS UMR 6457, IN2P3/EMN Nantes/Université de Nantes, 4 rue Alfred Kastler, BP 20722, 44307 Nantes Cedex 3 (France); Réal, Florent; Gomes, André Severo Pereira; Vallet, Valérie [Laboratoire PhLAM, CNRS UMR 8523, Université de Lille, 59655 Villeneuve d’Ascq Cedex (France); Galland, Nicolas [CEISAM, UMR CNRS 6230, Université de Nantes, 2 rue de la Houssinière, BP 92208, 44322 Nantes Cedex 3 (France)

    2015-03-07

    The nature of chemical bonds in heavy main-group diatomics is discussed from the viewpoint of effective bond orders, which are computed from spin–orbit wave functions resulting from spin–orbit configuration interaction calculations. The reliability of the relativistic correlated wave functions obtained in such two-step spin–orbit coupling frameworks is assessed by benchmark studies of the spectroscopic constants with respect to either experimental data, or state-of-the-art fully relativistic correlated calculations. The I{sub 2}, At{sub 2}, IO{sup +}, and AtO{sup +} species are considered, and differences and similarities between the astatine and iodine elements are highlighted. In particular, we demonstrate that spin–orbit coupling weakens the covalent character of the bond in At{sub 2} even more than electron correlation, making the consideration of spin–orbit coupling compulsory for discussing chemical bonding in heavy (6p) main group element systems.

  11. Effective bond orders from two-step spin–orbit coupling approaches: The I2, At2, IO+, and AtO+ case studies

    International Nuclear Information System (INIS)

    The nature of chemical bonds in heavy main-group diatomics is discussed from the viewpoint of effective bond orders, which are computed from spin–orbit wave functions resulting from spin–orbit configuration interaction calculations. The reliability of the relativistic correlated wave functions obtained in such two-step spin–orbit coupling frameworks is assessed by benchmark studies of the spectroscopic constants with respect to either experimental data, or state-of-the-art fully relativistic correlated calculations. The I2, At2, IO+, and AtO+ species are considered, and differences and similarities between the astatine and iodine elements are highlighted. In particular, we demonstrate that spin–orbit coupling weakens the covalent character of the bond in At2 even more than electron correlation, making the consideration of spin–orbit coupling compulsory for discussing chemical bonding in heavy (6p) main group element systems

  12. Different ways to improve the clinical effectiveness of radioimmunotherapy in solid tumors

    Directory of Open Access Journals (Sweden)

    Chatal Jean-Francois

    2009-09-01

    Full Text Available Radioimmunotherapy (RIT has been proven effective in the treatment of radiosensitive non-Hodgkin lymphoma but, for radioresistant solid tumors, new approaches are necessary to improve the clinical effectiveness. A real improvement has been the introduction of the pretargeting technology which appeared to be able to significantly increase tumor-to-normal organ uptake ratios.Another very promising approach consists in associating RIT with other treatment modalities. Finally the use of alpha particle-emitting radionuclides such as astatin-211 or bismuth-213 (alpha-RIT should allow to efficiently eradicate disseminated microscopic clusters of tumor cells or isolated tumor cells which fit well with the short path length of alpha particles.

  13. Sequential radioimmunotherapy with 177Lu- and 211At-labeled monoclonal antibody BR96 in a syngeneic rat colon carcinoma model

    DEFF Research Database (Denmark)

    Eriksson, Sophie E; Elgström, Erika; Bäck, Tom;

    2014-01-01

    UNLABELLED: Alpha-particle emitters, such as astatine-211 (211At), are generally considered suitable for the treatment of small cell clusters due to their short path length, while beta-particle emitters, for example, Lutetium-177 (177Lu), have a longer path length and are considered better for...... small, established tumors. A combination of such radionuclides may be successful in regimens of radioimmunotherapy. In this study, rats were treated by sequential administration of first a 177Lu-labeled antibody, followed by a 211At-labeled antibody 25 days later. METHODS: Rats bearing solid colon...... carcinoma tumors were treated with 400 MBq/kg body weight 177Lu-BR96. After 25 days, three groups of animals were given either 5 or 10 MBq/kg body weight of 211At-BR96 simultaneously with or without a blocking agent reducing halogen uptake in normal tissues. Control animals were not given any 211At-BR96...

  14. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  15. Development of 211At Chemistry for Labelling Biomolecules

    International Nuclear Information System (INIS)

    Our studies have demonstrated that high recovery of 211At can be obtained using a “wet chemistry” approach to isolation from the bismuth target. We have also demonstrated that direct labelling of antibody-B10 conjugates with 211At can be performed in high yields, and that the astatinated antibodies are stable to in vivo deastatination. While these results will allow us to enter clinical studies with 211At-labelled antibodies, the chemistry associated with 211At is not fully understood. Therefore, it is important that many more basic studies to be conducted with 211At, so the optimal labelling reagent for each type of disease-targeting agent becomes apparent

  16. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena;

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... levels of γH2AX decreased during the first 24h in both cycling and stationary cultures and complete repair was seen in all cultures but cycling cells exposed to (211)At. Compared to stationary cells alpha particles were more harmful for cycling cultures, an effect also seen at the pChk2 levels...... cultures at a modest level of damage, clearly demonstrating that cell cycle status influences the relative effectiveness of alpha particles....

  17. Kinetics of the methylglyoxal scavenging by antidiabetic biguanide drugs investigated using ion transfer voltammetry and capillary electrophoresis

    Czech Academy of Sciences Publication Activity Database

    Langmaier, Jan; Samec, Zdeněk; Tůma, P.; Samcová, E.

    2015-01-01

    Roč. 61, č. 3 (2015), s. 215-215. ISSN 0034-6691. [Annual Meeting of the Polarographic Society of Japan /61./. 24.11.2015-25.11.2015, Himeji] R&D Projects: GA ČR(CZ) GA15-03139S Institutional support: RVO:61388955 Keywords : electrochemistry * methylglyoxal * electrophoresis Subject RIV: CG - Electrochemistry

  18. Laparoscopic ventral rectopexy in an elderly population with external rectal prolapse

    DEFF Research Database (Denmark)

    Bjerke, Trine; Mynster, Tommie

    2014-01-01

    years (range 34-99), median prolapse size was 8 cm (range 2-15), and 30 % had previous prolapse surgery. The median operative time was 135 min (range 90-215), and the median length of stay was 2 days (range 1-14). The 30-day morbidity rate was 15 %, and there were two (4 %) deaths within 30 days. There...

  19. Drug: D07343 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D07343 Drug Fencamfamin (INN) C15H21N 215.1674 215.3339 D07343.gif ATC code: N06BA06 Anatomical ... OANALEPTICS N06B PSYCHOSTIMULANTS, AGENTS USED FOR ADHD ... AND NOOTROPICS N06BA Centrally acting sympathomime ...

  20. Thermomechanical processing of 5083 aluminum to increase strength without increasing susceptibility to stress corrosion cracking

    Energy Technology Data Exchange (ETDEWEB)

    Edstrom, C. M.; Blakeslee, J. J.

    1980-09-30

    5083 aluminium with 25% cold work must be processed above 215/sup 0/C or below 70/sup 0/C to avoid forming continuous precipitate in the grain boundaries which makes the material susceptible to stress corrosion cracking. Time at temperature above 215/sup 0/C should be held to minimum (less than 30 min) to retain some strength from the 25% cold work.

  1. 49 CFR 212.217 - Car inspector.

    Science.gov (United States)

    2010-10-01

    ... (ii) The Freight Car Safety Standards (49 CFR part 215), Safety Glazing Standards (49 CFR part 223), Safety Appliance Standards (49 CFR part 231) and Power Brake Standards (49 CFR part 232); (3) The... Safety Standards (49 CFR part 215), Safety Glazing Standards (49 CFR part 223), Safety...

  2. Drug: D06125 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D06125 Drug Tiamenidine (USAN/INN); Symcor base TTS (TN) C8H10ClN3S 215.0284 215.7031 D06125.gif Antihyperte...nsive CAS: 31428-61-2 PubChem: 47207783 LigandBox: D06125 NIKKAJI: J20.515J ATOM 13

  3. EST Table: CK516660 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CK516660 rswjb0_004566.y1 11/12/09 n.h 10/09/29 71 %/215 aa ref|XP_968436.2| PREDICTED: similar to best... %/176 aa gnl|Amel|GB16861-PA 10/09/10 71 %/215 aa gi|189235903|ref|XP_968436.2| PREDICTED: similar to bes

  4. Drug: D00901 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D00901 Drug Rimantadine hydrochloride (USAN); Flumadine (TN) C12H21N. HCl 215.1441 215.7628 D009 ... TC code: J05AC02 Adamantane derivative Indication: Influenza ... A influenza ... A M2 proton channel blocker [VG:NC_004 ... P drug classification [BR:br08302] Antivirals Anti-influenza ... Agents Rimantadine D00901 Rimantadine hydrochlorid ...

  5. 76 FR 57796 - Petition for Waiver of Compliance

    Science.gov (United States)

    2011-09-16

    ... requirements of 49 CFR part 232, Brake System Safety Standards for Freight and Other Non-Passenger Trains and Equipment; End-of-Train Devices and 49 CFR part 215, Railroad Freight Car Safety Standards. Presently, BRG's... provisions of the Federal railroad safety regulations contained at 49 CFR parts 232 and 215. FRA assigned...

  6. Drug: D06573 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D06573 Drug Carisbamate (USAN) C9H10ClNO3 215.0349 215.6336 D06573.gif Novel neuromodulator for ... the treatment of epilepsy ... and other CNS disorders ATC code: N03AX19 Anatomic ...

  7. Drug: D08624 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D08624 Drug Tramazoline (INN); Muconasal (TN) C13H17N3 215.1422 215.2942 D08624.gif...970(146+147+148) Salivary secretion Anatomical Therapeutic Chemical (ATC) classification [BR:br08303] R RESPIRATORY SYSTEM R01 NASA...L PREPARATIONS R01A DECONGESTANTS AND OTHER NASAL PREPARATIONS FOR TOPICAL USE R01AA

  8. An improved synthesis of an 125I and 211At labelled benzamide for melanoma imaging

    International Nuclear Information System (INIS)

    Recent studies have indicated that benzamides can exhibit affinity for malignant melanoma and may be exploited diagnostically in the treatment of this cancer. Radioiodinated N-(2-diethylaminoethyl)-3-[123I/131I]iodo-4-methoxybenzamide (*I-IMBA) is a benzamide with promising diagnostic properties. A new synthesis procedure was developed to obtain 125I-IMBA suitable for use in vivo. The assets of the procedure include the use of less toxic reagents and better reproducible results when radiolabelling the precursor. The procedure also facilitates the synthesis of the astatinated N-(2-diethylaminoethyl)-3-[211At]astatine-4-methoxybenzamide (211At-AMBA), a new benzamide with a therapeutic potential. The regiospecific no-carrier-added 125I- and 211At-labeling of the benzamide is performed by demetalation of an organotin precursor. Using tributylstannyl as a leaving group, the radiochemical yield obtained after 15 minutes of reaction was 70 %-90 % for both 125I-IMBA and 211At-AMBA. The labelling was performed in a solution of MeOH:AcOH with NCS as the oxidising agent. The organotin precursor N-(2-diethylaminoethyl)-3-(tri-n-butylstannyl)-4-methoxy-benzamide was synthesized from 3-bromo-4-methoxybenzoic acid, with n-BuLi (2 eq) and Bu3SnCl (1 eq) in THF, giving 3-(tri-n-butylstannyl)-4-methoxybenzoic acid. The amide function was introduced by converting the acid group into an active N-succinimidyl-ester, a good leaving group in the reaction with 2-(diethylamino)ethylamine. The overall yield of the organotin precursor was 65 %

  9. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    Energy Technology Data Exchange (ETDEWEB)

    Marsh, B.A., E-mail: bruce.marsh@cern.ch [CERN, CH-1211 Geneva (Switzerland); Andel, B. [Comenius University, Bratislava (Slovakia); Andreyev, A.N. [University of York, Department of Physics, York YO10 5DD (United Kingdom); Antalic, S. [Comenius University, Bratislava (Slovakia); Atanasov, D. [Max-Planck-Institut für Kernphysik, Saupfercheckweg 1, 69117 Heidelberg (Germany); Barzakh, A.E. [Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, 188300 Gatchina (Russian Federation); Bastin, B. [Grand Accérateur National d’Ions Lourds (GANIL), Bd Henri Becquerel, F-14076 Caen (France); Borgmann, Ch. [Max-Planck-Institut für Kernphysik, Saupfercheckweg 1, 69117 Heidelberg (Germany); Capponi, L. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Cocolios, T.E.; Day Goodacre, T. [CERN, CH-1211 Geneva (Switzerland); University of Manchester, Manchester (United Kingdom); Dehairs, M. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Derkx, X. [University of the West of Scotland, School of Engineering, Paisley PA1 2BE (United Kingdom); De Witte, H. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fedorov, D.V. [Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, 188300 Gatchina (Russian Federation); Fedosseev, V.N.; Focker, G.J. [CERN, CH-1211 Geneva (Switzerland); Fink, D.A. [Ruprecht-Karls Universität, Seminarstr. 2, 69117 Heidelberg (Germany); CERN, CH-1211 Geneva (Switzerland); Flanagan, K.T. [University of Manchester, Manchester (United Kingdom); Franchoo, S. [CSNSM-IN2P3-CNRS, Université Paris-Sud, 91406 Orsay (France); and others

    2013-12-15

    Highlights: • Upgrade of the lasers, detectors and data acquisition for in-source resonance ionization spectroscopy at ISOLDE. • First use of the ISOLTRAP MR-ToF MS in combination with laser spectroscopy at ISOLDE. • Resonance ionization of astatine for the study of its nuclear structure. -- Abstract: At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar free ionization using the Laser Ion Source Trap, LIST (Po); isobar selective particle identification using the multi-reflection time-of-flight mass separator (MR-ToF MS) of ISOLTRAP (Au, At). These are summarized as part of an overview of the current status of the in-source resonance ionization spectroscopy setup at ISOLDE.

  10. Where to Go Next?

    Czech Academy of Sciences Publication Activity Database

    Kindlmann, Pavel

    1st ed. Dodrecht : Springer, 2012 - (Kindlmann, P.), s. 215-216 ISBN 978-94-007-1801-2. - (Biomedical and Life Sciences) Institutional research plan: CEZ:AV0Z60870520 Keywords : conservation * Himalayan Subject RIV: EH - Ecology, Behaviour

  11. 50 CFR Table 2d to Part 679 - Species Codes-Non-FMP Species

    Science.gov (United States)

    2010-10-01

    ... 220 Pacific tomcod 250 Poacher (Family Agonidae) 219 Prowfish 215 Ratfish 714 Rockfish, black (GOA) 142 Rockfish, blue (GOA) 167 Rockfish, dark 173 Sardine, Pacific (pilchard) 170 Sea cucumber, red...

  12. Anogenital distance and reproductive parameters in young men

    DEFF Research Database (Denmark)

    Parra, M D; Mendiola, J; Jørgensen, N;

    2016-01-01

    cephalad insertion of the penis (AGDAP )] were assessed in 215 university students. Semen parameters (semen volume, sperm concentration, total sperm counts, motility and morphology) and serum reproductive hormones (follicle stimulating hormone, luteinising hormone, inhibin B, testosterone, calculated free...

  13. Space debris mitigation and prevention: how to bilt a stronger international regime

    Czech Academy of Sciences Publication Activity Database

    Perek, Luboš

    2004-01-01

    Roč. 2, č. 2 (2004), s. 215-226. ISSN 1477-7622 Institutional research plan: CEZ:AV0Z1003909 Keywords : space debris * registration * paper satellites Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  14. BIOMASS, SPECIES IDENTIFICATION, SPECIES IDENTIFICATION - LIFE STAGE, TAXONOMIC CODE and species abundance tows data collected in the Gulf of Alaska on the ALPHA HELIX and WECOMA cruises HX201, HX203 and others as part of the NEP project from 1997-10-14 to 2004-10-08 (NODC Accession 0113956)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113956 includes tows and biological data collected aboard the ALPHA HELIX and WECOMA during cruises HX201, HX203, HX205, HX208, HX211, HX215, HX217,...

  15. Poznámka o náhrobku císaře Friedricha III. a reflexe sepulchrálního sochařství v českých cestopisech 1450 - 1550

    Czech Academy of Sciences Publication Activity Database

    Chlíbec, Jan

    Praha : Arte factum, 2002 - (Prix, D.), s. 207-215 ISBN 80-903230-1-4 Institutional research plan: CEZ:AV0Z8033913 Keywords : Gerhaert van Leyden * Friedrich III Subject RIV: AL - Art, Architecture, Cultural Heritage

  16. Fully nonlinear model of a hydraulic circuit

    Czech Academy of Sciences Publication Activity Database

    Straškraba, Ivan

    2014-01-01

    Roč. 59, č. 3 (2014), s. 215-220. ISSN 0001-7043 Institutional support: RVO:67985840 Keywords : compressible fluid * Navier-Stokes equations * hydraulic systems Subject RIV: BA - General Mathematics

  17. BIOMASS, SPECIES IDENTIFICATION, TAXONOMIC CODE, SPECIES IDENTIFICATION - LIFE STAGE and species abundance tows data collected in the Gulf of Alaska on the ALPHA HELIX and WECOMA cruises HX201, HX203 and others as part of the NEP project from 1997-10-10 to 2004-10-07 (NODC Accession 0113896)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113896 includes tows and biological data collected aboard the ALPHA HELIX and WECOMA during cruises HX201, HX203, HX205, HX208, HX211, HX215, HX217,...

  18. Distribution patterns and environmental correlates of Thaumarchaeota abundance in six deep subalpine lakes.

    Czech Academy of Sciences Publication Activity Database

    Callieri, C.; Hernandez-Aviles, S.; Salcher, Michaela M.; Fontaneto, D.; Bertoni, R.

    2016-01-01

    Roč. 78, č. 2 (2016), s. 215-225. ISSN 1015-1621 Institutional support: RVO:60077344 Keywords : subalpine lakes * Thaumarchaeota vertical profile * CARD FISH * hypolimnion Subject RIV: EE - Microbiology, Virology Impact factor: 2.706, year: 2014

  19. Perissodactyla

    Czech Academy of Sciences Publication Activity Database

    Červený, Jaroslav

    Farmington Hills : Gale, 2003 - (Kleiman, D.; Geist, V.; Hutchins, M.; McDade, M.), s. 215-224 ISBN 0-7876-6573-8 Institutional research plan: CEZ:AV0Z6093917 Keywords : Perissodactyla Subject RIV: EG - Zoology

  20. Institute of Chemical Process Fundamentals of the ASCR: Expectation

    Czech Academy of Sciences Publication Activity Database

    Punčochář, Miroslav

    2013-01-01

    Roč. 62, 5-6 (2013), s. 214-215. ISSN 0022-9830 Institutional support: RVO:67985858 Keywords : laboratory investigation * large-scale applications * novel instrumentation and technology . Subject RIV: CI - Industrial Chemistry, Chemical Engineering

  1. Jak fyzika zvyšuje užitnou hodnotu polymerních materiálů

    Czech Academy of Sciences Publication Activity Database

    Raab, Miroslav; Kotek, Jiří

    2007-01-01

    Roč. 57, č. 4 (2007), s. 215-220. ISSN 0009-0700 Institutional research plan: CEZ:AV0Z40500505 Keywords : commodity plastics * polymeric materials * polymer physics Subject RIV: CD - Macromolecular Chemistry

  2. A new graptolite species of .i.Cyrtograptus./i. from the uppermost Llandovery of Ziyang, Shaanxi Province, China

    Czech Academy of Sciences Publication Activity Database

    Wang, J.; Štorch, Petr; Wang, X.; Zhang, J.

    2015-01-01

    Roč. 24, 1/2 (2015), s. 215-220. ISSN 1871-174X Institutional support: RVO:67985831 Keywords : Silurian * Llandovery * Cyrtograptus fui n. sp. * Ziyang * Graptolites Subject RIV: DB - Geology ; Mineralogy

  3. Popis, vjem, zdůvodnění a identifikace

    Czech Academy of Sciences Publication Activity Database

    Koťátko, Petr

    Bratislava : Infopress, 2010 - (Zouhar, M.), s. 204-215 ISBN 978-80-85402-99-5 Institutional research plan: CEZ:AV0Z90090514 Keywords : description * identification * perception Subject RIV: AA - Philosophy ; Religion

  4. Epidemiological Investigation of Lifestyle Associated Modifiable Risk Factors among Medical Students

    Directory of Open Access Journals (Sweden)

    Anurag Srivastava

    2013-06-01

    Conclusion: The study shows a high prevalence of NCD related risk factors in medical students. Primary prevention may be one way to lower the risk burden of NCDs. [Natl J Med Res 2013; 3(3.000: 210-215

  5. 75 FR 52957 - Supplemental Funding Under the Food and Drug Administration's Food Emergency Response Laboratory...

    Science.gov (United States)

    2010-08-30

    ... HUMAN SERVICES Food and Drug Administration Supplemental Funding Under the Food and Drug Administration's Food Emergency Response Laboratory Network Microbiological Cooperative Agreement Program (U18) PAR-09-215; Request for Supplemental Applications AGENCY: Food and Drug Administration, HHS....

  6. 78 FR 22225 - Meeting: African Development Foundation, Board of Directors Executive Session Meeting

    Science.gov (United States)

    2013-04-15

    ...; ] AFRICAN DEVELOPMENT FOUNDATION Board of Directors Executive Session Meeting Meeting: African Development Foundation, Board of Directors Executive Session Meeting Time: Tuesday, April 23, 2013 11:15 a.m. to 2:15...

  7. A Possible Scenario of Energy Transport in the 17th May 2002 Flare

    Czech Academy of Sciences Publication Activity Database

    Kotrč, Pavel; Kashapova, L. K.; Frolova, A.S.; Kupryjakov, Ju. A.

    2009-01-01

    Roč. 33, č. 1 (2009), s. 207-215. ISSN 1845-8319 Institutional research plan: CEZ:AV0Z10030501 Keywords : solar flare * accelerated particles * chromosphere and corona Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  8. 78 FR 11881 - Notice of Receipt of Requests To Voluntarily Cancel Certain Pesticide Registrations

    Science.gov (United States)

    2013-02-20

    .... 64014 Florida Silvics, Inc., d/b/a Tree Tech Microinjection Systems, 950 S.E. 215th Ave., Morriston, FL... Environmental protection, Pesticides and pests. Dated: February 12, 2013. Richard P. Keigwin, Jr.,...

  9. USA terrorismivastane seadus ja jälitustegevuse erivolitused / Piibe Jõgi

    Index Scriptorium Estoniae

    Jõgi, Piibe, 1969-

    2007-01-01

    24. okt. 2001 Ameerika Ühendriikides vastu võetud terrorismivastase seaduse (nn USA Patriot Act) paragrahvist 215, mis käsitleb andmete salajast kogumist ja paragrahvist 213 salajaste läbiotsimisite kohta

  10. Go-go, 40 miljonit krooni! / Kadri Paas, Laura Birkin

    Index Scriptorium Estoniae

    Paas, Kadri, 1982-

    2007-01-01

    Majandus- ja kommunikatsiooniminister Juhan Parts tegi valitsusele ettepaneku anda maabussiliinide toetuseks veel 20 miljonit ja Edelaraudteele 21,5 miljonit krooni, Eesti Reformierakond ootab ministri selgitusi. Vt. samas: GoBus: mei ei saa bussisõidule peale maksta

  11. Nearshore marine fish assemblages in southern California

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish benthic trawls were completed by the Southern California Coastal Water Research Project (SCCWRP). Data from 425 fisheries independent trawls ranging from 2-215...

  12. Historické nahrávky autentických forem chodské lidové hudby

    Czech Academy of Sciences Publication Activity Database

    Vejvoda, Zdeněk

    Plzeň : Západočeská univerzita v Plzni, 2013, s. 215-224. ISBN 978-80-261-0328-8 Institutional support: RVO:68378076 Keywords : Chodsko * ethnomusicology * historical recordings Subject RIV: AC - Archeology, Anthropology, Ethnology

  13. 78 FR 45592 - Reporting and Recordkeeping Requirements Under OMB Review

    Science.gov (United States)

    2013-07-29

    ...: Small Business Lending Companies. Responses: 215. Annual Burden: 107.50. Curtis Rich, Management Analyst... From the Federal Register Online via the Government Publishing Office SMALL BUSINESS ADMINISTRATION Reporting and Recordkeeping Requirements Under OMB Review AGENCY: Small Business...

  14. Research and Explication of the Quantitative Characteristic of Legislation, Using the Example of the Legislation of the CR

    Czech Academy of Sciences Publication Activity Database

    Novák, František

    151/2, 9/3 TLQ (2012), s. 206-215. ISSN 0231-6625 Institutional support: RVO:68378122 Keywords : quantitative description of legislation * analyses of legislation of the Czech Republic * possibilities and methodology Subject RIV: AG - Legal Sciences

  15. Drug: D09967 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ide bridge: 23-89; 135-195; H230-L215, Dimer) Peptide Uveitis, rheumatoid arthritis, psoriasis ATC code: L04...teraction hsa05323(3605) Rheumatoid arthritis map07050 Antirheumatics - DMARDs and biological agents Anatomi

  16. Sociální inteligence, sociální kompetence

    Czech Academy of Sciences Publication Activity Database

    Baumgartner, František; Orosová, O.; Výrost, J.

    Praha : Grada Publishing, 2008, s. 199-215 ISBN 978-80-247-1428-8 Institutional research plan: CEZ:AV0Z70250504 Keywords : social intelligence * social competence * emotional intelligence Subject RIV: AN - Psychology

  17. 75 FR 25238 - Environmental Impacts Statements; Notice of Availability

    Science.gov (United States)

    2010-05-07

    ..., Brunswick, ME, Comment Period Ends: 06/28/2010, Contact: Thomas H. Stephan, 215-897-4916. EIS No. 20100163.... EIS No. 20100164, Draft EIS, BLM, 00, Southern California Edison's Eldorado-Ivanpah Transmission...

  18. Financial conditions and investment during the transition: evidence from Czech firms

    Czech Academy of Sciences Publication Activity Database

    Lízal, Lubomír; Švejnar, Jan

    Cambridge : MIT Press, 2002 - (Meyendorff, A.; Thakor, A.), s. 215-260 ISBN 0-262-13391-1 Institutional research plan: CEZ:AV0Z7085904 Keywords : Czech Republic * transition * investment Subject RIV: AH - Economics

  19. 48 CFR 825.1001 - Waiver of right to examination of records.

    Science.gov (United States)

    2010-10-01

    ..., Contract Terms and Conditions Required to Implement Statutes or Executive Orders—Commercial Items. (2) Alternate III of the FAR clause at 52.215-2, Audit and Records—Negotiation. (b) The contracting officer...

  20. IDaphnia galeata/I life history response to heterogeneous food conditions and dissolved chemicals in the Římov Reservoir

    Czech Academy of Sciences Publication Activity Database

    Macháček, Jiří

    č. 442 (2001), s. 215-222. ISSN 0018-8158 R&D Projects: GA AV ČR IAA6017802 Keywords : Daphnia * life history * food resources Subject RIV: DA - Hydrology ; Limnology Impact factor: 0.659, year: 2001

  1. 48 CFR 1315.204-570 - Part IV representations and instructions.

    Science.gov (United States)

    2010-10-01

    ... officer shall insert the provision similar to 1352.215-74, Best Value Evaluation, for competitive, best..., Cost or Pricing Data, in all solicitations when cost or pricing data is required under FAR subpart 15.4....

  2. 75 FR 69397 - Minnkota Power Cooperative, Inc.: Notice of Availability of an Environmental Assessment

    Science.gov (United States)

    2010-11-12

    ... Independence Ave., SW., Room 2244-S, Stop 1571, Washington, DC 20250-1571, fax: (202) 690-0649, or e-mail... Auditor......... 115 West Main, 701-794-8777 Hensler, ND 58530. Sheridan County Auditor....... 215...

  3. AcEST: BP917458 [AcEST

    Lifescience Database Archive (English)

    Full Text Available + L A A W Sbjct: 200 WVLASVIPVAEGS-WGLEPLRRSSYLVKGMRRMSFSLNLFFAIAGLVLALWANYLQSSAS 258 Query: 212 ----LLQHVIGQFAAASVICLA...CGSFVR 402 Query: 215 WLLQHVIGQFAAASVICLAQMYFLVLWLIFYMSARS--LHDQPSHFSYRTLEDFLDRFR 45 W L G+ AA + ++YF+V WLIFY +AR...GRDIVREGVYLLSTMLNQAIQIKCLEAIFCGSFVR 412 Query: 215 WLLQHVIGQFAAASVICLAQMYFLVLWLIFYMSARS--LHDQPSHFSYRTLEDF...6/115 (40%), Gaps = 1/115 (0%) Frame = -3 Query: 371 CIYMIACWVTILERNY-WGLGAVTRSGNLVKGMKWQALVIRLIEAAVCGRTARWL...VYSSLMACSVITMMCVTILGTRWQLLYSCIAVVLACGACAFWALPFLIAKVS---- 435 Query: 170 ICLAQMYFLVLWL-----IFYMSARSLHDQPSHFSY

  4. AcEST: BP920703 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000140_D08 408 Adiantum capillus-veneris mRNA. clone: YMU001_000140_D08. BP920703 CL774Co ... = -3 Query: 400 VKLGCCDWYSKRIEKVALLEFDRSRKSMGVIVRTPSG ANKLLVKGAVENVLERSSHLQLA 221 VKLGCCDW+ KR ++VA LEFDR ... = -3 Query: 400 VKLGCCDWYSKRIEKVALLEFDRSRKSMGVIVRTPSG ANKLLVKGAVENVLERSSHLQLA 221 VKL CCDW++KR +KVA LEFDR ... me = -3 Query: 394 LGCCDWYSKRIEKVALLEFDRSRKSMGVIVRTPSG ANKLLVKGAVENVLERSSHLQLANG 215 L CC +S+ +++A LEFDR R ... me = -3 Query: 394 LGCCDWYSKRIEKVALLEFDRSRKSMGVIVRTPSG ANKLLVKGAVENVLERSSHLQLANG 215 L CC +S+ +++A LEFDR R ...

  5. Evaluation scheme for Blatta orientalis and Blattella germanica in food units with HACCP implementation

    OpenAIRE

    VINELA REFUGJATI; BIZENA BIJO; ENDRI HAXHIRAJ

    2014-01-01

    Blattella germanica and Blatta orientalis are the most common insects found in food industry, houses, offices, hotels, schools, etc. The aim of this study is the evaluation of gel baits efficiency (2.15% imidacloprid) against Blatta orientalis and Blattella germanica in albanian food units. The study was carried out in Tirana from June 2012 to June 2013 in 14 infested supermarkets, 13 of which were treated with 2.15% imidacloprid while 1 served as control unit. Monitor traps and visual inspec...

  6. Monitoring of onboard aircraft exposure level in the Czech republic; Overview of results acquired since 2001

    Czech Academy of Sciences Publication Activity Database

    Spurný, František; Ploc, Ondřej; Jadrníčková, Iva

    Busan: AOGS, 2008. s. 215-215. ISBN N. [Annual Meeting AOGS 2008 /5./. 16.06.2008-20.06.2008, Busan] R&D Projects: GA ČR(CZ) GD202/05/H031 Institutional research plan: CEZ:AV0Z10480505 Keywords : aircraft exposure * monitoring * radiation dosimetry Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders www.asiaoceania.org

  7. Transformation of Actinomyces spp. by a gram-negative broad-host-range plasmid.

    OpenAIRE

    Yeung, M K; Kozelsky, C S

    1994-01-01

    The gram-negative broad-host-range vector pJRD215 was transferred by electroporation into strains of Actinomyces viscosus or Actinomyces naeslundii at efficiencies which ranged from 10(2) to 10(7) transformants per microgram of plasmid DNA. The Actinomyces transformants expressed pJRD215-encoded resistance to kanamycin and streptomycin. Moreover, the transforming plasmid DNA had not undergone any deletions or rearrangements, nor had it integrated into the genomes of these strains.

  8. Exploratory experimental investigation of a wave propeller

    OpenAIRE

    Dane, Carl W.

    1992-01-01

    Approved for public release; distribution is unlimited A low-speed wind tunnel investigation was conducted to determine if a small secondary airfoil or wave propeller, oscillating in a rotary plunging motion, could significantly affect the airflow over a lifting airfoil surface to delay the onset of stall. The lifting airfoil shape was a NACA 66(215)-216, chosen for its chordwise pressure port instrumentation. Testing consisted of measuring the pressure distribution of the NACA 66(215)-2...

  9. Comparison of the Space Radiation Environments at Foton M3 Satellite Altitudes and on Aircraft Altitudes for Minimum of Solar Activity in 2007

    Czech Academy of Sciences Publication Activity Database

    Dachev, T. P.; Spurný, František; Ploc, Ondřej; Tomov, B.; Dimitrov, P.; Matviichuk, Y.; Bankov, N.

    Busan: AOGS, 2008. s. 215-215. ISBN N. [Annual Meeting AOGS 2008 /5./. 16.06.2008-20.06.2008, Busan] Grant ostatní: ESA(XE) ILSRA - 2004 - 248 Institutional research plan: CEZ:AV0Z10480505 Keywords : aircraft exposure * monitoring * radiation dosimetry * space radiation * space dosimetry * measurements Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders www.asiaoceania.org

  10. The biokinetics of alpha-particle emitting radiopharmaceuticals

    International Nuclear Information System (INIS)

    The past two decades have seen wide interest in the application of alpha-particle emitting radionuclides for targeted endoradiotherapy and a large number of compounds labeled with 211At (T1/2 7.21 h), 212Bi (T1/2 1 h) or 213Bi (T1/2 0.78 h) have been studied. Knowledge of the biokinetic behaviour of such agents is important both for their optimal clinical exploitation and for general radiological protection purposes. Animal studies of the distribution and retention of 211At compounds, including ionic astatide, substituted aromatic compounds and labelled monoclonal antibodies, have provided new information on the biochemistry of astatine. With respect the thyroid gland the uptake of the astatide ion has been shown to be very much lower than that of the iodide ion. Less information is available for 212Bi-labelled radiopharmaceuticals. The available data for both 211At and 212Bi radiopharmaceuticals are reviewed. Cautious generic biokinetic models for inorganic and simple organic compounds of 211At and 212Bi; for [211At]-, and [212Bi]-biphosphonates and for [211At]-, and [212Bi]-monoclonal antibodies, are proposed for use in general radiological protection when compound-specific data are not available. (orig.)

  11. The radiolabeled monoclonal antibodies in immunoscintigraphy and radioimmunotherapy: current state and perspectives

    International Nuclear Information System (INIS)

    The antibodies can be satisfactorily labelled with technitium-99 m or indium-111 for tumor immunoscintigraphy. The immunoscintigraphy is not useful for the primary tumor diagnosis. It can be useful for the diagnosis of the some cancer extension and for recurrent tumor visualization. The immunoscintigraphy is widely competed with Positron Emission Tomography (PET) which gives accurate results. In the future the immunoscintigraphy, in pre-therapeutic stage, contribute to the estimation of the dose delivered to the tumor and to normal organs for adopting or not a radioimmunotherapy. The antibodies can also be labeled with Iodine-131 for an application in radioimmunotherapy (RIT). The RIT is efficient in the non-Hodgkin's lymphoma treatment because of their great radiosensitivity. Until now the results have been very modest in solid tumor treatment but methodological and biotechnological progresses have to improve the efficiency especially for the small tumors. In the future iodine-131 which requires the confinement (very expensive) of patients will be substituted by yttrium-90 beta emitter, more energetic than iodine-131 and can be injected in walking case. In the long term, the alpha emitter radionuclides (astatine-211 or bismuth-213) can be used for hematologic cancer treatment. In conclusion the future of radiolabeled monoclonal antibodies is essentially therapeutic. The radioimmunotherapy associated to the chemotherapy give promising perspectives for the radiosensitive cancer treatment and in general small solid tumor treatment (F.M.)

  12. Biological toxicity of intracellular radionuclide decay. Part of a coordinated programme on radiation biology of Auger emitters and their therapeutic applications

    International Nuclear Information System (INIS)

    Internal radiotherapy should be performed with short-lived radionuclides which emit high LET radiation and short ranged radiation, and accumulated within cancers. Based on these considerations, several radionuclides (tritium, copper-64, gallium-67, iodine-123, iodine 125, iodine-131 and astatine-211) were chosen and their toxicity was assessed using cell division in mammalian cultured cells as a criterion. It was apparent that the toxic effects obtained with 125I greatly exceeded those observed in cells treated with any other radionuclides. The possible hypotheses to explain the excessive radiosensitivity of 125I were discussed in relation to microdosimetry calculation. It was also found that the division delay induced by radionuclide decay is primarily due to damage to the cell nucleus but not to the plasma membrane. The key problem remains the development of agents which can serve as carriers for radionuclide accumulation within tumors. Although several promising approaches (Synkavit, tamoxifen, iododeoxyuridine, antibodies, liposomes) were investigated, only 125I-labelled Synkavit would be desirable for clinical application

  13. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  14. The biokinetics of alpha-particle emitting radiopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    Taylor, D.M. [School of Chemistry, Cardiff Univ., Cardiff (United Kingdom); Duffield, J.R. [Faculty of Applied Sciences, Univ. of the West of England, Bristol (United Kingdom)

    2005-07-01

    The past two decades have seen wide interest in the application of alpha-particle emitting radionuclides for targeted endoradiotherapy and a large number of compounds labeled with {sup 211}At (T{sup 1}/{sub 2} 7.21 h), {sup 212}Bi (T{sup 1}/{sub 2} 1 h) or {sup 213}Bi (T{sup 1}/{sub 2} 0.78 h) have been studied. Knowledge of the biokinetic behaviour of such agents is important both for their optimal clinical exploitation and for general radiological protection purposes. Animal studies of the distribution and retention of {sup 211}At compounds, including ionic astatide, substituted aromatic compounds and labelled monoclonal antibodies, have provided new information on the biochemistry of astatine. With respect the thyroid gland the uptake of the astatide ion has been shown to be very much lower than that of the iodide ion. Less information is available for {sup 212}Bi-labelled radiopharmaceuticals. The available data for both {sup 211}At and {sup 212}Bi radiopharmaceuticals are reviewed. Cautious generic biokinetic models for inorganic and simple organic compounds of {sup 211}At and {sup 212}Bi; for [{sup 211}At]-, and [{sup 212}Bi]-biphosphonates and for [{sup 211}At]-, and [{sup 212}Bi]-monoclonal antibodies, are proposed for use in general radiological protection when compound-specific data are not available. (orig.)

  15. Effect of cetuximab in combination with alpha-radioimmunotherapy in cultured squamous cell carcinomas

    International Nuclear Information System (INIS)

    Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 (211At-cMAb U36). Effects on 211At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with 211At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced 211At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.

  16. Tumor immunotargeting using innovative radionuclides.

    Science.gov (United States)

    Kraeber-Bodéré, Françoise; Rousseau, Caroline; Bodet-Milin, Caroline; Mathieu, Cédric; Guérard, François; Frampas, Eric; Carlier, Thomas; Chouin, Nicolas; Haddad, Ferid; Chatal, Jean-François; Faivre-Chauvet, Alain; Chérel, Michel; Barbet, Jacques

    2015-01-01

    This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality. PMID:25679452

  17. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  18. Proceedings of transuranium elements

    International Nuclear Information System (INIS)

    The identification of the first synthetic elements was established by chemical evidence. Conclusive proof of the synthesis of the first artificial element, technetium, was published in 1937 by Perrier and Segre. An essential aspect of their achievement was the prediction of the chemical properties of element 43, which had been missing from the periodic table and which was expected to have properties similar to those of manganese and rhenium. The discovery of other artificial elements, astatine and francium, was facilitated in 1939-1940 by the prediction of their chemical properties. A little more than 50 years ago, in the spring of 1940, Edwin McMillan and Philip Abelson synthesized element 93, neptunium, and confirmed its uniqueness by chemical means. On August 30, 1940, Glenn Seaborg, Arthur Wahl, and the late Joseph Kennedy began their neutron irradiations of uranium nitrate hexahydrate. A few months later they synthesized element 94, later named plutonium, by observing the alpha particles emitted from uranium oxide targets that had been bombarded with deuterons. Shortly thereafter they proved that is was the second transuranium element by establishing its unique oxidation-reduction behavior. The symposium honored the scientists and engineers whose vision and dedication led to the discovery of the transuranium elements and to the understanding of the influence of 5f electrons on their electronic structure and bonding. This volume represents a record of papers presented at the symposium

  19. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  20. Development and radiotherapeutic application of 211At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    International Nuclear Information System (INIS)

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of 131I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, 211At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of 211At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated