WorldWideScience

Sample records for astatine 214

  1. Radiochemistry of astatine

    International Nuclear Information System (INIS)

    Ruth, T.J.; Dombsky, M.; D'Auria, J.M.; Ward, T.E.

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs

  2. Formation and decomposition of astatine molecules

    International Nuclear Information System (INIS)

    Takahashi, Naruto; Ishikuro, Mituhiro; Baba Hiroshi

    1989-01-01

    A method determining the boiling points of elementary astatine and astatine iodide has been developed (K. Otozai and N. Takahashi, Radio. Chim. Acta 31, (1982) 201). Further, it was concluded from the simple rule among the boiling point of elementary halogens and interhalogen compounds that elementary astatine might exist in diatomic molecules as the other halogens. In the present work the reaction mechanisms of elementary astatine with radioactive iodine and organic solvents were studied by means of radiogaschromatography in order to obtain further experimental evidences for diatomic astaine molecules. The following conclusions were obtained by the analysis of reaction kinetics. Two astatine atoms are lost from the elementary astatine fraction per each radioactive decay of astatine. The astatine radical or hot atom liberated by the decay of the complementary astatine atom immediately reacts with iodine or organic solvents. Thus formed astatine compounds decompose in turn due to the decay of astatine

  3. Organic astatine compounds, their preparation and properties

    Energy Technology Data Exchange (ETDEWEB)

    Vasaros, L; Berei, K

    1985-01-01

    Aromatic astatine compounds of possible medical application were prepared by high energy substitutions, by astatine-halogen, and by electrophil astatine-hydrogen substitutions at the Joint Institute of Nuclear Researches, Dubna. Physico-chemical properties of organic astatine compounds such as boiling point and evaporation heat, and the refraction and dissociation energy of carbon-astatine bonds were determined experimentally by gas chromatography. The results are compared with extrapolated data. (V.N.). 41 refs.; 7 figs.; 5 tables.

  4. Bibliography of astatine chemistry and biomedical applications

    International Nuclear Information System (INIS)

    Berei, K.; Vasaros, L.

    1992-02-01

    An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211 At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)

  5. Recent advances in the organic chemistry of astatine

    International Nuclear Information System (INIS)

    Berei, K.; Vasaros, L.

    1994-03-01

    Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211 At species, 211 At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs

  6. Experimental and computational evidence of halogen bonds involving astatine

    Science.gov (United States)

    Guo, Ning; Maurice, Rémi; Teze, David; Graton, Jérôme; Champion, Julie; Montavon, Gilles; Galland, Nicolas

    2018-03-01

    The importance of halogen bonds—highly directional interactions between an electron-deficient σ-hole moiety in a halogenated compound and an acceptor such as a Lewis base—is being increasingly recognized in a wide variety of fields from biomedicinal chemistry to materials science. The heaviest halogens are known to form stronger halogen bonds, implying that if this trend continues down the periodic table, astatine should exhibit the highest halogen-bond donating ability. This may be mitigated, however, by the relativistic effects undergone by heavy elements, as illustrated by the metallic character of astatine. Here, the occurrence of halogen-bonding interactions involving astatine is experimentally evidenced. The complexation constants of astatine monoiodide with a series of organic ligands in cyclohexane solution were derived from distribution coefficient measurements and supported by relativistic quantum mechanical calculations. Taken together, the results show that astatine indeed behaves as a halogen-bond donor—a stronger one than iodine—owing to its much more electrophilic σ-hole.

  7. The reaction of astatine with aromatic diazonium compounds

    International Nuclear Information System (INIS)

    Visser, G.W.M.; Diemer, E.L.

    1982-01-01

    Astatine reacts prefrentially with that type of aromatic diazonium salt that decomposes via a radical reaction channel (homolytic breakage of the C-N bond). The dediazonation with p-aminobenzoic acid and p-toluidine as model compounds was investigated through estatin produced in the 209 Bi(α,2n) 211 At reaction. (author)

  8. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    Science.gov (United States)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Köster, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjödin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine. PMID:23673620

  9. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...... vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....

  10. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single...... to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3......-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison...

  11. Some aspects of the organic, biological and inorganic chemistry of astatine

    International Nuclear Information System (INIS)

    Visser, G.W.M.

    1982-01-01

    Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments ( 209 At, 210 At, 211 At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)

  12. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    International Nuclear Information System (INIS)

    Sjoestroem, A.; Carlsson, J.; Lundqvist, H.; Koziorowski, J.

    2003-01-01

    A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)

  13. Estimation of the chemical form and the boiling point of elementary astatine by radiogas-chromatography

    International Nuclear Information System (INIS)

    Otozai, K.; Takahashi, N.

    1982-01-01

    After astatine (0) was mixed with 131 I 2 containing carrier I 2 , the sample was analyzed by means of radiogaschromatography and the peaks due to I 2 , AtI and At 2 were observed. Further, the boiling points were estimated from the retention volume in terms of the semi-empirical theory on gas chromatography. The boiling points of I 2 , AtI and At 2 were 457 +- 2,486 +- 2 and 503 +- 3K, respectively. The boiling point of At 2 obtained in the present work is far smaller than that expected by the extrapolation of lighter halogens. (orig.)

  14. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    Czech Academy of Sciences Publication Activity Database

    Sjostrom, A.; Tolmachev, V.; Lebeda, Ondřej; Koziorowski, J.; Carlsson, J.; Lundqvist, H.

    2003-01-01

    Roč. 256, č. 7 (2003), s. 191-197 ISSN 0236-5731 R&D Projects: GA AV ČR KSK4055109 Keywords : neutron-capture therapy * astatine-211 Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.472, year: 2003

  15. 211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    Pruszynski, M.; Bilewicz, A.

    2006-01-01

    211 At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211 At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At - to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh 3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At - anions, but first of all because of the kinetic inertness of low spin rhodium(III) d 6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh 3+ . The experiments related to optimization of the reaction conditions were performed with the 131 I, basing on a chemical similarity of I - to At - . The experiments with 211 At were then carried out under the conditions found optimal for I - . The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211 At-Rh(16-S4-diol) complex

  16. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  17. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  18. Thermogravimetric determination of the enthalpy of astatine and radon adsorption on palladium surfaces

    International Nuclear Information System (INIS)

    Eichler, B.; Son Chun, K.

    1985-01-01

    In order to investigate the adsorption of astatine and radon on a palladium surface some on- and off-line thermochromatographic experiments were carried out with 210 At and 220 Rn tracers. The partial molar adsorption enthalpy for zero covering was found to be ΔH/sub a//sup 0, loc./(At) = -(15S +- 10) kJ mole -1 and ΔH/sub a//sup 0, mob./(Rn) = -(37 +- 4) kJ mole -1 . The results are compared with theoretical and experimental values for other elements of the sixth period. The adsorption behaviour of At is in conformity with that of the p-metals on a palladium surface. (author)

  19. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  20. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    International Nuclear Information System (INIS)

    Lahiri, Susanta; Roy, Kamalika; Sen, Souvik

    2008-01-01

    No-carrier-added astatine radionuclides produced in the 7 Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about ∼12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h

  1. Astatine-211 Radiochemistry: The Development Of Methodologies For High Activity Level Radiosynthesis

    International Nuclear Information System (INIS)

    Zalutsky, Michael R.

    2012-01-01

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for α-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the α-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At-labeled targeted

  2. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  3. Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

    CERN Document Server

    Andreyev, Andrei

    2013-01-01

    Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

  4. In vitro evaluation of the astatinated chimeric monoclonal antibody U36, a potential candidate for treatment of head and neck squamous cell carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Nestor, M.; Anniko, M. [Uppsala University, Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala (Sweden); Persson, M. [Uppsala University, Unit of Urology, Department of Surgical Sciences, Uppsala (Sweden); Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden); Dongen, G.A.M.S. van [Vrije Universiteit Medical Center, Department of Otolaryngology/Head and Neck Surgery, Amsterdam (Netherlands); Jensen, H.J. [Righshospitalet, PET and Cyclotron Unit, Department of Clinical Physiology and Nuclear Medicine, Copenhagen (Denmark); Lundqvist, H.; Tolmachev, V. [Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden)

    2005-11-01

    The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with {sup 211}At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with {sup 125}I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with {sup 131}I-labelled cMAb U36 (directly labelled). Comparisons between {sup 211}At-cMAb U36 and {sup 125}I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31{+-}2% vs 42.6{+-}1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for {sup 211}At-cMAb U36, with about 10% cell survival at 50 decays per cell. The {sup 131}I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)

  5. In vitro evaluation of the astatinated chimeric monoclonal antibody U36, a potential candidate for treatment of head and neck squamous cell carcinoma

    International Nuclear Information System (INIS)

    Nestor, M.; Anniko, M.; Persson, M.; Dongen, G.A.M.S. van; Jensen, H.J.; Lundqvist, H.; Tolmachev, V.

    2005-01-01

    The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with 211 At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with 125 I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with 131 I-labelled cMAb U36 (directly labelled). Comparisons between 211 At-cMAb U36 and 125 I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31±2% vs 42.6±1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for 211 At-cMAb U36, with about 10% cell survival at 50 decays per cell. The 131 I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)

  6. 46 CFR 10.214 - Security Check.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Security Check. 10.214 Section 10.214 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY MERCHANT MARINE OFFICERS AND SEAMEN MERCHANT MARINER CREDENTIAL General Requirements for All Merchant Mariner Credentials § 10.214 Security Check. Until April 15, 2009...

  7. 24 CFR 884.214 - Marketing.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Marketing. 884.214 Section 884.214... HOUSING PROJECTS Project Development and Operation § 884.214 Marketing. (a) Compliance with equal opportunity requirements. Marketing of units and selection of Families by the Owner shall be in accordance...

  8. 49 CFR 195.214 - Welding procedures.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Welding procedures. 195.214 Section 195.214... PIPELINE Construction § 195.214 Welding procedures. (a) Welding must be performed by a qualified welder in accordance with welding procedures qualified under Section 5 of API 1104 or Section IX of the ASME Boiler and...

  9. 49 CFR 214.4 - Preemptive effect.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Preemptive effect. 214.4 Section 214.4 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY General § 214.4 Preemptive effect. Under 49 U.S.C...

  10. 33 CFR 214.11 - Costs.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Costs. 214.11 Section 214.11... SUPPLIES OF DRINKING WATER § 214.11 Costs. Costs incurred by the Corps of Engineers in furnishing emergency... by the community generally will not be required. Costs of necessary measures for the decontamination...

  11. 49 CFR 214.323 - Foul time.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Foul time. 214.323 Section 214.323 Transportation... TRANSPORTATION RAILROAD WORKPLACE SAFETY Roadway Worker Protection § 214.323 Foul time. Working limits established on controlled track through the use of foul time procedures shall comply with the following...

  12. 24 CFR 214.500 - Audit.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Audit. 214.500 Section 214.500... PROGRAM Other Federal Requirements § 214.500 Audit. Housing counseling grant recipients and subrecipients shall be subject to the audit requirements contained in 24 CFR parts 84 and 85. HUD must be provided a...

  13. 49 CFR 214.325 - Train coordination.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY Roadway Worker Protection § 214.325 Train coordination. Working limits established by a roadway worker through the use of train coordination shall comply with the... 49 Transportation 4 2010-10-01 2010-10-01 false Train coordination. 214.325 Section 214.325...

  14. Valence configurations in 214Rn

    International Nuclear Information System (INIS)

    Dracoulis, G.D.; Byrne, A.P.; Stuchbery, A.E.; Bark, R.A.; Poletti, A.R.

    1987-01-01

    Excited states of 214 Rn, up to spins of ≅ 24 ℎ have been studied using γ-ray and electron spectroscopy following the 208 Pb( 9 Be,3n) 214 Rn reaction. The level scheme (which differs substantially from earlier work) is compared with the results of a semi-empirical shell model calculation. The availability of high-spin orbitals for the four valence protons and two valence neutrons, and the effect of the attractive proton-neutron interaction, leads to the prediction of high-spin states at an unusually low excitation energy. Experimentally, the high level density leads to difficulties in the level scheme assignments at high spin. Nevertheless, configuration assignments, supported by transition strengths deduced from the measured lifetimes (in the nanosecond region) are suggested for the main yrast states. The decay properties also suggest that configuration mixing is important. The possibility of a gradual transition to octupole deformation, implied by the decay properties of the 11 - and 10 + yrast states is also discussed. (orig.)

  15. High-efficiency astatination of antibodies using N-iodosuccinimide as the oxidising agent in labelling of N-succinimidyl 3-(trimethylstannyl)benzoate

    International Nuclear Information System (INIS)

    Lindegren, S.; Andersson, H.; Baeck, T.; Jacobsson, L.; Karlsson, B.; Skarnemark, G.

    2001-01-01

    Monoclonal antibodies C215, reactive with colorectal carcinomas, and MOv18, reactive with most of the ovarian carcinomas, were radiohalogenated with [ 211 At]astatine. The radiohalogen was conjugate coupled to antibodies via the intermediate labelling reagent N-succinimidyl-3-(trimethylstannyl)benzoate (m-MeATE) in a two-step, single-pot reaction. Optimisation of the labelling of the reagent was achieved using N-iodosuccinimide, NIS, as the oxidising agent. The yields ranged from 69-95% in the labelling of 0.1-1.0 nmole of the m-MeATE precursor. Subsequent conjugation to antibodies resulted in yields of 58±7%. In vitro binding to tumour cells showed that the immunoreactivity of both antibodies was retained after astatine labelling

  16. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  17. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    International Nuclear Information System (INIS)

    Rothe, Sebastian

    2012-01-01

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  18. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  19. 25 CFR 214.1 - Definition.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Definition. 214.1 Section 214.1 Indians BUREAU OF INDIAN... MINING, EXCEPT OIL AND GAS § 214.1 Definition. The term “officer in charge” shall refer to the... time, be in charge of the Osage Agency and school, or any person who may be detailed by the Secretary...

  20. Radiobiological Effects of Alpha-Particles from Astatine-211: From DNA Damage to Cell Death

    Energy Technology Data Exchange (ETDEWEB)

    Claesson, Kristina

    2011-05-15

    In recent years, the use of high linear energy transfer (LET) radiation for radiotherapeutic applications has gained increased interest. Astatine-211 (211At) is an alpha-particle emitting radionuclide, promising for targeted radioimmunotherapy of isolated tumor cells and microscopic clusters. To improve development of safe radiotherapy using 211At it is important to increase our knowledge of the radiobiological effects in cells. During radiotherapy, both tumors and adjacent normal tissue will be irradiated and therefore, it is of importance to understand differences in the radio response between proliferating and resting cells. The aim of this thesis was to investigate effects in fibroblasts with different proliferation status after irradiation with alpha-particles from 211At or X-rays, from inflicted DNA damage, to cellular responses and biological consequences. Throughout this work, irradiation was performed with alpha-particles from 211A or X-rays. The induction and repair of double-strand breaks (DSBs) in human normal fibroblasts were investigated using pulsed-field gel electrophoresis and fragment analysis. The relative biological effectiveness (RBE) of 211At for DSB induction varied between 1.4 and 3.1. A small increase of DSBs was observed in cycling cells compared to stationary cells. The repair kinetics was slower after 211At and more residual damage was found after 24 h. Comparison between cells with different proliferation status showed that the repair was inefficient in cycling cells with more residual damage, regardless of radiation quality. Activation of cell cycle arrests was investigated using immunofluorescent labeling of the checkpoint kinase Chk2 and by measuring cell cycle distributions with flow cytometry analysis. After alpha-particle irradiation, the average number of Chk2-foci was larger and the cells had a more affected cell cycle progression for several weeks compared with X-irradiated cells, indicating a more powerful arrest after 211At

  1. 12 CFR 21.4 - Report.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Report. 21.4 Section 21.4 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY MINIMUM SECURITY DEVICES AND PROCEDURES, REPORTS OF... Report. The security officer for a national bank shall report at least annually to the bank's board of...

  2. 47 CFR 214.1 - Purpose.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Purpose. 214.1 Section 214.1 Telecommunication OFFICE OF SCIENCE AND TECHNOLOGY POLICY AND NATIONAL SECURITY COUNCIL PROCEDURES FOR THE USE AND... provide guidance for the use of the radio spectrum in a period of war, or a threat of war, or a state of...

  3. 49 CFR 214.113 - Head protection.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Head protection. 214.113 Section 214.113 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... conform to the national consensus standards for industrial head protection (American National Standards...

  4. 49 CFR 214.115 - Foot protection.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Foot protection. 214.115 Section 214.115... protection. (a) The railroad or railroad contractor shall require railroad bridge workers to wear foot protection equipment when potential foot injury may result from impact, falling or flying objects, electrical...

  5. 24 CFR 214.311 - Funding.

    Science.gov (United States)

    2010-04-01

    ... Internet or other electronic media. (b) Local funding sources. HUD recommends that approved agencies seek and secure funding from funding sources that may include local and state governments, private... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Funding. 214.311 Section 214.311...

  6. 29 CFR 553.214 - Trainees.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Trainees. 553.214 Section 553.214 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS APPLICATION OF THE FAIR LABOR STANDARDS ACT TO EMPLOYEES OF STATE AND LOCAL GOVERNMENTS Fire Protection and Law...

  7. 49 CFR 384.214 - Reciprocity.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Reciprocity. 384.214 Section 384.214 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL MOTOR CARRIER SAFETY... Reciprocity. The State shall allow any person to operate a CMV in the State who is not disqualified from...

  8. 33 CFR 214.9 - Requirements.

    Science.gov (United States)

    2010-07-01

    ... included in the evaluation. (a) Whether the criteria required by the law and outlined in § 214.6 have been... other than negligence attributable to the United States or its contractor. (3) To maintain and operate...

  9. Dicty_cDB: SLH214 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH214 (Link to dictyBase) - - - Contig-U16455-1 SLH214E (Link... to Original site) - - - - - - SLH214E 308 Show SLH214 Library SL (Link to library) Clone ID SLH214 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH214Q.Seq.d/ Representative seq. ID SLH21...4E (Link to Original site) Representative DNA sequence >SLH214 (SLH214Q) /CSM/SL/SLH2-A/SLH214Q.Seq.d/ GTTGA...a: 0.00 m3b: 0.00 m_ : 1.00 48.0 %: nuclear 28.0 %: mitochondrial 20.0 %: cytoplasmic 4.0 %: peroxisomal >> prediction for SLH2

  10. 24 CFR 214.315 - Recordkeeping.

    Science.gov (United States)

    2010-04-01

    ... of clients with the same housing need. (f) Group education file. The housing counseling agency must... COUNSELING PROGRAM Program Administration § 214.315 Recordkeeping. (a) Recordkeeping system. Each participating housing counseling agency must maintain a recordkeeping system. The system must permit HUD to...

  11. 24 CFR 214.300 - Counseling services.

    Science.gov (United States)

    2010-04-01

    ... to provide specified types of counseling nationally. (6) All participating agencies that offer group educational sessions must also offer individual counseling on the same topics covered in the group educational... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Counseling services. 214.300...

  12. 33 CFR 214.6 - Discussion.

    Science.gov (United States)

    2010-07-01

    ... providing emergency supplies of clean drinking water. Sewage treatment and disposal, and other sanitary... with contamination of water used in its process is not eligible. The drinking water used by the people... SUPPLIES OF DRINKING WATER § 214.6 Discussion. (a) The amendment provides for furnishing emergency supplies...

  13. 50 CFR 216.214 - Prohibitions.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance Activities Conducted During Offshore Structure Removal Operations on the Outer Continental Shelf in the U.S. Gulf of Mexico § 216.214 Prohibitions. No...

  14. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  15. 48 CFR 12.214 - Cost Accounting Standards.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Cost Accounting Standards. 12.214 Section 12.214 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION... Items 12.214 Cost Accounting Standards. Cost Accounting Standards (CAS) do not apply to contracts and...

  16. 49 CFR 214.523 - Hi-rail vehicles.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Hi-rail vehicles. 214.523 Section 214.523..., DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY On-Track Roadway Maintenance Machines and Hi-Rail Vehicles § 214.523 Hi-rail vehicles. (a) The hi-rail gear of all hi-rail vehicles shall be inspected for...

  17. 30 CFR 77.214 - Refuse piles; general.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Refuse piles; general. 77.214 Section 77.214... Installations § 77.214 Refuse piles; general. (a) Refuse piles constructed on or after July 1, 1971, shall be..., tipples, or other surface installations and such piles shall not be located over abandoned openings or...

  18. 22 CFR 214.37 - Public access to committee records.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Public access to committee records. 214.37 Section 214.37 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ADVISORY COMMITTEE MANAGEMENT Operation of Advisory Committees § 214.37 Public access to committee records. Records maintained in...

  19. 22 CFR 214.42 - Uniform pay guidelines.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Uniform pay guidelines. 214.42 Section 214.42... Advisory Committees § 214.42 Uniform pay guidelines. (a) A.I.D. follows OMB/CSC guidelines in section 11 of... experts, their compensation shall be fixed in accordance with CSC guidelines and regulations, and the...

  20. 36 CFR 2.14 - Sanitation and refuse.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Sanitation and refuse. 2.14 Section 2.14 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR RESOURCE PROTECTION, PUBLIC USE AND RECREATION § 2.14 Sanitation and refuse. (a) The following are...

  1. 49 CFR 214.117 - Eye and face protection.

    Science.gov (United States)

    2010-10-01

    ... corrective lenses, when required by this section to wear eye protection, shall be protected by goggles or... 49 Transportation 4 2010-10-01 2010-10-01 false Eye and face protection. 214.117 Section 214.117..., DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY Bridge Worker Safety Standards § 214.117 Eye and face...

  2. 48 CFR 214.202-5 - Descriptive literature.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Descriptive literature. 214.202-5 Section 214.202-5 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS... 214.202-5 Descriptive literature. (c) Requirements of invitation for bids. When brand name or equal...

  3. 48 CFR 5433.214. - Alternative Dispute Resolution (ADR).

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Alternative Dispute Resolution (ADR). 5433.214. Section 5433.214. Federal Acquisition Regulations System DEFENSE LOGISTICS AGENCY, DEPARTMENT OF DEFENSE PROTESTS, DISPUTES AND APPEALS 5433.214. Alternative Dispute Resolution (ADR). The...

  4. Spectroscopy of 214Bi and systematics of 210,212,214Pb(0+) long->β-210,212,214Bi(0-)

    International Nuclear Information System (INIS)

    Berant, Z.; Schuhmann, R.B.; Alburger, D.E.; Chou, W.T.; Gill, R.L.; Warburton, E.K.; Wesselborg, C.

    1991-01-01

    Experiments designed to provide more information on the spectroscopy of 214 Bi, and on 214 Pb(β - ) 214 Bi in particular, were undertaken because of interest in first-forbidden β decay in the lead region. The experiments consisted of γ-γ coincidences and angular correlations, conversion electron measurements, level lifetime determinations, and precision γ-ray energy measurements. The 352-keV level of 214 Bi was found to be a strong candidate (and the only candidate) for the 0 1 - state. Recent additions to the 214 Pb decay scheme are confirmed by γ-γ coincidence measurements. A careful evaluation of the 214 Bi level scheme is made with emphasis on separating experimentally based conclusions from speculations based on systematics and other ''weak'' arguments. Shell-model calculations of the spectroscopy of 210,212 Bi and 210,212 Pb(β - ) 210,212 Bi were performed using a modification of the Kuo-Herling realistic interaction. These calculations and a generalized seniority model provide a basis for an examination of the systematics of the A=210, 212, 214 spectroscopy and β decay. The generalized seniority model is found to be a quite good approximation which provides a quantitative understanding of the 214 Pb decay rates

  5. 32 CFR Appendix A to Part 45 - DD Form 214

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false DD Form 214 A Appendix A to Part 45 National... CERTIFICATE OF RELEASE OR DISCHARGE FROM ACTIVE DUTY (DD FORM 214/5 SERIES) Pt. 45, App. A Appendix A to Part 45—DD Form 214 EC23OC91.003 EC23OC91.004 EC23OC91.005 EC23OC91.006 [54 FR 9985, Mar. 9, 1989] ...

  6. 49 CFR 214.311 - Responsibility of employers.

    Science.gov (United States)

    2010-10-01

    ... Responsibility of employers. (a) Each employer is responsible for the understanding and compliance by its employees with its rules and the requirements of this part. (b) Each employer shall guarantee each employee... 49 Transportation 4 2010-10-01 2010-10-01 false Responsibility of employers. 214.311 Section 214...

  7. 7 CFR 58.214 - General construction, repair and installation.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false General construction, repair and installation. 58.214... Service 1 Equipment and Utensils § 58.214 General construction, repair and installation. All equipment and utensils necessary to the manufacture of dry milk products, including pasteurizer, timing-pump or device...

  8. 25 CFR 214.13 - Diligence; annual expenditures; mining records.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Diligence; annual expenditures; mining records. 214.13... OSAGE RESERVATION LANDS, OKLAHOMA, FOR MINING, EXCEPT OIL AND GAS § 214.13 Diligence; annual expenditures; mining records. (a) Lessees shall exercise diligence in the conduct of prospecting and mining...

  9. 24 CFR 214.313 - Housing counseling fees.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Housing counseling fees. 214.313... HOUSING COUNSELING PROGRAM Program Administration § 214.313 Housing counseling fees. (a) Participating agencies may charge reasonable and customary fees for housing education and counseling services, as long as...

  10. 49 CFR 214.331 - Definite train location.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Definite train location. 214.331 Section 214.331... location. A roadway worker may establish on-track safety by using definite train location only where... may only use definite train location to establish on-track safety at points where such procedures were...

  11. 5 CFR 531.214 - Setting pay upon promotion.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Setting pay upon promotion. 531.214... Changes § 531.214 Setting pay upon promotion. (a) General. An agency must set an employee's payable rate of basic pay upon promotion following the rules in this section, consistent with 5 U.S.C. 5334(b...

  12. 49 CFR 214.341 - Roadway maintenance machines.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Roadway maintenance machines. 214.341 Section 214... Roadway maintenance machines. (a) Each employer shall include in its on-track safety program specific provisions for the safety of roadway workers who operate or work near roadway maintenance machines. Those...

  13. 49 CFR 214.345 - Training for all roadway workers.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Training for all roadway workers. 214.345 Section... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY Roadway Worker Protection § 214.345 Training for all roadway workers. The training of all roadway workers shall include, as a minimum, the...

  14. 49 CFR 214.343 - Training and qualification, general.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Training and qualification, general. 214.343... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY Roadway Worker Protection § 214.343 Training and qualification, general. (a) No employer shall assign an employee to perform the duties of a...

  15. 49 CFR 214.351 - Training and qualification of flagmen.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Training and qualification of flagmen. 214.351... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY Roadway Worker Protection § 214.351 Training and qualification of flagmen. (a) The training and qualification for roadway workers assigned the...

  16. 5 CFR 591.214 - How does OPM collect prices?

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false How does OPM collect prices? 591.214 Section 591.214 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS ALLOWANCES AND DIFFERENTIALS Cost-of-Living Allowance and Post Differential-Nonforeign Areas Cost-Of-Living...

  17. 31 CFR 800.214 - Foreign government-controlled transaction.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Foreign government-controlled transaction. 800.214 Section 800.214 Money and Finance: Treasury Regulations Relating to Money and Finance... control of a U.S. business by a foreign government or a person controlled by or acting on behalf of a...

  18. 40 CFR 211.214 - Removal of label.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Removal of label. 211.214 Section 211... PRODUCT NOISE LABELING Hearing Protective Devices § 211.214 Removal of label. Section 10(a)(4) of the Act prohibits any person from removing, prior to sale, any label required by this subpart, by either physical...

  19. 40 CFR 86.214-94 - Analytical gases.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Analytical gases. 86.214-94 Section 86.214-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED... Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty...

  20. 34 CFR 668.214 - Participation rate index appeals.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 3 2010-07-01 2010-07-01 false Participation rate index appeals. 668.214 Section 668... § 668.214 Participation rate index appeals. (a) Eligibility. (1) You may appeal a notice of a loss of... rate index for that cohort's fiscal year is equal to or less than 0.06015. (2) You may appeal a notice...

  1. 49 CFR 214.5 - Responsibility for compliance.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY General § 214.5 Responsibility for compliance. Any... railroad; a manager, supervisor, official, or other employee or agent of a railroad; any owner...

  2. 14 CFR 1274.214 - Inquiries and release of information.

    Science.gov (United States)

    2010-01-01

    ... AGREEMENTS WITH COMMERCIAL FIRMS Pre-Award Requirements § 1274.214 Inquiries and release of information. NASA personnel shall follow the procedures established in NFS 1805.402 prior to releasing information to the news...

  3. 47 CFR 90.214 - Transient frequency behavior.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Transient frequency behavior. 90.214 Section 90... PRIVATE LAND MOBILE RADIO SERVICES General Technical Standards § 90.214 Transient frequency behavior... Behavior for Equipment Designed to Operate on 25 kHz Channels t1 4 ±25.0 kHz 5.0 ms 10.0 ms t2 ±12.5 kHz 20...

  4. 5 CFR 214.402 - Career reserved positions.

    Science.gov (United States)

    2010-01-01

    ... collection of taxes and the preparation or review of interpretative opinions. (2) Career reserved positions... review agency designations of general and career reserved positions. If the Office finds that an agency... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Career reserved positions. 214.402...

  5. 48 CFR 852.214-72 - Alternate item(s).

    Science.gov (United States)

    2010-10-01

    ... AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 852.214-72... 2008) Bids on []* will be given equal consideration along with bids on []** and any such bids received... [].** * Contracting officer will insert an alternate item that is considered acceptable. ** Contracting officer will...

  6. Lukas 2:14 vanuit 'n Joods-Christelike perspektief

    African Journals Online (AJOL)

    A concordance to the Septuagint, Vol L Graz: Akademische Druck- u Verlagsanstalt. Jeremias, J 1980. Die sprache des Lukasevangeliums. Gottingen; Vandenhoeck &. Ruprecht. Kilpatrick, R S 1988. The Greek syntax of Luke 2:14. NTS 34,472-475. Maier, G 1991. Lukas-Evangelium, 1 Teil. Neuhausen-Stuttgart: Hanssler.

  7. 9 CFR 113.214 - Parvovirus Vaccine, Killed Virus (Canine).

    Science.gov (United States)

    2010-01-01

    ... REQUIREMENTS Killed Virus Vaccines § 113.214 Parvovirus Vaccine, Killed Virus (Canine). Parvovirus Vaccine... antibody against canine parvovirus to determine susceptibility. A constant virus-varying serum... vaccinates and the controls shall be challenged with virulent canine parvovirus furnished or approved by...

  8. 29 CFR 779.214 - “Business” purpose.

    Science.gov (United States)

    2010-07-01

    ... RETAILERS OF GOODS OR SERVICES Employment to Which the Act May Apply; Enterprise Coverage Common Business Purpose § 779.214 “Business” purpose. The activities described in section 3(r) are included in an enterprise only when they are performed for a “business” purpose. Activities of eleemosynary, religious, or...

  9. 50 CFR 226.214 - Critical habitat for Gulf sturgeon.

    Science.gov (United States)

    2010-10-01

    ... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS DESIGNATED CRITICAL HABITAT § 226.214... Sound or the Gulf of Mexico. The Withlacoochee River main stem from Florida State Road 6, Madison and...) Unit 11: Florida Nearshore Gulf of Mexico Unit in Escambia, Santa Rosa, Okaloosa, Walton, Bay, and Gulf...

  10. 24 CFR 214.105 - Preliminary application process.

    Science.gov (United States)

    2010-04-01

    ... program, SHFAs must either submit a request and provide HUD with a list of affiliates, if applicable, and... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES HOUSING COUNSELING PROGRAM Approval and Disapproval of Housing Counseling Agencies § 214.105...

  11. 24 CFR 214.305 - Agency profile changes.

    Science.gov (United States)

    2010-04-01

    ...) of its branches and affiliates; (2) Staff personnel responsible for the Housing Counseling program... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES HOUSING COUNSELING PROGRAM Program Administration § 214.305 Agency profile changes. Participating agencies...

  12. 41 CFR 101-29.214 - Commercial-type product.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Commercial-type product... Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 29-FEDERAL PRODUCT DESCRIPTIONS 29.2-Definitions § 101-29.214 Commercial-type product. A commercial-type product is defined as: (a...

  13. 27 CFR 24.214 - Spanish type blending sherry.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Spanish type blending... BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Production of Other Than Standard Wine § 24.214 Spanish..., produced under this section, is designated “Spanish Type Blending Sherry.” Upon removal, the shipping...

  14. Development of an atmospheric 214Bi measuring instrument

    International Nuclear Information System (INIS)

    1975-01-01

    Part of the radiation environment encountered during airborne gamma ray surveys is produced by 214 Bi existing in the atmosphere. The 214 Bi atmospheric concentration changes with time and location, and should be measured to process the acquired data correctly. Three methods of atmospheric 214 Bi measurement are evaluated in this work. These are: (1) an 11 1 / 2 '' dia. x 4'' thick NaI(Tl) crystal shielded from ground radiation, (2) a negatively charged wire to collect radioactive ions, and (3) a high volume air sampler collecting particulate matter on filter paper. The shielded detector and filter paper methods yield good results with the shielded detector producing a factor of about 10 times higher counting rate. The charged wire method gave very low counting rates where the shielded detector counting rates were about a factor of 100 times higher, and the results did not correlate with the 214 Bi atmospheric concentration as determined by the other two methods. The theory necessary to understand the collection and decay of the airborne radioactivity using the charged wire and filter paper methods is developed

  15. 22 CFR 1203.735-214 - Transmitting communications and gifts.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Transmitting communications and gifts. 1203.735....735-214 Transmitting communications and gifts. (a) Correspondence. In corresponding with anyone other... it to be clearly in the public interest to do so. (c) Gifts. An employee shall not act as an agent...

  16. 48 CFR 52.214-21 - Descriptive Literature.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Descriptive Literature. 52....214-21 Descriptive Literature. As prescribed in 14.201-6(p)(1), insert the following provision: Descriptive Literature (APR 2002) (a) Descriptive literature, as used in this provision, means information...

  17. 48 CFR 1433.214 - Alternative dispute resolution (ADR).

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Alternative dispute... GENERAL CONTRACTING REQUIREMENTS PROTESTS, DISPUTES, AND APPEALS Disputes and Appeals 1433.214 Alternative dispute resolution (ADR). DOI strongly encourages the use of ADR in the resolution of disputes in lieu of...

  18. 48 CFR 33.214 - Alternative dispute resolution (ADR).

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Alternative dispute... GENERAL CONTRACTING REQUIREMENTS PROTESTS, DISPUTES, AND APPEALS Disputes and Appeals 33.214 Alternative dispute resolution (ADR). (a) The objective of using ADR procedures is to increase the opportunity for...

  19. 48 CFR 3033.214 - Alternative dispute resolution (ADR).

    Science.gov (United States)

    2010-10-01

    ..., DISPUTES, AND APPEALS Disputes and Appeals 3033.214 Alternative dispute resolution (ADR). (c) The Administrative Dispute Resolution Act (ADRA) of 1996, as amended, 5 U.S.C. 571, et seq., authorizes and... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Alternative dispute...

  20. An analysis of 214 cases of rib fractures

    OpenAIRE

    Karadayi, Sule; Nadir, Aydin; Sahin, Ekber; Celik, Burcin; Arslan, Sulhattin; Kaptanoglu, Melih

    2011-01-01

    INTRODUCTION: Rib fractures are the most common type of injury associated with trauma to the thorax. In this study, we investigated whether morbidity and mortality rates increased in correlation with the number of fractured ribs. MATERIALS AND METHODS: Data from 214 patients with rib fractures who applied or were referred to our clinic between January 2007 and December 2008 were retrospectively evaluated. The patients were allocated into three groups according to the number of fractures: 1) p...

  1. 48 CFR 1552.214-71 - Contract award-other factors-formal advertising.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Contract award-other factors-formal advertising. 1552.214-71 Section 1552.214-71 Federal Acquisition Regulations System ENVIRONMENTAL PROTECTION AGENCY CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 1552.214-71 Contract...

  2. 49 CFR 214.507 - Required safety equipment for new on-track roadway maintenance machines.

    Science.gov (United States)

    2010-10-01

    ... maintenance machines. 214.507 Section 214.507 Transportation Other Regulations Relating to Transportation... Roadway Maintenance Machines and Hi-Rail Vehicles § 214.507 Required safety equipment for new on-track roadway maintenance machines. (a) Each new on-track roadway maintenance machine shall be equipped with: (1...

  3. 49 CFR 214.513 - Retrofitting of existing on-track roadway maintenance machines; general.

    Science.gov (United States)

    2010-10-01

    ... maintenance machines; general. 214.513 Section 214.513 Transportation Other Regulations Relating to... SAFETY On-Track Roadway Maintenance Machines and Hi-Rail Vehicles § 214.513 Retrofitting of existing on-track roadway maintenance machines; general. (a) Each existing on-track roadway maintenance machine...

  4. 49 CFR 214.515 - Overhead covers for existing on-track roadway maintenance machines.

    Science.gov (United States)

    2010-10-01

    ... maintenance machines. 214.515 Section 214.515 Transportation Other Regulations Relating to Transportation... Roadway Maintenance Machines and Hi-Rail Vehicles § 214.515 Overhead covers for existing on-track roadway maintenance machines. (a) For those existing on-track roadway maintenance machines either currently or...

  5. 48 CFR 52.214-34 - Submission of Offers in the English Language.

    Science.gov (United States)

    2010-10-01

    ... the English Language. 52.214-34 Section 52.214-34 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.214-34 Submission of Offers in the English Language. As prescribed in 14.201-6(w), insert the following provision: Submission of Offers in the English Language (APR 1991) Offers submitted...

  6. 13 CFR 120.214 - What conditions apply for variable interest rates?

    Science.gov (United States)

    2010-01-01

    ... interest rates? 120.214 Section 120.214 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Policies Specific to 7(a) Loans Maturities; Interest Rates; Loan and Guarantee Amounts § 120.214 What conditions apply for variable interest rates? A Lender may use a variable rate of interest...

  7. 22 CFR 214.38 - Submission of reports to the Library of Congress.

    Science.gov (United States)

    2010-04-01

    ... Congress. 214.38 Section 214.38 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ADVISORY COMMITTEE MANAGEMENT Operation of Advisory Committees § 214.38 Submission of reports to the Library of Congress. (a) Each advisory committee is to file with the Library of Congress eight copies of each of its reports...

  8. 22 CFR 214.51 - Administrative review of denial for public access to records.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Administrative review of denial for public access to records. 214.51 Section 214.51 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ADVISORY COMMITTEE MANAGEMENT Administrative Remedies § 214.51 Administrative review of denial for public access to...

  9. 32 CFR Appendix B to Part 45 - DD Form 214ws

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false DD Form 214ws B Appendix B to Part 45 National... CERTIFICATE OF RELEASE OR DISCHARGE FROM ACTIVE DUTY (DD FORM 214/5 SERIES) Pt. 45, App. B Appendix B to Part 45—DD Form 214ws EC23OC91.007 ...

  10. 8 CFR 214.14 - Alien victims of certain qualifying criminal activity.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Alien victims of certain qualifying criminal activity. 214.14 Section 214.14 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS NONIMMIGRANT CLASSES § 214.14 Alien victims of certain qualifying criminal activity. (a...

  11. 27 CFR 555.214 - Storage within types 1, 2, 3, and 4 magazines.

    Science.gov (United States)

    2010-04-01

    ..., 3, and 4 magazines. 555.214 Section 555.214 Alcohol, Tobacco Products, and Firearms BUREAU OF... Storage § 555.214 Storage within types 1, 2, 3, and 4 magazines. (a) Explosive materials within a magazine... materials are not to be unpacked or repacked inside a magazine or within 50 feet of a magazine, and must not...

  12. 12 CFR 347.214 - Branch established under section 5 of the International Banking Act.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Branch established under section 5 of the International Banking Act. 347.214 Section 347.214 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION REGULATIONS AND STATEMENTS OF GENERAL POLICY INTERNATIONAL BANKING Foreign Banks § 347.214 Branch established...

  13. 48 CFR 1852.214-70 - Caution to offerors furnishing descriptive literature.

    Science.gov (United States)

    2010-10-01

    ... furnishing descriptive literature. 1852.214-70 Section 1852.214-70 Federal Acquisition Regulations System... CLAUSES Texts of Provisions and Clauses 1852.214-70 Caution to offerors furnishing descriptive literature... Descriptive Literature (DEC 1988) Bidders are cautioned against furnishing as a part of their bids descriptive...

  14. Quantification of the 214 Pb and 214 Bi decay products before and after to reach the secular equilibria with the 226 Ra

    International Nuclear Information System (INIS)

    Quintero P, E.; Rojas M, V.P.; Cervantes N, M.L.; Gaso P, M.I.

    2002-01-01

    In this work a comparison between the 226 Ra concentration and its decay products ( 214 Pb and 214 Bi) in soil samples is presented before and after that the decay mentioned products reach the equilibria with the radium. Moreover, the obtained daughter/father ratio is presented; and the correction factor for the calculus of the 214 Pb and 214 Bi quantification without being necessary to wait until that the secular equilibria has been established. For the quantification of the concentration of the three radionuclides the gamma spectrometry technique was used. (Author)

  15. Radon and progeny (214Pb and 214Bi) in urban water-supply systems of Sao Paulo State, Brazil

    International Nuclear Information System (INIS)

    Bonotto, Daniel Marcos; Padron-Armada, Priscilla Cardoso

    2008-01-01

    Many water-supply systems in South America utilize the waters of the Guarani aquifer at least as part of their networks. However, there is little present knowledge in Brazil of the factors affecting Rn presence in the water supplied for end-users, despite the economic importance of Guarani aquifer. 222 Rn analyzes of 162 water samples were performed at 8 municipalities in Sao Paulo State, Brazil, with the aim of investigating the major factors affecting its presence in solution. The 222 Rn activity concentration ranged from 0.04 up to 204.9 Bq/L, with three samples exceeding the World Health Organization maximum limit of 100 Bq/L. Aeration was confirmed as the most important factor for Rn release, as expected due to its gaseous nature. Accumulation in pipes and stratification in the water column were other significant factors explaining the data obtained in some circumstances. The Rn daughters 214 Pb and 214 Bi were also determined in a set of selected samples and their presence was directly related to the occurrence of Rn dissolved in water

  16. MicroRNA-214 suppresses gluconeogenesis by targeting activating transcriptional factor 4.

    Science.gov (United States)

    Li, Kai; Zhang, Jin; Yu, Junjie; Liu, Bin; Guo, Yajie; Deng, Jiali; Chen, Shanghai; Wang, Chunxia; Guo, Feifan

    2015-03-27

    Although the gluconeogenesis pathway is already a target for the treatment of type 2 diabetes, the potential role of microRNAs (miRNAs) in gluconeogenesis remains unclear. Here, we investigated the physiological functions of miR-214 in gluconeogenesis. The expression of miR-214 was suppressed by glucagon via protein kinase A signaling in primary hepatocytes, and miR-214 was down-regulated in the livers of fasted, high fat diet-induced diabetic and leptin receptor-mutated (db/db) mice. The overexpression of miR-214 in primary hepatocytes suppressed glucose production, and silencing miR-214 reversed this effect. Gluconeogenesis was suppressed in the livers of mice injected with an adenovirus expressing miR-214 (Ad-miR-214). Additionally, Ad-miR-214 alleviated high fat diet-induced elevation of gluconeogenesis and hyperglycemia. Furthermore, we found that activating transcription factor 4 (ATF4), a reported target of miR-214, can reverse the suppressive effect of miR-214 on gluconeogenesis in primary hepatocytes, and this suppressive effect was blocked in liver-specific ATF4 knock-out mice. ATF4 regulated gluconeogenesis via affecting forkhead box protein O1 (FOXO1) transcriptional activity. Finally, liver-specific miR-214 transgenic mice exhibited suppressed gluconeogenesis and reduced expression of ATF4, phosphoenolpyruvate carboxykinase, and glucose-6-phosphatase in liver. Taken together, our results suggest that the miR-214-ATF4 axis is a novel pathway for the regulation of hepatic gluconeogenesis. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.

  17. MicroRNA-214 Suppresses Gluconeogenesis by Targeting Activating Transcriptional Factor 4*

    Science.gov (United States)

    Li, Kai; Zhang, Jin; Yu, Junjie; Liu, Bin; Guo, Yajie; Deng, Jiali; Chen, Shanghai; Wang, Chunxia; Guo, Feifan

    2015-01-01

    Although the gluconeogenesis pathway is already a target for the treatment of type 2 diabetes, the potential role of microRNAs (miRNAs) in gluconeogenesis remains unclear. Here, we investigated the physiological functions of miR-214 in gluconeogenesis. The expression of miR-214 was suppressed by glucagon via protein kinase A signaling in primary hepatocytes, and miR-214 was down-regulated in the livers of fasted, high fat diet-induced diabetic and leptin receptor-mutated (db/db) mice. The overexpression of miR-214 in primary hepatocytes suppressed glucose production, and silencing miR-214 reversed this effect. Gluconeogenesis was suppressed in the livers of mice injected with an adenovirus expressing miR-214 (Ad-miR-214). Additionally, Ad-miR-214 alleviated high fat diet-induced elevation of gluconeogenesis and hyperglycemia. Furthermore, we found that activating transcription factor 4 (ATF4), a reported target of miR-214, can reverse the suppressive effect of miR-214 on gluconeogenesis in primary hepatocytes, and this suppressive effect was blocked in liver-specific ATF4 knock-out mice. ATF4 regulated gluconeogenesis via affecting forkhead box protein O1 (FOXO1) transcriptional activity. Finally, liver-specific miR-214 transgenic mice exhibited suppressed gluconeogenesis and reduced expression of ATF4, phosphoenolpyruvate carboxykinase, and glucose-6-phosphatase in liver. Taken together, our results suggest that the miR-214-ATF4 axis is a novel pathway for the regulation of hepatic gluconeogenesis. PMID:25657009

  18. "Neurologic complications in Hemophilia: A study in 214 cases "

    Directory of Open Access Journals (Sweden)

    Ghaffarpoor M

    2001-08-01

    Full Text Available Intracranial hemorrhage and entrapment neuropathy are the most serious and disabling complications in hemophilia.The occurance of these neurological complications was studied in 214 hemophiliac patients during a 3 month period. Nine patients (4.2% suffered intracranial hemorrhage (One epidural and others intracerebral. All of intracranial hemorrhage patients had the sevee form of disease (<1% factor VIII or IX. 6 out of 9 intracranial hemorrhage cases mentioned a history of head trauma. Entrapment neuropathy was presen in 10 patients (femoral neuropathy 5, ulnar n. 3, radial n. 1 median n. 1 all of entropament neuropathy patients described a history of trauma to the extremities. Eight patients in the latter group had severe disease and two patients had moderate disease (1-5%. The proportion of intracranial hemorrhage following head trauma (20% in this series was greater than other studies. In conclusion, early diagnostic evaluation and replacement therapy may be beneficial in hemophilic patients with trauma.

  19. Quantification of the {sup 214} Pb and {sup 214} Bi decay products before and after to reach the secular equilibria with the {sup 226} Ra; Cuantificacion de los productos de decaimiento {sup 214} Pb y {sup 214} Bi antes y despues de alcanzar el equilibrio secular con el {sup 226} Ra

    Energy Technology Data Exchange (ETDEWEB)

    Quintero P, E.; Rojas M, V.P.; Cervantes N, M.L.; Gaso P, M.I. [Gerencia de Seguridad Radiologica, ININ, A.P. 18-1027, 11801 Mexico D.F. (Mexico)

    2002-07-01

    In this work a comparison between the {sup 226} Ra concentration and its decay products ({sup 214} Pb and {sup 214} Bi) in soil samples is presented before and after that the decay mentioned products reach the equilibria with the radium. Moreover, the obtained daughter/father ratio is presented; and the correction factor for the calculus of the {sup 214} Pb and {sup 214} Bi quantification without being necessary to wait until that the secular equilibria has been established. For the quantification of the concentration of the three radionuclides the gamma spectrometry technique was used. (Author)

  20. 46 CFR 199.214 - Immersion suits and thermal protective aids.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Immersion suits and thermal protective aids. 199.214... Passenger Vessels § 199.214 Immersion suits and thermal protective aids. (a) Each passenger vessel must... an immersion suit. (c) The immersion suits and thermal protective aids required under paragraphs (a...

  1. 75 FR 55272 - Safety Zone; Mississippi River, Mile 212.0 to 214.5

    Science.gov (United States)

    2010-09-10

    ...-AA00 Safety Zone; Mississippi River, Mile 212.0 to 214.5 AGENCY: Coast Guard, DHS. ACTION: Temporary final rule. SUMMARY: The Coast Guard is establishing a temporary safety zone for waters of the Upper Mississippi River, Mile 212.0 to 214.5, extending West of Portage Island to the right descending bank of the...

  2. 49 CFR 214.529 - In-service failure of primary braking system.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false In-service failure of primary braking system. 214... Maintenance Machines and Hi-Rail Vehicles § 214.529 In-service failure of primary braking system. (a) In the event of a total in-service failure of its primary braking system, an on-track roadway maintenance...

  3. 40 CFR 98.214 - Monitoring and QA/QC requirements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Monitoring and QA/QC requirements. 98.214 Section 98.214 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... standard method or other enhanced industry consensus standard method published by an industry consensus...

  4. 9 CFR 93.214 - Import permit and declaration for poultry.

    Science.gov (United States)

    2010-01-01

    ... poultry. 93.214 Section 93.214 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE EXPORTATION AND IMPORTATION OF ANIMALS (INCLUDING POULTRY) AND ANIMAL PRODUCTS IMPORTATION OF CERTAIN ANIMALS, BIRDS, FISH, AND POULTRY, AND CERTAIN ANIMAL, BIRD, AND POULTRY PRODUCTS...

  5. 23 CFR 973.214 - Indian lands congestion management system (CMS).

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Indian lands congestion management system (CMS). 973.214... HIGHWAYS MANAGEMENT SYSTEMS PERTAINING TO THE BUREAU OF INDIAN AFFAIRS AND THE INDIAN RESERVATION ROADS PROGRAM Bureau of Indian Affairs Management Systems § 973.214 Indian lands congestion management system...

  6. 25 CFR 214.21 - Inspection of lessees' books and records.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Inspection of lessees' books and records. 214.21 Section... OSAGE RESERVATION LANDS, OKLAHOMA, FOR MINING, EXCEPT OIL AND GAS § 214.21 Inspection of lessees' books... premises for the purpose of inspection, and their books and records showing manner of operations and...

  7. 48 CFR 36.214 - Special procedures for price negotiation in construction contracting.

    Science.gov (United States)

    2010-10-01

    ... price negotiation in construction contracting. 36.214 Section 36.214 Federal Acquisition Regulations... negotiation in construction contracting. (a) Agencies shall follow the policies and procedures in part 15 when... scope of the work. If negotiations reveal errors in the Government estimate, the estimate shall be...

  8. An analysis of 214 cases of rib fractures

    Directory of Open Access Journals (Sweden)

    Sule Karadayi

    2011-01-01

    Full Text Available INTRODUCTION: Rib fractures are the most common type of injury associated with trauma to the thorax. In this study, we investigated whether morbidity and mortality rates increased in correlation with the number of fractured ribs. MATERIALS AND METHODS: Data from 214 patients with rib fractures who applied or were referred to our clinic between January 2007 and December 2008 were retrospectively evaluated. The patients were allocated into three groups according to the number of fractures: 1 patients with an isolated rib fracture (RF1 (n = 50, 23.4%, 2 patients with two rib fractures (RF2 (n = 53, 24.8%, and 3 patients with more than two rib fractures (RF3 (n = 111, 51.9%. The patients were evaluated and compared according to the number of rib fractures, mean age, associated chest injuries (hemothorax, pneumothorax, and/or pulmonary contusion, and co-existing injuries to other systems. FINDINGS: The mean age of the patients was 51.5 years. The distribution of associated chest injuries was 30% in group RF1, 24.6% in group RF2, and 75.6% in group RF3 (p<0.05. Co-existing injuries to other systems were 24% in group RF1, 23.2% in group RF2, and 52.6% in group RF3 (p<0.05. Two patients (4% in group RF1, 2 patients (3.8% in group RF2, and 5 patients (4.5% in group RF3 (total n = 9; 4.2% died. CONCLUSION: Patients with any number of rib fractures should be carefully screened for co-existing injuries in other body systems and hospitalized to receive proper treatment.

  9. 49 CFR 214.521 - Flagging equipment for on-track roadway maintenance machines and hi-rail vehicles.

    Science.gov (United States)

    2010-10-01

    ... maintenance machines and hi-rail vehicles. 214.521 Section 214.521 Transportation Other Regulations Relating... WORKPLACE SAFETY On-Track Roadway Maintenance Machines and Hi-Rail Vehicles § 214.521 Flagging equipment for on-track roadway maintenance machines and hi-rail vehicles. Each on-track roadway maintenance machine...

  10. 49 CFR 214.525 - Towing with on-track roadway maintenance machines or hi-rail vehicles.

    Science.gov (United States)

    2010-10-01

    ... or hi-rail vehicles. 214.525 Section 214.525 Transportation Other Regulations Relating to... SAFETY On-Track Roadway Maintenance Machines and Hi-Rail Vehicles § 214.525 Towing with on-track roadway maintenance machines or hi-rail vehicles. (a) When used to tow pushcars or other maintenance-of-way equipment...

  11. 49 CFR 214.519 - Floors, decks, stairs, and ladders of on-track roadway maintenance machines.

    Science.gov (United States)

    2010-10-01

    ... roadway maintenance machines. 214.519 Section 214.519 Transportation Other Regulations Relating to... SAFETY On-Track Roadway Maintenance Machines and Hi-Rail Vehicles § 214.519 Floors, decks, stairs, and ladders of on-track roadway maintenance machines. Floors, decks, stairs, and ladders of on-track roadway...

  12. 49 CFR 214.509 - Required visual illumination and reflective devices for new on-track roadway maintenance machines.

    Science.gov (United States)

    2010-10-01

    ... devices for new on-track roadway maintenance machines. 214.509 Section 214.509 Transportation Other... TRANSPORTATION RAILROAD WORKPLACE SAFETY On-Track Roadway Maintenance Machines and Hi-Rail Vehicles § 214.509 Required visual illumination and reflective devices for new on-track roadway maintenance machines. Each new...

  13. 49 CFR 214.511 - Required audible warning devices for new on-track roadway maintenance machines.

    Science.gov (United States)

    2010-10-01

    ... roadway maintenance machines. 214.511 Section 214.511 Transportation Other Regulations Relating to... SAFETY On-Track Roadway Maintenance Machines and Hi-Rail Vehicles § 214.511 Required audible warning devices for new on-track roadway maintenance machines. Each new on-track roadway maintenance machine shall...

  14. Measurements of Bismuth (214Bi) in Indoor Air and Evaluation of Deposition Fraction

    International Nuclear Information System (INIS)

    Mohamed, A.; Ahmed, A.A.; Yuness, M.

    2010-01-01

    The activity size distribution of unattached as well as attached 214 Bi to aerosol particles was measured in indoor air of physics department at Minia University, Minia City, Egypt. The samples were collected using a wire screen diffusion battery technique and a low pressure Berner cascade impactor. The mean Activity Median Thermodynamic Diameter (AMTD) of unattached 214 Bi was determined to be 1.25 nm with a relative mean Geometric Standard Deviation (GSD) of 1.29. A mean unattached fraction (fun) of 0.08±0.05 was obtained. The average activity concentration of 214 Bi was found to be 4.9±0.42 Bq m -3 . Most of the attached activities of progeny were associated with aerosol particles of the accumulation mode. The GSD of the accumulation mode of 214 Bi was determined to be 3 with an Active Median Aerodynamic Diameter (AMAD) of 350 nm. Based on the obtained measured data values, deposition fraction of 214 Bi has been evaluated by using a stochastic deposition model. The bronchial deposition efficiencies of particles in the size range of attached 214 Bi were found to be lower than those of unattached progeny

  15. Educational experiment for university students using natural radioactivity. Development of an additional experiment to measure the increase in 214Pb and 214Bi produced from 222Rn

    International Nuclear Information System (INIS)

    Nakamura, Mariko; Esaka, Takao; Kamata, Masahiro

    2005-01-01

    Although several works have been published to date regarding radiochemistry, most of them have been designed for those who major in subjects related to chemistry or physics and use rather sophisticated methods and apparatus. Education about radiation and radioactivity is also very important for other students because a basic knowledge of radiation and radioactivity is indispensable for understanding environmental problems or energy problems in the future. However, it is not easy to conduct practical work using radioactivity in students' experiments at school or at university because the use of radioactivity is strictly regulated by the law, and equipment such as radiation counters is too expensive for school budgets. From such a viewpoint, we developed several kinds of safe and inexpensive experiments for education using natural radioactivity so that university (or senior high school) students can learn through their practical work without being regulated by the law. For this purpose, radioactive species belonging to the uranium decay series are suitable because these species can be easily obtained from mineral spring water or soil samples. In addition, some of the species such as 214 Pb and 214 Bi emit beta rays, which are easy to detect, and the half-lives of these which are easy to detect, and the half-lives of these elements can be measured in one or two-hour school activities. This kind of experiment was employed as an ''Educational experiment for radiochemistry'' at Tottori University for nearly fifty students every year. Although the experiment itself was essentially complete, the students did not have the chance to observe how radioactive equilibrium was established. Therefore, we have developed an additional work plan to enable students to observe how 214 Pb and 214 Bi are produced from 222 Rn, and have made this experiment more complete. The educational usefulness of this additional experiment was evaluated and will be presented in section 5. (author)

  16. Reagents for Astatination of Biomolecules. 5. Evaluation of hydrazone linkers in 211At- and 125I-labeled closo-decaborate(2-) conjugates of Fab′ as a means of decreasing kidney retention

    Science.gov (United States)

    Wilbur, D. Scott; Chyan, Ming-Kuan; Hamlin, Donald K.; Nguyen, Holly; Vessella, Robert L.

    2011-01-01

    Evaluation of monoclonal antibody (MAb) fragments (e.g. Fab′, Fab or engineered fragments) as cancer-targeting reagents for therapy with the α-particle emitting radionuclide astatine-211 (211At) has been hampered by low in vivo stability of the label and a propensity of these proteins localize to kidneys. Fortunately, our group has shown that the low stability of the 211At label, generally a meta- or para-[211At]astatobenzoyl conjugate, on MAb Fab′ fragments can be dramatically improved by use of closo-decaborate(2-) conjugates. However, the higher stability of radiolabeled MAb Fab′ conjugates appears to result in retention of the radioactivity in kidneys. This investigation was conducted to evaluate whether the retention of radioactivity in kidney might be decreased by the use of acid-cleavable hydrazone between the Fab′ and the radiolabeled closo-decaborate(2-) moiety. Five conjugation reagents containing sulfhydryl-reactive maleimide groups, a hydrazone functionality and a closo-decaborate(2-) moiety were prepared. In four of the five conjugation reagents, a discrete polyethylene glycol (PEG) linker was used, and one substituent adjacent to the hydrazone was varied (phenyl, benzoate, anisole or methyl) to provide varying acid-sensitivity. In the initial studies, the five maleimido-closo-decaborate(2-) conjugation reagents were radioiodinated (125I or 131I), then conjugated with an anti-PSMA Fab′ (107-1A4 Fab′). Biodistributions of the five radioiodinated Fab′ conjugates were obtained in nude mice at 1, 4 and 24 h post injection (pi). In contrast to closo-decaborate(2-) conjugated to 107-1A4 Fab′ through a non-cleavable linker, two conjugates containing either a benzoate or a methyl substituent on the hydrazone functionality displayed clearance rates from kidney, liver and spleen that were similar to those obtained with directly radioiodinated Fab′ (i.e. no conjugate). The maleimido-closo-decaborate(2-) conjugation reagent containing a benzoate

  17. CT-guided percutaneous spine biopsy in suspected infection or malignancy. A study of 214 patients

    International Nuclear Information System (INIS)

    Rehm, J.; Veith, S.; Kauczor, H.U.; Weber, M.A.; Akbar, M.

    2016-01-01

    To retrospectively determine the effectiveness and accuracy of CT-guided percutaneous biopsy of malignant and inflammatory bone lesions of the spine and to assess the reliability of pre-biopsy CT and MRI. 214 patients with lesions of the spine, which were suspicious either for being malignant or inflammatory, underwent CT-guided biopsy for pathological and/or microbiological detection. Biopsy samples were sent for histological examination in 128/214 patients, for microbiological analysis in 17/214 patients and for both analyses in 69/214 patients. Retrospectively, the diagnostic accuracy and sensitivity/specificity of the pre-interventional imaging (CT and MRI) were determined. In addition, the influence of the biopsy on subsequent patient management was assessed. The accuracy was 94.4% for histopathological analysis and 97.7% for microbiological analysis. In 25% of cases the microbiological analysis revealed an underlying pathogen that was not significantly affected by pre-biopsy antibiotic therapy. The sensitivity/specificity of the pre-biopsy cross-sectional imaging concerning suspected malignancy was 69%/78%. For suspected infection, the sensitivity/specificity of pre-biopsy imaging was 81%/44%. In 52% of all cases, the biopsy result changed subsequent patient management. Percutaneous CT-guided spine biopsy is a useful and reliable diagnostic procedure to establish a definitive diagnosis but with a relatively low yield of microorganisms in the case of infection.

  18. 25 CFR 214.28 - Location of sites for mines and buildings.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Location of sites for mines and buildings. 214.28 Section... and buildings. In event of disagreement between two or more mineral lessees regarding sites for the location of wells, mines, buildings, plants, etc., the same shall be determined by the superintendent after...

  19. 49 CFR 214.329 - Train approach warning provided by watchmen/lookouts.

    Science.gov (United States)

    2010-10-01

    ... Protection § 214.329 Train approach warning provided by watchmen/lookouts. Roadway workers in a roadway work group who foul any track outside of working limits shall be given warning of approaching trains by one... shall clearly signify to all recipients of the warning that a train or other on-track equipment is...

  20. 23 CFR 970.214 - Federal lands congestion management system (CMS).

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Federal lands congestion management system (CMS). 970....214 Federal lands congestion management system (CMS). (a) For purposes of this section, congestion...) Develop criteria to determine when a CMS is to be implemented for a specific transportation system; and (2...

  1. 23 CFR 972.214 - Federal lands congestion management system (CMS).

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Federal lands congestion management system (CMS). 972... § 972.214 Federal lands congestion management system (CMS). (a) For purposes of this section, congestion... interference. For those FWS transportation systems that require a CMS, in both metropolitan and non...

  2. 49 CFR 214.503 - Good-faith challenges; procedures for notification and resolution.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Good-faith challenges; procedures for notification... Roadway Maintenance Machines and Hi-Rail Vehicles § 214.503 Good-faith challenges; procedures for... vehicle shall inform the employer whenever the employee makes a good-faith determination that the machine...

  3. CT-guided percutaneous spine biopsy in suspected infection or malignancy. A study of 214 patients

    Energy Technology Data Exchange (ETDEWEB)

    Rehm, J.; Veith, S.; Kauczor, H.U.; Weber, M.A. [Heidelberg Univ. (Germany). Inst. of Diagnostic and Interventional Radiology; Akbar, M. [Heidelberg Univ. (Germany). Dept. of Orthopaedic Surgery and Rehabilitation Medicine

    2016-12-15

    To retrospectively determine the effectiveness and accuracy of CT-guided percutaneous biopsy of malignant and inflammatory bone lesions of the spine and to assess the reliability of pre-biopsy CT and MRI. 214 patients with lesions of the spine, which were suspicious either for being malignant or inflammatory, underwent CT-guided biopsy for pathological and/or microbiological detection. Biopsy samples were sent for histological examination in 128/214 patients, for microbiological analysis in 17/214 patients and for both analyses in 69/214 patients. Retrospectively, the diagnostic accuracy and sensitivity/specificity of the pre-interventional imaging (CT and MRI) were determined. In addition, the influence of the biopsy on subsequent patient management was assessed. The accuracy was 94.4% for histopathological analysis and 97.7% for microbiological analysis. In 25% of cases the microbiological analysis revealed an underlying pathogen that was not significantly affected by pre-biopsy antibiotic therapy. The sensitivity/specificity of the pre-biopsy cross-sectional imaging concerning suspected malignancy was 69%/78%. For suspected infection, the sensitivity/specificity of pre-biopsy imaging was 81%/44%. In 52% of all cases, the biopsy result changed subsequent patient management. Percutaneous CT-guided spine biopsy is a useful and reliable diagnostic procedure to establish a definitive diagnosis but with a relatively low yield of microorganisms in the case of infection.

  4. 8 CFR 214.4 - Denial of certification, denial of recertification or withdrawal of SEVP certification.

    Science.gov (United States)

    2010-01-01

    ... school will be notified of the reasons and appeal rights if a petition for certification is denied, in accordance with the provisions of 8 CFR 103.3(a)(1)(iii). No fee is required with appeals related to SEVP... qualified professional personnel. (xiv) Failure to limit advertising in the manner prescribed in 8 CFR 214.3...

  5. 20 CFR 410.214 - Conditions of entitlement; parent, brother, or sister.

    Science.gov (United States)

    2010-04-01

    ... entitlement to brother's benefits may be established for any month before January 1973, based on a disability... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Conditions of entitlement; parent, brother...; Duration of Entitlement; Filing of Claims and Evidence § 410.214 Conditions of entitlement; parent, brother...

  6. 49 CFR 214.349 - Training and qualification of watchmen/lookouts.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Training and qualification of watchmen/lookouts...) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY Roadway Worker Protection § 214.349 Training and qualification of watchmen/lookouts. (a) The training and qualification for...

  7. 27 CFR 28.214 - Notice and claim, Form 1582-A (5120.24).

    Science.gov (United States)

    2010-04-01

    ... AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS EXPORTATION OF ALCOHOL Exportation of Wine With Benefit of Drawback § 28.214 Notice and claim, Form 1582-A (5120.24). Claim for allowance of drawback of internal revenue taxes on wines removed under the provisions of § 28.211 and § 28.212, shall be prepared by...

  8. Half-life of 214Po and 212Po measured with CTF at LNGS

    International Nuclear Information System (INIS)

    Bellini, G.; Benziger, J.; Bick, D.

    2013-01-01

    Polonium isotopes 214 Po and 212 Po are part of the 238 U and 232 Th decay chains, respectively. There exist only a few measurements of these two mean lifetimes with precision better than one or two percent. Since we have been studying decay spectra of 214 Bi and 212 Bi with the purpose of experimentally constraining anti-neutrino spectral shape important for geoneutrino studies, we have a large statistics of decays of 214 Po and 212 Po collected with the Counting Test Facility (CTF), which was operational in the underground I.N.F.N. Gran Sasso National Laboratory. The apparatus consisted of an external cylindrical water tank (diameter ∼ 11 m, high ∼ 10 m; ∼ 1000 tons of water) serving as passive shielding for 4.8 m 3 of liquid organic scintillator contained in an inner spherical vessel with a diameter of ∼ 2 m. The inner vessel was realized with a nylon membrane (∼ 500 ?m thick), with excellent optical clarity, which allowed the effective transmission of the scintillation light to the 100 phototubes (PMTs) forming the optical read-out, anchored on a 7 m diameter support structure inside the water tank. The high purity and low background in CTF allows a favourable signal to background ratio for these measurements. More specifically the ratio of signal to background of the present measurements is more than three orders of magnitude larger than the best existing measurements. We have studied the decays of 214 Po into 210 Pb and of 212 Po into 208 Pb tagged by the coincidence with the previously decays from 214 Bi and 212 Bi by using 222 Rn, 232 Th and 220 Rn sources sealed inside quartz vials and inserted in the CTF

  9. 20 CFR 416.214 - You are disabled and drug addiction or alcoholism is a contributing factor material to the...

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false You are disabled and drug addiction or alcoholism is a contributing factor material to the determination of disability. 416.214 Section 416.214 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SUPPLEMENTAL SECURITY INCOME FOR THE AGED, BLIND, AND DISABLED Eligibility Reasons Why You May Not...

  10. 49 CFR 214.355 - Training and qualification in on-track safety for operators of roadway maintenance machines.

    Science.gov (United States)

    2010-10-01

    ... operators of roadway maintenance machines. 214.355 Section 214.355 Transportation Other Regulations Relating... operators of roadway maintenance machines. (a) The training and qualification of roadway workers who operate roadway maintenance machines shall include, as a minimum: (1) Procedures to prevent a person from being...

  11. 47 CFR 25.214 - Technical requirements for space stations in the satellite digital audio radio service and...

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Technical requirements for space stations in the satellite digital audio radio service and associated terrestrial repeaters. 25.214 Section 25.214 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS...

  12. miR-214 down-regulates ARL2 and suppresses growth and invasion of cervical cancer cells

    International Nuclear Information System (INIS)

    Peng, Ruiqing; Men, Jianlong; Ma, Rui; Wang, Qian; Wang, Yang; Sun, Ying; Ren, Jing

    2017-01-01

    Increasing evidence has shown that miRNAs are implicated in carcinogenesis and can function as oncogenes or tumor suppressor genes in human cancers. In this study, we confirmed that miR-214 is frequently down-regulated in cervical cancer compared with normal cervical tissues. Ectopic expression of miR-214 suppressed proliferation, migration and invasion of HeLa and C33A cervical cancer cells. Bioinformatics analysis revealed that ADP ribosylation factor like 2 (ARL2) was a potential target of miR-214 and was remarkably up-regulated in cervical cancer. Knockdown of ARL2 markedly inhibited cervical cancer cell proliferation, migration and invasion, similarly to over-expression of miR-214, indicating that ARL2 may function as an oncogene in cervical cancer. In conclusion, our study revealed that miR-214 acts as a tumor suppressor via inhibiting proliferation, migration and invasion of cervical cancer cells through targeting ARL2, and that both miR-214 and ARL2 may serve as prognostic or therapeutic targets for cervical cancer. - Highlights: • miR-214 targets ARL2. • ARL2 maybe an oncogene in cervical cancer. • ARL2 rescues miR-214.

  13. The Oncogenic Fusion Proteins SET-Nup214 and Sequestosome-1 (SQSTM1)-Nup214 Form Dynamic Nuclear Bodies and Differentially Affect Nuclear Protein and Poly(A)+ RNA Export*

    Science.gov (United States)

    Port, Sarah A.; Mendes, Adélia; Valkova, Christina; Spillner, Christiane; Fahrenkrog, Birthe; Kaether, Christoph; Kehlenbach, Ralph H.

    2016-01-01

    Genetic rearrangements are a hallmark of several forms of leukemia and can lead to oncogenic fusion proteins. One example of an affected chromosomal region is the gene coding for Nup214, a nucleoporin that localizes to the cytoplasmic side of the nuclear pore complex (NPC). We investigated two such fusion proteins, SET-Nup214 and SQSTM1 (sequestosome)-Nup214, both containing C-terminal portions of Nup214. SET-Nup214 nuclear bodies containing the nuclear export receptor CRM1 were observed in the leukemia cell lines LOUCY and MEGAL. Overexpression of SET-Nup214 in HeLa cells leads to the formation of similar nuclear bodies that recruit CRM1, export cargo proteins, and certain nucleoporins and concomitantly affect nuclear protein and poly(A)+ RNA export. SQSTM1-Nup214, although mostly cytoplasmic, also forms nuclear bodies and inhibits nuclear protein but not poly(A)+ RNA export. The interaction of the fusion proteins with CRM1 is RanGTP-dependent, as shown in co-immunoprecipitation experiments and binding assays. Further analysis revealed that the Nup214 parts mediate the inhibition of nuclear export, whereas the SET or SQSTM1 part determines the localization of the fusion protein and therefore the extent of the effect. SET-Nup214 nuclear bodies are highly mobile structures, which are in equilibrium with the nucleoplasm in interphase and disassemble during mitosis or upon treatment of cells with the CRM1-inhibitor leptomycin B. Strikingly, we found that nucleoporins can be released from nuclear bodies and reintegrated into existing NPC. Our results point to nuclear bodies as a means of preventing the formation of potentially insoluble and harmful protein aggregates that also may serve as storage compartments for nuclear transport factors. PMID:27613868

  14. The Oncogenic Fusion Proteins SET-Nup214 and Sequestosome-1 (SQSTM1)-Nup214 Form Dynamic Nuclear Bodies and Differentially Affect Nuclear Protein and Poly(A)+ RNA Export.

    Science.gov (United States)

    Port, Sarah A; Mendes, Adélia; Valkova, Christina; Spillner, Christiane; Fahrenkrog, Birthe; Kaether, Christoph; Kehlenbach, Ralph H

    2016-10-28

    Genetic rearrangements are a hallmark of several forms of leukemia and can lead to oncogenic fusion proteins. One example of an affected chromosomal region is the gene coding for Nup214, a nucleoporin that localizes to the cytoplasmic side of the nuclear pore complex (NPC). We investigated two such fusion proteins, SET-Nup214 and SQSTM1 (sequestosome)-Nup214, both containing C-terminal portions of Nup214. SET-Nup214 nuclear bodies containing the nuclear export receptor CRM1 were observed in the leukemia cell lines LOUCY and MEGAL. Overexpression of SET-Nup214 in HeLa cells leads to the formation of similar nuclear bodies that recruit CRM1, export cargo proteins, and certain nucleoporins and concomitantly affect nuclear protein and poly(A) + RNA export. SQSTM1-Nup214, although mostly cytoplasmic, also forms nuclear bodies and inhibits nuclear protein but not poly(A) + RNA export. The interaction of the fusion proteins with CRM1 is RanGTP-dependent, as shown in co-immunoprecipitation experiments and binding assays. Further analysis revealed that the Nup214 parts mediate the inhibition of nuclear export, whereas the SET or SQSTM1 part determines the localization of the fusion protein and therefore the extent of the effect. SET-Nup214 nuclear bodies are highly mobile structures, which are in equilibrium with the nucleoplasm in interphase and disassemble during mitosis or upon treatment of cells with the CRM1-inhibitor leptomycin B. Strikingly, we found that nucleoporins can be released from nuclear bodies and reintegrated into existing NPC. Our results point to nuclear bodies as a means of preventing the formation of potentially insoluble and harmful protein aggregates that also may serve as storage compartments for nuclear transport factors. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.

  15. True coincidence summing correction determination for 214Bi principal gamma lines in NORM samples

    International Nuclear Information System (INIS)

    Haddad, Kh.

    2014-01-01

    The gamma lines 609.3 and 1,120.3 keV are two of the most intensive γ emissions of 214 Bi, but they have serious true coincidence summing (TCS) effects due to the complex decay schemes with multi-cascading transitions. TCS effects cause inaccurate count rate and hence erroneous results. A simple and easy experimental method for determination of TCS correction of 214 Bi gamma lines was developed in this work using naturally occurring radioactive material samples. Height efficiency and self attenuation corrections were determined as well. The developed method has been formulated theoretically and validated experimentally. The corrections problems were solved simply with neither additional standard source nor simulation skills. (author)

  16. Flux density measurements of radio sources at 2.14 millimeter wavelength

    International Nuclear Information System (INIS)

    Cogdell, J.R.; Davis, J.H.; Ulrich, B.T.; Wills, B.J.

    1975-01-01

    Flux densities of galactic and extragalactic sources, and planetary temperatures, have been measured at 2.14 mm wavelength (140 GHz). Results are presented for OJ 287; the galactic sources DR 21, W3, and Orion A; the extragalactic sources PKS 0106plus-or-minus01, 3C 84, 3C 120, BL Lac, 3C 216, 3C 273, 3C 279, and NGC 4151; and the Sun, Venus, Mars, and Jupiter. Also presented is the first measurement of the 2.14-mm temperature of Uranus. The spectra of some of these sources are discussed. The flux density scale was calibrated absolutely. The measurements were made with a new continuum receiver on the 4.88-m radio telescope of The University of Texas

  17. Optical observations of the millisecond pulsars PSR 1937+214 and PSR 1953+29

    International Nuclear Information System (INIS)

    Loredo, T.J.; Ricker, G.R.; Rappaport, S.A.; Middleditch, J.

    1984-01-01

    The results of photometric and time-resolved optical observations of the fields of the recently discovered ultra-fast radio pulsars, PSR 1937+214 and PSR 1953+29 (Backer et al. 1982; Boriakoff et al. 1983) are reported. Deep images of the fields reveal no conspicuous optical counterpart for PSR 1937+214, though a star with m/sub r/ approx. 20.5 is coincident with the position of PSR 1953+29. Time-resolved images of the fields of both objects, obtained with a new stroboscopic technique, have yielded upper limits on the pulsed near-infrared emission from each object. Constraints on the physical models for these systems derived from the optical studies are briefly discussed. 25 references, 9 figures, 4 tables

  18. MicroRNA-214 Suppresses Osteogenic Differentiation of Human Periodontal Ligament Stem Cells by Targeting ATF4

    Directory of Open Access Journals (Sweden)

    Siqi Yao

    2017-01-01

    Full Text Available Periodontitis is the main cause of adult tooth loss. Stem cell-based tissue engineering has become a promising therapy for periodontitis treatment. To date, human periodontal ligament stem cells (hPDLSCs have been shown to be a favorable source for tissue engineering, but modulatory mechanisms of hPDLSCs remain unclear. Approximately 60% of mammalian genes are the targets of over 2000 miRNAs in multiple human cell types, and miRNAs are able to influence various biological processes in the human body, including bone formation. In this study, we found that after osteogenic induction, miR-214 was significantly decreased in hPDLSCs; therefore, we examined the effects of miR-214 on osteogenic differentiation. Computational miRNA target prediction analyses and luciferase reporter assays revealed that activating transcription factor 4 (ATF4 is a direct target of miR-214. We prepared cells overexpressing miR-214 and found that miR-214 negatively regulates osteogenic differentiation of hPDLSCs. For the target of miR-214, ATF4 protein expression level was decreased after induction. In conclusion, we found that miR-214-ATF4 axis is a novel pathway for regulating hPDLSC osteogenic differentiation.

  19. 49 CFR Appendix A to Part 214 - Schedule of Civil Penalties 1

    Science.gov (United States)

    2010-10-01

    ... individual train detection with interfering noise 2,000 (6) Use of individual train detection while a train...,500 5,000 (4) Failure to inspect and remove 5,000 10,000 (5) Failure to train 5,000 10,000 (6) Failure... 214.323 Foul time: (a) Foul time authority overlapping movement authority of train or equipment 5,000...

  20. 40 CFR 421.214 - Standards of performance for new sources.

    Science.gov (United States)

    2010-07-01

    ...] [Reserved]. Ammonia (as N) 61.720 27.130 Fluoride 16.210 9.214 Total suspended solids 6.945 5.556 pH (1) (1) 1 Within the range of 7.5 to 10.0 at all times. (b) Roaster SO2 scrubber. NSPS for the Primary....218 Nickel 0.924 0.621 Selenium 1.377 0.621 Molybdenum [Reserved] [Reserved]. Ammonia (as N) 223.800...

  1. Measurements of Po214 at Sao Jose dos Campos and Cachoeira Paulista: correlation with meteorological data

    International Nuclear Information System (INIS)

    Marinho, E.V.A.; Nordemann, D.J.R.

    1985-01-01

    PO 214 , a short life daughter product of RN 222 , was measured by alpha-ray spectrometry of a atmospheric particles sampled on Millipore filters (0.8 μm pore) at Sao Jose dos Campos (23 0 12'S, 45 0 51'W) and Cachoeira Paulista (22 0 41'S, 45 0 00'W). The infleunce of rainfall on the atmospheric Po 214 was studied at Sao Jose dos Campos. The mean activity was 98 pCi/m 3 for dry days (without rain during the preceding two days). On the contrary a low mean activity of 35 pCi/m 3 was observed for high pluviometry days from 08/30 to 10/26 for which total rainfall was 365.5 mm. At Cachoeria Paulista the Po 214 activity was correlated with the stability of the air (measured by the Richardson number), showing an accumaltion of natural radioactive aerosols during periods of higher stability of the lower atmosphere. (author) [pt

  2. 44Sc-DOTA-BN[2-14]NH2 in comparison to 68Ga-DOTA-BN[2-14]NH2 in pre-clinical investigation. Is 44Sc a potential radionuclide for PET?

    Science.gov (United States)

    Koumarianou, E; Loktionova, N S; Fellner, M; Roesch, F; Thews, O; Pawlak, D; Archimandritis, S C; Mikolajczak, R

    2012-12-01

    In the present study we demonstrate the in vitro and in vivo comparison of the (44)Sc and (68)Ga labeled DOTA-BN[2-14]NH(2). (44)Sc is a positron emitter with a half life of 3.92 h. Hence it could be used for PET imaging with ligands requiring longer observation time than in the case of (68)Ga. The binding affinity of (nat)Sc-DOTA-BN[2-14]NH(2) and (nat)Ga-DOTA-BN[2-14]NH(2) to GRP receptors was studied in competition to [(125)I-Tyr(4)]-Bombesin in the human prostate cancer cell line PC-3. A preliminary biodistribution in normal rats was performed, while first microPET images were assessed in male Copenhagen rats bearing the androgen-independent Dunning R-3327-AT-1 prostate cancer tumor. The affinity to GRP receptors in the PC-3 cell line was higher for (nat)Ga-DOTA-BN[2-14]NH(2) (IC(50)(nM)=0.85 ± 0.06) than that of (nat)Sc-DOTA-BN[2-14]NH(2) (IC(50) (nM)=6.49 ± 0.13). The internalization rate of (68)Ga labeled DOTA-BN[2-14]NH(2) was slower than that of (44)Sc, but their final internalization percents were comparable. (68)Ga-DOTA-BN[2-14]NH(2) was externalized faster than (44)Sc-DOTA-BN[2-14]NH(2). The biodistribution of (44)Sc-DOTA-BN[2-14]NH(2) and (68)Ga-DOTA-BN[2-14]NH(2) in normal rats revealed a higher uptake in target organs and tissues of the first one while both excreted mainly through urinary tract. In microPET images both tracers were accumulated in the tumor with similar uptake patterns. Despite the differences in the receptor affinity both the (68)Ga- and the (44)Sc-labeled DOTA-BN[2-14]NH(2) tracers showed comparable distribution and similar time constants of uptake and elimination. Moreover no differences in tumor accumulation (neither in the overall uptake nor in the dynamics) were observed from the microPet imaging. From that perspective the use of either (44)Sc or (68)Ga for detecting tumors with GRP receptors is equivalent. Copyright © 2012 Elsevier Ltd. All rights reserved.

  3. 78 FR 76888 - Twentieth Meeting: RTCA Special Committee 214/EUROCAE WG-78: Standards for Air Traffic Data...

    Science.gov (United States)

    2013-12-19

    ...The FAA is issuing this notice to advise the public of nineteenth meeting of RTCA Special Committee 214 to be held jointly with EUROCAE WG-78: Standards for Air Traffic Data Communication Services.

  4. 78 FR 47480 - Nineteenth Meeting: RTCA Special Committee 214/EUROCAE WG-78: Standards for Air Traffic Data...

    Science.gov (United States)

    2013-08-05

    ...The FAA is issuing this notice to advise the public of nineteenth meeting of RTCA Special Committee 214 to be held jointly with EUROCAE WG-78: Standards for Air Traffic Data Communication Services.

  5. SET-NUP214 fusion in acute myeloid leukemia- and T-cell acute lymphoblastic leukemia-derived cell lines

    Directory of Open Access Journals (Sweden)

    Zaborski Margarete

    2009-01-01

    Full Text Available Abstract Background SET-NUP214 fusion resulting from a recurrent cryptic deletion, del(9(q34.11q34.13 has recently been described in T-cell acute lymphoblastic leukemia (T-ALL and in one case of acute myeloid leukemia (AML. The fusion protein appears to promote elevated expression of HOXA cluster genes in T-ALL and may contribute to the pathogenesis of the disease. We screened a panel of ALL and AML cell lines for SET-NUP214 expression to find model systems that might help to elucidate the cellular function of this fusion gene. Results Of 141 human leukemia/lymphoma cell lines tested, only the T-ALL cell line LOUCY and the AML cell line MEGAL expressed the SET(TAF-Iβ-NUP214 fusion gene transcript. RT-PCR analysis specifically recognizing the alternative first exons of the two TAF-I isoforms revealed that the cell lines also expressed TAF-Iα-NUP214 mRNA. Results of fluorescence in situ hybridization (FISH and array-based copy number analysis were both consistent with del(9(q34.11q34.13 as described. Quantitative genomic PCR also confirmed loss of genomic material between SET and NUP214 in both cell lines. Genomic sequencing localized the breakpoints of the SET gene to regions downstream of the stop codon and to NUP214 intron 17/18 in both LOUCY and MEGAL cells. Both cell lines expressed the 140 kDa SET-NUP214 fusion protein. Conclusion Cell lines LOUCY and MEGAL express the recently described SET-NUP214 fusion gene. Of special note is that the formation of the SET exon 7/NUP214 exon 18 gene transcript requires alternative splicing as the SET breakpoint is located downstream of the stop codon in exon 8. The cell lines are promising model systems for SET-NUP214 studies and should facilitate investigating cellular functions of the the SET-NUP214 protein.

  6. Metabolism of [2-14C]acetate and its use in assessing hepatic Krebs cycle activity and gluconeogenesis

    International Nuclear Information System (INIS)

    Schumann, W.C.; Magnusson, I.; Chandramouli, V.; Kumaran, K.; Wahren, J.; Landau, B.R.

    1991-01-01

    To examine the fate of the carbons of acetate and to evaluate the usefulness of labeled acetate in assessing intrahepatic metabolic processes during gluconeogenesis, [2-14C]acetate, [2-14C]ethanol, and [1-14C]ethanol were infused into normal subjects fasted 60 h and given phenyl acetate. Distributions of 14C in the carbons of blood glucose and glutamate from urinary phenylacetylglutamine were determined. With [2-14C]acetate and [2-14C]ethanol, carbon 1 of glucose had about twice as much 14C as carbon 3. Carbon 2 of glutamate had about twice as much 14C as carbon 1 and one-half to one-third as much as carbon 4. There was only a small amount in carbon 5. These distributions are incompatible with the metabolism of [2-14C]acetate being primarily in liver. Therefore, [2-14C]acetate cannot be used to study Krebs cycle metabolism in liver and in relationship to gluconeogenesis, as has been done. The distributions can be explained by: (a) fixation of 14CO2 from [2-14C]acetate in the formation of the 14C-labeled glucose and glutamate in liver and (b) the formation of 14C-labeled glutamate in a second site, proposed to be muscle. [1,3-14C]Acetone formation from the [2-14C]acetate does not contribute to the distributions, as evidenced by the absence of 14C in carbons 2-4 of glutamate after [1-14C]ethanol administration

  7. Induction of Pro-Apoptotic Endoplasmic Reticulum Stress in Multiple Myeloma Cells by NEO214, Perillyl Alcohol Conjugated to Rolipram.

    Science.gov (United States)

    Chen, Thomas C; Chan, Nymph; Labib, Shirin; Yu, Jiali; Cho, Hee-Yeon; Hofman, Florence M; Schönthal, Axel H

    2018-01-17

    Despite the introduction of new therapies for multiple myeloma (MM), many patients are still dying from this disease and novel treatments are urgently needed. We have designed a novel hybrid molecule, called NEO214, that was generated by covalent conjugation of the natural monoterpene perillyl alcohol (POH), an inducer of endoplasmic reticulum (ER) stress, to rolipram (Rp), an inhibitor of phosphodiesterase-4 (PDE4). Its potential anticancer effects were investigated in a panel of MM cell lines. We found that NEO214 effectively killed MM cells in vitro with a potency that was over an order of magnitude stronger than that of its individual components, either alone or in combination. The cytotoxic mechanism of NEO214 involved severe ER stress and prolonged induction of CCAAT/enhancer-binding protein homologous protein (CHOP), a key pro-apoptotic component of the ER stress response. These effects were prevented by salubrinal, a pharmacologic inhibitor of ER stress, and by CHOP gene knockout. Conversely, combination of NEO214 with bortezomib, a drug in clinical use for patients with MM, resulted in synergistic enhancement of MM cell death. Combination with the adenylate cyclase stimulant forskolin did not enhance NEO214 impact, indicating that cyclic adenosine 3',5'-monophosphate (AMP) pathways might play a lesser role. Our study introduces the novel agent NEO214 as a potent inducer of ER stress with significant anti-MM activity in vitro. It should be further investigated as a potential MM therapy aimed at exploiting this tumor's distinct sensitivity to ER stress.

  8. Tumor-secreted miR-214 induces regulatory T cells: a major link between immune evasion and tumor growth

    Science.gov (United States)

    Yin, Yuan; Cai, Xing; Chen, Xi; Liang, Hongwei; Zhang, Yujing; Li, Jing; Wang, Zuoyun; Chen, Xiulan; Zhang, Wen; Yokoyama, Seiji; Wang, Cheng; Li, Liang; Li, Limin; Hou, Dongxia; Dong, Lei; Xu, Tao; Hiroi, Takachika; Yang, Fuquan; Ji, Hongbin; Zhang, Junfeng; Zen, Ke; Zhang, Chen-Yu

    2014-01-01

    An increased population of CD4+CD25highFoxp3+ regulatory T cells (Tregs) in the tumor-associated microenvironment plays an important role in cancer immune evasion. However, the underlying mechanism remains unclear. Here we observed an increased secretion of miR-214 in various types of human cancers and mouse tumor models. Tumor-secreted miR-214 was sufficiently delivered into recipient T cells by microvesicles (MVs). In targeted mouse peripheral CD4+ T cells, tumor-derived miR-214 efficiently downregulated phosphatase and tensin homolog (PTEN) and promoted Treg expansion. The miR-214-induced Tregs secreted higher levels of IL-10 and promoted tumor growth in nude mice. Furthermore, in vivo studies indicated that Treg expansion mediated by cancer cell-secreted miR-214 resulted in enhanced immune suppression and tumor implantation/growth in mice. The MV delivery of anti-miR-214 antisense oligonucleotides (ASOs) into mice implanted with tumors blocked Treg expansion and tumor growth. Our study reveals a novel mechanism through which cancer cell actively manipulates immune response via promoting Treg expansion. PMID:25223704

  9. 44Sc-DOTA-BN[2-14]NH2 in comparison to 68Ga-DOTA-BN[2-14]NH2 in pre-clinical investigation. Is 44Sc a potential radionuclide for PET?

    International Nuclear Information System (INIS)

    Koumarianou, E.; Loktionova, N.S.; Fellner, M.; Roesch, F.; Thews, O.; Pawlak, D.; Archimandritis, S.C.; Mikolajczak, R.

    2012-01-01

    Aim: In the present study we demonstrate the in vitro and in vivo comparison of the 44 Sc and 68 Ga labeled DOTA-BN[2-14]NH 2 . 44 Sc is a positron emitter with a half life of 3.92 h. Hence it could be used for PET imaging with ligands requiring longer observation time than in the case of 68 Ga. Methods: The binding affinity of nat Sc-DOTA-BN[2-14]NH 2 and nat Ga-DOTA-BN[2-14]NH 2 to GRP receptors was studied in competition to [ 125 I-Tyr 4 ]-Bombesin in the human prostate cancer cell line PC-3. A preliminary biodistribution in normal rats was performed, while first microPET images were assessed in male Copenhagen rats bearing the androgen-independent Dunning R-3327-AT-1 prostate cancer tumor. Results: The affinity to GRP receptors in the PC-3 cell line was higher for nat Ga-DOTA-BN[2-14]NH 2 (IC 50 (nM)=0.85±0.06) than that of nat Sc-DOTA-BN[2-14]NH 2 (IC 50 (nM)=6.49±0.13). The internalization rate of 68 Ga labeled DOTA-BN[2-14]NH 2 was slower than that of 44 Sc, but their final internalization percents were comparable. 68 Ga-DOTA-BN[2-14]NH 2 was externalized faster than 44 Sc-DOTA-BN[2-14]NH 2 . The biodistribution of 44 Sc-DOTA-BN[2-14]NH 2 and 68 Ga-DOTA-BN[2-14]NH 2 in normal rats revealed a higher uptake in target organs and tissues of the first one while both excreted mainly through urinary tract. In microPET images both tracers were accumulated in the tumor with similar uptake patterns. Conclusions: Despite the differences in the receptor affinity both the 68 Ga- and the 44 Sc-labeled DOTA-BN[2-14]NH 2 tracers showed comparable distribution and similar time constants of uptake and elimination. Moreover no differences in tumor accumulation (neither in the overall uptake nor in the dynamics) were observed from the microPet imaging. From that perspective the use of either 44 Sc or 68 Ga for detecting tumors with GRP receptors is equivalent. - Highlights: ► In vitro and in vivo evaluation of 44 Sc- and 68 Ga-DOTA-BN[2-14]NH 2 in reference to published

  10. Leukemia-Associated Nup214 Fusion Proteins Disturb the XPO1-Mediated Nuclear-Cytoplasmic Transport Pathway and Thereby the NF-κB Signaling Pathway.

    Science.gov (United States)

    Saito, Shoko; Cigdem, Sadik; Okuwaki, Mitsuru; Nagata, Kyosuke

    2016-07-01

    Nuclear-cytoplasmic transport through nuclear pore complexes is mediated by nuclear transport receptors. Previous reports have suggested that aberrant nuclear-cytoplasmic transport due to mutations or overexpression of nuclear pore complexes and nuclear transport receptors is closely linked to diseases. Nup214, a component of nuclear pore complexes, has been found as chimeric fusion proteins in leukemia. Among various Nup214 fusion proteins, SET-Nup214 and DEK-Nup214 have been shown to be engaged in tumorigenesis, but their oncogenic mechanisms remain unclear. In this study, we examined the functions of the Nup214 fusion proteins by focusing on their effects on nuclear-cytoplasmic transport. We found that SET-Nup214 and DEK-Nup214 interact with exportin-1 (XPO1)/CRM1 and nuclear RNA export factor 1 (NXF1)/TAP, which mediate leucine-rich nuclear export signal (NES)-dependent protein export and mRNA export, respectively. SET-Nup214 and DEK-Nup214 decreased the XPO1-mediated nuclear export of NES proteins such as cyclin B and proteins involved in the NF-κB signaling pathway by tethering XPO1 onto nuclear dots where Nup214 fusion proteins are localized. We also demonstrated that SET-Nup214 and DEK-Nup214 expression inhibited NF-κB-mediated transcription by abnormal tethering of the complex containing p65 and its inhibitor, IκB, in the nucleus. These results suggest that SET-Nup214 and DEK-Nup214 perturb the regulation of gene expression through alteration of the nuclear-cytoplasmic transport system. Copyright © 2016, American Society for Microbiology. All Rights Reserved.

  11. Work in the area of buildings 513 - 289 - 214 - Disruption to traffic

    CERN Multimedia

    Optical Fibre Section, TS/EL

    2005-01-01

    The TS/EL group wishes to inform you that, in order to create an optical fibre access for the GEANT2 project, Route Rutherford will be closed to the public between Buildings 289 and 214 on 13 July 2005. Part of the Sophora car park will also be closed while the work is in progress (week 28: 11 - 15 July). You are requested to comply with the road signs in place. For more information, please call 160484. Optical Fibre Section, TS/EL

  12. Astatine-211 labeling. A study towards automatic production of astatinated antibodies

    International Nuclear Information System (INIS)

    Emma Aneheim; Per Albertsson; Sture Lindegren; Holger Jensen

    2015-01-01

    Targeted alpha therapy is especially interesting for therapy of microscopic cancer tumors due to short path length and high linear energy transfer of the alpha particles. One of the most promising nuclides for targeted alpha therapy is 211 At. To facilitate larger clinical studies using 211 At, the current manual synthesis of radiolabeled antibodies would benefit from being transferred into an automated method. In this work, successful modifications of the manual synthesis have been performed in order to adapt it to automation. The automatic synthesis has also been tested using the modified synthesis method. (author)

  13. Nuclear distributions of NUP62 and NUP214 suggest architectural diversity and spatial patterning among nuclear pore complexes.

    Directory of Open Access Journals (Sweden)

    Yayoi Kinoshita

    Full Text Available The shape of nuclei in many adherent cultured cells approximates an oblate ellipsoid, with contralateral flattened surfaces facing the culture plate or the medium. Observations of cultured cell nuclei from orthogonal perspectives revealed that nucleoporin p62 (NUP62 and nucleoporin 214 (NUP214 are differentially distributed between nuclear pore complexes on the flattened surfaces and peripheral rim of the nucleus. High resolution stimulated emission depletion (STED immunofluorescence microscopy resolved individual NPCs, and suggested both heterogeneity and microheterogeneity in NUP62 and NUP214 immunolabeling among in NPC populations. Similar to nuclear domains and interphase chromosome territories, architectural diversity and spatial patterning of NPCs may be an intrinsic property of the nucleus that is linked to the functions and organization of underlying chromatin.

  14. MicroRNA-214-5p Inhibits the Invasion and Migration of Hepatocellular Carcinoma Cells by Targeting Wiskott-Aldrich Syndrome Like.

    Science.gov (United States)

    Li, Hongdan; Wang, Haoqi; Ren, Zhen

    2018-01-01

    This study aims to explore the effects of microRNA-214-5p (miR-214-5p) on the invasion and migration of Hepatocellular Carcinoma cells (HCC). Hepatocellular Carcinoma tissues and adjacent normal tissues from 44 hepatocellular carcinoma patients were prepared for this study. The HepG2 and BEL-7402 cells were transfected with miR-214-5p mimic and inhibitor. qRT-PCR was performed to detect the expressions of miR-214-5p. Transwell assays were used to detect the invasion and migration assays in HepG2 and BEL-7402 cells. A dual-luciferase reporter assay was conducted to examine the effect of miR-214-5p on Wiskott-Aldrich Syndrome Like (WASL/ N-WASP). Western blot and qRT-PCR were used to measure the expressions of the E-cadherin, N-cadherin and Vimentin proteins. Transwell chamber assays were performed to detect cell invasion and migration. Compared with normal tissues, HCC tissues demonstrated significantly lower expression of miR-214-5p. Overexpression of miR-214-5p significantly inhibited the migration and invasion of HCC cells and inhibition of miR-214-5p promoted the migration and invasion. Additionally, miR-214-5p suppressed the epithelial-mesenchymal transition (EMT). Further study showed WASL was a putative target gene of miR-214-5p. Up-regulating the expression of WASL could reverse the inhibition effect of miR-214-5p on invasion and migration. Our data suggested that miR-214-5p inhibited the invasion and migration of HepG2 and BEL-7402 by targeting WASL in Hepatocellular carcinoma. © 2018 The Author(s). Published by S. Karger AG, Basel.

  15. Interpersonal relationships and child-rearing practices in 214 parents of battered children.

    Science.gov (United States)

    Smith, S M; Hanson, R

    1975-12-01

    The self-reported child-rearing practices of 214 parents of battered babies were characterized in a few but not all respects by demanding behaviour which exceeded that to be expected in relation to their social class and age. Inconsistency in child management was noted in the comparison between lack of demonstrativeness and emotional over-involvement, and between physical punishment and a tendency to be lax in the supervision of the child, and was reminiscent of parents of delinquents. Unhappiness and hostility in relationships with members of their families of origin, with unsupporting partners and with people in general were other important features. Generally, identified perpetrators were characterized by features significant for the sample as a whole.

  16. Correlation between inflammatory infiltrate and epithelial lining in 214 cases of periapical cysts.

    Science.gov (United States)

    Alcantara, Bárbara Albertini Roquim; Carli, Marina Lara de; Beijo, Luiz Alberto; Pereira, Alessandro Antônio Costa; Hanemann, João Adolfo Costa

    2013-01-01

    The aim of this study was to evaluate the prevalence of periapical cysts, identify their clinical and microscopic features and correlate their microscopic features with the inflammatory infiltrate present in the lesion site. A total of 214 cases were collected over a 10-year period. Clinical data, including gender, age, race, symptoms and location of the lesion, were recorded. Two independent examiners with no prior knowledge of the patients' clinical data conducted the microscopic evaluations. Statistical analyses were performed using Fisher's or chi-square tests at a 5% level of significance. The results showed that periapical cysts were more prevalent in white women, with a mean age of 35 years, and in the anterosuperior region. The majority of the lesions were lined by atrophic cystic epithelium, which was associated with moderate inflammatory infiltrate in the cystic capsule (p periapical cysts lined by atrophic epithelium are related to the presence of moderate mononuclear inflammatory infiltrate.

  17. Thermodynamic Critical Field and Superconducting Fluctuation of Vortices for High Temperature Cuprate Superconductor: La-214

    International Nuclear Information System (INIS)

    Yung Moo Huh

    2001-01-01

    Thermodynamics has been studied systematically for the high temperature cuprate superconductor La 2-x Sr x CuO 4-δ , La-214, in the entire superconductive region from strongly underdoped to strongly overdoped regimes. Magnetization studies with H(parallel)c have been made in order to investigate the changes in free energy of the system as the number of carriers is reduced. Above the superconducting transition temperature, the normal-state magnetization exhibits a two-dimensional Heisenberg antiferromagnetic behavior. Below T c , magnetization data are thermodynamically reversible over large portions of the H-T plane, so the free energy is well defined in these regions. As the Sr concentration is varied over the wide range from 0.060 (strongly underdoped) to 0.234 (strongly overdoped), the free energy change goes through a maximum at the optimum doped in a manner similar to the T c0 vs. x curve. The density of states, N(0), remains nearly constant in the overdoped and optimum doped regimes, taking a broad maximum around x = 0.188, and then drops abruptly towards zero in the underdoped regime. The La 2-x Sr x CuO 4 (La-214) system displays the fluctuating vortex behavior with the characteristic of either 2D or 3D fluctuations as indicated by clearly identifiable crossing points T* close to T c . The dimensional character of the fluctuations depends on both applied magnetic fields and the density of charge carriers. The dimensional crossover from 2D to 3D occurs in the strongly underdoped regime when the c-axis coherence distance ζ c becomes comparable to the spacing between adjacent CuO 2 layers s at sufficiently high magnetic fields near H c2

  18. Thermodynamic Critical Field and Superconducting Fluctuation of Vortices for High Temperature Cuprate Superconductor: La-214

    International Nuclear Information System (INIS)

    Finnemore, Douglas K.

    2001-01-01

    Thermodynamics has been studied systematically for the high temperature cuprate superconductor La 2-x Sr x CuO 4-δ , La-214, in the entire superconductive region from strongly underdoped to strongly overdoped regimes. Magnetization studies with H (parallel) c have been made in order to investigate the changes in free energy of the system as the number of carriers is reduced. Above the superconducting transition temperature, the normal-state magnetization exhibits a two-dimensional Heisenberg antiferromagnetic behavior. Below T c , magnetization data are thermodynamically reversible over large portions of the H-T plane, so the free energy is well defined in these regions. As the Sr concentration is varied over the wide range from 0.060 (strongly underdoped) to 0.234 (strongly overdoped), the free energy change goes through a maximum at the optimum doped in a manner similar to the T c0 vs. x curve. The density of states, N(0), remains nearly constant in the overdoped and optimum doped regimes, taking a broad maximum around x = 0.188, and then drops abruptly towards zero in the underdoped regime. The La 2-x Sr x CuO 4 (La-214) system displays the fluctuating vortex behavior with the characteristic of either 2D or 3D fluctuations as indicated by clearly identifiable crossing points T* close to T c . The dimensional character of the fluctuations depends on both applied magnetic fields and the density of charge carriers. The dimensional crossover from 2D to 3D occurs in the strongly underdoped regime when the c-axis coherence distance ξ c becomes comparable to the spacing between adjacent CuO 2 layers s at sufficiently high magnetic field near H c2

  19. Role of Rhodobacter sphaeroides photosynthetic reaction center residue M214 in the composition, absorbance properties, and conformations of H(A) and B(A) cofactors.

    Science.gov (United States)

    Saer, Rafael G; Hardjasa, Amelia; Rosell, Federico I; Mauk, A Grant; Murphy, Michael E P; Beatty, J Thomas

    2013-04-02

    In the native reaction center (RC) of Rhodobacter sphaeroides, the side chain of (M)L214 projects orthogonally toward the plane and into the center of the A branch bacteriopheophytin (BPhe) macrocycle. The possibility that this side chain is responsible for the dechelation of the central Mg(2+) of bacteriochlorophyll (BChl) was investigated by replacement of (M)214 with residues possessing small, nonpolar side chains that can neither coordinate nor block access to the central metal ion. The (M)L214 side chain was also replaced with Cys, Gln, and Asn to evaluate further the requirements for assembly of the RC with BChl in the HA pocket. Photoheterotrophic growth studies showed no difference in growth rates of the (M)214 nonpolar mutants at a low light intensity, but the growth of the amide-containing mutants was impaired. The absorbance spectra of purified RCs indicated that although absorbance changes are associated with the nonpolar mutations, the nonpolar mutant RC pigment compositions are the same as in the wild-type protein. Crystal structures of the (M)L214G, (M)L214A, and (M)L214N mutants were determined (determined to 2.2-2.85 Å resolution), confirming the presence of BPhe in the HA pocket and revealing alternative conformations of the phytyl tail of the accessory BChl in the BA site of these nonpolar mutants. Our results demonstrate that (i) BChl is converted to BPhe in a manner independent of the aliphatic side chain length of nonpolar residues replacing (M)214, (ii) BChl replaces BPhe if residue (M)214 has an amide-bearing side chain, (iii) (M)214 side chains containing sulfur are not sufficient to bind BChl in the HA pocket, and (iv) the (M)214 side chain influences the conformation of the phytyl tail of the BA BChl.

  20. 48 CFR 52.214-23 - Late submissions, modifications, revisions, and withdrawals of technical proposals under two-step...

    Science.gov (United States)

    2010-10-01

    ..., modifications, revisions, and withdrawals of technical proposals under two-step sealed bidding. 52.214-23... Late submissions, modifications, revisions, and withdrawals of technical proposals under two-step..., Modifications, Revisions, and Withdrawals of Technical Proposals Under Two-Step Sealed Bidding (NOV 1999) (a...

  1. Gamma-gamma directional correlations for levels excited up to 2.5 MeV of 214Po

    International Nuclear Information System (INIS)

    Morales, A.; Nunez-Lagos, R.; Morales, J.; Plo, M.

    1984-01-01

    The spin of twenty two excited states (up to an energy of 2.5 MeV) of 214 Po have been measured by using gamma-gamma directional correlation techniques, twelve of them for the first time. The multipole mixing ratios of the corresponding electromagnetic transition from these levels to the first excited level have also been determined. (author)

  2. High-spin states in 214Rn, 216Ra and a study of even-even N = 128 systematics

    International Nuclear Information System (INIS)

    Loennroth, T.; Horn, D.; Baktash, C.; Lister, C.J.; Young, G.R.

    1983-01-01

    High-spin states in 214 Rn and 216 Ra have been studied by means of the reaction 208 Pb( 13 C, α 3n #betta#) 214 Rn and 208 Pb( 13 C, 5n #betta#) 216 Ra at beam energies in the range 75--95 MeV. In-beam spectroscopy techniques, including #betta#-decay excitation functions, α-#betta# coincidences, #betta#-#betta# coincidences, #betta#-ray angular distributions, and pulsed-beam-#betta# timing, were utilized to establish level energies, #betta#-ray multipolarities, J/sup π/ assignments, and isomeric lifetimes. Excited states with spins up to 23h in 214 Rn and roughly-equal30h in 216 Ra were observed. Isomers were found in 214 Rn at 1625 keV (T/sub 1/2/ = 9 ns, J/sup π/ = 8 + ), 1787 keV (22 ns, 10 + ), 3485 keV (95 ns, 16), 4509 keV (230 ns, 20), and 4738 keV (8 ns, 22), and in 216 Ra at 1708 keV (8 ns, 8 + ) and 5868 keV (10 ns, approx.24). B(EL) values were deduced and compared to previously known lead-region electric transition rates. Shell-model calculations were performed and used to make configurational assignments. The absence of major α-decay branching in the isomers is explained and the systematic behavior of N = 128 even-even nuclei is discussed

  3. 30 CFR 250.214 - What geological and geophysical (G&G) information must accompany the EP?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What geological and geophysical (G&G... and Information Contents of Exploration Plans (ep) § 250.214 What geological and geophysical (G&G) information must accompany the EP? The following G&G information must accompany your EP: (a) Geological...

  4. High-spin states in 214Rn, 216Ra and a study of even-even N = 128 systematics

    International Nuclear Information System (INIS)

    Loennroth, T.; Horn, D.; Baktash, C.; Lister, C.J.; Young, G.R.

    1981-09-01

    High-spin states in 214 Rn and 216 Ra have been studied by means of the reaction 208 Pb( 13 C,α3nγ) 214 Rn and 208 Pb( 13 C,5nγ) 216 Ra at beam energies in the range 75-95 MeV. In-beam spectroscopy techniques, including γ-decay excitation functions, α-γ coincidences, γ-γ coincidences, γ-ray angular distributions and pulsed-beam-γ timing, were utilized to establish level energies, γ-ray multipolarities, JHπ assignments and isomeric lifetimes. Excited states with spins up to 23 h/2π in 214 Rn and 30 h/2π in 216 Ra were established. Isomers are found in 214 Rn at 1625 keV (9 ns, 8 + ), 1787 keV (22 ns, 10 + ), 3485 keV (95 ns, 16 + ), 4509 keV (230 ns, 20 + ) and 4735 keV (8.0 ns, 22 + ) and in 216 Ra at 1710 keV (8 ns, 8 + ) and 5868 keV (10 ns, 24 - ). B(EL) values are derived and compared to previously known lead-region electric transition rates. Shell-model calculations are performed on the basis of which configuration assignment is made. The absence of α-decay branching in the isomers is explained. The systematical behaviour of N = 128 even-even nuclei is discussed. Effective moments of inertia are derived. (author)

  5. 75 FR 20423 - Tenth Meeting: RTCA Special Committee 214: Working Group 78: Standards for Air Traffic Data...

    Science.gov (United States)

    2010-04-19

    ... so far SPR & INT documents version H SC-214/WG-78 TORs and Work Plan Review of Position Papers.... Francisco Estrada C., RTCA Advisory Committee. [FR Doc. 2010-8849 Filed 4-16-10; 8:45 am] BILLING CODE 4910...

  6. 48 CFR 52.214-27 - Price Reduction for Defective Certified Cost or Pricing Data-Modifications-Sealed Bidding.

    Science.gov (United States)

    2010-10-01

    ... reduction. This right to a price reduction is limited to that resulting from defects in data relating to... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Price Reduction for... PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52.214-27 Price Reduction for Defective...

  7. Synthesis and antibacterial activity of 1-N-(1,3-dihydroxy-2-propyl)kanamycin B (UK-31,214).

    Science.gov (United States)

    Richardson, K; Brammer, K W; Jevons, S; Plews, R M; Wright, J R

    1979-10-01

    1-N-(1,3-Dihydroxy-2-propyl)kanamycin B was prepared and its in vitro activity against aminoglycoside-sensitive and aminoglycoside-resistant organisms was compared with that of kanamycin B and gentamicin. This kanamycin B derivative (code No. UK-31,214) demonstrated potent activity in all of these tests and gave good protection in experimental infections in mice.

  8. High-spin states in 214Rn, 216Ra and a study of even-even N=128 systematics

    Science.gov (United States)

    Lönnroth, T.; Horn, D.; Baktash, C.; Lister, C. J.; Young, G. R.

    1983-01-01

    High-spin states in 214Rn and 216Ra have been studied by means of the reaction 208Pb(13C, α 3n γ)214Rn and 208Pb(13C, 5n γ)216Ra at beam energies in the range 75-95 MeV. In-beam spectroscopy techniques, including γ-decay excitation functions, α-γ coincidences, γ-γ coincidences, γ-ray angular distributions, and pulsed-beam-γ timing, were utilized to establish level energies, γ-ray multipolarities, Jπ assignments, and isomeric lifetimes. Excited states with spins up to 23ℏ in 214Rn and ~30ℏ in 216Ra were observed. Isomers were found in 214Rn at 1625 keV (T12=9 ns, Jπ=8+), 1787 keV (22 ns, 10+), 3485 keV (95 ns, 16), 4509 keV (230 ns, 20), and 4738 keV (8 ns, 22), and in 216Ra at 1708 keV (8 ns, 8+) and 5868 keV (10 ns, ~24). B(EL) values were deduced and compared to previously known lead-region electric transition rates. Shell-model calculations were performed and used to make configurational assignments. The absence of major α-decay branching in the isomers is explained and the systematic behavior of N=128 even-even nuclei is discussed. NUCLEAR STRUCTURE 208Pb(13C, α 3n γ)214Rn, 208Pb(13C, 5n γ) 216Ra, Elab=75-95 MeV. Measured α-γ coin, γ-γ(t) coin, I(θ), pulsed-beam-γ timing. Deduced level schemes, Jπ, T12, B(EL), multipolarities. Shell model calculations, Ge(Li) and Si detectors, enriched target.

  9. 47 CFR 68.214 - Changes in other than “fully protected” premises wiring that serves fewer than four subscriber...

    Science.gov (United States)

    2010-10-01

    ... premises wiring that serves fewer than four subscriber access lines. 68.214 Section 68.214... other than “fully protected” premises wiring that serves fewer than four subscriber access lines. Operations associated with the installation, connection, reconfiguration and removal (other than final...

  10. 41 CFR 301-71.214 - Does mandatory use of the Government contractor-issued travel charge card change the employee's...

    Science.gov (United States)

    2010-07-01

    ... the Government contractor-issued travel charge card change the employee's obligation to pay his/her travel card bill by the due date? 301-71.214 Section 301-71.214 Public Contracts and Property Management Federal Travel Regulation System TEMPORARY DUTY (TDY) TRAVEL ALLOWANCES AGENCY RESPONSIBILITIES 71-AGENCY...

  11. T-cell acute lymphoblastic leukemia associated with complex karyotype and SET-NUP214 rearrangement: a case study and review of the literature.

    Science.gov (United States)

    Lee, Sang-Guk; Park, Tae Sung; Cho, Sun Young; Lim, Gayoung; Park, Gwang Jin; Oh, Seung Hwan; Cho, Eun Hae; Chong, So Young; Huh, Ji Young

    2011-01-01

    SET-NUP214 rearrangements have been rarely reported in T-cell acute lymphoblastic leukemia (T-ALL), acute undifferentiated leukemia, and acute myeloid leukemia, and most documented cases have been associated with normal karyotypes in conventional cytogenetic analyses. Here, we describe a novel case of T-ALL associated with a mediastinal mass and a SET-NUP214 rearrangement, which was masked by a complex karyotype at the time of initial diagnosis. Using multiplex reverse transcriptase-polymerase chain reaction analysis, we detected a cryptic SET-NUP214 rearrangement in our patient. As only 11 cases (including the present study) of T-ALL with SET-NUP214 rearrangement have been reported, the clinical features and treatment outcomes have not been fully determined. Further studies are necessary to evaluate the incidence of SET-NUP214 rearrangement in T-ALL patients and the treatment responses as well as prognosis of these patients.

  12. Nonnatural amino acid incorporation into the methionine 214 position of the metzincin Pseudomonas aeruginosa alkaline protease

    Directory of Open Access Journals (Sweden)

    Honek John F

    2005-10-01

    Full Text Available Abstract Background The alkaline protease from Pseudomonas aeruginosa (AprA is a member of the metzincin superfamily of metalloendoproteases. A key feature of these proteases is a conserved methionine-containing 1,4-tight β turn at the base of the active site zinc binding region. Results To explore the invariant methionine position in this class of protease, incorporation of a nonnatural fluorinated methionine, L-difluoromethionine (DFM, into this site was accomplished. Although overproduction of the N-terminal catalytic fragment of AprA resulted in protein aggregates which could not be resolved, successful heterologous production of the entire AprA was accomplished in the presence and absence of the nonnatural amino acid. DFM incorporation was found to only slightly alter the enzyme kinetics of AprA. In addition, differential scanning calorimetry indicated no significant alteration in the thermal stability of the modified enzyme. Conclusion Although invariant in all metzincin proteases, the methionine 214 position in AprA can be successfully replaced by the nonnatural amino acid DFM resulting in little effect on protein structure and function. This study indicates that the increased size of the methyl group by the introduction of two fluorines is still sufficiently non-sterically demanding, and bodes well for the application of DFM to biophysical studies of protein structure and function in this class of protease.

  13. Nonnatural amino acid incorporation into the methionine 214 position of the metzincin Pseudomonas aeruginosa alkaline protease

    Science.gov (United States)

    Walasek, Paula; Honek, John F

    2005-01-01

    Background The alkaline protease from Pseudomonas aeruginosa (AprA) is a member of the metzincin superfamily of metalloendoproteases. A key feature of these proteases is a conserved methionine-containing 1,4-tight β turn at the base of the active site zinc binding region. Results To explore the invariant methionine position in this class of protease, incorporation of a nonnatural fluorinated methionine, L-difluoromethionine (DFM), into this site was accomplished. Although overproduction of the N-terminal catalytic fragment of AprA resulted in protein aggregates which could not be resolved, successful heterologous production of the entire AprA was accomplished in the presence and absence of the nonnatural amino acid. DFM incorporation was found to only slightly alter the enzyme kinetics of AprA. In addition, differential scanning calorimetry indicated no significant alteration in the thermal stability of the modified enzyme. Conclusion Although invariant in all metzincin proteases, the methionine 214 position in AprA can be successfully replaced by the nonnatural amino acid DFM resulting in little effect on protein structure and function. This study indicates that the increased size of the methyl group by the introduction of two fluorines is still sufficiently non-sterically demanding, and bodes well for the application of DFM to biophysical studies of protein structure and function in this class of protease. PMID:16221305

  14. Autoradiographic disposition of [1-methyl-14C]- and [2-14C]caffeine in mice

    International Nuclear Information System (INIS)

    Lachance, M.P.; Marlowe, C.; Waddell, W.J.

    1983-01-01

    Male, C57B1/6J mice received either [1-methyl-14C]caffeine or [2-14C]caffeine via the tail vein at a dose of 0.7 or 11 mg/kg, respectively. At 0.1, 0.33, 1, 3, 9, and 24 hr after treatment, the mice were anesthetized with ether and frozen by immersion in dry ice/hexane. The mice were processed for whole-body autoradiography by the Ullberg technique; this procedure does not allow thawing or contact with solvents. All autoradiographs revealed some retention of radioactivity at early time intervals in the lacrimal glands, seminal vesicle fluid, nasal and olfactory epithelium, and retinal melanocytes. The remaining portion of the animal was densitometrically uniform except for the lower levels noted in the CNS and adipose tissues. Excretion of radioactivity by the liver and kidneys seems to be the major routes of elimination. Localization in the liver at late time intervals was confined principally to the centrilobular region. Late sites of retention, observed only after [1-methyl-14C]caffeine administration, included the pancreas, minor and major salivary glands, splenic red pulp, thymal cortex, bone marrow, and gastrointestinal epithelium. Sites of localization present in both studies included the olfactory epithelium, lacrimal glands, hair follicles, and retinal melanocytes. Further studies are needed to determine whether the localization at these various sites is due to metabolic degradation, active transport, or possibly a specific receptor interaction

  15. Correlation between inflammatory infiltrate and epithelial lining in 214 cases of periapical cysts

    Directory of Open Access Journals (Sweden)

    Barbara Albertini Roquim Alcantara

    2013-12-01

    Full Text Available The aim of this study was to evaluate the prevalence of periapical cysts, identify their clinical and microscopic features and correlate their microscopic features with the inflammatory infiltrate present in the lesion site. A total of 214 cases were collected over a 10-year period. Clinical data, including gender, age, race, symptoms and location of the lesion, were recorded. Two independent examiners with no prior knowledge of the patients' clinical data conducted the microscopic evaluations. Statistical analyses were performed using Fisher's or chi-square tests at a 5% level of significance. The results showed that periapical cysts were more prevalent in white women, with a mean age of 35 years, and in the anterosuperior region. The majority of the lesions were lined by atrophic cystic epithelium, which was associated with moderate inflammatory infiltrate in the cystic capsule (p < 0.01, with a diffuse localization pattern (p = 0.03 and absence of neutrophils (p = 0.01. Our findings suggest that periapical cysts lined by atrophic epithelium are related to the presence of moderate mononuclear inflammatory infiltrate.

  16. System for Automated Geoscientific Analyses (SAGA) v. 2.1.4

    Science.gov (United States)

    Conrad, O.; Bechtel, B.; Bock, M.; Dietrich, H.; Fischer, E.; Gerlitz, L.; Wehberg, J.; Wichmann, V.; Böhner, J.

    2015-07-01

    The System for Automated Geoscientific Analyses (SAGA) is an open source geographic information system (GIS), mainly licensed under the GNU General Public License. Since its first release in 2004, SAGA has rapidly developed from a specialized tool for digital terrain analysis to a comprehensive and globally established GIS platform for scientific analysis and modeling. SAGA is coded in C++ in an object oriented design and runs under several operating systems including Windows and Linux. Key functional features of the modular software architecture comprise an application programming interface for the development and implementation of new geoscientific methods, a user friendly graphical user interface with many visualization options, a command line interpreter, and interfaces to interpreted languages like R and Python. The current version 2.1.4 offers more than 600 tools, which are implemented in dynamically loadable libraries or shared objects and represent the broad scopes of SAGA in numerous fields of geoscientific endeavor and beyond. In this paper, we inform about the system's architecture, functionality, and its current state of development and implementation. Furthermore, we highlight the wide spectrum of scientific applications of SAGA in a review of published studies, with special emphasis on the core application areas digital terrain analysis, geomorphology, soil science, climatology and meteorology, as well as remote sensing.

  17. Thermal regime of the State 2-14 well, Salton Sea Scientific Drilling Project

    Science.gov (United States)

    Sass, J.H.; Priest, S.S.; Duda, L.E.; Carson, C.C.; Hendricks, J.D.; Robison, L.C.

    1988-01-01

    Temperature logs were made repeatedly during breaks in drilling and both during and after flow tests in the Salton Sea Scientific Drilling Project well (State 2-14). The purpose of these logs was to assist in identifying zones of fluid loss or gain and to characterize reservoir temperatures. At the conclusion of the active phase of the project, a series of logs was begun in an attempt to establish the equilibrium temperature profile. Thermal gradients decrease from about 250 mK m-1 in the upper few hundred meters to just below 200 mK m-1 near the base of the conductive cap. Using one interpretation, thermal conductivities increase with depth (mainly because of decreasing porosity), resulting in component heat flows that agree reasonably well with the mean of about 450 mW m-2. This value agrees well with heat flow data from the shallow wells within the Salton Sea geothermal field. A second interpretation, in which measured temperature coefficients of quartz- and carbonate-rich rocks are used to correct thermal conductivity, results in lower mean conductivities that are roughly constant with depth and, consequently, systematically decreasing heat flux averaging about 350 mW m-2 below 300 m. This interpretation is consistent with the inference (from fluid inclusion studies) that the rocks in this part of the field were once several tens of degrees Celsius hotter than they are now. The age of this possible disturbance is estimated at a few thousand years. -from Authors

  18. Fatigue crack growth behaviour of 21/4Cr1Mo steel tube at elevated temperature

    International Nuclear Information System (INIS)

    Bulloch, J.H.; Buchanan, L.W.

    1987-01-01

    The fatigue crack growth characteristics of 21/4Cr1Mo steel tube have been examined at 588 0 C over the frequency range 0.02-20 Hz and dwell time range 10-960 min. All tests were conducted under load control in laboratory air at an R-ratio of 0.5. The elevated temperature fatigue crack growth characteristics were adequately described in terms of the stress intensity range ΔKAPPA. The continuous cyclic test data exhibited a significant effect of frequency that agreed well with predicted effects using a simple mathematical model of the high temperature fatigue process. With the dwell time range of 10-100 min there was a significant dwell time effect on the critical ΔKAPPA level for creep-fatigue interactive growth. At dwell times > 100 min the dwell time effect saturates. When creep-fatigue interactive growth occurs, growth rates reside above the maximum for continuum-controlled fatigue crack growth, and exhibit a da/dN varies as ΔKAPPA 10 dependence; failure is then intergranular in nature. (author)

  19. Impact of HIV-1 reverse transcriptase polymorphism F214L on virological response to thymidine analogue-based regimens in antiretroviral therapy (ART)-naive and ART-experienced patients

    DEFF Research Database (Denmark)

    Ceccherini-Silberstein, Francesca; Cozzi-Lepri, Alessandro; Ruiz, Lidia

    2007-01-01

    A negative association between the polymorphism F214L and type 1 thymidine analogue (TA) mutations (TAMs) has been observed. However, the virological response to TAs according to the detection of F214L has not been evaluated....

  20. Validation-based insertional mutagenesis for identification of Nup214 as a host factor for EV71 replication in RD cells

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Bei; Zhang, XiaoYu; Zhao, Zhendong, E-mail: timjszzd@163.com

    2013-08-02

    Highlights: •We introduced a new mutagenesis strategy named VBIM to the viral research. •This method can identify either host factors or host restriction factors. •Using VBIM system, we identified Nup214 as a host factor for EV71 replication in RD cells. -- Abstract: Lentiviral validation-based insertional mutagenesis (VBIM) is a sophisticated, forward genetic approach that is used for the investigation of signal transduction in mammalian cells. Using VBIM, we conducted function-based genetic screening for host genes that affect enterovirus 71 (EV71) viral replication. This included host factors that are required for the life cycle of EV71 and host restriction factors that inhibit EV71 replication. Several cell clones, resistant to EV71, were produced using EV71 infection as a selection pressure and the nuclear pore protein 214 (Nup214) was identified as a host factor required for EV71 replication. In SD2-2, the corresponding VBIM lentivirus transformed clone, the expression of endogenous Nup214 was significantly down-regulated by the reverse inserted VBIM promoter. After Cre recombinase-mediated excision of the VBIM promoter, the expression of Nup214 recovered and the clone regained sensitivity to the EV71 infection. Furthermore, over-expression of Nup214 in the cells suggested that Nup214 was promoting EV71 replication. Results of this study indicate that a successful mutagenesis strategy has been established for screening host genes related to viral replication.

  1. Validation-based insertional mutagenesis for identification of Nup214 as a host factor for EV71 replication in RD cells

    International Nuclear Information System (INIS)

    Wang, Bei; Zhang, XiaoYu; Zhao, Zhendong

    2013-01-01

    Highlights: •We introduced a new mutagenesis strategy named VBIM to the viral research. •This method can identify either host factors or host restriction factors. •Using VBIM system, we identified Nup214 as a host factor for EV71 replication in RD cells. -- Abstract: Lentiviral validation-based insertional mutagenesis (VBIM) is a sophisticated, forward genetic approach that is used for the investigation of signal transduction in mammalian cells. Using VBIM, we conducted function-based genetic screening for host genes that affect enterovirus 71 (EV71) viral replication. This included host factors that are required for the life cycle of EV71 and host restriction factors that inhibit EV71 replication. Several cell clones, resistant to EV71, were produced using EV71 infection as a selection pressure and the nuclear pore protein 214 (Nup214) was identified as a host factor required for EV71 replication. In SD2-2, the corresponding VBIM lentivirus transformed clone, the expression of endogenous Nup214 was significantly down-regulated by the reverse inserted VBIM promoter. After Cre recombinase-mediated excision of the VBIM promoter, the expression of Nup214 recovered and the clone regained sensitivity to the EV71 infection. Furthermore, over-expression of Nup214 in the cells suggested that Nup214 was promoting EV71 replication. Results of this study indicate that a successful mutagenesis strategy has been established for screening host genes related to viral replication

  2. Psychiatric stigma in treatment seeking adults with personality problems: evidence from a sample of 214 patients.

    Directory of Open Access Journals (Sweden)

    Kirsten eCatthoor

    2015-07-01

    Full Text Available Stigmatization is a major hindrance in adult psychiatric patients with Axis-I diagnoses, as shown consistently in most studies. Significantly fewer studies on the emergence of psychiatric stigma in adult patients with personality disorders exist, although the resulting evidence is conclusive. Some authors consider patients with personality disorders at risk for severe stigmatization because of intense difficulties during interpersonal contact, even in a psychotherapeutic relationship. The aim of this study was primarily the assessment of pre-existing stigma in patients referred for intensive treatment for personality disorders. The study enrolled 214 patients admitted to the adult department of a highly specialized mental health care institute offering psychotherapy for patients with severe and complex personality pathology. All patients underwent a standard assessment with self-report questionnaires and a semi-structured interview to measure Axis II personality disorders. The Stigma Consciousness Questionnaire (SCQ and the Perceived Devaluation-Discrimination Questionnaire (DDQ, both validated instruments, were used to measure perceived and actual experiences of stigma. Independent sample t-tests were used to investigate differences in the mean total stigma scores for patients both with and without a personality disorder. One-way ANOVA’s were performed to assess the differences between having a borderline personality disorder, another personality disorder, or no personality disorder diagnosis.Multiple regression main effect analyses were conducted in order to explore the impact of the different personality disorder diagnosis on the level of stigma. The mean scores across all patient groups were consistent with rather low stigma. No differences were found for patients with or without a personality disorder diagnosis. Level of stigma in general was not associated with an accumulating number of personality disorders.

  3. Detection of Helicobacter pylori infection by examination of human breath odor using electronic nose Bloodhound-214ST

    Science.gov (United States)

    Shnayder, E. P.; Moshkin, M. P.; Petrovskii, D. V.; Shevela, A. I.; Babko, A. N.; Kulikov, V. G.

    2009-05-01

    Our aim was to examine the possibility of use e-nose Bloodhound-214ST to determine presence or absence of H. pylori infection using exhalation samples of patients. Breath samples were collected twice: at baseline and after oral administration of 500 mg of urea. H. pylori status of patients was confirmed by antral biopsy. Using two approaches for the data analysis we showed the possibility to distinguish H. pylori free and infected patients.

  4. Personal monitoring of 218Po and 214Po radionuclide deposition onto individuals under normal environmental exposure conditions

    International Nuclear Information System (INIS)

    Eatough, J.P.; Worley, A.; Moss, G.R.

    1999-01-01

    Personal dosemeters have been utilized to monitor the deposition of the radon decay products 218 Po and 214 Po onto individuals under normal environmental exposure conditions. Each detector consists of TASTRAK alpha-sensitive plastic incorporated into an ordinary working wristwatch. Subsequent analysis provides energy discrimination of the detected alpha-particle decays, and allows events from the individual radon decay products 218 Po and 214 Po, attached to the detector surface, to be uniquely identified. Assuming similar deposition onto skin and detector surfaces, the activity per unit area of deposited radionuclides can be determined for exposed skin. Forty-one personal dosemeters were issued to volunteers selected through the hospital medical physics departments at Reading, Northampton, Exeter and Plymouth. Each volunteer was also issued with a personal radon dosemeter to determine their individual radon exposure. The volunteers wore the two dosemeters simultaneously and continuously for a period of around one month. Correlations were observed between the radon exposure of the individual and the activity per unit area of 218 Po and 214 Po on the detector surface. From these correlations it can be estimated that at the UK average radon exposure of 20 Bq m -3 , the number of decays/cm 2 /year on continuously exposed skin surface is between 3500 and 28 000 for 218 Po, and between 7000 and 21 000 for 214 Po. These results can be combined with theoretical modelling of the dose distribution in the skin to yield the alpha-particle radiation dose to any identified target cells. (author)

  5. Corrective Action Investigation Plan for Corrective Action Unit 214: Bunkers and Storage Areas Nevada Test Site, Nevada

    International Nuclear Information System (INIS)

    2003-01-01

    This Corrective Action Investigation Plan contains the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office's approach to collect the data necessary to evaluate corrective action alternatives appropriate for the closure of Corrective Action Unit (CAU) 214 under the Federal Facility Agreement and Consent Order. Located in Areas 5, 11, and 25 of the Nevada Test Site, CAU 214 consists of nine Corrective Action Sites (CASs): 05-99-01, Fallout Shelters; 11-22-03, Drum; 25-99-12, Fly Ash Storage; 25-23-01, Contaminated Materials; 25-23-19, Radioactive Material Storage; 25-99-18, Storage Area; 25-34-03, Motor Dr/Gr Assembly (Bunker); 25-34-04, Motor Dr/Gr Assembly (Bunker); and 25-34-05, Motor Dr/Gr Assembly (Bunker). These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives (CAAs). The suspected contaminants and critical analyte s for CAU 214 include oil (total petroleum hydrocarbons-diesel-range organics [TPH-DRO], polychlorinated biphenyls [PCBs]), pesticides (chlordane, heptachlor, 4,4-DDT), barium, cadmium, chronium, lubricants (TPH-DRO, TPH-gasoline-range organics [GRO]), and fly ash (arsenic). The land-use zones where CAU 214 CASs are located dictate that future land uses will be limited to nonresidential (i.e., industrial) activities. The results of this field investigation will support a defensible evaluation of viable corrective action alternatives that will be presented in the corrective action decision document

  6. 42 CFR 57.214 - Repayment of loans made after November 17, 1971, for failure to complete a program of study.

    Science.gov (United States)

    2010-10-01

    ... IMPROVEMENTS, SCHOLARSHIPS AND STUDENT LOANS Health Professions Student Loans § 57.214 Repayment of loans made... complete these studies, taking into account such factors as academic, medical, or financial difficulties...

  7. miR-214-Dependent Increase of PHLPP2 Levels Mediates the Impairment of Insulin-Stimulated Akt Activation in Mouse Aortic Endothelial Cells Exposed to Methylglyoxal

    Directory of Open Access Journals (Sweden)

    Cecilia Nigro

    2018-02-01

    Full Text Available Evidence has been provided linking microRNAs (miRNAs and diabetic complications, by the regulation of molecular pathways, including insulin-signaling, involved in the pathophysiology of vascular dysfunction. Methylglyoxal (MGO accumulates in diabetes and is associated with cardiovascular complications. This study aims to analyze the contribution of miRNAs in the MGO-induced damaging effect on insulin responsiveness in mouse aortic endothelial cells (MAECs. miRNA modulation was performed by transfection of specific miRNA mimics and inhibitors in MAECs, treated or not with MGO. miRNA-target protein levels were evaluated by Western blot. PH domain leucine-rich repeat protein phosphatase 2 (PHLPP2 regulation by miR-214 was tested by luciferase assays and by the use of a target protector specific for miR-214 on PHLPP2-3′UTR. This study reveals a 4-fold increase of PHLPP2 in MGO-treated MAECs. PHLPP2 levels inversely correlate with miR-214 modulation. Moreover, miR-214 overexpression is able to reduce PHLPP2 levels in MGO-treated MAECs. Interestingly, a direct regulation of PHLPP2 is proved to be dependent by miR-214. Finally, the inhibition of miR-214 impairs the insulin-dependent Akt activation, while its overexpression rescues the insulin effect on Akt activation in MGO-treated MAECs. In conclusion, this study shows that PHLPP2 is a target of miR-214 in MAECs, and identifies miR-214 downregulation as a contributing factor to MGO-induced endothelial insulin-resistance.

  8. Attached and Unattached Activity Size Distribution of Short-Lived Radon Progeny (214Pb) and Evaluation of Deposition Fraction

    International Nuclear Information System (INIS)

    Mohamed, A.; Ahmed, A.A.; Ali, A.E.; Yuness, M.

    2009-01-01

    Inhalation of 2 '2 2 Rn progeny in the domestic environment contributes the greatest fraction of the natural radiation exposure to the public. Dosimetric models are most often used in the assessment of human lung doses due to inhaled radioactivity because of the difficulty in making direct measurements. These models require information about the parameters of activity size distributions of radon progeny. The current study presents measured data on the attached and unattached activity size distributions of radon progeny in indoor air in El-Minia, Egypt. The attached fraction was collected using a low pressure Berner cascade impactor technique. A screen diffusion battery was used for collecting the unattached fraction. Most of the attached activities for 222 Rn progeny were associated with aerosol particles of the accumulation mode. The mean activity median aerodynamic diameter (AMAD) of this mode for 21 4 P b was determined to be 401 nm with relative mean geometric standard deviation of 2.96. The mean value of specific air activity concentration of 214 Pb associated with that mode was determined to be 4.74 %0.44 Bq m -3 . The relative mean geometric standard deviations of unattached 214 Pb was determined to be 1.21 with the mean activity thermodynamic diameter (AMTD) of 1.2 nm. The mean unattached activity concentration of 214 Pb was found to be 0.44%0.14 Bq m-3. Based on the obtained results of radon progeny size distributions (unattached and attached), the deposition fractions in each airway generation of the human lung were evaluated by using a lung deposition model

  9. LW-214, a newly synthesized flavonoid, induces intrinsic apoptosis pathway by down-regulating Trx-1 in MCF-7 human breast cells.

    Science.gov (United States)

    Pan, Di; Li, Wei; Miao, Hanchi; Yao, Jing; Li, Zhiyu; Wei, Libin; Zhao, Li; Guo, Qinglong

    2014-02-15

    In this study, the anticancer effect of LW-214, a newly synthesized flavonoid, against MCF-7 human breast cancer cells and the underlying mechanisms were investigated. LW-214 triggered the mitochondrial apoptotic pathway by increasing Bax/Bcl-2 ratio, loss of mitochondrial membrane potential (ΔΨm) and caspase-9 activation, degradation of poly (ADP-ribose) polymerase (PARP), cytochrome c (Cyt c) release and apoptosis-inducing factor (AIF) transposition. Further research revealed that both the reactive oxygen species (ROS) generation and the apoptosis signal regulating kinase 1 (ASK1) activation by LW-214 were induced by down-regulating the thioredoxin-1 (Trx-1) expression. The ROS elevation and ASK1 activation induced a sustained phosphorylation of c-Jun N-terminal kinase (JNK), while SP600125, as known as JNK inhibitor, almost reversed LW-214-induced apoptosis in MCF-7 cells. Overexpression of Trx-1 in MCF-7 cells attenuated LW-214-mediated apoptosis as well as the JNK activation and reversed the expression of mitochondrial apoptosis-related protein. Accordingly, the in vivo study showed that LW-214 exhibited a potential antitumor effect in BALB/c species mice inoculated MCF-7 tumor with low systemic toxicity, and the mechanism was the same as in vitro study. Taken together, these findings indicated that LW-214 may down-regulated Trx-1 function, causing intracellular ROS generation and releasing the ASK1, and lead to JNK activation, which consequently induced the mitochondrial apoptosis in vitro and in vivo. Copyright © 2013 Elsevier Inc. All rights reserved.

  10. Modeling the receptor pharmacology, pharmacokinetics, and pharmacodynamics of NKTR-214, a kinetically-controlled interleukin-2 (IL2 receptor agonist for cancer immunotherapy.

    Directory of Open Access Journals (Sweden)

    Deborah Charych

    Full Text Available Cytokines are potent immune modulating agents but are not ideal medicines in their natural form due to their short half-life and pleiotropic systemic effects. NKTR-214 is a clinical-stage biologic that comprises interleukin-2 (IL2 protein bound by multiple releasable polyethylene glycol (PEG chains. In this highly PEG-bound form, the IL2 is inactive; therefore, NKTR-214 is a biologic prodrug. When administered in vivo, the PEG chains slowly release, creating a cascade of increasingly active IL2 protein conjugates bound by fewer PEG chains. The 1-PEG-IL2 and 2-PEG-IL2 species derived from NKTR-214 are the most active conjugated-IL2 species. Free-IL2 protein is undetectable in vivo as it is eliminated faster than formed. The PEG chains on NKTR-214 are located at the region of IL2 that contacts the alpha (α subunit of the heterotrimeric IL2 receptor complex, IL2Rαβγ, reducing its ability to bind and activate the heterotrimer. The IL2Rαβγ complex is constitutively expressed on regulatory T cells (Tregs. Therefore, without the use of mutations, PEGylation reduces the affinity for IL2Rαβγ to a greater extent than for IL2Rβγ, the receptor complex predominant on CD8 T cells. NKTR-214 treatment in vivo favors activation of CD8 T cells over Tregs in the tumor microenvironment to provide anti-tumor efficacy in multiple syngeneic models. Mechanistic modeling based on in vitro and in vivo kinetic data provides insight into the mechanism of NKTR-214 pharmacology. The model reveals that conjugated-IL2 protein derived from NKTR-214 occupy IL-2Rβγ to a greater extent compared to free-IL2 protein. The model accurately describes the sustained in vivo signaling observed after a single dose of NKTR-214 and explains how the properties of NKTR-214 impart a unique kinetically-controlled immunological mechanism of action.

  11. Modeling the receptor pharmacology, pharmacokinetics, and pharmacodynamics of NKTR-214, a kinetically-controlled interleukin-2 (IL2) receptor agonist for cancer immunotherapy.

    Science.gov (United States)

    Charych, Deborah; Khalili, Samira; Dixit, Vidula; Kirk, Peter; Chang, Thomas; Langowski, John; Rubas, Werner; Doberstein, Stephen K; Eldon, Michael; Hoch, Ute; Zalevsky, Jonathan

    2017-01-01

    Cytokines are potent immune modulating agents but are not ideal medicines in their natural form due to their short half-life and pleiotropic systemic effects. NKTR-214 is a clinical-stage biologic that comprises interleukin-2 (IL2) protein bound by multiple releasable polyethylene glycol (PEG) chains. In this highly PEG-bound form, the IL2 is inactive; therefore, NKTR-214 is a biologic prodrug. When administered in vivo, the PEG chains slowly release, creating a cascade of increasingly active IL2 protein conjugates bound by fewer PEG chains. The 1-PEG-IL2 and 2-PEG-IL2 species derived from NKTR-214 are the most active conjugated-IL2 species. Free-IL2 protein is undetectable in vivo as it is eliminated faster than formed. The PEG chains on NKTR-214 are located at the region of IL2 that contacts the alpha (α) subunit of the heterotrimeric IL2 receptor complex, IL2Rαβγ, reducing its ability to bind and activate the heterotrimer. The IL2Rαβγ complex is constitutively expressed on regulatory T cells (Tregs). Therefore, without the use of mutations, PEGylation reduces the affinity for IL2Rαβγ to a greater extent than for IL2Rβγ, the receptor complex predominant on CD8 T cells. NKTR-214 treatment in vivo favors activation of CD8 T cells over Tregs in the tumor microenvironment to provide anti-tumor efficacy in multiple syngeneic models. Mechanistic modeling based on in vitro and in vivo kinetic data provides insight into the mechanism of NKTR-214 pharmacology. The model reveals that conjugated-IL2 protein derived from NKTR-214 occupy IL-2Rβγ to a greater extent compared to free-IL2 protein. The model accurately describes the sustained in vivo signaling observed after a single dose of NKTR-214 and explains how the properties of NKTR-214 impart a unique kinetically-controlled immunological mechanism of action.

  12. MicroRNA214 Is Associated With Progression of Ulcerative Colitis, and Inhibition Reduces Development of Colitis and Colitis-Associated Cancer in Mice.

    Science.gov (United States)

    Polytarchou, Christos; Hommes, Daniel W; Palumbo, Tiziana; Hatziapostolou, Maria; Koutsioumpa, Marina; Koukos, Georgios; van der Meulen-de Jong, Andrea E; Oikonomopoulos, Angelos; van Deen, Welmoed K; Vorvis, Christina; Serebrennikova, Oksana B; Birli, Eleni; Choi, Jennifer; Chang, Lin; Anton, Peter A; Tsichlis, Philip N; Pothoulakis, Charalabos; Verspaget, Hein W; Iliopoulos, Dimitrios

    2015-10-01

    Persistent activation of the inflammatory response contributes to the development of inflammatory bowel diseases, which increase the risk of colorectal cancer. We aimed to identify microRNAs that regulate inflammation during the development of ulcerative colitis (UC) and progression to colitis-associated colon cancer (CAC). We performed a quantitative polymerase chain reaction analysis to measure microRNAs in 401 colon specimens from patients with UC, Crohn's disease, irritable bowel syndrome, sporadic colorectal cancer, or CAC, as well as subjects without these disorders (controls); levels were correlated with clinical features and disease activity of patients. Colitis was induced in mice by administration of dextran sodium sulfate (DSS), and carcinogenesis was induced by addition of azoxymethane; some mice also were given an inhibitor of microRNA214 (miR214). A high-throughput functional screen of the human microRNAome found that miR214 regulated the activity of nuclear factor-κB. Higher levels of miR214 were detected in colon tissues from patients with active UC or CAC than from patients with other disorders or controls and correlated with disease progression. Bioinformatic and genome-wide profile analyses showed that miR214 activates an inflammatory response and is amplified through a feedback loop circuit mediated by phosphatase and tensin homolog (PTEN) and PDZ and LIM domain 2 (PDLIM2). Interleukin-6 induced signal transducer and activator of transcription 3 (STAT3)-mediated transcription of miR214. A miR214 chemical inhibitor blocked this circuit and reduced the severity of DSS-induced colitis in mice, as well as the number and size of tumors that formed in mice given azoxymethane and DSS. In fresh colonic biopsy specimens from patients with active UC, the miR214 inhibitor reduced inflammation by increasing levels of PDLIM2 and PTEN. Interleukin-6 up-regulates STAT3-mediated transcription of miR214 in colon tissues, which reduces levels of PDLIM2 and PTEN

  13. Production and assay of cellulolytic enzyme activity of Enterobacter cloacae WPL 214 isolated from bovine rumen fluid waste of Surabaya abbatoir, Indonesia

    Directory of Open Access Journals (Sweden)

    W. P. Lokapirnasari

    2015-03-01

    Full Text Available Aim: This study aims to produce and assay cellulolytic enzyme activity (endo-(1,4-β-D-glucanase, exo-(1,4-β-Dglucanase, and β-glucosidase, at optimum temperature and optimum pH of Enterobacter cloacae WPL 214 isolated from bovine rumen fluid waste of Surabaya Abbatoir, Indonesia. Materials and Methods: To produce enzyme from a single colony of E. cloacae WPL 214, 98 × 1010 CFU/ml of isolates was put into 20 ml of liquid medium and incubated in a shaker incubator for 16 h at 35°C in accordance with growth time and optimum temperature of E. cloacae WPL 214. Further on, culture was centrifuged at 6000 rpm at 4°C for 15 min. Pellet was discarded while supernatant containing cellulose enzyme activity was withdrawn to assay endo-(1,4-β-D-glucanase, exo-(1,4-β-D-glucanase, and β-glucosidase. Results: Cellulase enzyme of E. cloacae WPL 214 isolates had endoglucanase activity of 0.09 U/ml, exoglucanase of 0.13 U/ml, and cellobiase of 0.10 U/ml at optimum temperature 35°C and optimum pH 5. Conclusion: E. cloacae WPL 214 isolated from bovine rumen fluid waste produced cellulose enzyme with activity as cellulolytic enzyme of endo-(1,4-β-D-glucanase, exo-(1,4-β-D-glucanase and β-glucosidase.

  14. Evaluation of drought response of two poplar clones (Populus x canadensis Monch 'I-214' and P. deltoides Marsh. 'Dvina') through high resolution analysis of stem growth.

    Science.gov (United States)

    Giovannelli, Alessio; Deslauriers, Annie; Fragnelli, Giuseppe; Scaletti, Luciano; Castro, Gaetano; Rossi, Sergio; Crivellaro, Alan

    2007-01-01

    Different irrigation effects on stem radius variation (DeltaR) and maximum daily shrinkage (MDS) in Populus deltoides 'Dvina' and Populusxcanadensis 'I-214' were studied to assess differences in drought tolerance between clones. One-year-old trees growing in concrete tanks were submitted to two irrigation regimes (natural rainfall and irrigation) from 24 June to 10 August, and DeltaR was monitored by automatic point dendrometers. Independently of the irrigation regime, 'Dvina' showed a higher stem radial increment than 'I-214'. In both clones, the first response to changed soil water content was a significant increase in MDS, whilst DeltaR decreased about 20 d later when pre-dawn leaf water potential (Psipd) dropped below -0.4 MPa. However, they displayed different strategies to overcome drought. 'Dvina' maintained a positive DeltaR for longer than 'I-214', which had lower leaf Psipd and greater leaf abscission at the end of the drought period. After irrigation resumed, 'Dvina' showed a higher capacity to restore stem growth. 'I-214' was probably unable to recover secondary growth because of higher leaf abscission during drought stress and the production of newly expanded leaves during recovery. It is concluded that the larger radial growth of 'Dvina' derived from a better water use (carbon uptake versus water loss) than 'I-214' under limited water availability.

  15. Impact of HIV-1 reverse transcriptase polymorphism F214L on virological response to thymidine analogue based regimens in ART-naïve and experienced patients

    DEFF Research Database (Denmark)

    Silberstein, F; Cozzi-Lepri, A; Ruiz, L

    2007-01-01

    BACKGROUND: A negative association between the polymorphism F214L and type 1 thymidine analogue (TA) mutations (TAMs) has been observed. However, the virological response to TAs according to the detection of F214L has not been evaluated. METHODS: We studied 590 patients from EuroSIDA who started ...... were observed in patients with M41L/T215Y and mixed TAM profiles detected before the initiation of cART. CONCLUSIONS: This study provides evidence that the detection of polymorphism F214L is associated with a favorable virological response to TA-based cART.......BACKGROUND: A negative association between the polymorphism F214L and type 1 thymidine analogue (TA) mutations (TAMs) has been observed. However, the virological response to TAs according to the detection of F214L has not been evaluated. METHODS: We studied 590 patients from EuroSIDA who started TA...... therapy for the first time as part of potent combination antiretroviral therapy (cART) and who were tested for genotypic resistance within the past 6 months. End points were median reduction in the week 24 viral load and time to virological failure (2 consecutive VL measurements >400 copies/mL after...

  16. The α-MSH analogue AP214 attenuates rise in pulmonary pressure and fall in ejection fraction in lipopolysaccharide-induced systemic inflammatory response syndrome in pigs.

    Science.gov (United States)

    Kristensen, Jens; Jonassen, Thomas E N; Rehling, Michael; Tønnesen, Else; Sloth, Erik; Nielsen, Søren; Frøkiaer, Jørgen

    2011-01-01

    The effect of an α-melanocyte stimulating hormone (α-MSH) analogue (AP214) on experimentally endotoxin-induced systemic inflammatory response syndrome (SIRS) was studied, because α-MSH in rodent models has shown promise in attenuating inflammatory response markers and associated organ damage in SIRS. SIRS is associated with considerable morbidity and mortality. Consequently, new treatment modalities are still warranted to address the different aspects of the pathophysiological process. SIRS was induced by lipopolysaccharide (LPS) (Escherichia coli endotoxin) infusion in anaesthetized Danish Landrace pigs (20-25 kg). The pigs received an α-MSH analogue (AP214) or saline as a bolus at the initiation of the LPS infusion. The hemodynamic response was registered as well as echocardiographic indices of left ventricular function. The cardiovascular response was recorded together with echocardiographic indices of left ventricular function in control and in intervention animals. AP214 reduced the early peak in pulmonary pressure and pulmonary vascular resistance by approximately 33%. Furthermore, AP214 prevented the decline in left ventricular fractional shortening as observed in the control group. Mean change and standard deviation in fractional shortening (ΔFS) in control group: - 7·3 (4·7), AP214 (low dose): 0·9 (8·2) and AP214 (high dose) 4·1 (6·0), P < 0·05 for both intervention groups versus control. In the porcine model, the peak increase in pulmonary pressure was attenuated, and the LPS-induced decline in left ventricular function was prevented. © 2010 The Authors. Clinical Physiology and Functional Imaging © 2010 Scandinavian Society of Clinical Physiology and Nuclear Medicine.

  17. Application of 2-1/4 Cr-1 Mo as a structural material in saturated steam cycle LMFBR systems. Final report

    International Nuclear Information System (INIS)

    Licina, G.J.; Busboom, H.J.; Ring, P.J.; Roy, P.; Schmidt, C.G.; Spalaris, C.N.

    1982-02-01

    The suitability and incentives were examined for using 2-1/4Cr-1Mo steel as a structural material for the entire primary and secondary sodium systems in a 1000 MWe pool-type Liquid Metal Fast Breeder Reactor. The critical properties, advantages and disadvantages of 2-1/4Cr-1Mo, and data needed for design were described for each major component in the reactor. The relative importance of alloy properties to the successful use of ferritics in LMFBR was identified. Licensing issues, likely to surface if ferritic alloys were to be used for critical reactor components, were discussed

  18. MicroRNA-214 Reduces Insulin-like Growth Factor-1 (IGF-1) Receptor Expression and Downstream mTORC1 Signaling in Renal Carcinoma Cells*

    Science.gov (United States)

    Das, Falguni; Dey, Nirmalya; Bera, Amit; Kasinath, Balakuntalam S.; Ghosh-Choudhury, Nandini; Choudhury, Goutam Ghosh

    2016-01-01

    Elevated IGF-1/insulin-like growth factor-1 receptor (IGF-1R) autocrine/paracrine signaling in patients with renal cell carcinoma is associated with poor prognosis of the disease independent of their von Hippel-Lindau (VHL) status. Increased expression of IGF-1R in renal cancer cells correlates with their potency of tumor development and progression. The mechanism by which expression of IGF-1R is increased in renal carcinoma is not known. We report that VHL-deficient and VHL-positive renal cancer cells possess significantly decreased levels of mature, pre-, and pri-miR-214 than normal proximal tubular epithelial cells. We identified an miR-214 recognition element in the 3′UTR of IGF-1R mRNA and confirmed its responsiveness to miR-214. Overexpression of miR-214 decreased the IGF-1R protein levels, resulting in the inhibition of Akt kinase activity in both types of renal cancer cells. IGF-1 provoked phosphorylation and inactivation of PRAS40 in an Akt-dependent manner, leading to the activation of mTORC1 signal transduction to increase phosphorylation of S6 kinase and 4EBP-1. Phosphorylation-deficient mutants of PRAS40 and 4EBP-1 significantly inhibited IGF-1R-driven proliferation of renal cancer cells. Expression of miR-214 suppressed IGF-1R-induced phosphorylation of PRAS40, S6 kinase, and 4EBP-1, indicating inhibition of mTORC1 activity. Finally, miR-214 significantly blocked IGF-1R-forced renal cancer cell proliferation, which was reversed by expression of 3′UTR-less IGF-1R and constitutively active mTORC1. Together, our results identify a reciprocal regulation of IGF-1R levels and miR-214 expression in renal cancer cells independent of VHL status. Our data provide evidence for a novel mechanism for IGF-1R-driven renal cancer cell proliferation involving miR-214 and mTORC1. PMID:27226530

  19. Astatine-211 labelled proteins and their stability in vivo

    International Nuclear Information System (INIS)

    Yi Changhou; Jin Jannan; Zhang Shuyuan; Wang Ketai; Zhang Dayuan; Zhou Maolun

    1989-01-01

    211 At or 131 I labelled proteins, e.g. 211 At-IgG or 211 At-BSA (bovine serum albumin) were prepared by 211 At reaction with the diazo-compound of para-aminobenzoic acid, which is then conjugated with IgG or BSA via an acylation reaction. The 211 At-carbon bond was found metabolically stable under in vivo conditions. For the labelling of proteins with 211 At or 131 I, other methods of direct oxidation are also described. The results show that for the labelling of proteins with 211 At, high rate of incorporation can be obtained with hydrogen peroxide as oxidant, but the labelling of proteins with 131 I is more favourable with the strong oxidant Chloramine-T. (author) 12 refs.; 6 figs

  20. Degradation of Triazine-2-(14C Metsulfuron-Methyl in Soil from an Oil Palm Plantation.

    Directory of Open Access Journals (Sweden)

    B S Ismail

    Full Text Available Triazine-2-(14C metsulfuron-methyl is a selective, systemic sulfonylurea herbicide. Degradation studies in soils are essential for the evaluation of the persistence of pesticides and their breakdown products. The purpose of the present study was to investigate the degradation of triazine-2-(14C metsulfuron-methyl in soil under laboratory conditions. A High Performance Liquid Chromatograph (HPLC equipped with an UV detector and an on-line radio-chemical detector, plus a Supelco Discovery column (250 x 4.6 mm, 5 μm, and PRP-1 column (305 x 7.0 mm, 10 μm was used for the HPLC analysis. The radioactivity was determined by a Liquid Scintillation Counter (LSC in scintillation fluid. The soil used was both sterilized and non-sterilized in order to observe the involvement of soil microbes. The estimated DT50 and DT90 values of metsulfuron-methyl in a non-sterile system were observed to be 13 and 44 days, whereas in sterilized soil, the DT50 and DT90 were 31 and 70 days, respectively. The principal degradation product after 60 days was CO2. The higher cumulative amount of (14CO2 in (14C-triazine in the non-sterilized soil compared to that in the sterile system suggests that biological degradation by soil micro-organisms significantly contributes to the dissipation of the compound. The major routes of degradation were O-demethylation, sulfonylurea bridge cleavage and the triazine "ring-opened."

  1. Genome Sequence Analysis of the Biogenic Amine-Producing Strain Lactococcus lactis subsp. cremoris CECT 8666 (Formerly GE2-14)

    Science.gov (United States)

    del Rio, Beatriz; Linares, Daniel M.; Fernandez, Maria; Mayo, Baltasar; Martin, M. Cruz; Alvarez, Miguel A.

    2014-01-01

    We here report a 2,801,031-bp annotated draft assembly for the Lactococcus lactis subsp. cremoris GE2-14 genome. This dairy strain produces the biogenic amine putrescine. This sequence may help identify the mechanisms regulating putrescine biosynthesis and throw light on ways to reduce its presence in fermented foods. PMID:25342694

  2. 7 CFR 1.214 - Appearance as a witness on behalf of a party other than the United States where the United States...

    Science.gov (United States)

    2010-01-01

    ... in Judicial or Administrative Proceedings § 1.214 Appearance as a witness on behalf of a party other... valid summons, subpoena, or other compulsory process demanding his or her appearance, or otherwise requested to appear on behalf of a party other than the United States in a judicial or administrative...

  3. Planck intermediate results. VI. The dynamical structure of PLCKG214.6+37.0, a Planck discovered triple system of galaxy clusters

    NARCIS (Netherlands)

    Planck Collaboration, [Unknown; Ade, P. A. R.; Aghanim, N.; Arnaud, M.; Ashdown, M.; Atrio-Barandela, F.; Aumont, J.; Baccigalupi, C.; Balbi, A.; Banday, A. J.; Barreiro, R. B.; Bartlett, J. G.; Battaner, E.; Benabed, K.; Benoît, A.; Bernard, J.-P.; Bersanelli, M.; Bhatia, R.; Bikmaev, I.; Böhringer, H.; Bonaldi, A.; Bond, J. R.; Borrill, J.; Bouchet, F. R.; Bourdin, H.; Burenin, R.; Burigana, C.; Cabella, P.; Cardoso, J.-F.; Castex, G.; Catalano, A.; Cayón, L.; Chamballu, A.; Chiang, L.-Y.; Chon, G.; Christensen, P. R.; Clements, D. L.; Colafrancesco, S.; Colombi, S.; Colombo, L. P. L.; Comis, B.; Coulais, A.; Crill, B. P.; Cuttaia, F.; Da Silva, A.; Dahle, H.; Danese, L.; Davis, R. J.; de Bernardis, P.; de Gasperis, G.; de Zotti, G.; Delabrouille, J.; Démoclès, J.; Diego, J. M.; Dolag, K.; Dole, H.; Donzelli, S.; Doré, O.; Dörl, U.; Douspis, M.; Dupac, X.; Efstathiou, G.; Enßlin, T. A.; Eriksen, H. K.; Finelli, F.; Flores-Cacho, I.; Forni, O.; Frailis, M.; Franceschi, E.; Frommert, M.; Galeotta, S.; Ganga, K.; Génova-Santos, R. T.; Giard, M.; Gilfanov, M.; Giraud-Héraud, Y.; González-Nuevo, J.; Górski, K. M.; Gregorio, A.; Gruppuso, A.; Hansen, F. K.; Harrison, D.; Heinämäki, P.; Hempel, A.; Henrot-Versillé, S.; Hernández-Monteagudo, C.; Herranz, D.; Hildebrandt, S. R.; Hivon, E.; Hobson, M.; Holmes, W. A.; Hurier, G.; Jaffe, T. R.; Jaffe, A. H.; Jagemann, T.; Jones, W. C.; Juvela, M.; Keihänen, E.; Khamitov, I.; Kisner, T. S.; Kneissl, R.; Knoche, J.; Knox, L.; Kunz, M.; Kurki-Suonio, H.; Lagache, G.; Lähteenmäki, A.; Lamarre, J.-M.; Lasenby, A.; Lawrence, C. R.; Le Jeune, M.; Leonardi, R.; Lilje, P. B.; López-Caniego, M.; Luzzi, G.; Macías-Pérez, J. F.; Maino, D.; Mandolesi, N.; Maris, M.; Marleau, F.; Marshall, D. J.; Martínez-González, E.; Masi, S.; Massardi, M.; Matarrese, S.; Mazzotta, P.; Mei, S.; Melchiorri, A.; Melin, J.-B.; Mendes, L.; Mennella, A.; Mitra, S.; Miville-Deschênes, M.-A.; Moneti, A.; Montier, L.; Morgante, G.; Mortlock, D.; Munshi, D.; Murphy, J. A.; Naselsky, P.; Nati, F.; Natoli, P.; Nørgaard-Nielsen, H. U.; Noviello, F.; Novikov, D.; Novikov, I.; Osborne, S.; Pajot, F.; Paoletti, D.; Pasian, F.; Patanchon, G.; Perdereau, O.; Perotto, L.; Perrotta, F.; Piacentini, F.; Piat, M.; Pierpaoli, E.; Piffaretti, R.; Plaszczynski, S.; Pointecouteau, E.; Polenta, G.; Ponthieu, N.; Popa, L.; Poutanen, T.; Pratt, G. W.; Prunet, S.; Puget, J.-L.; Rachen, J. P.; Rebolo, R.; Reinecke, M.; Remazeilles, M.; Renault, C.; Ricciardi, S.; Riller, T.; Ristorcelli, I.; Rocha, G.; Roman, M.; Rosset, C.; Rossetti, M.; Rubiño-Martín, J. A.; Rusholme, B.; Sandri, M.; Savini, G.; Scott, D.; Smoot, G. F.; Starck, J.-L.; Sudiwala, R.; Sunyaev, R.; Sutton, D.; Suur-Uski, A.-S.; Sygnet, J.-F.; Tauber, J. A.; Terenzi, L.; Toffolatti, L.; Tomasi, M.; Tristram, M.; Tuovinen, J.; Valenziano, L.; Van Tent, B.; Vielva, P.; Villa, F.; Vittorio, N.; Wade, L. A.; Wandelt, B. D.; Welikala, N.; Yvon, D.; Zacchei, A.; Zaroubi, S.; Zonca, A.

    The survey of galaxy clusters performed by Planck through the Sunyaev-Zeldovich effect has already discovered many interesting objects, thanks to its full sky coverage. One of the SZ candidates detected inthe early months of the mission near to the signal-to-noise threshold, PLCKG214.6+37.0, was

  4. 49 CFR 214.353 - Training and qualification of roadway workers who provide on-track safety for roadway work groups.

    Science.gov (United States)

    2010-10-01

    ... RAILROAD WORKPLACE SAFETY Roadway Worker Protection § 214.353 Training and qualification of roadway workers who provide on-track safety for roadway work groups. (a) The training and qualification of roadway... 49 Transportation 4 2010-10-01 2010-10-01 false Training and qualification of roadway workers who...

  5. Effect of cryogenic treatment on the tensile behaviour of En 52 and 21-4N valve steels at room and elevated temperatures

    International Nuclear Information System (INIS)

    Jaswin, M. Arockia; Lal, D. Mohan

    2011-01-01

    Research highlights: → Tensile behaviour of cryo-treated valve steels are investigated at elevated temperature. → En 52 and 21-4N valve steel materials are treated at - 196 o C . → Tensile strength of cryo-treated En 52 and 21-4N valve steel has improved by 8 % and 12 % respectively. → Precipitation of fine carbides through cryogenic treatment is the reason for the improved strength. -- Abstract: This experimental study investigates the effects of cryogenic treatment on the tensile behaviour of En 52 and 21-4N valve steels at room and elevated temperatures. The materials are subjected to shallow cryogenic treatment (SCT) at 193 K and deep cryogenic treatment (DCT) at 85 K and the tensile behaviour is compared with that of the conventional heat treatment (CHT). The high temperature tensile test is conducted at 673 K (400 o C) and 923 K (650 o C) for the En 52 and 21-4N valve steels respectively. The ultimate tensile strength of the En 52 and 21-4N DCT samples show an enhancement of 7.87% and 6.76% respectively, over the CHT samples tested at the elevated temperature. The average yield strength of the En 52 DCT samples has an improvement 11% than that of the CHT samples when tested at room and elevated temperatures. The deep cryogenic treatment conducted at the optimized condition shows 7.84% improvement in the tensile strength for the En 52 valve steel and 11.87% improvement for the 21-4N valve steel when compared to the strength of the samples without the cryogenic treatment. A scanning electron microscopic analysis of the fracture surface indicates the presence of dimples and microvoid coalescence on the grain facets and interfaces of the cryo-treated specimens. The fracture surface of the deep cryo-treated 21-4N valve steel specimen shows a complete intergranular fracture with deep secondary cracks between the grains. On comparing the results of the percentage elongation, the cryo-treated samples show a smaller reduction in the elongation than that of the

  6. Evaluation of ferritic alloy Fe-2-1/4Cr-1Mo after neutron irradiation - microstructure development

    International Nuclear Information System (INIS)

    Gelles, D.S.

    1984-05-01

    Microstructural examinations are reported for nine specimen conditions of 2-1/4Cr-1Mo steel which had been irradiated by fast neutrons over the temperature range 390 to 510 0 C. Two heats of material were involved, each with a different preirradiation heat treatment, one irradiated to a peak fluence of 5.1 x 10 22 n/cm 2 (E > 0.1 MeV) or 24 dpa and the other to 2.4 x 10 23 n/cm 2 (E > 0.1 MeV) or 116 dpa. Void swelling is found following irradiation at 400 0 C in both conditions and to 480 0 C in the higher fluence conditions. Concurrently dislocation structure and precipitation formed. Peak void swelling, void density, dislocation density and precipitate number density developed at the lowest temperature, approx. 400 0 C, whereas mean void size, and mean precipitate size increased with increasing irradiation temperature. The examination results are used to provide interpretation of in-reactor creep, density change and post irradiation tensile behavior

  7. Multiaxial fatigue criterion for 2-1/4 Cr-1 Mo steel for use in high-temperature structural design

    International Nuclear Information System (INIS)

    Blass, J.J.

    1990-01-01

    An improved multiaxial fatigue failure criterion is described that is based on a definition of equivalent inelastic strain range incorporating the shear and normal components of inelastic strain range on the planes of maximum inelastic shear strain range. Optimum values of certain parameters contained in the formulation were obtained by the method of least squares from the results of combined axial-torsional strain cycling test of 2--1/4 Cr-1 Mo steel conducted at 538 degrees C (1000 degrees F). The ability of this criterion to correlate the test results was compared with that of the Mises equivalent inelastic strain range criterion and was found to be superior. A procedure is described for calculating the required shear and normal components of strain range under general multiaxial strain cycling conditions. An improved definition of equivalent total strain range based on these considerations is directly applicable to the method of estimating fatigue damage in ASME Code Case N-47. 17 refs., 5 figs., 1 tab

  8. The sedimentology of uranium-bearing sandstones on the Waterval portion of the farm Brandewyns Gat 214, Beaufort West area

    International Nuclear Information System (INIS)

    Cole, D.I.

    1980-08-01

    The sedimentology of two uranium-bearing sandstones on the Waterval portion of the farm Brandewyns Gat 214 was studied by means of 36 vertical profiles measured across, through and adjacent to 4 mineralised deposits. The vertical profiles basically consist of a succession of sedimentary facies. A total of 19 facies was recognised within the fluvial sandstone sequence according to the criteria of grain-size and sedimentary structure. Transitions between the facies were subjected to a Markov chain analysis in order to delineate Markov-dependent transitions. Uranium mineralisation occurs mostly within the lower half of the fluvial sandstone sequence and is confined to the coarser-grained sedimentary facies. These facies probably acted as suitable aquifers for the transport of uraniferous solutions and permeability differences between the sandstone and the underlying mudstone and siltstone must have restricted these solutions to the lower half of the channel sandstone. The massive mudstone facies contains 13 per cent of the total cumulative thickness of mineralisation. This mineralisation probably originated from synchronously deposited tuffaceous material. Subsequent migration of uraniferous solutions may have concentrated the uranium

  9. [Essential thrombocythemia: baseline characteristics and risk factors for survival and thrombosis in a series of 214 patients].

    Science.gov (United States)

    Angona, Anna; Alvarez-Larrán, Alberto; Bellosillo, Beatriz; Martínez-Avilés, Luz; Garcia-Pallarols, Francesc; Longarón, Raquel; Ancochea, Àgueda; Besses, Carles

    2015-03-15

    Two prognostic models to predict overall survival and thrombosis-free survival have been proposed: International Prognostic Score for Essential Thrombocythemia (IPSET) and IPSET-Thrombosis, respectively, based on age, leukocytes count, history of previous thrombosis, the presence of cardiovascular risk factors and the JAK2 mutational status. The aim of the present study was to assess the clinical and biological characteristics at diagnosis and during evolution in essential thrombocythemia (ET) patients as well as the factors associated with survival and thrombosis and the usefulness of these new prognostic models. We have evaluated the clinical data and the mutation status of JAK2, MPL and calreticulin of 214 ET patients diagnosed in a single center between 1985 and 2012, classified according to classical risk stratification, IPSET and IPSET-Thrombosis. With a median follow-up of 6.9 years, overall survival was not associated with any variable by multivariate analysis. Thrombotic history and leukocytes>10×10(9)/l were associated with thrombosis-free survival (TFS). In our series, IPSET prognostic systems of survival and thrombosis did not provide more clinically relevant information regarding the classic risk of thrombosis stratification. Thrombotic history and leukocytosis>10×10(9)/l were significantly associated with lower TFS, while the prognostic IPSET-Thrombosis system did not provide more information than classical thrombotic risk assessment. Copyright © 2014 Elsevier España, S.L.U. All rights reserved.

  10. Absolute quantification of regional cerebral glucose utilization in mice by 18F-FDG small animal PET scanning and 2-14C-DG autoradiography.

    Science.gov (United States)

    Toyama, Hiroshi; Ichise, Masanori; Liow, Jeih-San; Modell, Kendra J; Vines, Douglass C; Esaki, Takanori; Cook, Michelle; Seidel, Jurgen; Sokoloff, Louis; Green, Michael V; Innis, Robert B

    2004-08-01

    The purpose of this study was to evaluate the feasibility of absolute quantification of regional cerebral glucose utilization (rCMR(glc)) in mice by use of (18)F-FDG and a small animal PET scanner. rCMR(glc) determined with (18)F-FDG PET was compared with values determined simultaneously by the autoradiographic 2-(14)C-DG method. In addition, we compared the rCMR(glc) values under isoflurane, ketamine and xylazine anesthesia, and awake states. Immediately after injection of (18)F-FDG and 2-(14)C-DG into mice, timed arterial samples were drawn over 45 min to determine the time courses of (18)F-FDG and 2-(14)C-DG. Animals were euthanized at 45 min and their brain was imaged with the PET scanner. The brains were then processed for 2-(14)C-DG autoradiography. Regions of interest were manually placed over cortical regions on corresponding coronal (18)F-FDG PET and 2-(14)C-DG autoradiographic images. rCMR(glc) values were calculated for both tracers by the autoradiographic 2-(14)C-DG method with modifications for the different rate and lumped constants for the 2 tracers. Average rCMR(glc) values in cerebral cortex with (18)F-FDG PET under normoglycemic conditions (isoflurane and awake) were generally lower (by 8.3%) but strongly correlated with those of 2-(14)C-DG (r(2) = 0.95). On the other hand, under hyperglycemic conditions (ketamine/xylazine) average cortical rCMR(glc) values with (18)F-FDG PET were higher (by 17.3%) than those with 2-(14)C-DG. Values for rCMR(glc) and uptake (percentage injected dose per gram [%ID/g]) with (18)F-FDG PET were significantly lower under both isoflurane and ketamine/xylazine anesthesia than in the awake mice. However, the reductions of rCMR(glc) were markedly greater under isoflurane (by 57%) than under ketamine and xylazine (by 19%), whereas more marked reductions of %ID/g were observed with ketamine/xylazine (by 54%) than with isoflurane (by 37%). These reverse differences between isoflurane and ketamine/xylazine may be due to

  11. Novel ZEB2-BCL11B Fusion Gene Identified by RNA-Sequencing in Acute Myeloid Leukemia with t(2;14(q22;q32.

    Directory of Open Access Journals (Sweden)

    Synne Torkildsen

    Full Text Available RNA-sequencing of a case of acute myeloid leukemia with the bone marrow karyotype 46,XY,t(2;14(q22;q32[5]/47,XY,idem,+?4,del(6(q13q21[cp6]/46,XY[4] showed that the t(2;14 generated a ZEB2-BCL11B chimera in which exon 2 of ZEB2 (nucleotide 595 in the sequence with accession number NM_014795.3 was fused to exon 2 of BCL11B (nucleotide 554 in the sequence with accession number NM_022898.2. RT-PCR together with Sanger sequencing verified the presence of the above-mentioned fusion transcript. All functional domains of BCL11B are retained in the chimeric protein. Abnormal expression of BCL11B coding regions subjected to control by the ZEB2 promoter seems to be the leukemogenic mechanism behind the translocation.

  12. Twelve-year experience of radioembolization for colorectal hepatic metastases in 214 patients: survival by era and chemotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Lewandowski, Robert J.; Memon, Khairuddin; Hickey, Ryan; Gates, Vanessa L.; Atassi, Bassel; Vouche, Michael; Atassi, Rohi; Desai, Kush; Hohlastos, Elias; Sato, Kent; Habib, Ali [Robert H. Lurie Comprehensive Cancer Center, Department of Radiology, Section of Interventional Radiology, Northwestern Memorial Hospital, Chicago, IL (United States); Mulcahy, Mary F.; Kircher, Sheetal; Newman, Steven B.; Nimeiri, Halla; Benson, Al B. [Northwestern University, Department of Medicine, Division of Hematology and Oncology, Robert H. Lurie Comprehensive Cancer Center, Chicago, IL (United States); Marshall, Karen; Williams, Melissa; Salzig, Krystina; Salem, Riad [Robert H. Lurie Comprehensive Cancer Center, Department of Radiology, Section of Interventional Radiology, Northwestern Memorial Hospital, Chicago, IL (United States); Northwestern University, Department of Medicine, Division of Hematology and Oncology, Robert H. Lurie Comprehensive Cancer Center, Chicago, IL (United States)

    2014-10-15

    The aim of this study was to analyze the safety, treatment characteristics and survival outcomes of Yttrium-90 (Y90) radioembolization for unresectable colorectal carcinoma (CRC) liver metastases refractory to standard of care therapy. A total of 214 patients with CRC metastases were treated with Y90 radioembolization over 12 years. Toxicity was assessed using National Cancer Institute common terminology criteria. Overall survival was analyzed from date of diagnosis of primary cancer, hepatic metastases and from the first Y90. Uni/multivariate analyses were performed. Substratification by era of chemotherapeutics was performed. Most patients were male (60 %) and <65 years old (61 %). Of them, 98 % had been exposed to chemotherapy. Grade 3 lymphocyte, bilirubin, albumin, ALP and AST toxicities were observed in 39 %, 11 %, 10 %, 8 % and 4 % of patients, respectively. Grade 4 lymphocyte and ALP toxicities were observed in 5 % and 3 % of patients, respectively. Median overall survival was 43.0, 34.6, and 10.6 months from date of diagnosis of primary cancer, hepatic metastases and first Y90, respectively. Survival was significantly longer in patients: (1) who received ≤2 cytotoxic drugs (n = 104) than those who received 3 (n = 110) (15.2 vs. 7.5 months, p = 0.0001); and (2) who received no biologic agents (n = 52) compared with those that did (n = 162) (18.6 vs. 9.4 months, p = 0.0001). Multivariate analyses identified ≤2 cytotoxic agents, no exposure to biologics, ECOG 0, tumor burden <25 %, lack of extrahepatic disease and albumin >3 g/dL as independent predictors of survival. In this largest metastatic CRC series published to date, Y90 radioembolization was found to be safe; survival varied by prior therapy. Further studies are required to further refine the role of Y90 in metastatic CRC. (orig.)

  13. Mechanical properties data of 2-1/4Cr-1Mo steel for the experimental very high temperature gas-cooled reactor

    International Nuclear Information System (INIS)

    Oku, Tatsuo; Kikuyama, Toshihiko; Fukaya, Kiyoshi; Kodaira, Tsuneo

    1978-11-01

    This is a collection of mechanical properties data of 2-1/4Cr-1Mo steel necessary for structural design and safety analysis of the pressure vessel of the Experimental Very High Temperature Gas-Cooled Reactor (VHTR). These include physical properties, mechanical properties, temper embrittlement, creep with fatigue, fracture toughness and irradiation effects. A review of the data shows the research areas to be carried out particularly in the future for more data. (author)

  14. Wear behavior of 2-1/4 Cr-1Mo tubing against alloy 718 tube-support material in sodium-cooled steam generators

    International Nuclear Information System (INIS)

    Wilson, W.L.

    1983-05-01

    A series of prototypic steam generator 2-1/4 Cr-1 Mo tube/alloy 718 tube support plate wear tests were conducted in direct support of the Westinghouse Nuclear Components Division -- Breeder Reactor Components Project Large Scale steam Generator design. The initial objective was to verify the acceptable wear behavior of softer, ''over-aged'' alloy 718 support plate material. For all interfaces under all test conditions, resultant wear damage was adhesive in nature with varying amounts of 2-1/4 Cr-1 Mo tube material being adhesively transferred to the alloy 718 tube supports. Maximum tube wear depths exceeded the initially established design allowable limit of 127 μm (.005 in.) at 17 of the 18 interfaces tested. A decrease in contact stresses produced acceptable tube wear depths below a readjusted maximum design allowable value of 381 μm (.015 in.). Additional conservatisms associated with the simulation of a 40-year lifetime of rubbing in a one-week laboratory test provided further confidence that the 381 μm maximum tube wear allowance would not be exceeded in service. Softer, ''over-aged'' alloy 718 material was found to produce slightly less wear damage on 2-1/4 Cr-1 Mo tubing than fully age hardened material. Also, air formed oxide films on the alloy 718 reduced initial tube wear and delayed the onset of adhesive surface damage. However, at high surface stress levels, these films were not sufficiently stable to provide adequate long term protection from adhesive wear. The results of the present work and those of previous test programs suggest that the successful in-sodium tribological performance of 2-1/4 Cr-1 Mo/alloy 718 rubbing couples is dependent upon the presence of lubricative surface films, such as oxides and/or surface reaction or deposition products. 11 refs., 13 figs., 4 tabs

  15. In vitro activity of solithromycin and its metabolites, CEM-214 and N-acetyl-CEM-101, against 100 clinical Ureaplasma spp. isolates compared with azithromycin.

    Science.gov (United States)

    Furfaro, Lucy L; Spiller, O Brad; Keelan, Jeffrey A; Payne, Matthew S

    2015-09-01

    There is a strong association between vaginal and/or amniotic fluid Ureaplasma spp. colonisation and risk of preterm birth. The novel fluoroketolide antibiotic solithromycin (CEM-101) is active against Ureaplasma spp. in vitro. Evidence from ex vivo and in vivo models suggests that, unlike most macrolide antibiotics, solithromycin readily crosses the placenta. Solithromycin metabolism varies according to species; in pregnant sheep, the bioactive metabolites CEM-214 and N-acetyl-CEM-101 (NAc-CEM-101) have been shown to accumulate in the amniotic cavity following maternal solithromycin administration, potentially contributing to its antimicrobial effects. To determine the antimicrobial activity of these metabolites against Ureaplasma spp., the effects of solithromycin, CEM-214, NAc-CEM-101 and the comparator azithromycin were tested on a collection of 100 clinical Ureaplasma spp. isolates from the UK and Australia using a modified 96-well broth microdilution method. MIC90 values observed for the combined cohort were: solithromycin, 0.125 mg/L; CEM-214, 0.5mg/L; NAc-CEM-101, 0.5mg/L; and azithromycin, 2mg/L. Solithromycin showed 34-fold greater activity against Ureaplasma spp. isolates than azithromycin, whilst CEM-214 and NAc-CEM-101 possessed ca. 22% and 17% of the activity of solithromycin, respectively, significantly greater than that of azithromycin. One bacterial isolate showed resistance to azithromycin (MIC=16 mg/L) but had a much lower MIC for solithromycin (MIC=0.25mg/L). In conclusion, the metabolites of solithromycin had reduced, but still potent, activity against 100 clinical Ureaplasma spp. isolates in vitro. This may be important in some instances such as pregnancy, however studies to determine levels of the metabolites in these settings are required. Copyright © 2015 Elsevier B.V. and the International Society of Chemotherapy. All rights reserved.

  16. A Functional Variant at the miR-214 Binding Site in the Methylenetetrahydrofolatereductase Gene Alters Susceptibility to Gastric Cancer in a Chinese Han Population

    Directory of Open Access Journals (Sweden)

    Qiaoyun Chen

    2015-05-01

    Full Text Available Background and Aims: Single nucleotide polymorphisms in miRNA binding sites, which are located in mRNA 3' untranslated regions (3'-UTRs, were recently found to influence microRNA-target interactions. Specifically, such polymorphisms can modulatebinding affinity or create or destroy miRNA-binding sites; such variants have also been found to be associated with cancer risk. In this study, we explored the effect of a functional variant at the miR-214 binding site in the methylenetetrahydrofolate reductase gene (rs114673809 on gastric cancer (GC risk in a hospital-based case-control study in a Chinese Han population. Methods and Results: We genotyped the rs114673809 polymorphism in 345 gastric cancer patients and 376 cancer-free controls using the polymerase chain reaction restriction fragment length polymorphism (PCR-RFLP technique. The functions of rs114673809 were investigated using a luciferase activity assay and validated by immunoblotting. We found that participants carrying the rs114673809 AA genotype or A allele had a significantly increased risk of gastric cancer (OR = 1.667, 95% CI = 1.044-2.660, P = 0.034; OR = 1.261, 95% CI = 1.017-1.563, P = 0.037, respectively compared to those carrying the GG genotype and G allele. In addition, rs114673809 modified the binding of hsa-miR-214 to MTHFR as well as MTHFR protein levels in gastric cancer patients. Conclusion: Our data suggested that rs114673809, which is located at the miR-214 binding site in the 3'-UTR of MTHFR, may play an important role in the development of gastric cancer in a Chinese Han population.

  17. Structure, magnetic and thermo-mechanic properties of Ni2.14Mn0.81Fe0.05Ga Heusler alloy

    International Nuclear Information System (INIS)

    Borisenko, I.D.; Koledov, V.V.; Khovajlo, V.V.; Khudaverdyan, T.O.; Shavrov, V.G.; Grechishkin, R.M.; Krasnoperov, E.P.; Li, Ya.; Tszyan, Ch.

    2005-01-01

    The influence of a strong magnetic field, single-axis pressure and intensive ultrasound on the process of structural (martensitic) transition on polycrystals of ferromagnetic alloy Ni 2.14 Mn 0.81 Fe 0.05 Ga with shape memory was studied experimentally. It is shown that magnetic field up to 8 T shifts without essential distortions the temperature hysteresis loop of martensitic transition to the range of higher temperatures, single-axis pressure blurs the martensitic transition, expanding the temperature hysteresis loop, while ultrasonic vibration may result in contraction of the hysteresis loop [ru

  18. Inhibition of microRNA-214-5p promotes cell survival and extracellular matrix formation by targeting collagen type IV alpha 1 in osteoblastic MC3T3-E1 cells.

    Science.gov (United States)

    Li, Q S; Meng, F Y; Zhao, Y H; Jin, C L; Tian, J; Yi, X J

    2017-08-01

    This study aimed to investigate the functional effects of microRNA (miR)-214-5p on osteoblastic cells, which might provide a potential role of miR-214-5p in bone fracture healing. Blood samples were obtained from patients with hand fracture or intra-articular calcaneal fracture and from healthy controls (HCs). Expression of miR-214-5p was monitored by qRT-PCR at day 7, 14 and 21 post-surgery. Mouse osteoblastic MC3T3-E1 cells were transfected with antisense oligonucleotides (ASO)-miR-214-5p, collagen type IV alpha 1 (COL4A1) vector or their controls; thereafter, cell viability, apoptotic rate, and the expression of collagen type I alpha 1 (COL1A1), type II collagen (COL-II), and type X collagen (COL-X) were determined. Luciferase reporter assay, qRT-PCR, and Western blot were performed to ascertain whether COL4A1 was a target of miR-214-5p. Plasma miR-214-5p was highly expressed in patients with bone fracture compared with HCs after fracture (p extracellular matrix (ECM) formation of osteoblastic MC3T3-E1 cells by targeting COL4A1. Cite this article: Q. S. Li, F. Y. Meng, Y. H. Zhao, C. L. Jin, J. Tian, X. J. Yi. Inhibition of microRNA-214-5p promotes cell survival and extracellular matrix formation by targeting collagen type IV alpha 1 in osteoblastic MC3T3-E1 cells. Bone Joint Res 2017;6:464-471. DOI: 10.1302/2046-3758.68.BJR-2016-0208.R2. © 2017 Yi et al.

  19. Build up of radon, /sup 218/Po and /sup 214/Po in a Karlsruhe diffusion chamber as a function of time

    International Nuclear Information System (INIS)

    Fazal-ur-Rehman; Jamil, K.; Ali, S.; Khan, H.A.

    1996-01-01

    Passive radon /sup 222/Rn dosimeters employing particle detectors are widely used in concentration (p Ci/l) measurement in houses, mines and other areas of activity. These dosimeters yield track density which is needed to be converted into physically meaningful parameter of radon concentration in either p Ci/l or Bq m/sup -3/. Therefore, it is required to know the separate contributions of /sup 222/Rn and its progeny. In the present study we have measured the concentration of /sup 222/Rn and its daughters (/sup 218/Po and /sup 214/Po) separately in the Karlsruhe diffusion chamber radon dosimeter, with and without a filter, as a function of time by an active method using a surface barrier detector. The build up behavior of radon and its two daughters (/sup 218/Po and /sup 214/Po) as a function of time was studied by plotting the area under each peak versus collection time. The differential curves and the relative concentration of radon daughters as a function of time were also studied. The concentration of radon and its daughters shows a somewhat linear build up as a function of time for the presently studied time periods. The results of this experiment are expected to be useful in converting the integrated alpha track density as measured by a particle track detector, (used in passive radon dosimetry) to radon concentration levels and for determination of equilibrium factor. (author)

  20. Mechanochemical solvent-free in situ synthesis of drug-loaded {Cu2(1,4-bdc)2(dabco)}n MOFs for controlled drug delivery

    Science.gov (United States)

    Nadizadeh, Zahra; Naimi-Jamal, M. Reza; Panahi, Leila

    2018-03-01

    In the present study, ibuprofen-loaded nano metal-organic frameworks (NMOFs) {Cu2(1,4-bdc)2(dabco)}n and {Cu2(1,4-bdc-NH2)2(dabco)}n (bdc=benzenedicarboxylic acid, and dabco=diazabicyclooctane) were synthesized by ball-milling at room temperature in 2 h. The produced drug-loaded Cu-NMOFs were studied as ibuprofen drug delivery system and exhibited well-defined drug release behavior, exceptionally high drug loading capacities and the ability to entrap the model drug. The loading efficiency for ibuprofen was determined about 50.54% and 50.27%, respectively. The drug release of NMOFs was also monitored, and all of the loaded drug was released in 1 day. The NMOFs were characterized by FT-IR spectroscopy, X-ray powder diffraction (XRPD), thermogravimetric analysis (TGA), SEM (scanning electron microscopy), transmission electron microscopy (TEM), energy-dispersive X-ray spectroscopy (EDS), inductively coupled plasma (ICP), UV-vis spectroscopy and N2 adsorption porosimetry (BET&BJH).

  1. The rate commitment to ISO 214 standard among the persian abstracts of approved research projects at school of health management and medical informatics, Isfahan University of Medical Sciences, Isfahan, Iran.

    Science.gov (United States)

    Papi, Ahmad; Khalaji, Davoud; Rizi, Hasan Ashrafi; Shabani, Ahmad; Hassanzadeh, Akbar

    2014-01-01

    Commitment to abstracting standards has a very significant role in information retrieval. The present research aimed to evaluate the rate of Commitment to ISO 214 Standard among the Persian abstracts of approved research projects at School of Health Management and Medical Informatics, Isfahan University of Medical Sciences, Isfahan, Iran. This descriptive study used a researcher-made checklist to collect data, which was then analyzed through content analysis. The studied population consisted of 227 approved research projects in the School of Health Management and Medical Informatics, Isfahan University of Medical Sciences during 2001-2010. The validity of the checklist was measured by face and content validity. Data was collected through direct observations. Statistical analyzes including descriptive (frequency distribution and percent) and inferential statistics (Chi-square test) were performed in SPSS-16. The highest and lowest commitment rates to ISO 214 standard were in using third person pronouns (100%) and using active verbs (34/4%), respectively. In addition, the highest commitment rates to ISO 214 standard (100%) related to mentioning third person pronouns, starting the abstract with a sentence to explain the subject of the research, abstract placement, and including keyword in 2009. On the other hand, during 2001-2003, the lowest commitment rate was observed in reporting research findings (16/7%). Moreover, various educational groups differed significantly only in commitment to study goals, providing research findings, and abstaining from using abbreviations, signs, and acronyms. Furthermore, educational level of the corresponding author was significantly related with extracting the keywords from the text. Other factors of ISO 214 standard did not have significant relations with the educational level of the corresponding author. In general, a desirable rate of commitment to ISO 214 standard was observed among the Persian abstracts of approved research

  2. Electrocatalytic determination of L-ascorbic acid by modified glassy carbon with Ni(Me2(CH3CO)2[14]tetraenoN4) complex.

    Science.gov (United States)

    Khorasani-Motlagh, Mozhgan; Noroozifar, Meissam

    2003-12-01

    A novel modified glassy carbon electrode containing Ni(Me2(CH3CO)2[14]tetraenoN4) complex was used as an electrocatalytic sensor for the determination of L-ascorbic acid in pH = 6.6. The peak potential shifted to negative by 205 mV compared with that for a bare electrode in cyclic voltammograms. The calibration curve was linear up to 6.2 x 10(-3) M with a detection limit 3.1 x 10(-7) M and an RSD% better than 2.47%. This newly modified electrode was applied to commercial pharmaceutical tablets, injections and foods. The obtained results were identical to those obtained by the classical 2,6-dichlorophenolindophenol method.

  3. Fatigue-creep life prediction for a notched specimen of 2[1]/[4]Cr-1Mo steel at 600 C

    International Nuclear Information System (INIS)

    Inoue, Tatsuo; Sakane, Masao; Fukuda, Yoshio; Igari, Toshihide; Miyahara, Mitsuo; Okazaki, Masakazu

    1994-01-01

    This paper presents the life prediction of 2[1]/[4]Cr-1Mo notched specimens subjected to fast-fast, slow-slow and hold-time loadings at 600 C. The crack initiation lives of notched specimens were estimated based on the local stress-strain calculated by inelastic finite element analyses. For the life prediction, combinations of seven different constitutive models and five fatigue-creep damage laws were used. The applicability of the constitutive model and damage law is discussed. The constitutive models predict similar stress-strain relations at the notch root, leading to similar predicted lives. The damage model, however, has a much larger influence on the life prediction. ((orig.))

  4. Prediction of Molar Extinction Coefficients of Proteins and Peptides Using UV Absorption of the Constituent Amino Acids at 214 nm To Enable Quantitative Reverse Phase High-Performance Liquid Chromatography-Mass Spectrometry Analysis

    NARCIS (Netherlands)

    Kuipers, B.J.H.; Gruppen, H.

    2007-01-01

    The molar extinction coefficients of 20 amino acids and the peptide bond were measured at 214 nm in the presence of acetonitrile and formic acid to enable quantitative comparison of peptides eluting from reversed-phase high-performance liquid chromatography, once identified with mass spectrometry

  5. Study of the background of the neutrinoless double {beta} decay with the detector NEMO 2: contribution arising from the radon diffusion and internal pollution of the source {sup 214}Bi have been estimated; Etude du bruit de fond de la double-desintegration {beta} sans emission de neutrino dans le detecteur NEMO 2: contribution du radon ambiant et mesure de la pollution interne de la source en {sup 214}Bi

    Energy Technology Data Exchange (ETDEWEB)

    Mauger, F.

    1995-02-01

    The NEMO experiment is designed to understand the nature of the neutrino by studying the double beta decay of Mo-100 which is related to the Majorana neutrino effective mass. In this kind of experiment a good understanding of the different sources of background is crucial as only few events are expected per year at the required level of sensitivity. In this thesis we present the main theoretical and experimental aspects of the measurement of the neutrinoless double beta decay of Mo-100 with the prototype detector NEMO2. The goal of this study is to obtain a realistic interpretation of the few events detected at high energy in the two-electron channel as a background to neutrinoless double beta decay. In particular, the contribution arising from Bi-214 has been investigated. These events have been selected and analysed by means of the beta-alpha decays of Bi-214 into Pb-210. The events are characterized by a delayed track in the wire chamber and the corresponding signal is rather clean. The study has demonstrated the diffusion of Rn-222 into the detector and its contribution to Bi-214 pollution has been estimated. A measurement of the Bi-214 internal contamination of the source has been made as well as an estimation of the Bi-214 deposit due to Rn-222. As a result of this study it appears that, under the conditions of the NEMO2 experiment, the Bi and Rn contributions are of the same order of magnitude as the background induced at high energy by two-neutrino double beta decay. In conclusion, the backgrounds of the neutrinoless double beta decay of Mo-100 are well understood in the NEMO2 experiment leading to an extrapolation for the NEMO3 experiment. (authors).

  6. Molecular characterization of a 21.4 kilobase antibiotic resistance plasmid from an α-hemolytic Escherichia coli O108:H- human clinical isolate.

    Directory of Open Access Journals (Sweden)

    Fay E Dawes

    Full Text Available This study characterizes the 21.4 kilobase plasmid pECTm80 isolated from Escherichia coli strain 80, an α hemolytic human clinical diarrhoeal isolate (serotype O108:H-. DNA sequence analysis of pECTm80 revealed it belonged to incompatibility group X1, and contained plasmid partition and toxin-antitoxin systems, an R6K-like triple origin (ori replication system, genes required for replication regulation, insertion sequences IS1R, ISEc37 and a truncated transposase gene (Tn3-like ΔtnpA of the Tn3 family, and carried a class 2 integron. The class 2 integron of pECTm80 contains an intact cassette array dfrA1-sat2, encoding resistance to trimethoprim and streptothricin, and an aadA1 gene cassette truncated by the insertion of IS1R. The complex plasmid replication system includes α, β and γ origins of replication. Pairwise BLASTn comparison of pECTm80 with plasmid pE001 reveals a conserved plasmid backbone suggestive of a common ancestral lineage. Plasmid pECTm80 is of potential clinical importance, as it carries multiple genes to ensure its stable maintenance through successive bacterial cell divisions and multiple antibiotic resistance genes.

  7. Familial transmission of venous thromboembolism: a cohort study of 80 214 Swedish adoptees linked to their biological and adoptive parents.

    Science.gov (United States)

    Zöller, Bengt; Li, Xinjun; Sundquist, Jan; Sundquist, Kristina

    2014-06-01

    Venous thromboembolism (VTE) clusters in families, but the familial risk of VTE has not been determined among adoptees. The aim was to disentangle the contributions of genetic and environmental factors to the familial transmission of VTE. The Swedish Multi-Generation Register was used to follow all Swedish-born adoptees born from 1932 to 2004 (n=80,214) between January 1, 1964, and December 31, 2010, for VTE. The risk of VTE was estimated in adoptees with ≥1 biological parent with VTE compared with adoptees without a biological parent with VTE. The risk of VTE was also estimated in adoptees with ≥1 adoptive parent with VTE compared with adoptees without an adoptive parent with VTE. Adoptees with ≥1 biological parent with VTE (n=137) were more likely to have VTE than adoptees without a biological parent with VTE (standardized incidence ratio) 1.51 (95% confidence interval, 1.27-1.79). The standardized incidence ratio for VTE was highest for adoptees with a biological parent diagnosed with VTE before the age of 50 years (standardized incidence ratio=2.03, 1.24-3.14). In contrast, adoptees with ≥1 adoptive parent with VTE (n=156) were not at increased risk of VTE (standardized incidence ratio=1.07, 0.91-1.25). These novel findings suggest that genetic factors make a stronger contribution to the familial transmission of VTE from parents to offspring than family environmental factors. © 2014 American Heart Association, Inc.

  8. Middle Pleistocene Transition (MPT) in the Eastern Indian Ocean: a 2000 kyr planktic faunal and isotope record from DSDP site 214

    International Nuclear Information System (INIS)

    Gupta, Anil K.; Dhingra, Hitesh

    2004-01-01

    Planktic foraminiferal faunal and isotope data from Deep Sea Drilling Project (DSDP) Site 214 reveal a major change in surface water properties in the eastern Indian Ocean, coinciding with the mid-Pleistocene climate transition (MPT). A comparative study of Globigerinoides sacculifer (a surface dwelling, warm water, mixed layer tropical planktic foraminifera), Globorotalia menardii Complex (a deep dwelling, tropical species group), and Orbulina universa (an intermediate depth warm-water subtropical foraminifera) with the stable isotope record of Globigerinoides ruber suggests a warm, thick mixed layer in the eastern Indian Ocean during,∼ 2000 Kyr to ∼ 900 Kyr. Since,∼ 900 Kyr the surface water mass stratification weakened, and the mixed layer as well as thermocline were shallow. A decrease in the population abundance of Gs. sacculifer, together with a decrease in δ 13 C and increase in δ 18 O values suggest a continuous cool climate and increased surface productivity over the last ∼ 900 Kyr. This coincides with an increased variance in the 400 ∼Kyr component of Earth's eccentricity cycle. (author)

  9. Data of expression status of miR- 29a and its putative target mitochondrial apoptosis regulatory gene DRP1 upon miR-15a and miR-214 inhibition

    Directory of Open Access Journals (Sweden)

    Muhammad Ishtiaq Jan

    2018-02-01

    Full Text Available Data is about the mitochondrial apoptosis regulatory framework genes PUMA, DRP1 (apoptotic, and ARC (anti-apoptotic analysis after the employment of their controlling miRNAs inhibitors. The data represents putative conserved targeting of seed regions of miR-15a, miR-29a, and miR-214 with respective target genes PUMA, DRP1, and ARC. Data is of cross interference in expression levels of one miRNA family, miR-29a and its putative target DRP1 upon the inhibitory treatment of other miRNAs 15a and 214. Keywords: DRP1, miR-15a, Apoptosis, miRNAs inhibition

  10. Sõpruse pst. 214 / Ilme Trepp

    Index Scriptorium Estoniae

    Trepp, Ilme

    2002-01-01

    Rööptekst vene k. lk. 33-34. Ühistute huvide eest seismiseks loodi Mustamäe Korteriühistute Nõukoda, mis seab eesmärgiks esindada Mustamäe korteriühistuid, teha koostööd linnavalitsusega, vahetada infot ja kasulikke kogemusi

  11. Familial [corrected] transmission of coronary heart disease: a cohort study of 80,214 Swedish adoptees linked to their biological and adoptive parents.

    Science.gov (United States)

    Sundquist, Kristina; Winkleby, Marilyn; Li, Xinjun; Ji, Jianguang; Hemminki, Kari; Sundquist, Jan

    2011-08-01

    Studies of adoptees have the potential to disentangle the contributions of genetic versus family environmental factors in the familial [corrected] transmission of coronary heart disease (CHD) because adoptees do not share the same family environment as their biological parents. The aims of this study were as follows: (1) to examine the risk of CHD in adopted men and women with at least one biological parent with CHD and (2) to examine the risk of CHD in adopted men and women with at least one adoptive parent with CHD. The Swedish Multigenerational register was used to follow all Swedish-born adoptees (born in or after 1932, n = 80,214) between January 1, 1973, and December 31, 2008, for CHD. The risk of CHD was estimated in adopted men and women with at least one biological parent with CHD and adopted men and women with at least one adoptive parent with CHD. The control groups consisted of adopted men or women without a biological parent with CHD or adopted men or women without an adoptive parent with CHD. Adopted men and women with at least one biological parent with CHD (n = 749) were 1.4 to 1.6 times (statistically significant, 95% CI) more likely to have CHD than adoptees without a biological parent with CHD. In contrast, men and women with at least one adoptive parent with CHD (n = 1,009) were not at increased risk of the disease. These findings (based on validated hospital diagnoses unbiased by recall) suggest that the familial [corrected] transmission of CHD from parents to offspring is more related to genetic factors than to family environmental factors. Copyright © 2011 Mosby, Inc. All rights reserved.

  12. Regional changes in brain 2-14C-deoxyglucose uptake induced by convulsant and non-convulsant doses of lindane

    International Nuclear Information System (INIS)

    Sanfeliu, C.; Sola, C.; Camon, L.; Martinez, E.; Rodriguez-Farre, E.

    1990-01-01

    Lindane-induced dose- and time-related changes in regional 2-14C-deoxyglucose (2-DG) uptake were examined in 59 discrete rat brain structures using the 2-DG autoradiographic technique. At different times (0.5-144 hr) after administration of a seizure-inducing single dose of lindane (60 mg/kg), 2-DG uptake was significantly increased in 18 cortical and subcortical regions mainly related to the limbic system (e.g., Ammon's horn, dentate gyrus, septal nuclei, nucleus accumbens, olfactory cortex) and extrapyramidal and sensory-motor areas (e.g., cerebellar cortex, red nucleus, medial vestibular nucleus). There was also a significant increase in superior colliculus layer II. In addition, significant decreases occurred in a group of 6 regions (e.g., auditory and motor cortices). Non-convulsing animals treated with the same dose of lindane showed a regional pattern of 2-DG uptake less modified than the convulsant group. A non-convulsant single dose of lindane (30 mg/kg) also modified significantly the 2-DG uptake (0.5-24 hr) in some brain areas. Although the various single doses of lindane tested produced different altered patterns of brain 2-DG uptake, some structures showed a similar trend in their modification (e.g., superior colliculi and accumbens, raphe and red nuclei). Repeated non-convulsant doses of lindane produced defined and long-lasting significant elevations of 2-DG uptake in some subcortical structures. Considering the treated groups all together, 2-DG uptake increased significantly in 26 of the 59 regions examined but only decreased significantly in 9 of them during the course of lindane effects. This fact can be related to the stimulant action described for this neurotoxic agent. The observed pattern provides a descriptive approach to the functional alterations occurring in vivo during the course of lindane intoxication

  13. Corrective Action Investigation Plan for Corrective Action Unit 214: Bunkers and Storage Areas Nevada Test Site, Nevada: Revision 0, Including Record of Technical Change No. 1 and No. 2

    Energy Technology Data Exchange (ETDEWEB)

    U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office

    2003-05-16

    This Corrective Action Investigation Plan contains the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office's approach to collect the data necessary to evaluate corrective action alternatives appropriate for the closure of Corrective Action Unit (CAU) 214 under the Federal Facility Agreement and Consent Order. Located in Areas 5, 11, and 25 of the Nevada Test Site, CAU 214 consists of nine Corrective Action Sites (CASs): 05-99-01, Fallout Shelters; 11-22-03, Drum; 25-99-12, Fly Ash Storage; 25-23-01, Contaminated Materials; 25-23-19, Radioactive Material Storage; 25-99-18, Storage Area; 25-34-03, Motor Dr/Gr Assembly (Bunker); 25-34-04, Motor Dr/Gr Assembly (Bunker); and 25-34-05, Motor Dr/Gr Assembly (Bunker). These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives (CAAs). The suspected contaminants and critical analyte s for CAU 214 include oil (total petroleum hydrocarbons-diesel-range organics [TPH-DRO], polychlorinated biphenyls [PCBs]), pesticides (chlordane, heptachlor, 4,4-DDT), barium, cadmium, chronium, lubricants (TPH-DRO, TPH-gasoline-range organics [GRO]), and fly ash (arsenic). The land-use zones where CAU 214 CASs are located dictate that future land uses will be limited to nonresidential (i.e., industrial) activities. The results of this field investigation will support a defensible evaluation of viable corrective action alternatives that will be presented in the corrective action decision document.

  14. Targeted Inhibition of the miR-199a/214 Cluster by CRISPR Interference Augments the Tumor Tropism of Human Induced Pluripotent Stem Cell-Derived Neural Stem Cells under Hypoxic Condition

    Directory of Open Access Journals (Sweden)

    Yumei Luo

    2016-01-01

    Full Text Available The human induced pluripotent stem cell (hiPSC provides a breakthrough approach that helps overcoming ethical and allergenic challenges posed in application of neural stem cells (NSCs in targeted cancer gene therapy. However, the tumor-tropic capacity of hiPSC-derived NSCs (hiPS-NSCs still has much room to improve. Here we attempted to promote the tumor tropism of hiPS-NSCs by manipulating the activity of endogenous miR-199a/214 cluster that is involved in regulation of hypoxia-stimulated cell migration. We first developed a baculovirus-delivered CRISPR interference (CRISPRi system that sterically blocked the E-box element in the promoter of the miR-199a/214 cluster with an RNA-guided catalytically dead Cas9 (dCas9. We then applied this CRISPRi system to hiPS-NSCs and successfully suppressed the expression of miR-199a-5p, miR-199a-3p, and miR-214 in the microRNA gene cluster. Meanwhile, the expression levels of their targets related to regulation of hypoxia-stimulated cell migration, such as HIF1A, MET, and MAPK1, were upregulated. Further migration assays demonstrated that the targeted inhibition of the miR-199a/214 cluster significantly enhanced the tumor tropism of hiPS-NSCs both in vitro and in vivo. These findings suggest a novel application of CRISPRi in NSC-based tumor-targeted gene therapy.

  15. Developmental Decline in the MicroRNA 199a (miR-199a)/miR-214 Cluster in Human Fetal Lung Promotes Type II Cell Differentiation by Upregulating Key Transcription Factors.

    Science.gov (United States)

    Mishra, Ritu; Benlhabib, Houda; Guo, Wei; Lerma Cervantes, Connie B; Mendelson, Carole R

    2018-06-01

    The major surfactant protein, SP-A (a product of the SFTPA gene), serves as a marker of type II pneumocyte differentiation and surfactant synthesis. SFTPA expression in cultured human fetal lung (HFL) epithelial cells is upregulated by hormones that increase cyclic AMP (cAMP) and activate TTF-1/NKX2.1 and NF-κB. To further define mechanisms for type II cell differentiation and induction of SP-A, we investigated roles of microRNAs (miRNAs). Using microarray to identify differentially expressed miRNAs in HFL epithelial cells during type II cell differentiation in culture, we observed that members of the miRNA 199a (miR-199a)/miR-214 cluster were significantly downregulated during differentiation. Validated and predicted targets of miR-199a-3p/miR-199a-5p and miR-214, which serve roles in type II cell differentiation (COX-2, NF-κB p50/p65, and CREB1), and the CREB1 target, C/EBPβ, were coordinately upregulated. Accordingly, overexpression of miR-199a-5p, miR-199a-3p, or miR-214 mimics in cultured HFL epithelial cells decreased COX-2, NF-κB p50/p65, CREB1, and C/EBPβ proteins, with an associated inhibition of SP-A expression. Interestingly, overexpression of the EMT factor, ZEB1, which declines during cAMP-induced type II cell differentiation, increased pri-miR-199a and reduced the expression of the targets NF-κB/p50 and COX-2. Collectively, these findings suggest that the developmental decline in miR-199a/miR-214 in HFL causes increased expression of critical targets that enhance type II cell differentiation and SP-A expression. Copyright © 2018 American Society for Microbiology.

  16. Measuring naturally occurring uranium in soil and minerals by analysing the 352 keV gamma-ray peak of 214Pb using a NaI(Tl)-detector

    International Nuclear Information System (INIS)

    Bezuidenhout, J.

    2013-01-01

    This article investigates the prospect of utilising the 351.9 keV gamma-ray of 214 Pb when determining the concentration of uranium. Soil samples were collected from various locations around South Africa and laboratory gamma ray spectra for each were obtained by means of a NaI(Tl)-detector (7.62×7.62 cm 2 ). The potassium, uranium and thorium concentrations where extracted by analysing gamma ray peaks that are associated with these radionuclides. Two separate uranium concentrations were extracted; one by means of the 214 Pb decay and the other one by means of the 214 Bi decay. These uranium concentrations were compared in terms of accuracies and detection limits. - Highlights: • Investigated a method to improve uranium concentrations measurements. • Expansion on an existing method that analyses naturally occurring radionuclides. • Utilise pill containers opposed to Marrinelli beakers. • Possible application to in situ measurements. • The method utilise NaI(Tl)-detectors with relative high efficiency

  17. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  18. Reaction of aromatic diazonium salts with carrier-free radioiodine and astatine, evidence for complex formation

    International Nuclear Information System (INIS)

    Meyer, G.J.; Roessler, K.; Stoecklin, G.

    1979-01-01

    Systematic studies of the astatodiazoniation reaction and a comparison with iododediazoniation under comparable conditions are reported. The yields for all astatohalobenzenes and -toluenes were nearly constant and unaffected by the nature of the diazonium compound, its isomeric form, and the number of isomers used at the same time. Only astatofluorobenzenes were obtained at higher yields. An electron-transfer mechanism is proposed for dediazoniation at these low halide concentration levels. At sufficient thermal excitation levels the electron transfer leads to the dissociation of nitrogen, while the phenyl and halogen radicals recombine. The isomer distribution found for some of the derivatives from dediazoniation may also be due to steric effects

  19. Astatine-211-labeled biotin conjugates resistant to biotinidase for use in pretargeted radioimmunotherapy

    International Nuclear Information System (INIS)

    Foulon, Catherine F.; Alston, Kevin L.; Zalutsky, Michael R.

    1998-01-01

    We report herein the preparation and biological evaluation of two radioastatinated biotin conjugates, (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide. Both conjugates were stable in the presence of human serum and cerebrospinal fluid as well as murine serum, indicating a resistance to degradation to biotinidase. The normal tissue clearance of (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide was rapid, as observed previously with their iodo analogues. Also reported are the first syntheses of N-succinimidyl 5-[ 211 At]astato-3-pyridinecarboxylate and 3-[ 211 At]astatoaniline, two reagents of potential utility for labeling proteins and peptides with 211 At

  20. Microdosimetry of astatine-211 and comparison with that of iodine-125

    International Nuclear Information System (INIS)

    Unak, T.

    2001-01-01

    211 At is an alpha and Auger emitter radionuclide and has been frequently used for labeling of different kind of chemical agents. 125 I is also known as an effective Auger emitter. The radionuclides which emit short range and high LET radiations such as alpha particles and Auger electrons have high radiotoxic effectiveness on the living systems. The microdosimetric data are suitable to clarify the real radiotoxic effectiveness and to get the detail of diagnostic and therapeutic application principles of these radionuclides. In this study, the energy and dose absorptions by cell nucleus from alpha particles and Auger electrons emitted by 211 At have been calculated using a Monte Carlo calculation program (code: UNMOC). For these calculations two different model corresponding to the cell nucleus have been used and the data obtained were compared with the data earlier obtained for 125 I. As a result, the radiotoxicity of 211 At is in the competition with 125 I. In the case of a specific agent labelled with 211 At or 125 I is incorporated into the cell or cell nucleus, but non-bound to DNA or not found very close to it, 211 At should considerably be much more radiotoxic than 125 I, but in the case of the labelled agent is bound to DNA or take a place very close to it, the radiotoxicity of 125 I should considerably be higher than 211 At. (author)

  1. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-211 Isolation

    International Nuclear Information System (INIS)

    Wilbur, Daniel Scott

    2016-01-01

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O'Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-year project with 1 year no-cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211 At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211 At capture (>95%) from 8M HCl solutions and release with conc. NH 4 OH (~50-80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211 At when loading [ 211 At]astatate appeared to be similar to that of [ 211 At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211 At on PEG columns was lower (e.g. 80-90%) from solutions of 8M HNO 3 , but higher capture rates (e.g. 99%) can be obtained when 10M HNO 3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211 At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-automated 211 At isolation studies have been conducted with full-scale target dissolution and 211 At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO 3 was used (rather than HCl) for loading the 211 At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211 At separation from bismuth, which allow use of HNO 3 /HCl mixtures for loading and NaOH for eluting 211 At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  2. The potential of 211Astatine for NIS-mediated radionuclide therapy in prostate cancer

    International Nuclear Information System (INIS)

    Willhauck, Michael J.; Sharif Samani, Bibi-Rana; Goeke, Burkhard; Wolf, Ingo; Senekowitsch-Schmidtke, Reingard; Stark, Hans-Juergen; Meyer, Geerd J.; Knapp, Wolfram H.; Morris, John C.; Spitzweg, Christine

    2008-01-01

    We reported recently the induction of selective iodide uptake in prostate cancer cells (LNCaP) by prostate-specific antigen (PSA) promoter-directed sodium iodide symporter (NIS) expression that allowed a significant therapeutic effect of 131 I. In the current study, we studied the potential of the high-energy alpha-emitter 211 At, also transported by NIS, as an alternative radionuclide after NIS gene transfer in tumors with limited therapeutic efficacy of 131 I due to rapid iodide efflux. We investigated uptake and therapeutic efficacy of 211 At in LNCaP cells stably expressing NIS under the control of the PSA promoter (NP-1) in vitro and in vivo. NP-1 cells concentrated 211 At in a perchlorate-sensitive manner, which allowed a dramatic therapeutic effect in vitro. After intrapertoneal injection of 211 At (1 MBq), NP-1 tumors accumulated approximately 16% ID/g 211 At (effective half-life 4.6 h), which resulted in a tumor-absorbed dose of 1,580 ± 345 mGy/MBq and a significant tumor volume reduction of up to 82 ± 19%, while control tumors continued their growth exponentially. A significant therapeutic effect of 211 At has been demonstrated in prostate cancer after PSA promoter-directed NIS gene transfer in vitro and in vivo suggesting a potential role for 211 At as an attractive alternative radioisotope for NIS-targeted radionuclide therapy, in particular in smaller tumors with limited radionuclide retention time. (orig.)

  3. Sci-Thur AM: YIS – 01: New technologies for astatine-211 targeted alpha therapy research

    Energy Technology Data Exchange (ETDEWEB)

    Crawford, Jason; Yang, Hua; Schaffer, Paul; Ruth, Thomas [University of Victoria, Victoria, BC (Canada); TRIUMF, Vancouver, BC (Canada)

    2016-08-15

    Purpose: The short-range, densely ionizing α-particles emitted by {sup 211}At (t{sub 1/2}=7.2h) are well suited for the treatment of diffuse microscopic disease, using cancer targeting biomolecules. {sup 211}At availability is limited by the rarity of α-cyclotrons required for standard production. Image-based dosimetry is also limited for {sup 211}At, which emits low intensity X-rays. Our goal was to leverage state-of-the-art infrastructure at TRIUMF to produce and evaluate two related isotopes, {sup 211}Rn (t{sub 1/2}=14.6h, 73% decay to {sup 211}At) as a generator for {sup 211}At, and {sup 209}At (t{sub 1/2}=5.4h, X-ray/gamma-ray emitter) as a novel 211At surrogate for preclinical imaging studies. Methods: Produced by spallation of uranium with 480 MeV protons, mass separated ion beams of short-lived francium isotopes were implanted into NaCl targets where {sup 211}Rn or {sup 209}At were produced by radioactive decay, in situ. {sup 211}Rn was transferred to dodecane from which {sup 211}At was efficiently extracted and evaluated for clinical applicability. High energy SPECT/CT was evaluated for measuring {sup 209}At activity distributions in mice and phantoms. Results: Our small scale {sup 211}Rn/{sup 211}At generator system provided high purity {sup 211}At samples. The methods are immediately scalable to the level of radioactivity required for in vivo experiments with {sup 211}At. {sup 209}At-based high energy SPECT imaging was determined suitable for pursuing image-based dosimetry in mouse tumour models. In the future, we will utilize quantitative {sup 209}At-SPECT for image-based dose calculations. Conclusion: These early studies provided a foundation for future endeavours with {sup 211}At-based α-therapy. Canada is now significantly closer to clinical targeted α-therapy of cancer.

  4. Targeted radionuclide therapy with astatine-211: Oxidative dehalogenation of astatobenzoate conjugates.

    Science.gov (United States)

    Teze, David; Sergentu, Dumitru-Claudiu; Kalichuk, Valentina; Barbet, Jacques; Deniaud, David; Galland, Nicolas; Maurice, Rémi; Montavon, Gilles

    2017-05-31

    211 At is a most promising radionuclide for targeted alpha therapy. However, its limited availability and poorly known basic chemistry hamper its use. Based on the analogy with iodine, labelling is performed via astatobenzoate conjugates, but in vivo deastatination occurs, particularly when the conjugates are internalized in cells. Actually, the chemical or biological mechanism responsible for deastatination is unknown. In this work, we show that the C-At "organometalloid" bond can be cleaved by oxidative dehalogenation induced by oxidants such as permanganates, peroxides or hydroxyl radicals. Quantum mechanical calculations demonstrate that astatobenzoates are more sensitive to oxidation than iodobenzoates, and the oxidative deastatination rate is estimated to be about 6 × 10 6 faster at 37 °C than the oxidative deiodination one. Therefore, we attribute the "internal" deastatination mechanism to oxidative dehalogenation in biological compartments, in particular lysosomes.

  5. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  6. Use of interhalogen exchange for preparation of astatine-benzene and iodo-benzene

    International Nuclear Information System (INIS)

    Kolachkovski, A.; Khalkin, V.A.

    1976-01-01

    Experimental testing of interhalogen exchange between the solid and liquid phases has been carried out at 155 deg C with particular reference to a NaOH-Na 131 I-BrPh system. Iodine transition rate is dependent on the process duration and alkali amount. The relative amounts of 131 IPh resultant from the reaction of interhalogen exchange is evaluated by paper chromatography. The results obtained may be considered as those which provide experimental support for the assumed efficiency of the production of 131 IPh based on the reaction of interhalogen exchange to yield 70-80% 131 IPh

  7. Preparation and evaluation of an astatine-211-labeled sigma receptor ligand for alpha radionuclide therapy

    International Nuclear Information System (INIS)

    Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira

    2015-01-01

    Introduction: Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated 131 I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[ 131 I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[ 131 I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[ 211 At]pAtV, an 211 At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. Methods: The radiolabeled sigma receptor ligand (+)-[ 211 At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[ 211 At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. Results: The lipophilicity of (+)-[ 211 At]pAtV was similar to that of (+)-[ 125 I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1 h post-injection were also similar between (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV. Namely, (+)-[ 211 At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. Conclusion: These results indicate that (+)-[ 211 At]pAtV could function as an new agent for alpha-radionuclide receptor therapy.

  8. Preparation and evaluation of an astatine-211-labeled sigma receptor ligand for alpha radionuclide therapy.

    Science.gov (United States)

    Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira

    2015-11-01

    Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated (131)I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[(131)I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[(131)I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[(211)At]pAtV, an (211)At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. The radiolabeled sigma receptor ligand (+)-[(211)At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[(211)At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[(211)At]pAtV and (+)-[(125)I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. The lipophilicity of (+)-[(211)At]pAtV was similar to that of (+)-[(125)I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1h post-injection were also similar between (+)-[(211)At]pAtV and (+)-[(125)I]pIV. Namely, (+)-[(211)At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. These results indicate that (+)-[(211)At]pAtV could function as an new agent for alpha-radionuclide receptor therapy. Copyright © 2015 Elsevier Inc. All rights reserved.

  9. Multiaxial fatigue criteria for AISI 304 and 2-1/4 Cr-1 Mo steel at 5380C with applications to strain-range partitioning and linear summation of creep and fatigue damage

    International Nuclear Information System (INIS)

    Blass, J.J.

    1982-01-01

    An improved multiaxial fatigue failure criterion was developed based on the results of combined axial-torsional strain cycling tests of AISI 304 and 2-1/4 Cr-1 Mo steel conducted at 538 0 C (1000 0 F). The formulation of this criterion involves the shear and normal components of inelastic strain range on the planes of maximum inelastic shear strain range. Optimum values of certain parameters contained in the formulation were obtained for each material by the method of least squares. The ability of this criterion to correlate the test results was compared with that of the usual (Mises) equivalent inelastic strain range criterion. An improved definition of equivalent inelastic strain range resulting from these considerations was used to generalize the theory of Strain Range Partitioning to multiaxial stress-strain conditions and was also applied to the linear summation of creep and fatigue damage

  10. miR-371, miR-138, miR-544, miR-145, and miR-214 could modulate Th1/Th2 balance in asthma through the combinatorial regulation of Runx3.

    Science.gov (United States)

    Qiu, Yu-Ying; Zhang, Ying-Wei; Qian, Xiu-Fen; Bian, Tao

    2017-01-01

    Asthma is tightly related to the imbalance of Th1/Th2 cells, and Runx3 plays a pivotal role in the differentiation of T helper cells. The present study aimed to investigate dysregulated microRNAs that may target Runx3 in CD4 + T cells from asthmatic patients and reveal Runx3 function in Th1/Th2 balance regulation. We detected the levels of Th1- and Th2-related cytokines by ELISA and analyzed the differentiation marker gene of T helper cells by qRT-PCR. Results indicated that an imbalance of Th1/Th2 cells was present in our asthmatic subject. Runx3 expression was reduced in the CD4 + T cells from asthmatic patients. Overexpression of Runx3 could restore the Th1/Th2 balance. After performing microRNA microarray assay, we found a series of microRNAs that were considerably altered in the CD4 + T cells from asthmatic patients. Among these upregulated microRNAs, eight microRNAs that may target Runx3 were selected by bioinformatics prediction. Five microRNAs, namely miR-371, miR-138, miR-544, miR-145, and miR-214, were confirmed by qRT-PCR and selected as candidate microRNAs. Luciferase reporter assay showed that these five microRNAs could directly target the 3'-UTR of Runx3. However, only simultaneous inhibition of these five microRNAs could alter the expression of Runx3. Most importantly, only simultaneous inhibition could improve the Th1/Th2 balance. Thus, we suggest that miR-371, miR-138, miR-544, miR-145, and miR-214 can modulate the Th1/Th2 balance in asthma by regulating Runx3 in a combinatorial manner.

  11. Acute effects of sodium valproate and gamma-vinyl GABA on regional amino acid metabolism in the rat brain: incorporation of 2-[14C]glucose into amino acids.

    Science.gov (United States)

    Chapman, A G; Riley, K; Evans, M C; Meldrum, B S

    1982-09-01

    Amino acid concentrations have been determined in rat brain regions (cortex, striatum, cerebellum, and hippocampus) by HPLC after administration of acute anticonvulsant doses of sodium valproate (400 mg/kg, i.p.) and gamma-vinyl-GABA (1 g/kg, i.p.). After valproate administration the GABA level increases only in the cortex; aspartic acid concentration decreases in the cortex and hippocampus, and glutamic acid decreases in the hippocampus and striatum and increases in the cortex and cerebellum. There are no changes in the concentrations of glutamine, taurine, glycine, serine, and alanine following valproate administration. Only the GABA level increases in all the regions after gamma-vinyl-GABA administration. Cortical analyses 2, 4 and 10 minutes after pulse labeling with 2-[14C]glucose, i.v., show no change in the rate of cortical glucose utilization in the valproate treated group. The rate of labeling of glutamic acid is also unchanged, but the rate of labeling of GABA is reduced following valproate administration. After gamma-vinyl-GABA administration there is no change in the rate of labeling of GABA. These biochemical findings can be interpreted in terms of a primary anticonvulsant action of valproate on membrane receptors with secondary effects on the metabolism of amino acid neurotransmitters. This contrasts with the primary action of gamma-vinyl-GABA on GABA-transaminase activity.

  12. The synthesis and the spectroscopic, thermal, and structural properties of the M2[(fumarate)Ni(CN)4]·2(1,4-Dioxane) clathrate (M = Co, Ni, Cd and Hg)

    Science.gov (United States)

    Kartal, Zeki; Yavuz, Abdülkerim

    2018-03-01

    In this study, the clathrates of fumarate-tetracyanonickel-dioxane, given by the formula M2[(fumarate)Ni(CN)4]·2(1,4-Dioxane) (M = Co, Ni, Cd and Hg), have been obtained for the first time through chemical methods. These clathrates have been characterized by elemental, thermal, FT-IR, and FT-Raman spectroscopies. The parameters of structures of clathrates have been determined by X-ray powder diffraction. The thermal behaviors of these clathrates have been also investigated by thermo-gravimetric analysis (TGA), differential thermal analysis (DTA), and derivative thermal gravimetric analysis (DTG) in the range of 20-900 °C. X-ray powder diffraction data have been recorded at ambient temperature in the 2θ range 5-50°. The FT-IR and FT-Raman spectra of clathrates have been recorded in the region of 4000-400 cm-1 and 4000-100 cm-1, respectively. The results of the spectral and thermal analyses of the newly synthesized clathrates of fumarate-tetracyanonickel-dioxane suggest that these clathrates are new examples of the Hofmann-type dioxane clathrates. In our study, the Hofmann-type dioxane clathrates, which are formed by bounding electrons of oxygen-donor atoms of fumarate ion ligand molecule to transition metal atoms, consist of the corrugated |M-Ni(CN)4|∞ polymeric layers, which are held in parallel through the chain of (-M-fumarate-M-).

  13. 47 CFR 214.2 - Scope.

    Science.gov (United States)

    2010-10-01

    ... OFFICE OF SCIENCE AND TECHNOLOGY POLICY AND NATIONAL SECURITY COUNCIL PROCEDURES FOR THE USE AND... the use of radio frequencies upon proclamation by the President that there exists war, or a threat of war or a state of public peril or other wartime emergency or in order to preserve the neutrality of...

  14. 47 CFR 214.4 - Planned actions.

    Science.gov (United States)

    2010-10-01

    ... Telecommunication OFFICE OF SCIENCE AND TECHNOLOGY POLICY AND NATIONAL SECURITY COUNCIL PROCEDURES FOR THE USE AND... 13471; 3 CFR, 1984 Comp., p. 193). (b) In this connection, and concurrently with the war or national... the use of the radio spectrum in areas of active combat, where such control is necessary to the...

  15. Proclamation No. 214, 3 February 1988.

    Science.gov (United States)

    1988-01-01

    This Proclamation declares the second week of February 1988 and every year thereafter as Respect and Care for Life Week. The text of the Proclamation, including its preamble, is as follows: "Whereas, the UN Declaration on Rights of the Child provides that 'the Child, by reason of his physical and mental immaturity, needs special safeguards and care, including appropriate legal protection, before as well as after birth'; Whereas, Section 12, Article 2 of the Constitution provides that it is the policy of the State to 'protect the life of the mother and the life of the unborn from conception'; Whereas, available statistics detail the frightening losses of innocent human lives by abortion; and Whereas, in pursuance of the above constitutional mandate and in support of the UN universal declaration and in order to instill the same, as well as the value and sacredness of human life, in the minds and hearts of the Filipino people and thereby help reverse the above statistical trend, it becomes imperative to set aside a period of time for them to ponder and focus attention on their moral and constitutional obligations to protect human life or one's inherent right to life; Now, Therefore, I, Corazon C. Aquino, President of the Philippines, by virtue of the powers vested in me by law, do hereby declare the second week of February 1988 and every year thereafter as "Respect and Care for Life Week" under the auspices of the Department of Social Welfare and Development and Pro-Life Philippines, and other involved entities or organization[s]." full text

  16. 25 CFR 214.3 - Corporate information.

    Science.gov (United States)

    2010-04-01

    ... company, and its value. (e) What the total indebtedness of the company is, and the nature of its... share remains unpaid and subject to assessment. (c) How much cash the company has in its treasury and...

  17. 49 CFR 214.7 - Definitions.

    Science.gov (United States)

    2010-10-01

    ...-highway ground transportation that run on rails or electro-magnetic guideways, including (1) commuter or other short-haul rail passenger service in a metropolitan or suburban area, and (2) high-speed ground... structures, whether of timber, stone, concrete, metal, or any combination thereof. Railroad bridge worker or...

  18. Gender | Page 214 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Uncontrolled development was threatening to destroy the forest environment and the traditional way of life of the hill people of Ratanakiri. Researchers worked with the villagers to produce unique maps and resource use plans that convinced the government of the people's traditional resource use and management rights, ...

  19. 23 CFR 646.214 - Design.

    Science.gov (United States)

    2010-04-01

    ... crossing improvements. (1) All traffic control devices proposed shall comply with the latest edition of the Manual on Uniform Traffic Control Devices for Streets and Highways supplemented to the extent applicable... use by traffic or the project accepted by FHWA until adequate warning devices for the crossing are...

  20. 25 CFR 214.8 - Acreage limitation.

    Science.gov (United States)

    2010-04-01

    ..., silver, copper, or other useful metals, 640 acres. (b) For beds of placer gold, gypsum, asphaltum, phosphate, iron ores, and other useful minerals, other than coal, lead, and zinc, 960 acres. (c) For coal, 4...

  1. 24 CFR 214.303 - Performance criteria.

    Science.gov (United States)

    2010-04-01

    ... mortgage lenders, brokers, builders, or real estate sales agents or brokers in which the officer, employee... referring a client to mortgage lenders, brokers, builders, or real estate sales agents or brokers. (3) A...) Conflicts of interest. (1) A director, employee, officer, contractor, or agent of a participating agency...

  2. Publications | Page 214 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded research, and offer free training materials to guide researchers and institutions. Want more? Explore outputs from more than four decades of ...

  3. 214 Using Appropriate Strategies to Improve Students ...

    African Journals Online (AJOL)

    User

    2011-07-21

    Jul 21, 2011 ... As a result, learners lack the skills and strategies involved in reading and hence having .... Readers must intentionally and purposefully work to ... anticipating what is going to happen or come ..... Life long Learning: The Adult.

  4. Publications | Page 214 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... studies, we aim to widen the impact of our investment and advance development research. ... However, the institutional context of decision making and planning for coastal... Fiscal decentralization and local tax effort (restricted access) ... cultural and economic needs of local communities with the long-term sustainability of ...

  5. 6 CFR 21.4 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... care, housing, social services, or parks and recreation; or (ii) The entire plant or other comparable... or any part of structures, equipment, or other real or personal property or interests therein, and... Federal funds; (2) The grant or donation of Federal property and interests in property; (3) The detail of...

  6. 24 CFR 5.214 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... HUD PROGRAM REQUIREMENTS; WAIVERS Disclosure and Verification of Social Security Numbers and Employer... Administration (including wages, net earnings from self-employment, and payments of retirement income), as... respect to which the individual actually received such compensation; (4) Unearned IRS income and self...

  7. 20 CFR 498.214 - Sanctions.

    Science.gov (United States)

    2010-04-01

    ... to the severity and nature of the failure or misconduct. Such sanction may include— (1) In the case... claim or defense; (3) Striking pleadings, in whole or in part; (4) Staying the proceedings; (5...

  8. 15 CFR 280.214 - Hearings.

    Science.gov (United States)

    2010-01-01

    ... STANDARDS AND TECHNOLOGY, DEPARTMENT OF COMMERCE ACCREDITATION AND ASSESSMENT PROGRAMS FASTENER QUALITY... conducted in a fair and impartial manner by the administrative law judge, who may limit attendance at any... may nevertheless proceed, and that party's failure to appear will not affect the validity of the...

  9. 4 CFR 21.4 - Protective orders.

    Science.gov (United States)

    2010-01-01

    ... material, as well as other information the release of which could result in a competitive advantage to one... the applicant is not involved in competitive decision-making for any firm that could gain a competitive advantage from access to the protected information and that there will be no significant risk of...

  10. 25 CFR 214.10 - Royalty rates.

    Science.gov (United States)

    2010-04-01

    ... and allied substances, the lessee shall pay quarterly a royalty of 10 cents per ton of 2,000 pounds on crude material, and 60 cents per ton on refined substances. (d) For substances other than gold, silver... in the selling price per ton thereof over and above the following, which shall be the agreed base or...

  11. 24 CFR 214.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... Southwest, Mid-Atlantic, New England: (i) Housing counseling services through its branches or affiliates or.... Virgin Islands. Subgrantee. An affiliate of a HUD-approved intermediary or SHFA that receives a subgrant...

  12. 24 CFR 214.103 - Approval criteria.

    Science.gov (United States)

    2010-04-01

    ... status and tax-exempt status under section 501(a), pursuant to section 501(c) of the Internal Revenue..., including agencies offering similar or related services to non-English speaking clients. (k) State and local...

  13. Fungal Planet description sheets: 214–280

    NARCIS (Netherlands)

    Crous, P.W.; Shivas, R.G.; Quaedvlieg, W.; Bank, van der M.; Zhang, Y.; Summerell, B.A.; Guarro, J.; Wingfield, M.J.; Wood, A.R.; Alfenas, A.C.; Braun, U.; Cano-Lira, J.F.; Garcia, D.; Marin-Felix, Y.; Alvarado, P.; Andrade, J.P.; Armengol, J.; Assefa, A.; Breeÿen, den A.; Camele, I.; Cheewangkoon, R.; Souza, De J.T.; Duong, T.A.; Esteve-Raventós, F.; Fournier, J.; Frisullo, S.; García-Jiménez, J.; Gardiennet, A.; Gené, J.; Hernández-Restrepo, M.; Hirooka, Y.; Hospenthal, D.R.; King, A.; Lechat, C.; Lombard, L.; Mang, S.M.; Marbach, P.A.S.; Marincowitz, S.; Montaño-Mata, N.J.; Moreno, G.; Perez, C.A.; Pérez Sierra, A.M.; Robertson, J.L.; Roux, J.; Rubio, E.; Schumacher, R.K.; Stchigel, A.M.; Sutton, D.A.; Tan, Y.P.; Thompson, E.H.; Vanderlinde, E.; Walker, A.K.; Walker, D.M.; Wickes, B.L.; Wong, P.T.W.; Groenewald, J.Z.

    2014-01-01

    Novel species of microfungi described in the present study include the following from South Africa: Cercosporella dolichandrae from Dolichandra unguiscati, Seiridium podocarpi from Podocarpus latifolius, Pseudocercospora parapseudarthriae from Pseudarthria hookeri, Neodevriesia coryneliae from

  14. Publications | Page 214 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    evidence from local Panchayat elections in rural India (restricted access) ... Case study : ISIF - the Information Society Innovation Fund (ISIF) (restricted access). Utilization Focused Evaluation (UFE) begins with the premise that ... Proposals.

  15. 211 At-labeled agents for alpha-immunotherapy: On the in vivo stability of astatine-agent bonds

    OpenAIRE

    Ayed , Tahra ,; Pilmé , Julien; Tézé , David; Bassal , Fadel ,; Barbet , Jacques ,; Chérel , Michel; Champion , Julie ,; Maurice , Rémi; Montavon , Gilles ,; Galland , Nicolas ,

    2016-01-01

    International audience; The application of 211 At to targeted cancer therapy is currently hindered by the rapid deastatination that occurs in vivo. As the deastatination mechanism is unknown, we tackled this issue from the viewpoint of the intrinsic properties of At-involving chemical bonds. An apparent correlation has been evidenced between in vivo stability of 211 At-labeled compounds and the AtÀR (R ¼ C, B) bond enthalpies obtained from relativistic quantum mechanical calculations. Further...

  16. Preparation and biological evaluation of an astatine-211 labeled biotin conjugate: Biotinyl-3-[211At]astatoanilide

    International Nuclear Information System (INIS)

    Foulon, Catherine F.; Schoultz, Bent W.; Zalutsky, Michael R.

    1997-01-01

    Biotinyl-3-[ 211 At]astatoanilide ([ 211 At]AtBA) was prepared in more than 80% yield by destannylation. In vitro, [ 211 At]AtBA exhibited a high affinity for streptavidin, and was stable after incubation in human serum, cerebrospinal fluid and distilled water, whereas it was rapidly degraded in mouse serum. HPLC analysis showed that the main degradation pathway in mouse serum was the cleavage of [ 211 At]astatoaniline. In mice, [ 211 At]AtBA and its 125 I-labeled analogue cleared rapidly from most tissues; however, there was some evidence for dehalogenation of both tracers

  17. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  18. 49 CFR 571.214 - Standard No. 214; Side impact protection.

    Science.gov (United States)

    2010-10-01

    ...) of 4,536 kilograms (kg) (10,000 pounds (lb)) or less, except for walk-in vans, or otherwise specified..., in part or in total. Raised roof is used as defined in paragraph S4 of 49 CFR 571.216. Walk-in van... in S6 (door crush resistance), S7 (moving deformable barrier test), and S9 (vehicle-to-pole test...

  19. Inactivation of human osteosarcoma cells in vitro by 211At-TP-3 monoclonal antibody: Comparison with astatine-211 and external-beam X rays

    International Nuclear Information System (INIS)

    Larsen, R.H.; Bruland, O.S.; Hoff, P.; Alstad, J.; Lindmo, T.; Rofstad, E.K.

    1994-01-01

    The potential usefulness of α-particle radioimmunotherapy in the treatment of osteosarcoma was studied in vitro by using the monoclonal antibody TP-3 and cells of three human osteosarcoma cell lines (OHS, SAOS and KPDX) differing in antigen expression. Cell survival curves were established after treatment with (a) 211 At-TP-3 of different specific activities, (b) 211 At-labeled bovine serum albumin (BSA), (c) free 211 At and (d) external-beam X rays. The three osteosarcoma cell lines showed similar survival curves, whether treated with external-beam X rays, 211 At-BSA or free 211 At. The D o 's were lower for free 211 At than for 211 At-BSA. The survival curves for 211 At-TP-3 treatment, on the other hand, differed significantly among the cell lines, suggesting that sensitivity to 211 At-TP-3 treatment was governed by cellular properties other than sensitivity to external-beam X rays. The cellular property most important for sensitivity to 211 At-TP-3 treatment was the antigen expression. Cell inactivation after 211 At-TP-3 treatment increased substantially with increasing specific activity of the 211 At-TP-3. At high specific activities, the cytotoxic effect of 211 At-TP-3 was significantly higher than that of 211 At-BSA. In conclusion, 211 At-TP-3 has the potential to give clinically favorable therapeutic ratios in the treatment of osteosarcoma. 39 refs., 5 figs., 2 tabs

  20. 48 CFR 52.214-5 - Submission of Bids.

    Science.gov (United States)

    2010-10-01

    ... authorized by the solicitation. (e) Bids submitted by electronic commerce shall be considered only if the electronic commerce method was specifically stipulated or permitted by the solicitation. (End of provision...

  1. 34 CFR 685.214 - Closed school discharge.

    Science.gov (United States)

    2010-07-01

    ... the school's closing with any third party, such as the holder of a performance bond or a tuition... their successors, its sureties, and any private fund, including the portion of a public fund that represents funds received from a private party. (2) The provisions of this section apply notwithstanding any...

  2. 48 CFR 633.214-70 - Alternative dispute resolution.

    Science.gov (United States)

    2010-10-01

    ... situations; (vi) There is a need for independent expert analysis; or, (vii) The claim has merit but its value... of either the trial's conclusion or receipt of a trial transcript. (4) Mediation. Mediation is a... decisionmaking authority and cannot impose a decision. Mediation assistance involves working with the parties to...

  3. The synthesis of 2-14C-N-nitrosothiazolidine

    International Nuclear Information System (INIS)

    Cragin, D.W.; Shibamoto, Takayuki

    1989-01-01

    2- 14 C-N-Nitrosothiazolidine was synthesized with a chemical purity of 99.6%, a radio chemical purity of 99.4%, and an overall yield of 30.7%. Unlabelled N-nitrosothiazolidine, synthesized using the same method, resulted in a purity of 99.85% by capillary GC and 99.7% by HPLC. Analysis of N-nitrosothiazolidine by GC was found to require a low injection port temperature of 160 0 C to prevent denitrosation in the injection port. During the nitrosation of thiazolidine, if the pH was reduced below 4 with hydrochloric acid, ring hydrolysis occurred, and chlorinated disulfide compounds formed. (author)

  4. 49 CFR 214.321 - Exclusive track occupancy.

    Science.gov (United States)

    2010-10-01

    ... printed document directly, by relay through a designated employee, in a data transmission, or by oral... train dispatcher or control operator in charge of the track shall make a written or electronic record of...

  5. Electrical Experiments. VT-214-12-5. Part V. Transformers.

    Science.gov (United States)

    Connecticut State Dept. of Education, Hartford. Div. of Vocational Education.

    Designed for high school electronics students, this fifth document in a series of six electrical learning activity packages focuses on transformers. An introductory section gives the objective for the activities, an introduction, and an outline of the content. The remainder of the activity book is comprised of information sheets and job sheets on…

  6. 48 CFR 2052.214-70 - Prebid conference.

    Science.gov (United States)

    2010-10-01

    ... prebid conference is scheduled for: Date: * Location: * Time: * (b) This conference is to afford... amendment to the solicitation. If you plan to attend the conference, notify * by letter or telephone * , no later than close of business * . Notification of your intention to attend is essential in the event the...

  7. 28 CFR 2.214 - Probable cause hearing and determination.

    Science.gov (United States)

    2010-07-01

    ... adverse witnesses (i.e., witnesses who have given information upon which revocation may be based) at a... confrontation. Whenever a probable cause hearing is postponed to secure the appearance of adverse witnesses (or...

  8. 27 CFR 9.214 - Haw River Valley.

    Science.gov (United States)

    2010-04-01

    ... significance. (b) Approved maps. The two United States Geological Survey 1:100,000-scale metric topographic...) Greensboro, North Carolina, 1984; and (2) Chapel Hill, North Carolina, 1984. (c) Boundary. The Haw River... line southeast 2 miles to the intersection of North Carolina State Highway 49 and an unnamed, light...

  9. 22 CFR 214.36 - Records of advisory committees.

    Science.gov (United States)

    2010-04-01

    ..., working papers, drafts, studies, agenda, and other documents which were made available to, or prepared for... according to procedures prescribed in the Agency's Handbook 21—Communications, Part III, Records Filing and...

  10. 38 CFR 21.214 - Furnishing supplies for special programs.

    Science.gov (United States)

    2010-07-01

    ... the veteran's farm by an individual instructor, VA will furnish to a student only those textbooks and...; and (3) Other related assistance such as business license fees. (Authority: 38 U.S.C. 3104(a)(12)) (f...

  11. Human factors assessment of SC-214 message set

    Science.gov (United States)

    2010-08-18

    This is a presentation that was given at the Communication Navigation and Surveillance (CNS) Task Force Meeting. It discusses a review of current literature, analysis of Pilot Deviations and ASRS reports involving data link communications, and discus...

  12. Die skrywer. Esta Steyn. Kaapstad: Tafelberg, 2012. 214 pp. ISBN ...

    African Journals Online (AJOL)

    ningsromans in Duits, is die Christelike ele- mente en die humor. Die straatslim Anabella wat twee plaaswerkers aansê om nie die Here se naam te misbruik nie, toon kenmerke van die heldin in 'n Afrikaanse liefdesverhaal. Hierdie roman sal byval vind by lesers wat. Esta Steyn se vorige romans geniet het. Die humor in die ...

  13. All projects related to | Page 214 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-02-21

    The Greater Mekong Subregion-Development Analysis Network (GMS-DAN) is a collaborative development research network of leading research institutes and think tanks in Cambodia, Laos, Thailand, and China's Yunnan province. Start Date: February 21, 2012. End Date: November 17, 2014. Topic: SOUTHEAST ASIA ...

  14. 48 CFR 1233.214 - Alternative dispute resolution (ADR).

    Science.gov (United States)

    2010-10-01

    ... Alternative dispute resolution (ADR). (c) The Administrative Dispute Resolution Act (ADRA) of 1990, Public Law... Specialist, who is responsible for the operations of the Center for Alternative Dispute Resolution, (C-4... alternative means of dispute resolution set forth in the ADRA, 5 U.S.C. 571(3) on a non-reimbursable basis for...

  15. 48 CFR 833.214 - Alternative dispute resolution (ADR).

    Science.gov (United States)

    2010-10-01

    ... Alternative dispute resolution (ADR). Contracting officers and contractors are encouraged to use alternative dispute resolution (ADR) procedures. CBCA guidance on ADR may be obtained at http://www.cbca.gsa.gov. ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Alternative dispute...

  16. 13 CFR 400.214 - Participations in guaranteed loans.

    Science.gov (United States)

    2010-01-01

    ...) Subject to paragraphs (b), (c) and (d) of this section, a Lender may distribute the risk of a portion of a... the Guarantee is assigned, conveyed, sold, or transferred in whole or in part; (2) The Lender remains... Lenders; (2) Private investment funds and insurance companies that do not usually invest in commercial...

  17. 49 CFR 214.101 - Purpose and scope.

    Science.gov (United States)

    2010-10-01

    ... scope. (a) The purpose of this subpart is to prevent accidents and casualties arising from the performance of work on railroad bridges. (b) This subpart prescribes minimum railroad safety rules for railroad employees performing work on bridges. Each railroad and railroad contractor may prescribe...

  18. Low-frequency polarimetry of the millisecond pulsar PSR1937+214

    Energy Technology Data Exchange (ETDEWEB)

    Stinebring, D R [National Radio Astronomy Observatory, Charlottesville, VA (USA); Cordes, J M [Cornell Univ., Ithaca, NY (USA). Dept. of Astronomy; Cornell Univ., Ithaca, NY (USA). National Astronomy and Ionospheric Center)

    1983-11-24

    Polarization observations are reported at 431 MHz that have 4 ..mu..s time resolution and are free from the effects of interstellar dispersion. The interpulse polarization decreases towards lower frequencies, opposite in trend to the polarization of the main pulse and of most other pulsars. The position angles at the center of the main pulse and interpulse are approximately equal and the position angle gradients have the same sign, supporting a model in which the main pulse and interpulse are emitted above opposite magnetic poles.

  19. Energy analysis handbook. CAC document 214. [Combining process analysis with input-output analysis

    Energy Technology Data Exchange (ETDEWEB)

    Bullard, C. W.; Penner, P. S.; Pilati, D. A.

    1976-10-01

    Methods are presented for calculating the energy required, directly and indirectly, to produce all types of goods and services. Procedures for combining process analysis with input-output analysis are described. This enables the analyst to focus data acquisition cost-effectively, and to achieve a specified degree of accuracy in the results. The report presents sample calculations and provides the tables and charts needed to perform most energy cost calculations, including the cost of systems for producing or conserving energy.

  20. Electrical Experiments. VT-214-12-1. Part I. Electric Motor Control.

    Science.gov (United States)

    Connecticut State Dept. of Education, Hartford. Div. of Vocational Education.

    Designed for high school electronics students, this first document in a series of six electrical learning activity packages focuses on electric motor control. An introductory section gives the objective for the activities, an introduction, and an outline of the content. The remainder of the activity book is comprised of information sheets and job…

  1. 22 CFR 214.31 - A.I.D. Advisory Committee Representative.

    Science.gov (United States)

    2010-04-01

    .... Advisory Committee Representative. (b) The designated A.I.D. employee performs functions required by section 10 of the Act and assigned herein. Such functions include: (1) Calling, or giving advance approval... Administrator; (4) Assuring that advance notices of each meeting (whether open or closed) are published in the...

  2. Synthesis of 14C analogue of 1,2-diaryl-[2-14C]-pyrroles

    International Nuclear Information System (INIS)

    Saemian, N.; Shirvani, G.; Matloubi, H.

    2007-01-01

    Three 1,2-diaryl pyrroles selective COX-2 inhibitors, 2-(4-fluorophenyl)-5-methyl-1-(4-methylsulfonyl-phenyl)-1H pyrrole, 2-(4-fluorophenyl)-1- [4-(methylsulfonyl) phenyl]-1H-pyrrole and 4-[2-(4-fluorophenyl)-1H-pyrrol-1-yl]benzenesulfon-amide, all three labeled with 14 C in the 2-position were prepared from para-fluoro-benzaldehyde-[carbonyl- 14 C]. (author)

  3. Convenient synthesis of [2-14C]-methylglyoxal bis(guanylhydrazone), [14C]-mitoguazone

    International Nuclear Information System (INIS)

    Burgos, A.; Ellames, G.J.

    1995-01-01

    [2- 14 C]-Methylglyoxal bis(guanylhydrazone) dihydrochloride, [ 14 C]-mitoguazone has been prepared in three steps from potassium[1- 14 C]-acetate in an overall radiochemical yield of 16%. The key steps in this procedure are the formation of the sodium salt of[acetone-2- 14 C]-methylsulfinylacetone, and Pummerer rearrangement to the [ 14 C] labelled hermithioacetal, which is trapped with two equivalents of aminoguanidine to afford the desired [ 14 C]-mitoguazone. (Author)

  4. Cavitation erosion resistance of 13/4 and 21-4-N steels

    Indian Academy of Sciences (India)

    small change in the operating efficiency can be very expensive. ... The samples for cavitation erosion tests were cut by diamond cutter of 10 × 10 × .... in which it has been reported that the graphite inclusions provide the required crack initiation.

  5. 8 CFR 214.1 - Requirements for admission, extension, and maintenance of status.

    Science.gov (United States)

    2010-01-01

    ...)(iii), (U)(iv), and (U)(v) for the spouse, child, parent, and siblings, respectively, of a nonimmigrant... (B) A new Form I-20A-B if there has been any substantive change in the information on the student's...

  6. 23 CFR 971.214 - Federal lands congestion management system (CMS).

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Federal lands congestion management system (CMS). 971... Federal lands congestion management system (CMS). (a) For purposes of this section, congestion means the...) Develop criteria to determine when a CMS is to be implemented for a specific FH; and (2) Have CMS coverage...

  7. 48 CFR 52.214-7 - Late submissions, modifications, and withdrawals of bids.

    Science.gov (United States)

    2010-10-01

    ... transmitted through an electronic commerce method authorized by the IFB, it was received at the initial point... Government processes resume. (e) Bids may be withdrawn by written notice received at any time before the...

  8. 49 CFR 214.337 - On-track safety procedures for lone workers.

    Science.gov (United States)

    2010-10-01

    ...-track equipment is not impaired by background noise, lights, precipitation, fog, passing trains, or any... performing routine inspection or minor correction may use individual train detection to establish on-track... worker retains an absolute right to use on-track safety procedures other than individual train detection...

  9. The incorporation of 2-[14C]glycine into porcine lens protein

    International Nuclear Information System (INIS)

    Lee, Y.B.; Kauffman, R.G.; DeVenecia, G.

    1977-01-01

    A series of experiments was conducted to estimate the apparent turnover rate of lens soluble protein, the incorporation rate of 2-[ 14 C]glycine into various soluble protein components and the effect of nutritional stress on the disappearance of radioactivity with time. Evidence is presented that there are two fractions of soluble lens protein with different turnover rates: one is a fast turnover fraction with a half-life of 20.8 hr and the other is a metabolically inert fraction with an infinitely long half-life. It is postulated that the fast turnover fraction is present in the newly-formed younger fibers in the periphery, whereas the inert fraction is in the old lens fibers of the cortex and nucleus. Sephadex G-200 column chromatography was used to separate the soluble lens protein into four components: A, B, C and D in the order of elution. The changes in specific activities of the four components with the time course after injection were followed. Prolonged starvation did not affect the disappearance of carbon incorporated into lens protein with the time course after injection, suggesting normal synthesis and degradation of lens protein without regard to dietary stress. (author)

  10. Equity from an Aging Specialist's Perspective. Research and Development Series No. 214O.

    Science.gov (United States)

    Sheppard, N. Alan

    As the incidence of older persons in American society grows, their participation in training and employment programs (including vocational education) will be of special importance. Although the elderly population has become increasingly "older," this group is retiring earlier. There will be a decrease in active workers supporting retired citizens…

  11. 48 CFR 52.214-10 - Contract Award-Sealed Bidding.

    Science.gov (United States)

    2010-10-01

    ... the solicitation, will be most advantageous to the Government considering only price and the price... quantity less than the quantity offered, at the unit prices offered, unless the bidder specifies otherwise in the bid. (d) A written award or acceptance of a bid mailed or otherwise furnished to the...

  12. 8 CFR 214.2 - Special requirements for admission, extension, and maintenance of status.

    Science.gov (United States)

    2010-01-01

    ... Diplomatic Relations or other international agreements does not apply to these dependents with respect to... temporary employment of not more than 12 weeks during school holiday periods; and (E) The proposed...) [Reserved] (7) Enrollment in a course of study prohibited. An alien who is admitted as, or changes status to...

  13. 214 D. P. Verna, B. Kumar and H C Verma and by

    Indian Academy of Sciences (India)

    To minimise the truncation error, special care was taken while programming and the terms of too different magnitudes, were not added directly. 4. Results and discussion. The results for different c/a are listed in table 1 together with the available calculation of de Wette (1961) using Fourier transforms. The good agreement ...

  14. Oxidation of sodium (2-14C) acetate with alkaline permanganate

    International Nuclear Information System (INIS)

    Zielinski, M.

    1983-01-01

    The mechanism and kinetics of the oxidation of sodium acetate with permanganate in alkile and neutral media have been investigated using (2- 14 C) acetate. The reaction is first order with respect to both permanganate and acetate ions. The initial second order rate constants depend linearly on the square of the hydroxide ion concentration. Arrhenius activation energy of the oxidation reaction carried out in 12M NaOH is 24.0 kcal/mole in the temperature interval of 50-100 deg C. The mechanism of the principal path leading to the oxalate formation and the mechanism of the side reaction resulting in the carbon dioxide production have been proposed and discussed. (author)

  15. 47 CFR 63.09 - Definitions applicable to international Section 214 authorizations.

    Science.gov (United States)

    2010-10-01

    ... telecommunications services offered to the public in that country within the meaning of the International... carriers are parties to, or the beneficiaries of, a contractual relation (e.g., a joint venture or market alliance) affecting the provision or marketing of international basic telecommunications services in the...

  16. 48 CFR 52.214-22 - Evaluation of Bids for Multiple Awards.

    Science.gov (United States)

    2010-10-01

    ... will be evaluated on the basis of advantages and disadvantages to the Government that might result from... $500 would be the administrative cost to the Government for issuing and administering each contract... result in the lowest aggregate cost to the Government, including the assumed administrative costs. (End...

  17. 48 CFR 214.407-3 - Other mistakes disclosed before award.

    Science.gov (United States)

    2010-10-01

    ... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SEALED BIDDING Opening of... Information Systems Agency: General Counsel, DISA. (iii) Defense Intelligence Agency: Principal Assistant for.... (v) National Geospatial-Intelligence Agency: General Counsel, NGA. (vi) Defense Threat Reduction...

  18. 10 CFR 72.214 - List of approved spent fuel storage casks.

    Science.gov (United States)

    2010-01-01

    ... STORAGE OF SPENT NUCLEAR FUEL, HIGH-LEVEL RADIOACTIVE WASTE, AND REACTOR-RELATED GREATER THAN CLASS C... Systems, Inc. SAR Title: Topical Safety Analysis Report for the Castor V/21 Cask Independent Spent Fuel... Title: Topical Safety Analysis Report for the NAC Storage/Transport Cask for Use at an Independent Spent...

  19. Sexospécificités | Page 214 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Citizen participation in the user groups and local management committees that often accompany decentralization is also intended to spill over into broader processes of empowerment. Marginalized groups such as women, ethnic minorities, and the poor are especially supposed to benefit. Read more about Realizing Their ...

  20. Tank 214-AW-105, grab samples, analytical results for the final report

    International Nuclear Information System (INIS)

    Esch, R.A.

    1997-01-01

    This document is the final report for tank 241-AW-105 grab samples. Twenty grabs samples were collected from risers 10A and 15A on August 20 and 21, 1996, of which eight were designated for the K Basin sludge compatibility and mixing studies. This document presents the analytical results for the remaining twelve samples. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DO). The results for the previous sampling of this tank were reported in WHC-SD-WM-DP-149, Rev. 0, 60-Day Waste Compatibility Safety Issue and Final Results for Tank 241-A W-105, Grab Samples 5A W-95-1, 5A W-95-2 and 5A W-95-3. Three supernate samples exceeded the TOC notification limit (30,000 microg C/g dry weight). Appropriate notifications were made. No immediate notifications were required for any other analyte. The TSAP requested analyses for polychlorinated biphenyls (PCB) for all liquids and centrifuged solid subsamples. The PCB analysis of the liquid samples has been delayed and will be presented in a revision to this document

  1. 8 CFR 214.3 - Approval of schools for enrollment of F and M nonimmigrants.

    Science.gov (United States)

    2010-01-01

    ... students under section 101(a)(15)(F)(i) of the Act: (A) A college or university, i.e., an institution of... computer problems on the part of SEVIS cause an error in the student's record, the DSO may request the... transcripts or other records of courses taken, proof of financial responsibility for the student, and other...

  2. Diffusion of [2-14C]diazepam across hairless mouse skin and human skin

    International Nuclear Information System (INIS)

    Koch, R.L.; Palicharla, P.; Groves, M.J.

    1987-01-01

    The objectives of this study were to investigate the absorption of diazepam applied topically to the hairless mouse in vivo and to determine the diffusion of diazepam across isolated hairless mouse skin and human skin. [ 14 C]Diazepam was readily absorbed after topical administration to the intact hairless mouse, a total of 75.8% of the 14 C-label applied being recovered in urine and feces. Diazepam was found to diffuse across human and hairless mouse skin unchanged in experiments with twin-chambered diffusion cells. The variation in diffusion rate or the flux for both human and mouse tissues was greater among specimens than between duplicate or triplicate trials for a single specimen. Fluxes for mouse skin (stratum corneum, epidermis, and dermis) were greater than for human skin (stratum corneum and epidermis): 0.35-0.61 microgram/cm2/h for mouse skin vs 0.24-0.42 microgram/cm2/h for human skin. The permeability coefficients for mouse skin ranged from 1.4-2.4 X 10(-2)cm/h compared with 0.8-1.4 X 10(-2)cm/h for human skin. Although human stratum corneum is almost twice the thickness of that of the hairless mouse, the diffusion coefficients for human skin were 3-12 times greater (0.76-3.31 X 10(-6) cm2/h for human skin vs 0.12-0.27 X 10(-6) cm2/h for hairless mouse) because of a shorter lag time for diffusion across human skin. These differences between the diffusion coefficients and diffusion rates (or permeability coefficients) suggest that the presence of the dermis may present some barrier properties. In vitro the dermis may require complete saturation before the diazepam can be detected in the receiving chamber

  3. 48 CFR 52.214-28 - Subcontractor Certified Cost or Pricing Data-Modifications-Sealed Bidding.

    Science.gov (United States)

    2010-10-01

    ... cost or pricing data at FAR 15.403-4(a)(1), on the date of agreement on price or the date of award... nature and amount of any contingencies included in the price), unless an exception under FAR 15.403-1(b... prescribed in subsection 15.406-2 of the Federal Acquisition Regulation that, to the best of its knowledge...

  4. 77 FR 214 - Revisions to the California State Implementation Plan, San Joaquin Valley Unified Air Pollution...

    Science.gov (United States)

    2012-01-04

    ... the California State Implementation Plan, San Joaquin Valley Unified Air Pollution Control District... approval of revisions to the San Joaquin Valley Air Pollution Control District (SJVUAPCD) portion of the... used by the California Air Resources Board and air districts for evaluating air pollution control...

  5. 23 CFR 450.214 - Development and content of the long-range statewide transportation plan.

    Science.gov (United States)

    2010-04-01

    ...., transportation, safety, economic development, social and environmental effects, or energy) that were relevant to... time of adoption, that provides for the development and implementation of the multimodal transportation... consultation with affected non-metropolitan officials with responsibility for transportation using the State's...

  6. Role of apical oxygen in 2-1-4 electron-doped superconductors

    Czech Academy of Sciences Publication Activity Database

    Richard, P.; Riou, G.; Jandl, S.; Poirier, M.; Furnier, P.; Nekvasil, Vladimír; Diviš, M.

    408-410, - (2004), s. 830-831 ISSN 0921-4534 R&D Projects: GA ČR GA202/03/0552 Institutional research plan: CEZ:AV0Z1010914 Keywords : Nd 2-x Ce x CuO 4 * crystal-field * apical oxygen * HTSC Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.072, year: 2004

  7. 78 FR 22025 - Eighteenth Meeting: RTCA Special Committee 214, Standards for Air Traffic Data Communication...

    Science.gov (United States)

    2013-04-12

    ... VDL Sub-Group Update Change 1 to DO-224C & Change 1 to DO-281B (Dongsong Zeng) Approve TOR Chagens to... Techniques'' Approve TOR Changes to add to the SC deliveralbes Change 1 to DO-281B ``Minimum Operational..., Federal Aviation Administration. [FR Doc. 2013-08541 Filed 4-11-13; 8:45 am] BILLING CODE 4910-13-P ...

  8. Ultrasonic Examination of Double-Shell Tank 214-AW-102 Knuckle Region. Examination completed February 2003

    International Nuclear Information System (INIS)

    Pardini, Allan F.; Posakony, Gerald J.

    2003-01-01

    COGEMA Engineering Corporation (COGEMA), under a contract from CH2M Hill Hanford Group (CH2M Hill), has performed an ultrasonic examination of the knuckle region of Double-Shell Tank 241-AW-102 utilizing the Remotely Operated Nondestructive Examination (RONDE) system. The purpose of this examination was to provide information that could be used to evaluate the integrity of the knuckle region of the primary tank. The requirements for the ultrasonic examination of Tank 241-AW-102 were to detect, characterize (identify, size, and locate), and record measurements made of any circumferentially oriented cracks that might be present in the knuckle area of the primary tank. Any measurements that exceed the requirements set forth in the Engineering Task Plan (ETP), RPP-7869, are reported to CH2M Hill and the Pacific Northwest National Laboratory (PNNL) for further evaluation. Under the contract with CH2M Hill, all data is to be recorded on disk and paper copies of all measurements are provided t o PNNL for third-party evaluation. PNNL is responsible for preparing a report(s) that describes the results of the COGEMA ultrasonic examinations

  9. Transport and degradation of 2-14C abscicine acid in the coleus rehneltianus berger sprout

    International Nuclear Information System (INIS)

    Klaska, A.

    1979-01-01

    1 μg ABA-2- 14 C aqueous solution was injected into the youngest or into a fully grown leaf of young and older coleus plants. The activity quantity in the various sprout parts is investigated after 2, 24 and 72 h; as well as which labelled substances other than abscisic acid (ABA) occur. The activity in the ethanol extracts was detected with the help of liquid scintillation measurements. Thin layer chromatography and gas chromatography were used to characterize the radioactive substances. The results show that ABA is degraded into three metabolites which are characterized by their relative Rsub(F) values using chromatography with LM 2 as substance 0.2, 0.5a, 0.5b and 0.8. Comparing with the literature shows that it could be 6'-hydroxy methyl ABA, ABA glucoside, phaseic acid and dihydrophaseic acid. Young and old leaves in older plants have the same ability to degrade ABA taking the occurence of the 0.8 metabolite as standard. The degradation in younger plants is firstly very slight. However, within 72 h the ability of ABA degradation is induced in older leaves of younger plants, so that finally the degradation rate is as big as in older plants. Activity is essentially exported by adult leaves of older plants. The basipetal transport is considerably greater than the acropetal one. Results show that mainly ABA is transported in the acropetal test, whereas ABA and fraction 0.5 are transported in the basipetal direction. A reversed transport direction is observed after applying ABA to a young leaf. The transport basipetal is polarized in the first two hours, after 72 hours of transport there is a definite acropetal polarity. (orig./MG) [de

  10. 6-Bromo-2-(1,4-dibromo-4-methylcyclohexyl-6-methylheptan-4-one

    Directory of Open Access Journals (Sweden)

    Ahmed Benharref

    2017-11-01

    Full Text Available The title compound, C15H25Br3O, was synthesized in one step from a mixture of α-atlantone [2-methyl-6-(4-methylcyclohex-3-en-1-ylhepta-2,5-dien-4-one] and γ-atlantone [2-methyl-6-(4-methylcyclohex-3-en-1-ylidenehept-2-en-4-one], which were isolated from an essential oil of the Atlas cedar (Cedrus Atlantica. The molecule is built up from the bromo ethyl cyclohexane ring, which has a substituent bromomethylhexanone group. The cyclohexane ring adopts a chair conformation. In the crystal, molecules are linked by C—H...O hydrogen bonds, forming zigzag chains parallel to [100].

  11. Tank 241-AX-103, cores 212 and 214 analytical results for the final report

    International Nuclear Information System (INIS)

    Steen, F.H.

    1998-01-01

    This document is the analytical laboratory report for tank 241-AX-103 push mode core segments collected between July 30, 1997 and August 11, 1997. The segments were subsampled and analyzed in accordance with the Tank 241-AX-103 Push Mode Core Sampling and Analysis Plan (TSAP) (Comer, 1997), the Safety Screening Data Quality Objective (DQO) (Dukelow, et al., 1995) and the Data Quality Objective to Support Resolution of the Organic Complexant Safety Issue (Organic DQO) (Turner, et al., 1995). The analytical results are included in the data summary table (Table 1). None of the samples submitted for Differential Scanning Calorimetry (DSC), Total Alpha Activity (AT), plutonium 239 (Pu239), and Total Organic Carbon (TOC) exceeded notification limits as stated in the TSAP (Conner, 1997). The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group in accordance with the Memorandum of Understanding (Schreiber, 1997) and not considered in this report

  12. Alternate Methods of Effluent Disposal for On-Lot Home Sewage Systems. Special Circular 214.

    Science.gov (United States)

    Wooding, N. Henry

    This circular provides current information for homeowners who must repair or replace existing on-lot sewage disposal systems. Several alternatives such as elevated sand mounds, sand-lined beds and trenches and oversized absorption areas are discussed. Site characteristics and preparation are outlined. Each alternative is accompanied by a diagram…

  13. 33 CFR 110.214 - Los Angeles and Long Beach harbors, California.

    Science.gov (United States)

    2010-07-01

    ... Angeles Harbor). A circular area with a radius of 400 yards (approximately 366 meters), centered in... 400 Transportation Corridor. (C) Outer Harbor: The western boundary of Commercial Anchorage B. (2... Thence along a line described as an arc, radius of 460 meters (approximately 1509 feet) centered on 33...

  14. 8 CFR 214.15 - Certain spouses and children of lawful permanent residents.

    Science.gov (United States)

    2010-01-01

    ..., subsequent to filing, USCIS returns the petition to the applicant for any reason or makes a request for... status to that of lawful permanent residence; (iv) The V-1 spouse's divorce from the LPR becomes final...

  15. Role of apical oxygen in 2-1-4 electron-doped superconductors

    Energy Technology Data Exchange (ETDEWEB)

    Richard, P.; Riou, G.; Jandl, S.; Poirier, M.; Fournier, P.; Nekvasil, V.; Divis, M

    2004-08-01

    We report a crystal-field infrared transmission and Raman study of oxygenated and reduced Nd{sub 2-x}Ce{sub x}CuO{sub 4} single crystals. Some Nd{sup 3+} crystal-field absorption bands corresponding to rare-earth ions in non-regular sites are attributed to Nd{sup 3+} ions in the vicinity of apical oxygens. This is correlated with a study of the A{sup *} ({approx}580 cm{sup -1}) Raman local mode and with the transport properties of undoped materials. We show that the apical oxygen is not removed by the reduction.

  16. 8 CFR 214.11 - Alien victims of severe forms of trafficking in persons.

    Science.gov (United States)

    2010-01-01

    ...) Personal interview. After the filing of an application for T nonimmigrant status, the Service may require an applicant to participate in a personal interview. The necessity of an interview is to be... pledge by the debtor of his or her personal services or of those of a person under his or her control as...

  17. Synthesis of 1-(2,3-dihydroxypropyl)-2-nitro-1H-imidazole-2-14C and N-(2-hydroxyethyl)-2-(2-nitro-1H-imidazol-1-YL-2-14C)acetamide

    International Nuclear Information System (INIS)

    Fong, M.T.; Leaffer, M.A.

    1986-01-01

    We have prepared the 14 C-labeled analogs of NSC 261036, 1-(2,3-dihydroxypropyl)-2-nitro-1H-imidazole-2- 14 C, and NSC 301467, N-(2-hydroxyethyl)-2-(2-nitro-1H-imidazol-1-yl-2- 14 C) acetamide, for pharmacological, drug distribution, and mechanisms of action studies. The latter is an analog designed for lower toxicity and improved properties. The former is a metabolite of, and appears to be less toxic than, misonidazole. (author)

  18. Effect of carbon activity on the creep behaviour of 21/4Cr, 1Mo steel in sodium

    International Nuclear Information System (INIS)

    Cordwell, J.E.; Charnock, W.; Nicholson, R.D.

    1979-02-01

    The creep endurance and creep cracking behaviour of 2 1/4Cr, 1Mo steel in sodium at 475 0 C have been studied at three different sodium carbon activities. Creep endurance was found to increase with increasing carbon activity of the sodium. Tests carried out in high carbon activity sodium were discontinued before fracture. Creep crack initiation displacement at notches decreased with increasing carbon activity, presumably as a result of notch tip carburisation. The plastic zones at the tips of blunt notches in specimens exposed in high carbon activity sodium were preferentially carburised. These observations were similar to those made previously on 9Cr, 1Mo steel. One difference detected metallographically was that in a high carburising environment uniform carburisation was obtained in the 2 1/4Cr, 1Mo steel specimens whereas carburisation gradients were observed in the 9Cr, 1Mo steel. Creep crack propagation rates for given notch opening displacement rates in low and intermediate carbon activity sodium were indistinguishable. However, the strenthening that resulted from the mild carburisation of the specimen in the intermediate carbon activity sodium caused slower notch opening displacement rates and crack propagation rates than in the low carbon activity sodium, when the rates were compared at the same crack length. (author)

  19. Uptake of [2-14C]abscisic acid and distribution of 14C in apple embryos

    International Nuclear Information System (INIS)

    Barthe, P.; Bulard, C.

    1981-01-01

    Pyrus malus L. var. Golden delicious embryos were incubated with (+-)-[2- 14 C] abscisic acid (ABA). After incubations of various durations, the radioactivity was measured in whole embryos, cotyledons, and embryonic axes. With either 48-h or 16-d incubation periods, the uptake of [ 14 C] ABA depended upon the mode of culture used. The lowest values corresponded to the absorption by the embryonic axis, the highest to the absorption by the distal parts of the two cotyledons. The cotyledons accumulated the main part of the radioactivity under all conditions. Dormant and almost completely after-ripened embryos cultivated for 4 d showed no significant differences in the radioactivity uptake for identical modes of culture. There was a linear relationship between exogenous ABA concentrations (0.5 to 3.10 -5 M) and ABA uptake for embryos cultivated for 4 d with the distal parts of the cotyledons immersed in the medium. (orig.) [de

  20. SU-F-J-214: Dose Reduction by Spatially Optimized Image Quality Via Fluence Modulated Proton CT (FMpCT)

    International Nuclear Information System (INIS)

    De Angelis, L; Landry, G; Dedes, G; Parodi, K; Hansen, D; Rit, S; Belka, C

    2016-01-01

    Purpose: Proton CT (pCT) is a promising imaging modality for reducing range uncertainty in image-guided proton therapy. Range uncertainties partially originate from X-ray CT number conversion to stopping power ratio (SPR) and are limiting the exploitation of the full potential of proton therapy. In this study we explore the concept of spatially dependent fluence modulated proton CT (FMpCT), for achieving optimal image quality in a clinical region of interest (ROI), while reducing significantly the imaging dose to the patient. Methods: The study was based on simulated ideal pCT using pencil beam (PB) scanning. A set of 250 MeV protons PBs was used to create 360 projections of a cylindrical water phantom and a head and neck cancer patient. The tomographic images were reconstructed using a filtered backprojection (FBP) as well as an iterative algorithm (ITR). Different fluence modulation levels were investigated and their impact on the image was quantified in terms of SPR accuracy as well as noise within and outside selected ROIs, as a function of imaging dose. The unmodulated image served as reference. Results: Both FBP reconstruction and ITR without total variation (TV) yielded image quality in the ROIs similar to the reference images, for modulation down to 0.1 of the full proton fluence. The average dose was reduced by 75% for the water phantom and by 40% for the patient. FMpCT does not improve the noise for ITR with TV and modulation 0.1. Conclusion: This is the first work proposing and investigating FMpCT for producing optimal image quality for treatment planning and image guidance, while simultaneously reducing imaging dose. Future work will address spatial resolution effects and the impact of FMpCT on the quality of proton treatment plans for a prototype pCT scanner capable of list mode data acquisition. Acknowledgement: DFG-MAP DFG - Munich-Centre for Advanced Photonics (MAP)

  1. Consequences of a radioactive surface pool resulting from waste transfer operations between tanks 214-C-106 and 241-AY-102

    Energy Technology Data Exchange (ETDEWEB)

    Van Vleet, R.J.

    1997-08-05

    This document contains supporting calculations for quantifying the dose consequences from a pool formed from an underground leak or a-leak from an above grade structure for the Waste Retrieval Sluicing System (Project W-320), i.e., sluicing the contents of Tank 241-C-106 (high heat, SST) into Tank 241-AY-102 (aging waste, DST).

  2. Observation of Hydrological Processes Using Remote Sensing. Chapter 2.14; Volume 2: The Science of Hydrology

    Science.gov (United States)

    Wilder, Peter (Editor); Su, Z.; Robeling, R. A.; Schulz, J.; Holleman, I.; Levizzani, V.; Timmermans, W. J.; Rott, H.; Mognard-Campbell, N.; de Jeu, R.; hide

    2011-01-01

    Improving water management can make a significant contribution to achieving most of the Millennium Development Goals established by the UN General Assembly in 2000, especially those related to poverty, hunger, and major diseases. The World Summit on Sustainable Development (WSSD) in 2002 recognized this need. Water and sanitation in particular received great attention from the Summit. The Johannesburg Plan of Implementation recommended to improve water resources management and scientific understanding of the water cycle through joint cooperation and research. For this purpose, it is recommended to promote knowledge sharing, provide capacity building, and facilitate the transfer of technology including remote-sensing (RS) and satellite technologies, especially to developing countries and countries with economies in transition, and to support these countries in their efforts to monitor and assess the quantity and quality of water resources, for example, by establishing and/or further developing national monitoring networks and water resources databases and by developing relevant national indicators. The Johannesburg Plan also adopted integrated water resources management as the overarching concept in addressing and solving water-related issues. As a result of the commitments made in the Johannesburg Plan of Implementation, several global and regional initiatives have emerged. Current international initiatives such as the Global Monitoring for Environment and Security (GMES) program of the European Commission and the European Space Agency (ESA), and the Global Earth Observation System of Systems (GEOSS) 10-Year Implementation Plan, have all identified Earth observation (EO) of the water cycle as the key in helping to solve the world s water problems. The availability of spatial information on water quantity and quality will also enable closure of the water budget at river basin and continental scales to the point where effective water management is essential (e.g., as requested by the European Union s Water Framework Directive (WFD), as well as national policies). Geo-information science and EO are vital in achieving a better understanding of the water cycle and better monitoring, analysis, prediction, and management of the world s water resources. The major components of the water cycle of the Earth system and their possible observations are presented. Such observations are essential to understand the global water cycle and its variability, both spatially and temporally, and can only be achieved consistently by means of EOs. Additionally, such observations are essential to advance our understanding of coupling between the terrestrial, atmospheric, and oceanic branches of the water cycle, and how this coupling may influence climate variability and predictability. Water resources management directly interferes with the natural water cycle in the forms of building dams, reservoirs, water transfer systems, and irrigation systems that divert and redistribute part of the water storages and fluxes on land. The water cycle is mainly driven and coupled to the energy cycle in terms of phase changes of water (changes among liquid, water vapor, and solid phases) and transport of water by winds in addition to gravity and diffusion processes. The water-cycle components can be observed with in situ sensors as well as airborne and satellite sensors in terms of radiative quantities. Processing and conversion of these radiative signals are necessary to retrieve the water-cycle components.

  3. 49 CFR 214.505 - Required environmental control and protection systems for new on-track roadway maintenance...

    Science.gov (United States)

    2010-10-01

    ... operative positive pressurized ventilation systems: (1) Ballast regulators; (2) Tampers; (3) Mechanical... or sold. (e) If the ventilation system on a new on-track roadway maintenance machine or a designated... respiratory protective equipment shall be provided for each such employee until the machine is repaired in...

  4. Precision and within- and between-day variation of bioimpedance parameters in children aged 2-14 years

    DEFF Research Database (Denmark)

    Andersen, Trine B; Jødal, Lars; Arveschoug, Anne

    2011-01-01

    BACKGROUND & AIMS: Bioimpedance spectroscopy (BIS) offers the possibility to perform rapid estimates of fluid distribution and body composition. Few studies, however, have addressed the precision and biological variation in a pediatric population. Our objectives were to evaluate precision.......4-14.9 years) had one series measured on day one (precision population). Forty-four children had a second series on day one (within-day sub-population). Thirty-two children had a series measured on the next day (between-day sub-population). Each measurement series consisted of three repeated measurements....... A linear mixed model was used for statistical analysis. RESULTS: The precision was 0.3-0.8% in children ≥6 years and 0.5-2.4% in children...

  5. Consequences of a radioactive surface pool resulting from waste transfer operations between tanks 214-C-106 and 241-AY-102

    International Nuclear Information System (INIS)

    Van Vleet, R.J.

    1997-01-01

    This document contains supporting calculations for quantifying the dose consequences from a pool formed from an underground leak or a-leak from an above grade structure for the Waste Retrieval Sluicing System (Project W-320), i.e., sluicing the contents of Tank 241-C-106 (high heat, SST) into Tank 241-AY-102 (aging waste, DST)

  6. 19 CFR 351.214 - New shipper reviews under section 751(a)(2)(B) of the Act.

    Science.gov (United States)

    2010-04-01

    ... procedures for conducting such reviews. (b) Request for new shipper review—(1) Requirement of sale or export... notice of initiation of the requested review. (2) Absence of entry and sale to an unaffiliated customer...; and (ii) An expansion of the normal period of review to include an entry and sale to an unaffiliated...

  7. MTLRP genetic polymorphism (214C>A) was associated with Type 2 diabetes in Caucasian population: a meta-analysis

    OpenAIRE

    Chen, Li-Li; Han, Song-Mei; Tang, Fei-Fei; Li, Qiang

    2014-01-01

    Background Previous studies reported the relation between MTLRP genetic polymorphism and type 2 diabetes, however, the conclusion were conflicting. In the present study, we performed a meta-analysis to reveal this association. Methods Literature retrieval, selection and assessment, data extraction, and meta-analyses were performed according to the RevMan 5.0 guidelines. In the meta-analysis, we utilized random-effect model or fixed-effect model to pool the Odds ratio (OR) according to the tes...

  8. 8 CFR 214.6 - Citizens of Canada or Mexico seeking temporary entry under NAFTA to engage in business activities...

    Science.gov (United States)

    2010-01-01

    ... has professional level status; and (E) The arrangements for remuneration for services to be rendered... remuneration for services. Employment with a different or with an additional employer is not authorized prior... informs the Director of USCIS that a strike or other labor dispute involving a work stoppage of workers is...

  9. Oahu Photomosaic 2000 (213-214e-0516) - Orthorectification and Mosaicing of Color Aerial Photography Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Habitat maps of the main Hawaiian Islands were created by visual interpretation of aerial photos and hyperspectral imagery using the Habitat Digitizer extension....

  10. Oahu Photomosaic 2000 (213-214w-0516) - Orthorectification and Mosaicing of Color Aerial Photography Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Habitat maps of the main Hawaiian Islands were created by visual interpretation of aerial photos and hyperspectral imagery using the Habitat Digitizer extension....

  11. Human metabolism of [1-methyl-14C]- and [2-14C]caffeine after oral administration

    International Nuclear Information System (INIS)

    Callahan, M.M.; Robertson, R.S.; Arnaud, M.J.; Branfman, A.R.; McComish, M.F.; Yesair, D.W.

    1982-01-01

    Radiolabeled caffeine was administered orally at 5 mg/kg to adult, male volunteers. Blood, saliva, expired CO2, urine, and feces were collected and analyzed for total radiolabeled equivalents, caffeine, and its metabolites. High-performance liquid chromatography (HPLC) was the principal technique used to separate caffeine and the various metabolites with quantitation by liquid-scintillation counting. The half-life of caffeine in both serum and saliva was approximately 3 hr, with the concentration of caffeine in the saliva samples ranging from 65 to 85% of that found in the serum samples. The major metabolites found in serum and saliva were the dimethylxanthines. In the course of separating the urinary metabolites, our HPLC system partially resolved two unidentified polar metabolites arising from radiolabeled caffeine. The major component corresponded to 5-acetylamino-6-amino-3-methyluracil and in our subjects ranged from 7 to 35% of the administered dose. The other principal urinary metabolites were 1-methylxanthine at approximately 18% of the administered dose and 1-methyluric acid at 15%. The fecal samples contained approximately 5% of the dose, mainly as uric acid compounds which retained the 1-methyl group. In this study we accounted for approximately 90% of the administered radiolabeled dose and identified greater than 95% of the urinary radioactivity as specific metabolites

  12. Energy Insecurity in South America: Network Development and Sectoral Integration in Chile and Peru - CERI Studies No. 214

    International Nuclear Information System (INIS)

    Artigas, Alvaro

    2015-10-01

    The South American continent has experienced a robust economic growth presently overshadowed by an uneven energy integration that fails to meet both an ever-growing industrial and metropolitan demand. Several integration mechanisms co-exist, but a poor integration layout threatens the energy security of the region and individual countries. Several factors contribute to this. Firstly, the very template of regional integration has failed to deliver a valid set of supranational coordination mechanisms aimed at coordinating and sorting out disputes among individual countries. Secondly, national States tie security to self-sufficiency in the face of mutual distrust, thus rendering potential advantages of market and networks integration a less desirable choice. The example of Chile and Peru integration drive reveals many of these dynamics while showing at the same time the windfalls of a transversal sectoral coordination over diplomatic exchange by individual states. What is the potential for an alternative template where the State will play a less intrusive role while consigning territorial disagreements backstage? (author)

  13. Structural, electronic, and magnetic properties of Y(n)O (n=2-14) clusters: Density functional study.

    Science.gov (United States)

    Yang, Zhi; Xiong, Shi-Jie

    2008-09-28

    The geometries stability, electronic properties, and magnetism of Y(n)O clusters up to n=14 are systematically studied with density functional theory. In the lowest-energy structures of Y(n)O clusters, the equilibrium site of the oxygen atom gradually moves from an outer site of the cluster, via a surface site, and finally, to an interior site as the number of the Y atoms increases from 2 to 14. Starting from n=12, the O atom falls into the center of the cluster with the Y atoms forming the outer frame. The results show that clusters with n=2, 4, 8, and 12 are more stable than their respective neighbors, and that the total magnetic moments of Y(n)O clusters are all quite small except Y(12)O cluster. The lowest-energy structure of Y(12)O cluster is a perfect icosahedron with a large magnetic moment 6mu(B). In addition, we find that the total magnetic moments are quenched for n=2, 6, and 8 due to the closed-shell electronic configuration. The calculated ionization potentials and electron affinities are in good agreement with the experimental results, which imply that the present theoretical treatments are satisfactory.

  14. 76 FR 56362 - Removal of Approved Non-U.S.-Licensed Space Stations From the Section 214 Exclusion List

    Science.gov (United States)

    2011-09-13

    ...'s web page, the Bureau plans to insert a link entitled Space Stations Approved for U.S. Market Access. Once users click on that link, they will be taken to a page with that same title that provides... pursuant to the DISCO II procedures. The web page will include links to other lists already maintained for...

  15. Labelling of the thymidine and deoxyctidine bases of DNA by (2-14C) deoxycytidine in cultured L1210 cells

    International Nuclear Information System (INIS)

    Karle, J.M.; Hoeraut, R.M.; Cysyk, R.L.

    1983-01-01

    Exposure of cultured L1210 cells to (2- 14 C) deoxycytidine and analysis of radioactivity incorporated into DNA-pyrimidines revealed that 2.7-5.5-fold more radioactivity is incorporated into DNA-thymine than into cytosine bases. Thus, the pathway involving deamination of deoxycytidylate to deoxyuridylate and methylation to thymidylate is highly favoured over successive phosphorlation to dCTP. Several modified and endogenous pyrimidines altered the labelling of DNA-thymine and DNA-cytosine with (2- 14 C)-deoxycytidine. 3-deazauridine at 0.1 mM caused a 56% increase in the labelling of DNA-thymine. Both thymidine and 3-deazauridine (>=10 μM) increased the specific activity to DNA-cytosine by 4-fold. Cytosine arabinoside (ara-C) (>= 10 μM) reduced the labelling of both DNA-cytosine and DNA-thymine. Excess cytidine (0.1 mM) reduced the labelling of DNA-cytosine by 40%. Tetrahydrouridine at concentrations up to 1 mM had no effect. (author)

  16. 75 FR 66828 - Eleventh Meeting: RTCA Special Committee 214: Working Group 78: Standards for Air Traffic Data...

    Science.gov (United States)

    2010-10-29

    .... Now TORS(OCL/DSC, update ED 154/Doxxx, * * *). Outcome FRAC/consultation DO306/ED 122 and Publication... TORs and Work Plan. Review of Position Papers and Contributions. 13:30-17:00: Plenary Session.... Robert L. Bostiga, RTCA Advisory Committee. [FR Doc. 2010-27260 Filed 10-28-10; 8:45 am] BILLING CODE...

  17. 8 CFR 214.12 - Preliminary enrollment of schools in the Student and Exchange Visitor Information System (SEVIS).

    Science.gov (United States)

    2010-01-01

    ... of schools in the Student and Exchange Visitor Information System (SEVIS). (a) Private elementary and private secondary schools, public high schools, post-secondary schools, language schools, and vocational... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Preliminary enrollment of schools in the...

  18. Fast Facts: Recent Statistics from the Library Research Service, Nos. 214-224. February 11-March 31, 2005

    Science.gov (United States)

    Steffen, Nicolle Olivia; Lance, Keith Curry; Lietzau, Zeth; Dickenson, Don

    2005-01-01

    Eleven issues of "Fast Facts" from the Library Research Service cover information from libraries across Colorado. These issues focus on topics from the public, academic, and school sectors. These topics include patron use of AskColorado (a statewide virtual reference service) and the rising use of online services. The "Fast…

  19. Mathematical description for the stress-strain behavior of annealed 21/4 Cr--1 Mo steel

    International Nuclear Information System (INIS)

    Klueh, R.L.; Hebble, T.L.

    1976-01-01

    We have conducted a detailed series of tensile tests on one heat of annealed 2 1 / 4 Cr-1 Mo steel over the range 25 to 593 0 C (75 to 1100 0 F) and at nominal strain rates of 0.4, 0.04, 0.004, and 0.0004/min. To determine an empirical relationship to represent the flow behavior, we fitted the true-stress true-strain data from these tests to several proposed models. The models fit were those proposed by Holloman, Ludwik, Ludwigson, and Voce. From a comparison of the standard error of estimate, the Voce equation was concluded to be the best mathematical description of the data under most test conditions and the best single representation over the wide range of test conditions

  20. 77 FR 29750 - Fifteenth Meeting: RTCA Special Committee 214, Joint With EUROCAE WG-78, Standards for Air...

    Science.gov (United States)

    2012-05-18

    ....int no later than May 21, 2012 with the following security information: Last Name/ First name, Organization, ID or Passport number, Details for visiting the Maastricht centre, hotels and how to get here can... , (for hotels please note that the hotel ``Tulip Inn Maastricht Airport'' is next to the runway and the...

  1. Philippe Lejeune, Catherine Bogaert: Historia pewnej praktyki „Uri journal à soi" (Paris 2003, Ed. Textuel, s. 214, album

    Directory of Open Access Journals (Sweden)

    Regina Lubas-Bartoszyńska

    2007-06-01

    Full Text Available This article discusses the content of an album of P. Lejeune and C. Bogaert, published in Paris in last year (in 2003, dedicated to a personal diary. The fact of bringing out of this publication became for the author of this article an impulse to present an anthropological view at the form of diary. The author - taking an opportunity of presenting the content of the album - gives an outline of the tradition of the genre, discusses various criteria (geographical, historical, sociological which have an influence on the development and formation of this literary form. The author also draws attention to the significant features of a personal diary (the ones which differ it from, e.g. autobiography and its kinds (from the purest form of a personal, intimate diary through the diary-letter written by one to him/herself to some unconvetional diaries such as: a painter's diary, diary-comic-strip, film diary, diary-photograph, on line diary - blog. While also pointing to such forms as: spiritual diaries, journey diaries, log books, and historical chronicles, the author emphasises the necessity of relating the origin of the diary with a concrete situation of men.

  2. Synthesis of [14C]-62514, a radiolabelled derivative of erythromycin A, via [2-14C]N,N-dimethylethylenediamine

    International Nuclear Information System (INIS)

    Surber, B.W.; Baker, W.R.; Seif, L.

    1991-01-01

    The synthesis of [ 14 C]A-62514, 11-deoxy-11[carboxy(2-dimethylamino-[1- 14 C]ethyl)amino]-6-0-methyl-e rythromycin A 11,12-(cyclic ester), was performed in five steps. The key intermediate, [2- 14 C]N,N-dimethylethyl-enediamine, was obtained in 80% yield by reacting Eschenmoser's salt with K 14 CN and reducing the resulting [1- 14 C]N,N-dimethylglycinonitrile with H 2 and Raney Ni in methanol and ammonium hydroxide. The final product was obtained 97% radiochemically pure in an overall radiochemical yield of 14%, with a specific activity of 39 mCi/mmol. (author)

  3. 29 CFR 778.214 - Benefit plans; including profit-sharing plans or trusts providing similar benefits.

    Science.gov (United States)

    2010-07-01

    ... fide plan for providing old age, retirement, life, accident, or health insurance or similar benefits... employee on account of severance of employment (or for any other reason) would not result in any increase... mechanics performing contract work subject to the Davis-Bacon Act and related statutes, the provisions of...

  4. 8 CFR 214.7 - Habitual residence in the territories and possessions of the United States and consequences thereof.

    Science.gov (United States)

    2010-01-01

    ... funds that meet or exceed 100 percent of the official poverty guidelines for Hawaii for a family unit of... Balanced Budget Act of 1997, Public Law 105-33, 111 Stat. 638. 639. (b) Where do these rules regarding...

  5. Macro-Environmental Mapping of International Branch Campus Activities of Universities Worldwide. Research & Occasional Paper Series: CSHE.2.14

    Science.gov (United States)

    Kosmützky, Anna; Krücken, Georg

    2014-01-01

    The paper provides an initial international comparative empirical assessment of international branch campuses (IBCs) worldwide. Building on neo-institutional theory and organizational ecology, it sheds light on the new organizational form by analyzing their founding age of the home university and IBC mortality. Furthermore the paper analyzes the…

  6. SU-F-J-214: Dose Reduction by Spatially Optimized Image Quality Via Fluence Modulated Proton CT (FMpCT)

    Energy Technology Data Exchange (ETDEWEB)

    De Angelis, L; Landry, G; Dedes, G; Parodi, K [Ludwig-Maximilians-Universitaet Muenchen (LMU Munich), Garching b. Muenchen (Germany); Hansen, D [Aarhus University Hospital, Aarhus, Jutland (Denmark); Rit, S [University Lyon, Lyon, Auvergne-Rhone-Alpes (France); Belka, C [LMU Munich, Munich (Germany)

    2016-06-15

    Purpose: Proton CT (pCT) is a promising imaging modality for reducing range uncertainty in image-guided proton therapy. Range uncertainties partially originate from X-ray CT number conversion to stopping power ratio (SPR) and are limiting the exploitation of the full potential of proton therapy. In this study we explore the concept of spatially dependent fluence modulated proton CT (FMpCT), for achieving optimal image quality in a clinical region of interest (ROI), while reducing significantly the imaging dose to the patient. Methods: The study was based on simulated ideal pCT using pencil beam (PB) scanning. A set of 250 MeV protons PBs was used to create 360 projections of a cylindrical water phantom and a head and neck cancer patient. The tomographic images were reconstructed using a filtered backprojection (FBP) as well as an iterative algorithm (ITR). Different fluence modulation levels were investigated and their impact on the image was quantified in terms of SPR accuracy as well as noise within and outside selected ROIs, as a function of imaging dose. The unmodulated image served as reference. Results: Both FBP reconstruction and ITR without total variation (TV) yielded image quality in the ROIs similar to the reference images, for modulation down to 0.1 of the full proton fluence. The average dose was reduced by 75% for the water phantom and by 40% for the patient. FMpCT does not improve the noise for ITR with TV and modulation 0.1. Conclusion: This is the first work proposing and investigating FMpCT for producing optimal image quality for treatment planning and image guidance, while simultaneously reducing imaging dose. Future work will address spatial resolution effects and the impact of FMpCT on the quality of proton treatment plans for a prototype pCT scanner capable of list mode data acquisition. Acknowledgement: DFG-MAP DFG - Munich-Centre for Advanced Photonics (MAP)

  7. 9 CFR 205.214 - Litigation as to whether a system is operating in compliance with the Section.

    Science.gov (United States)

    2010-01-01

    ... as to whether a system is operating in compliance with the Section. (a) The requirements for a system... certification, is operating in compliance, thus whether it is a “central filing system” as defined, could be... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Litigation as to whether a system is...

  8. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    International Nuclear Information System (INIS)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons

  9. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  10. Negative Ion Source Development and Photodetachment Studies at ISOLDE

    CERN Document Server

    AUTHOR|(CDS)2254068; Hanstorp, Dag; Rothe, Sebastian

    Astatine is one of the rarest elements on earth. The small amount of existing astatine is either created in decay chains of heavier elements or artificially. One of its longer lived isotopes, 211At, is of interest for targeted alpha therapy, a method of treating cancer by using the alpha decay of radioactive elements directly at the location of a tumor. However, its chemical properties are yet to be determined due to the short life time of astatine. A milestone towards the determination of the electronegativity of astatine was the measurement of its ionization potential (IP) at CERN-ISOLDE. However, its electron affinity (EA, the binding energy of the additional electron in a negative ion), is still to be measured. In order to determine the EA of radioisotopes by laser photodetachment spectroscopy, the Gothenburg ANion Detector for Affinity measurements by Laser Photodetachment (GANDALPH) has been built in recent years. As a proof-of-principle, the EA of the 128I negative ion, produced at the CERN-ISOLDE rad...

  11. An Expert System for Managing Storage Space Constraints Aboard United States Naval Vessels

    Science.gov (United States)

    1991-12-01

    d. solvents, thinners, primers, cmpounds, varnishes , and lacquers i e. alcohol, acetone, ether, and naphtha; f. greases * nd pastes Except for...suffocation. Malocarbon liquids are compounds of carbon containing any of the halogen elements ( fluorine , chlorine, bromine, iodine, or astatine. (Examples are

  12. Workshop on selected aspects of radiochemistry

    International Nuclear Information System (INIS)

    1991-11-01

    The aspects chosen for the workshop are: isotope preparation, separation methods; radiochemical methods and analyses; environmental protection and radiochemistry; the chemistry of the fifth halogen, astatine. From the 28 contributions presented at the workshop, 24 are of relevance in the INIS and EDB scope and are separately retrievable from the database. (BBR) [de

  13. Development and therapeutic application of internally emitting radiopharmaceuticals

    International Nuclear Information System (INIS)

    Adelstein, S.J.; Bloomer, W.D.

    1980-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Among the available α-emitters, astatine-211 appears most promising for testing the efficacy of α-emitters for therapeutic applications because: (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides; (2) it has a half life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells; and (3) α-emission is associated with 100% of its decays. If appropriate biological carriers can be labeled with an alpha emitter such as 211 At, they could be of great utility in several areas of therapeutic medicine where elimination of specific cell populations is desired. While previous attempts to astatinate proteins using standard iodination techniques have been unsuccessful, effective labeling of proteins with astatine by first synthesizing an aryl astatide and then coupling this compound to the protein via an acylation has been achieved. Undergoing current investigation are several different aryl astatide-followed-by-acylation approaches including an astatinated Bolton-Hunter type reagent using concanavalin A (ConA) and melanocyte stimulating hormone (MSH) as model compounds

  14. Creep-Rupture Properties and Corrosion Behaviour of 21/4 Cr-1 Mo Steel and Hastelloy X-Alloys in Simulated HTGR Environment

    DEFF Research Database (Denmark)

    Lystrup, Aage; Rittenhouse, P. L.; DiStefano, J. R.

    Hastelloy X and 2/sup 1///sub 4/ Cr-1 Mo steel are being considered as structural alloys for components of a High-Temperature Gas-Cooled Reactor (HTGR) system. Among other mechanical properties, the creep behavior of these materials in HTGR primary coolant helium must be established to form part...

  15. Topographic Map of Quadrangles 3666 and 3766, Balkh (219), Mazar-I-Sharif (220), Qarqin (213), and Hazara Toghai (214) Quadrangles, Afghanistan

    Science.gov (United States)

    Bohannon, Robert G.

    2006-01-01

    This map was produced from several larger digital datasets. Topography was derived from Shuttle Radar Topography Mission (SRTM) 85-meter digital data. Gaps in the original dataset were filled with data digitized from contours on 1:200,000-scale Soviet General Staff Sheets (1978-1997). Contours were generated by cubic convolution averaged over four pixels using TNTmips surface-modeling capabilities. Minor artifacts resulting from the auto-contouring technique are present. Streams were auto-generated from the SRTM data in TNTmips as flow paths. Flow paths were limited in number by their Horton value on a quadrangle-by-quadrangle basis. Peak elevations were averaged over an area measuring 85 m by 85 m (represented by one pixel), and they are slightly lower than the highest corresponding point on the ground. Cultural data were extracted from files downloaded from the Afghanistan Information Management Service (AIMS) Web site (http://www.aims.org.af). The AIMS files were originally derived from maps produced by the Afghanistan Geodesy and Cartography Head Office (AGCHO). Because cultural features were not derived from the SRTM base, they do not match it precisely. Province boundaries are not exactly located. This map is part of a series that includes a geologic map, a topographic map, a Landsat natural-color-image map, and a Landsat false-color-image map for the USGS/AGS (Afghan Geological Survey) quadrangles covering Afghanistan. The maps for any given quadrangle have the same open-file number but a different letter suffix, namely, -A, -B, -C, and -D for the geologic, topographic, Landsat natural-color, and Landsat false-color maps, respectively. The open-file report (OFR) numbers for each quadrangle range in sequence from 1092 - 1123. The present map series is to be followed by a second series, in which the geology is reinterpreted on the basis of analysis of remote-sensing data, limited fieldwork, and library research. The second series is to be produced by the USGS in cooperation with the AGS and AGCHO.

  16. Metabolic patterns of 14C incorporation by selected vascular plants following field incubations with acetate-2-14C in two plant successional stages in Glacier Bay, Alaska

    International Nuclear Information System (INIS)

    Wu, Pei-Hsing Lin

    1975-01-01

    Metabolic patterns of some vascular plants (Dryas sp., Vaccinium sp., Salix sp., Alnus sp., Epilobium sp.), occurring in successional habitats, following acetate-2- 14 C incubations in the field were demonstrated for the first time. Relative radioactivity within the alcoholic soluble fraction of each species reflects its distribution in successional communities. A high level of 14 C-sugars was present in the plants of the pioneer community; on the other hand a high level of 14 C-organic acids was present in the plants of the forest community. Three patterns, based on the relative activities of the sugar- and organic acid-pools were noted which correspond to the range and the frequency of occurrence of each species in the successional stages. Only two types of 14 C-amino acid levels were noted corresponding to the range of distribution. Plants having less than 10% relative radioactivity in amino acid-pools had a limited range of distribution and reside in only one habitat; plants having more than 10% radioactivity showed wider ranges of distribution occurring in at least two habitats. (auth.)

  17. Reseña: Prevenir la exclusión social. Bellver Moreno, Mª C. (2013. Valencia: Tirant lo Blanch. 214 pp.

    Directory of Open Access Journals (Sweden)

    María Julia Diz López

    2014-12-01

    Full Text Available La autora en esta obra profundiza en distintos ámbitos de la intervención socioeducativa desde una perspectiva proactiva: prevención del consumo de drogas en el ámbito familiar y escolar, prevención de la violencia escolar y familiar, actuación sobre menores en riesgo de exclusión social.

  18. Fracture toughness of neutron irradiated solid and powder HIP 316L(N). ITER Task 214, NET deliverable GB6 ECN-5

    International Nuclear Information System (INIS)

    Rensman, J.; Van den Broek, F.P.; Jong, M.; Van Osch, E.V.

    1998-04-01

    The fracture toughness properties of unirradiated and neutron irradiated type 316L(N) stainless steel plate (European Reference Heat ERHII), conventional 316L(N) solid HIP joints (heat PM-130), and 316L(N)-1G powder HIP material have been measured. Compact tension specimens with a thickness of 12 and 5 mm were irradiated in the High Flux Reactor (HFR) in Petten, The Netherlands, simulating the fusion reactor's first wall conditions by a combination of high displacement damage with proportional amounts of helium. The solid HIP (or HIP-bonded) CT-specimens were irradiated in two separate experiments: SIWAS-6 with 1.3 to 2.3 dpa (1.7 dpa av.) at 353 K, and CHARIOT-3 with 2.7 to 3.1 dpa (2.9 dpa av.) at 600 K. The plate material and powder HIP CT-specimens were irradiated in one experiment only, SIWAS-6. The helium content is up to 20 appm for the 2.9 dpa (av.) dose level. Testing temperatures of 353K and 573K have been used for the fracture toughness experiments. The report contains the experimental conditions and summarises the results, which are given in terms of J-resistance curve fits. The main conclusions are that all three materials have very high toughness in the unirradiated state with little difference between them; the solid HIP has the highest toughness, the powder HIP lowest. The toughness of all three materials is reduced significantly by irradiation, the reduction is the least for the plate material and the highest for the powder HIP material. However, many, but not all, of the solid HIP CT specimens showed debonding of the joint during testing. The machined notch of the CT specimens was not exactly on the joint interface, which could lead to unjustified interpretation of the measured values as being the toughness of the joint, the toughness of the joint being probably much lower. The reduction by irradiation of the fracture toughness of the powder HIP material is clearly larger than for plate material, which is confirmed by the observed early initiation of stable crack extension. As these fracture toughness measurements have been obtained by using CT specimens with a thickness of 12 and 5 mm, and as unirradiated austenitic stainless steel has a very high toughness, the values presented do in general not qualify as a size independent material property, but can be used as valid data for constructions with thicknesses of respectively 12 and 5 mm. 12 refs

  19. Low cycle fatigue properties of neutron irradiated solid HIP 316L(N). ITER Task T214, NET deliverable GB6 ECN-5

    International Nuclear Information System (INIS)

    Rensman, J.; Van Osch, E.V.; Tjoa, G.L.; Boskeljon, J.; Van Hoepen, J.

    1998-05-01

    The Low Cycle Fatigue (LCF) properties of neutron irradiated Hot Isostatically Pressed (HIP) joints of type 316L(N) stainless steel (heat PM-130) have been measured, as well as the LCF properties of reference 316L(N)-ERHII. Cylindrical LCF test specimens of 3 mm diameter were irradiated in the High Flux Reactor (HFR) in Petten, The Netherlands, simulating the first wall conditions of future fusion reactors by a combination of high displacement damage with proportional amounts of helium. The solid HIP specimens were irradiated up to a target dose level of 5 dpa at a temperature of 550K. The damage levels realised range from 3.0 to 4.4 dpa, with helium contents up to 41 appm. Testing temperature was equal to the irradiation temperature: 550K. The report contains the experimental conditions and summarises the results, which are given in terms of first cycle stress, the peak stress, the number of cycles where the peak stress is reached, the stress at half life and the plastic strain at half life, and the total number of cycles to failure, N f . The main conclusions are that the unirradiated solid-HIP materials has the same LCF properties as unirradiated 316L(N)-ERHII plate material. The neutron irradiation induces both hardening and reduction of fatigue life. The bond does not seem to have any effect on the fatigue properties for the unirradiated solid HIP 316L(N), whereas a combined effect of irradiation and the bond cannot be established. No failures related to debonding of the joint were observed for the tests. 7 refs

  20. Tensile properties of neutron irradiated solid HIP 316L(N). ITER Task T214, NET deliverable GB6 ECN-5

    International Nuclear Information System (INIS)

    Van Osch, E.V.; Tjoa, G.L.; Boskeljon, J.; Van Hoepen, J.

    1998-05-01

    The tensile properties of neutron irradiated Hot Isostatically Pressed (HIP) joints of type 316L(N) stainless steel (heat PM-130) have been measured. Cylindrical tensile test specimens of 4 mm diameter were irradiated in the High Flux Reactor (HFR) in Petten, The Netherlands, simulating the first wall conditions by a combination of high displacement damage with proportional amounts of helium. The solid HIP specimens were irradiated up to a target dose level of 5 dpa at a temperature of 550K. The damage levels realized range from 3.0 to 4.1 dpa, with helium contents up to 38 appm. Post irradiation testing temperatures ranged from 300 to 700K. The report contains the experimental conditions and summarises the results, which are given in terms of engineering stresses and strains and reduction of area. The main conclusions are that the unirradiated solid-HIP material is very soft, assumingly due to the relatively large grain size. Neutron irradiation induces both hardening and reduction of ductility, similar to the behaviour of 316L(N) plate. No failures related to debonding were observed for the tests of the unirradiated samples, however one of eight tested irradiated specimens fractured in the HIP joint, showing a flat fracture surface and a low reduction of area. 6 refs

  1. Manpower development for safe operation of nuclear power plant. China. Simulator training for instructions. Activity: 2.1.4-Task-16. Technical report

    International Nuclear Information System (INIS)

    Han, Dong Hyun; Song, Suk Ill.

    1996-01-01

    By the request of the Qinshan Nuclear Power training center, Korea Electric Power Company (KEPCO) expert team visited the Qinshan Nuclear Power Training Center during October 7-21, 1996. The purpose of the visiting was as follows: To give some ideas, through KEPCO KNTC training experiences about operator training programme including simulator training - how to improve simulator instructors' training skill and knowledge; how to conduct classroom and simulator lectures; how to prepare lesson note for lectures; how to make the trainees evaluation; how to course analyze and feed back; how to make scenario for simulator training. To fulfill above purposes, the expert team used KNTC procedures, 1996 KNTC training plan, development and qualification for instructor, simulator training and evaluation, control and preparedness of lesson notes. These procedures were used only to establish the framework for Qinshan nuclear training center's procedures

  2. SU-E-J-214: Comparative Assessment On IGRT On Partial Bladder Cancer Treatment Between CT-On-Rails (CTOR) and KV Cone Beam CT (CBCT)

    International Nuclear Information System (INIS)

    Lin, T; Ma, C

    2014-01-01

    Purpose: Image-Guided radiation therapy(IGRT) depends on reliable online patient-specific anatomy information to address random and progressive anatomy changes. Large margins have been suggested to bladder cancer treatment due to large daily bladder anatomy variation. KV Cone beam CT(CBCT) has been used in IGRT localization prevalently; however, its lack of soft tissue contrast makes clinicians hesitate to perform daily soft tissue alignment with CBCT for partial bladder cancer treatment. This study compares the localization uncertainties of bladder cancer IGRT using CTon- Rails(CTOR) and CBCT. Methods: Three T2N0M0 bladder cancer patients (total of 66 Gy to partial bladder alone) were localized daily with either CTOR or CBCT for their entire treatment course. A total of 71 sets of CTOR and 22 sets of CBCT images were acquired and registered with original planning CT scans by radiation therapists and approved by radiation oncologists for the daily treatment. CTOR scanning entailed 2mm slice thickness, 0.98mm axial voxel size, 120kVp and 240mAs. CBCT used a half fan pelvis protocol from Varian OBI system with 2mm slice thickness, 0.98axial voxel size, 125kVp, and 680mAs. Daily localization distribution was compared. Accuracy of CTOR and CBCT on partial bladder alignment was also evaluated by comparing bladder PTV coverage. Results: 1cm all around PTV margins were used in every patient except target superior limit margin to 0mm due to bowel constraint. Daily shifts on CTOR averaged to 0.48, 0.24, 0.19 mms(SI,Lat,AP directions); CBCT averaged to 0.43, 0.09, 0.19 mms(SI,Lat,AP directions). The CTOR daily localization showed superior results of V100% of PTV(102% CTOR vs. 89% CBCT) and bowel(Dmax 69.5Gy vs. 78Gy CBCT). CTOR images showed much higher contrast on bladder PTV alignment. Conclusion: CTOR daily localization for IGRT is more dosimetrically beneficial for partial bladder cancer treatment than kV CBCT localization and provided better soft tissue PTV identification

  3. A data base and analysis program for shuttle main engine dynamic pressure measurements. Appendix C: Data base plots for SSME tests 902-214 through 902-314

    Science.gov (United States)

    Coffin, T.

    1986-01-01

    A dynamic pressure data base and data base management system developed to characterize the Space Shuttle Main Engine (SSME) dynamic pressure environment is reported. The data base represents dynamic pressure measurements obtained during single engine hot firing tests of the SSME. Software is provided to permit statistical evaluation of selected measurements under specified operating conditions. An interpolation scheme is included to estimate spectral trends with SSME power level. Flow Dynamic Environments in High Performance Rocket Engines are described.

  4. The use of hydroxy-DL-proline-2-14C in the investigation of hydroxyproline metabolism in normal subjects and in patients with renal insufficiency

    International Nuclear Information System (INIS)

    Hart, W.; Sluys Veer, J. van der

    1976-01-01

    The metabolism of hydroxproline was investigated in six healthy subjects and four patients with chronic renal insufficiency (creatinine clearances respectively 40, 10, 7, 2.5 ml/min). For this purpose, hydroxy-DL-proline-2- 14 C was administered intravenously and the excretion patterns of radio-activity in plasma, urine and expired air ( 14 CO 2 ) were determined. A separation procedure (using thin layer chromatography followed by oxidation with D-animo acid oxidase) made it possible to determine the concentration of hydroxy-L-proline-2- 14 C in the presence of the D-isomer and the degradation products of both. Although the use of a racemic mixture as tracer made conclusions more difficult, it could be shown that in uremic patients the concentration of hydroxy-DL-proline-2 14 C remained high in the blood for a longer period, the metabolites appeared in the urine later, and the peak respiratory 14 CO 2 excretion was reached later and was lower than in the healthy subjects. On this basis it was concluded that the metabolism of hydroxyproline is diminished in patients with renal insufficiency

  5. A homozygous nonsense mutation (c.214C->A) in the biliverdin reductase alpha gene (BLVRA) results in accumulation of biliverdin during episodes of cholestasis

    DEFF Research Database (Denmark)

    Nytofte, Nikolaj S; Serrano, Maria A; Monte, Maria J

    2011-01-01

    Green jaundice is a rare finding usually associated with end-stage liver disease. OBJECTIVE The authors investigated two unrelated Inuit women from different geographical areas in Greenland who had episodes of green jaundice associated with biliary obstruction.......Green jaundice is a rare finding usually associated with end-stage liver disease. OBJECTIVE The authors investigated two unrelated Inuit women from different geographical areas in Greenland who had episodes of green jaundice associated with biliary obstruction....

  6. SU-E-J-214: MR Protocol Development to Visualize Sirius MRI Markers in Prostate Brachytherapy Patients for MR-Based Post-Implant Dosimetry

    Energy Technology Data Exchange (ETDEWEB)

    Lim, T; Wang, J; Frank, S; Stafford, R; Bruno, T; Bathala, T; Mahmood, U; Pugh, T; Ibbott, G; Kudchadker, R [UT MD Anderson Cancer Center, Houston, TX (United States)

    2015-06-15

    Purpose: The current CT-based post-implant dosimetry allows precise seed localization but limited anatomical delineation. Switching to MR-based post-implant dosimetry is confounded by imprecise seed localization. One approach is to place positive-contrast markers (Sirius) adjacent to the negative-contrast seeds. This patient study aims to assess the utility of a 3D fast spoiled gradient-recalled echo (FSPGR) sequence to visualize Sirius markers for post-implant dosimetry. Methods: MRI images were acquired in prostate implant patients (n=10) on Day 0 (day-of-implant) and Day 30. The post-implant MR protocol consisted of 3D T2-weighted fast-spin-echo (FSE), T2-weighted 2D-FSE (axial) and T1-weighted 2D-FSE (axial/sagittal/coronal). We incorporated a 3D-FSPGR sequence into the post-implant MR protocol to visualize the Sirius markers. Patients were scanned with different number-of-excitations (6, 8, 10), field-of-view (10cm, 14cm, 18cm), slice thickness (1mm, 0.8mm), flip angle (14 degrees, 20 degrees), bandwidth (122.070 Hz/pixel, 325.508 Hz/pixel, 390.625 Hz/pixel), phase encoding steps (160, 192, 224, 256), frequency-encoding direction (right/left, anterior/posterior), echo-time type (minimum-full, out-of-phase), field strength (1.5T, 3T), contrast (with, without), scanner vendor (Siemens, GE), coil (endorectal-coil only, endorectal-and-torso-coil, torsocoil only), endorectal-coil filling (30cc, 50cc) and endorectal-coil filling type (air, perfluorocarbon [PFC]). For post-implant dosimetric evaluation with greater anatomical detail, 3D-FSE images were fused with 3D-FSPGR images. For comparison with CT-based post-implant dosimetry, CT images were fused with 3D-FSPGR images. Results: The 3D-FSPGR sequence facilitated visualization of markers in patients. Marker visualization helped distinguish signal voids as seeds versus needle tracks for more definitive MR-based post-implant dosimetry. On the CT-MR fused images, the distance between the seed on CT to MR images was 3.2±1.6mm in patients with no endorectal coil, 2.3±0.8mm in patients with 30cc-PFC-filled endorectal-coil and 5.0±1.8mm in patients with 50cc-PFC-filled endorectal-coil. Conclusion: An MR protocol to visualize positive-contrast Sirius markers to assist in the identification of negative-contrast seeds was demonstrated. S Frank is a co-founder of C4 Imaging LLC, the manufacturer of the MRI markers.

  7. SU-F-T-214: Re-Thinking the Useful Clinical Beam Energy in Proton Therapy: An Opportunity for Cost Reduction

    Energy Technology Data Exchange (ETDEWEB)

    Bentefour, El H [IBA, Advanced Technology Group, Louvain La Neuve (Belgium); Lu, H [Massachusetts General Hospital and Harvard Medical School, Boston, MA (United States)

    2016-06-15

    Purpose: We conducted a retrospective study of the useful clinical proton beam energy based on the beam range data of patients treated over the last 10 years at Massachusetts General Hospital Proton Therapy Center. Methods: Treatment field information were collected for all patients treated over the last 10 years (2005–2015) in the two gantry treatment rooms at MGH. The beam ranges for these fields were retrieved and categorized per treatment site. The 10 prostate patients that required the highest beam range (lateral fields) were selected. For these patients, anterior oblique beams (30–40 degrees) were simulated in a planning system to obtain the required beam ranges including the margins for potential range uncertainties. Results: There were a total of 4033 patients, treated with combined total of 23603 fields. All treatment indications were considered with the exception of ocular tumors generally treated in a fixed beam room. For all non-prostate treatments (21811 fields), only 5 fields for 4 patients (1-pancreas, 1-lumbar chordoma, 2-spine mets) required beam range greater than 25 cm. There were 446 prostate patients (1792 fields), with the required beam range from 22.3 to 29.0 cm; 386 of them had at least one of their lateral beam range greater than 25 cm. For the 10 prostate patients with highest lateral beam ranges (26 to 29 cm), their treatment with anterior oblique beams would drop the beam ranges below 25 cm (17.3 to 18.5 cm). Conclusion: if prostate patients are treated with anterior fields only, the useful maximum beam range is reduced to 25 cm. Thus a proton therapy system with maximum beam energy of 196 MeV is sufficient to treat all tumors sites with very rare exceptions (<0.1%). Designing such PT system would reduce the cost of proton therapy for hospitals and patients and increase the accessibility to the treatment.

  8. Two-dimensional structure of poly[[[μ2-1,4-bis(pyridin-4-ylbutane]bis(μ4-pentanedioatodicopper(II] acetonitrile disolvate

    Directory of Open Access Journals (Sweden)

    Do Nam Lee

    2017-10-01

    Full Text Available In the title compound, {[Cu2(μ4-C5H6O42(μ2-C14H16N2]·2CH3CN}n, the Cu2 dinuclear units are connected by glutartate ligands, forming one-dimensional double chains. These chains, are in turn bridged by 1,4-bis(pyridin-4-ylbutane ligands to form a two-dimensional layer structure parallel to (112. The carboxylate groups of the glutarate ligand bridge two copper(II ions, forming a paddle-wheel-type Cu2(CO24 dinuclear secondary building unit. A crystallographic inversion centre is located midway between two CuII ions, with a Cu...Cu distance of 2.639 (3 Å. The coordination geometry of the unique CuII ion is slightly disorted square pyramidal, formed by four equatorial carboxylate O atoms and an axial pyridyl N atom.

  9. Synthesis of 1-benzyl-4-[(5,6-dimethoxy[2-14C]-1-indanon)-2-YL]-methylpiperidine hydrochloride (E2020-14C)

    International Nuclear Information System (INIS)

    Iimura, Youichi; Mishima, Mannen; Sugimoto, Hachiro

    1989-01-01

    1-Benzyl-4-[(5,6-dimethoxy[2- 14 C]-1-indanon)-2-yl]-methylpiperidine hydrochloride (E2020- 14 C), and acetylcholinesterase inhibitor for studying the pharmacokinetic profiles of E2020, was synthesized from 5,6-dimethoxy[2- 14 C]-1-indanone as the labelled starting material. (author)

  10. SU-G-JeP2-14: MRI-Based HDR Prostate Brachytherapy: A Phantom Study for Interstitial Catheter Reconstruction with 0.35T MRI Images

    International Nuclear Information System (INIS)

    Park, S; Kamrava, M; Yang, Y

    2016-01-01

    Purpose: To evaluate the accuracy of interstitial catheter reconstruction with 0.35T MRI images for MRI-based HDR prostate brachytherapy. Methods: Recently, a real-time MRI-guided radiotherapy system combining a 0.35T MRI system and three cobalt 60 heads (MRIdian System, ViewRay, Cleveland, OH, USA) was installed in our department. A TrueFISP sequence for MRI acquisition at lower field on Viewray was chosen due to its fast speed and high signal-to-noise efficiency. Interstitial FlexiGuide needles were implanted into a tissue equivalent ultrasound prostate phantom (CIRS, Norfolk, Virginia, USA). After an initial 15s pilot MRI to confirm the location of the phantom, planning MRI was acquired with a 172s TrueFISP sequence. The pulse sequence parameters included: flip angle = 60 degree, echo time (TE) =1.45 ms, repetition time (TR) = 3.37 ms, slice thickness = 1.5 mm, field of view (FOV) =500 × 450mm. For a reference image, a CT scan was followed. The CT and MR scans were then fused with the MIM Maestro (MIM software Inc., Cleveland, OH, USA) and sent to the Oncentra Brachy planning system (Elekta, Veenendaal, Netherlands). Automatic catheter reconstruction using CT and MR image intensities followed by manual reconstruction was used to digitize catheters. The accuracy of catheter reconstruction was evaluated from the catheter tip location. Results: The average difference between the catheter tip locations reconstructed from the CT and MR in the transverse, anteroposterior, and craniocaudal directions was −0.1 ± 0.1 mm (left), 0.2 ± 0.2 mm (anterior), and −2.3 ± 0.5 mm (cranio). The average distance in 3D was 2.3 mm ± 0.5 mm. Conclusion: This feasibility study proved that interstitial catheters can be reconstructed with 0.35T MRI images. For more accurate catheter reconstruction which can affect final dose distribution, a systematic shift should be applied to the MR based catheter reconstruction in HDR prostate brachytherapy.

  11. Fatigue-creep life prediction of 21/4Cr-1Mo steel under combined tension-torsion at 600degC

    International Nuclear Information System (INIS)

    Inoue, Tatsuo; Kishi, Shigeru; Koto, Hiroyuki; Takahashi, Yukio.

    1991-01-01

    From the above discussion on the comparison between predicted and experimental lives in this project, the followings are suggested. The Mises equivalent stress is not a successful parameter to describe the multiaxial fatigue-creep damage, while the Huddleston's stress gives better prediction. SRP, Ostergren method and Lemaitre-Plumtree-Chaboche method give comparatively good estimation of life, though these methods predict more or less the greater damage than the experiment under pure torsion and in-phase cycling, and cannot predict the life under out-of-phase cycling. The reason is considered to be owing to employment of the Mises equivalent strain, which might be possibly improved by using more sophisticated equivalent strain such as the strain defined on the Γ-plane. The life prediction based on the analytical stress-strain relation gives almost similar results as that based on the experimental data. It suggests the applicability of the inelastic constitutive moeles to give the fundamental data for life prediction. The subcommittee wishes to express her gratitude to the head Committee on High Temperature Strength, JSMS, for supporting the project, and acknowledgement is due to the Ministry of Education and Culture for providing Grant-in-Aid for Co-operative Research A (No. 61302036 and 01302026). (author)

  12. SU-E-J-214: MR Protocol Development to Visualize Sirius MRI Markers in Prostate Brachytherapy Patients for MR-Based Post-Implant Dosimetry

    International Nuclear Information System (INIS)

    Lim, T; Wang, J; Frank, S; Stafford, R; Bruno, T; Bathala, T; Mahmood, U; Pugh, T; Ibbott, G; Kudchadker, R

    2015-01-01

    Purpose: The current CT-based post-implant dosimetry allows precise seed localization but limited anatomical delineation. Switching to MR-based post-implant dosimetry is confounded by imprecise seed localization. One approach is to place positive-contrast markers (Sirius) adjacent to the negative-contrast seeds. This patient study aims to assess the utility of a 3D fast spoiled gradient-recalled echo (FSPGR) sequence to visualize Sirius markers for post-implant dosimetry. Methods: MRI images were acquired in prostate implant patients (n=10) on Day 0 (day-of-implant) and Day 30. The post-implant MR protocol consisted of 3D T2-weighted fast-spin-echo (FSE), T2-weighted 2D-FSE (axial) and T1-weighted 2D-FSE (axial/sagittal/coronal). We incorporated a 3D-FSPGR sequence into the post-implant MR protocol to visualize the Sirius markers. Patients were scanned with different number-of-excitations (6, 8, 10), field-of-view (10cm, 14cm, 18cm), slice thickness (1mm, 0.8mm), flip angle (14 degrees, 20 degrees), bandwidth (122.070 Hz/pixel, 325.508 Hz/pixel, 390.625 Hz/pixel), phase encoding steps (160, 192, 224, 256), frequency-encoding direction (right/left, anterior/posterior), echo-time type (minimum-full, out-of-phase), field strength (1.5T, 3T), contrast (with, without), scanner vendor (Siemens, GE), coil (endorectal-coil only, endorectal-and-torso-coil, torsocoil only), endorectal-coil filling (30cc, 50cc) and endorectal-coil filling type (air, perfluorocarbon [PFC]). For post-implant dosimetric evaluation with greater anatomical detail, 3D-FSE images were fused with 3D-FSPGR images. For comparison with CT-based post-implant dosimetry, CT images were fused with 3D-FSPGR images. Results: The 3D-FSPGR sequence facilitated visualization of markers in patients. Marker visualization helped distinguish signal voids as seeds versus needle tracks for more definitive MR-based post-implant dosimetry. On the CT-MR fused images, the distance between the seed on CT to MR images was 3.2±1.6mm in patients with no endorectal coil, 2.3±0.8mm in patients with 30cc-PFC-filled endorectal-coil and 5.0±1.8mm in patients with 50cc-PFC-filled endorectal-coil. Conclusion: An MR protocol to visualize positive-contrast Sirius markers to assist in the identification of negative-contrast seeds was demonstrated. S Frank is a co-founder of C4 Imaging LLC, the manufacturer of the MRI markers

  13. The Effect of Morphaction on the Kinetics of Indol-3yl-Acetic Acid-2-14C Transport in Zea Mays L. Coleoptile Segments

    DEFF Research Database (Denmark)

    Naqvi, S. M.

    1972-01-01

    This paper elucidates the effects of chloroflurenol (morphactin, IT 3456) treatment on the kinetics of 14C-IAA transport through Zea mays L. (cv. Orla-266) coleoptile segments. Maximum inhibition of transport was achieved when chloroflurenol remained in contact with the tissue segments for at least...

  14. SU-E-T-214: Comparison of Treatment Techniques for Dupuytren’s Contracture and Risk Assessment of Normal Tissue Complications

    International Nuclear Information System (INIS)

    Arentsen, L; Lopater, Z; Dusenbery, K; Gerbi, B

    2015-01-01

    Purpose: Duputren’s contracture (DC) is a benign disease characterized by abnormal thickening of the fascial surfaces of the hands or feet causing curling of the surface, functional impairment, weakness, and pain. The purpose of the investigation is to describe the radiation treatment approaches, compare these techniques, and discuss the potential side effects and complications of these techniques. Methods: Early stage DC has been treated with 120 kVp X rays but also with high-energy electrons or photons. High-energy electrons have been the radiation of choice but severe contracture of the hand makes it difficult to produce a plan with acceptable dose uniformity. High-energy photons can overcome this difficulty either by directing a beam onto the palmer or back of the surface of the hand, including bolus to maximize the surface dose. We calculated the dose to the bone for the 120 kVp treatment using published %DD data and mass energy absorption coefficients for bone and muscle. Results: The dose to underlying bone from megavoltage photons and electrons is essentially the same, but dose to the bone for using 120 kVp can be 4–5 times greater due to the photoelectric effect. For the 30 Gy dose deliver using this technique, the dose to the bone could be 84–105 Gy after taking the penetration of the beam into account. After radiotherapy, there is often decreased osteoblastic activity and vascular fibrosis that leads to osteitis, atrophy, and decreased metabolic bone activity. Incidence of fractures occurs routinely above 60 Gy with higher doses potentially leading to higher incidences of bone complications. Conclusion: Radiation therapy for DC using low-energy X rays can deliver a prohibitively high dose to the underlying bone potentially leading to severe bone complications

  15. Direct preparation of 14C-labelled 5-allyl- and 5-propyl-2'-deoxyuridine from [2-14C]2'-deoxyuridine

    International Nuclear Information System (INIS)

    Ruth, J.L.; White, S.K.; Bergstrom, D.E.

    1982-01-01

    [2- 14 C]5-Allyl-2'-deoxyuridine was synthesized directly from [2- 14 C]2'-deoxyuridine using mercury, palladium, and 3-chloropropene. [2- 14 C]5-Propyl-2'-deoxyuridine was obtained by hydrogenation of the [ 14 C]5-allyl-2'-deoxyuridine. Advantages of the synthetic method and its application to the preparation of other radiolabeled 5-alkyl/alkenyl-2'-deoxyuridines are discussed. (author)

  16. Creep-rupture behavior of 2-1/4 Cr-1 Mo steel, Alloy 800H and Hastelloy Alloy X in a simulated HTGR helium environment

    International Nuclear Information System (INIS)

    Lai, G.Y.; Wolwowicz, R.J.

    1979-12-01

    Creep-rupture testing was conducted on 1 1/4 Cr-1 Mo steel, Alloy 800H and Hastelloy Alloy X in flowing helium containing nominal concentration of following gases: 1500 μatm H 2 , 450 μatm CO, 50 μatm CH 4 , 50 μatm H 2 O and 5 μatm CO 2 . This environment is believed to represent maximum permissible levels of impurities in the primary coolant for the steam-cycle system of a high-temperature gas-cooled reactor (HTGR) when it is operating continuously with a water and/or steam leak at technical specification limits. Two or three heats of material for each alloy were investigated. Tests were conducted at 482 0 C and 760 0 C (1200 0 F and 1400 0 F) for Alloy 800H, and at 760 0 C and 871 0 C (1400 0 F and 1600 0 F) for Hastelloy Alloy X for times up to 10,000 h. Selected tests were performed on same heat of material in both air and helium environments to make a direct comparison of creep-rupture behaviors between two environments. Metallurgical evaluation was performed on selected post test specimens with respect to gas-metal interactions which included oxidation, carburization and/or decarburization. Correlation between gaseous corrosion and creep-rupture behavior was attempted. Limited tests were also performed to investigate the specimen size effects on creep-rupture behavior in the helium environment

  17. Zn induced in-gap electronic states in La214 probed by uniform magnetic susceptibility: relevance to the suppression of superconducting T c

    Science.gov (United States)

    Islam, R. S.; Naqib, S. H.

    2018-02-01

    Substitution of isovalent non-magnetic defects, such as Zn, in the CuO2 plane strongly modifies the magnetic properties of strongly electron correlated hole doped cuprate superconductors. The reason for enhanced uniform magnetic susceptibility, χ, in Zn substituted cuprates is debatable. Generally the defect induced magnetic behavior has been analyzed mainly in terms of two somewhat contrasting scenarios. The first one is due to independent localized moments appearing in the vicinity of Zn arising because of the strong electronic/magnetic correlations present in the host compound and the second one is due to transfer of quasiparticle (QP) spectral weight and creation of weakly localized low-energy electronic states associated with each Zn atom in place of an in-plane Cu. If the second scenario is correct, one should expect a direct correspondence between Zn induced suppression of the superconducting transition temperature, T c, and the extent of the enhanced magnetic susceptibility at low temperature. In this case, the low-T enhancement of χ would be due to weakly localized QP states at low energy and these electronic states will be precluded from taking part in Cooper pairing. We explore this second possibility by analyzing the χ(T) data for La2-x Sr x Cu1-y Zn y O4 with different hole contents, p (=x), and Zn concentrations (y) in this paper. The results of our analysis support this scenario.

  18. SU-E-T-214: Intensity Modulated Proton Therapy (IMPT) Based On Passively Scattered Protons and Multi-Leaf Collimation: Prototype TPS and Dosimetry Study

    International Nuclear Information System (INIS)

    Sanchez-Parcerisa, D; Carabe-Fernandez, A

    2014-01-01

    Purpose. Intensity-modulated proton therapy is usually implemented with multi-field optimization of pencil-beam scanning (PBS) proton fields. However, at the view of the experience with photon-IMRT, proton facilities equipped with double-scattering (DS) delivery and multi-leaf collimation (MLC) could produce highly conformal dose distributions (and possibly eliminate the need for patient-specific compensators) with a clever use of their MLC field shaping, provided that an optimal inverse TPS is developed. Methods. A prototype TPS was developed in MATLAB. The dose calculation process was based on a fluence-dose algorithm on an adaptive divergent grid. A database of dose kernels was precalculated in order to allow for fast variations of the field range and modulation during optimization. The inverse planning process was based on the adaptive simulated annealing approach, with direct aperture optimization of the MLC leaves. A dosimetry study was performed on a phantom formed by three concentrical semicylinders separated by 5 mm, of which the inner-most and outer-most were regarded as organs at risk (OARs), and the middle one as the PTV. We chose a concave target (which is not treatable with conventional DS fields) to show the potential of our technique. The optimizer was configured to minimize the mean dose to the OARs while keeping a good coverage of the target. Results. The plan produced by the prototype TPS achieved a conformity index of 1.34, with the mean doses to the OARs below 78% of the prescribed dose. This Result is hardly achievable with traditional conformal DS technique with compensators, and it compares to what can be obtained with PBS. Conclusion. It is certainly feasible to produce IMPT fields with MLC passive scattering fields. With a fully developed treatment planning system, the produced plans can be superior to traditional DS plans in terms of plan conformity and dose to organs at risk

  19. Carbon-14 kinetic isotope effects and mechanisms of addition of 2,4-dinitrobenzenesulfenyl chloride to substituted styrenes-1-14C and styrenes-2-14C

    International Nuclear Information System (INIS)

    Kanska, M.; Fry, A.

    1983-01-01

    As the first reported examples of carbon isotope effects in simple electrophilic addition reactions we have measured the carbon-14 kinetic isotope effects in the addition of 2,4-dinitrobenzenesulfenyl chloride to a series of para-substituted α and β-labeled styrenes in acetic acid at 30.1 0 C: for para substituents Cl, H, and CH 3 the k/ 14 K values for α labeling are 1.027, 1.022, and 1.004, and the k/ 14 k values for β labeling are 1.035, 1.032, and 1.037, all +/-approx.0.004. The kinetics of the reaction were measured for the p-CH 3 O,p-CH 3 , unsubstituted, p-Cl, and m-NO 2 styrenes; electron-donating groups strongly accelerate the reaction, and electron-withdrawing groups retard it. The Hammett plot is curved with p + values ranging from about -4.6 at the electron-donating group (EDG) end to about -1.8 at the electron-withdrawing group (EWG) end. Both the isotope effect and kinetic data, and related data from the literature, are interpreted in terms of a changing mechanism, with the activated complexes of the rate-determining steps having much open carbenium ion (ion pair) character for EDG-substituted styrenes and much cyclic thiiranium io (ion par) character for EWG-substituted styrenes. 1 figure, 2 tables

  20. Carbon-14 isotope effects in the addition of 2,4-dinitrobenzenesulfenyl chloride to styrene-1-14C and styrene-2-14C

    International Nuclear Information System (INIS)

    Kanska, M.; Fry, A.

    1982-01-01

    The carbon-isotope effect reported here represents the first step in a general study of the mechanisms of simple electrophilic addition reactions by isotope effect techniques using the successive labeling approach. The addition of 2,4-dinitrobenzenesulfenyl chloride to styrene was chosen as a ''calibration case'' for the cyclic mechanism. The observed isotope effects at /sup α/C and /sup #betta#/C are fully consistent with the cyclic mechanism and probably inconsistent with the open carbenium ion mechanisms. The values of 12 k/ 14 k indicated in this report are averages (and standard deviations) of values for five different fractions of reaction ranging from 20% to 70% with the calculations being made by all four of the Tong and Yankwich equations for each fraction of reaction. Results indicated that there were no trends in the 12 k/ 14 k values as the fraction of reaction varied, and as can be seen by the low standard deviations, there was good agreement among the values calculated by the four equations. These two facts to indicate that the starting materials were of high chemical and radiochemical purity and that the procedures used in the isotope effect experiments were accurate and properly controlled

  1. A convenient method for 14C-labeling of 2-methylthio-1-[4-N-α-ethoxycarbonylbenzyl)-amino-benzyl] -5-hydroxymethyl-2-[14C]-1H-imidazole and 1-[4-N-α-ethoxy-carbonylbenzyl)-aminobenzyl]-5-hydroxymethyl-2-[14C] -1H-imidazole as potential antihypertensives

    International Nuclear Information System (INIS)

    Nader Saemian; Gholamhossein Shirvani; Mohsen Javaheri; Sayed Sajad Oliyaee

    2012-01-01

    The key synthetic intermediate, (2-mercapto-1-(4-nitrobenzyl)-1H-imidazol-5-yl)methanol-[2- 14 C], has been synthesized by using one pot procedure from potassium[ 14 C]-thiocyanate. It was converted to two nonpeptide angiotensin II receptor antagonists, 2-methylthio-1-[4-N-α-ethoxycarbonyl benzyl)-aminobenzyl]-5-hydroxymethyl-1H-imidazole-[2- 14 C] and 1-[4-N-α-ethoxy-carbonylbenzyl)-aminobenzyl] -5-hydroxymethyl-1H-imidazole-[2- 14 C] via a 3-step sequence synthetic pathway. (author)

  2. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  3. A simple method for labelling proteins with 211At via diazotized aromatic diamine

    International Nuclear Information System (INIS)

    Wunderlich, G.; Franke, W.-G.; Fischer, S.; Dreyer, R.

    1987-01-01

    A simple and rapid method for labelling proteins with 211 At by means of a 1,4-diaminobenzene link is described. This link is transformed into the diazonium salt and subsequently reactions of both 211 At and proteins with the diazonium salt take place simultaneously. For possibly high yields of astatized protein an appropriate temperature of 273 K was found. The results demonstrate the difference between the reaction mechanisms of iodine and astatine with proteins. (author)

  4. The Installation Restoration Program Toxicology Guide. Volume 2

    Science.gov (United States)

    1987-05-01

    Periodic Table: fluorine , chlorine, bromine, iodine, and astatine. Fluorine is the most active of all chemical elements. 5/87 LIST OF ABBREVIATIONS...fire- retardant varnishes and as an aminizing agent for cotton fabric (901). 37.2 ENVIRONMENTAL FATE A1D EXPOSURE PATHWAYS 37.2.1 Transport in Soil...subject to packaging and labeling regulations. Directive on Paints, Varnishes . Printing Inks. Adhesives and Similar Product; (1334) Pentachlorophenol

  5. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    International Nuclear Information System (INIS)

    Koziorowski, J.

    1998-01-01

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on 211 At and 124 I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[ 211 At]astato-2'-deoxyuridine (AUdR) and N-succinimidyl-4-[ 211 At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [ 124 I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[ 124 I]iodo-2'-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for radioiodination of

  6. RESENHA: FREDEL, Karla Maria. Arqueologia de Gênero nas cidades de Pelotas - RS - Brasil e Habana Vieja - Habana - Cuba / século XIX. Erechim, RS: Habilis Press, 2015, 214 p.

    Directory of Open Access Journals (Sweden)

    Juan Manuel Cano Sanchiz

    2016-11-01

    Full Text Available Arqueologia de Gênero nas cidades de Pelotas - RS - Brasil e Habana Vieja - Habana - Cuba / século XIX es la publicación de la Tesis Doctoral homónima de Karla Ma Fredel, defendida en el Instituto de Filosofia e Ciências Humanas de la Universidade Estadual de Campinas (UNICAMP, en octubre de 2012. La tesis se desarrolló bajo la orientación del profesor Dr. Pedro Paulo A. Funari (Laboratório de Arqueologia Pública, NEPAM/UNICAMP y la co-orientación de los profesores Dra. Lourdes Domínguez (Oficina del Historiador de La Habana; Academia de la Historia de Cuba y Dr. Lúcio Menezes Ferreira (Laboratório Multidisciplinar de Pesquisa Arqueológica, UFPel. Todos ellos han contribuido a esta nueva obra con sendos prólogo (Domínguez, prefacio (Funari y presentación (Ferreira.

  7. The measurements of coexistence curves and turbidity for {xC6H5CN + (1 - x)CH3(CH2)14CH3} in the critical region

    International Nuclear Information System (INIS)

    Wang Nong; Mao Chunfeng; Peng Xuhong; An, Xueqin; Shen Weiguo

    2006-01-01

    The coexistence curves and turbidity data for a critical solution of (benzonitrile + hexadecane) have been reported. The critical amplitudes and exponents relating to the difference in density variables of two coexisting phases, the correlation length, and the osmotic compressibility have been calculated. The experimental results of the coexistence curves have also been analyzed to examine the Wegner correction terms and the behaviour of the diameter of the coexistence curves. A combination of the Wegner equation and the expression for the diameter has been used to describe successfully the coexistence curves

  8. Use of [2-14C]mevalonate and saponin-bound [14C]-3-hydroxy-3-methylglutaric acid for the biosynthesis of terpenoids in leaves of Dioscorea deltoidea

    International Nuclear Information System (INIS)

    Gurielidze, K.G.; Paseshnichenko, V.A.; Vasil'eva, I.S.

    1986-01-01

    After the introduction of [2- 14 C]acetate into leaves of Dioscorea deltoidea, a radioactive furonanalog of deltafolin - protodeltofolin, containing two-thirds of the label in the 3-hydroxy-3-methylglutaryl portion - was isolated from them. Radioactive β-careotene and sterols were isolated from cut young leaves of Dioscorea 24 h after the introduction of [ 14 C] protodeltofolin into them, using chromatography on a column of silica gel and precipitation of sterols in the form of digitonins for this purpose. The incorporation of radioactivity from [ 14 C]-3-hydroxy-3-methyl-glutaric acid, bound in the form of a saponin, and β-carotene came to 0.18-0.80%, while incorporation into sterols came to 0.07-2.86% of the radioactivity of the alcohol extract. Thereby it was shown that 3-hydroxyl-3-methylglutaric acid, bound in the form of the saponin, can be used to form terpenoids in Dioscorea leaves. It was suggested that the binding of hydroxymethylglutaric acid to saponin represents one of the mechanisms of regulation of the rate of terpenoid biosynthesis in Dioscorea leaves

  9. Poly[[sesqui[mu2-1,4-bis(imidazol-1-ylmethyl)benzene-kappa(2)N:N'](carbonato-kappa(2)O,O')copper(II)] 1,4-bis(imidazol-1-ylmethyl)benzene hemisolvate pentahydrate].

    Science.gov (United States)

    Dai, Yu-Mei; Tang, En; Huang, Jin-Feng; Yang, Qiu-Yan

    2008-10-01

    The asymmetric unit of the title compound, {[Cu(CO(3))(C(14)H(14)N(4))(1.5)] x 0.5 C(14)H(14)N(4) x 5 H(2)O}(n), contains one Cu(II) cation in a slightly distorted square-pyramidal coordination environment, one CO(3)(2-) anion, one full and two half 1,4-bis(imidazol-1-ylmethyl)benzene (bix) ligands, one half-molecule of which is uncoordinated, and five uncoordinated water molecules. One of the coordinated bix ligands and the uncoordinated bix molecule are situated about centers of symmetry, located at the centers of the benzene rings. The coordinated bix ligands link the copper(II) ions into a [Cu(bix)(1.5)](n) molecular ladder. These molecular ladders do not form interpenetrated ladders but are arranged in an ABAB parallel terrace, i.e. with the ladders arranged one above another, with sequence A translated with respect to B by 8 A. To best of our knowledge, this arrangement has not been observed in any of the molecular ladder frameworks synthesized to date. The coordination environment of the Cu(II) atom is completed by two O atoms of the CO(3)(2-) anion. The framework is further strengthened by extensive O-H...O and O-H...N hydrogen bonds involving the water molecules, the O atoms of the CO(3)(2-) anion and the N atoms of the bix ligands. This study describes the first example of a molecular ladder coordination polymer based on bix and therefore demonstrates further the usefulness of bix as a versatile multidentate ligand for constructing coordination polymers with interesting architectures.

  10. A Comparative Study on Activated Carbons Derived from a Broad Range of Agro-industrial Wastes in Removal of Large-Molecular-Size Organic Pollutants in Aqueous Phase (vol 226, pg 214, 2015).

    Czech Academy of Sciences Publication Activity Database

    Cruz, G.J.F.; Matějová, Lenka; Pirilä, M.; Ainassari, K.; Canepa, C.A.; Solis, J.; Cruz, J.F.; Šolcová, Olga; Keiski, R.L.

    2015-01-01

    Roč. 226, č. 11 (2015), č. článku 386. ISSN 0049-6979 Institutional support: RVO:67985858 Keywords : agro-industrial biomass * activated carbon * adsorption Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 1.551, year: 2015

  11. Crystal structure of cis-1-phenyl-8-(pyridin-2-ylmethyldibenzo[1,2-c:2,1-h]-2,14-dioxa-8-aza-1-borabicyclo[4.4.0]deca-3,8-diene

    Directory of Open Access Journals (Sweden)

    Gabriela Ledesma

    2017-12-01

    Full Text Available The title compound, C26H23BN2O2, was obtained as by product during synthetic attempts of a complexation reaction between the tripodal ligand H2L [N,N-bis(2-hydroxybenzyl(pyridin-2-ylmethylamine] and manganese(III acetate in the presence of NaBPh4. The isolated B-phenyl dioxazaborocine contains an N→B dative bond with a cis conformation. In the crystal, C—H...O hydrogen bonds define chains parallel to the b-axis direction. A comparative analysis with other structurally related derivatives is also included, together with a rationalization of the unexpected production of this zwitterionic heterocycle.

  12. Hyperspectral surface materials map of quadrangles 3666 and 3766, Balkh (219), Mazar-e Sharif (220), Qarqin (213), and Hazara Toghai (214) quadrangles, Afghanistan, showing iron-bearing minerals and other materials

    Science.gov (United States)

    King, Trude V.V.; Hoefen, Todd M.; Kokaly, Raymond F.; Livo, Keith E.; Johnson, Michaela R.; Giles, Stuart A.

    2013-01-01

    This map shows the spatial distribution of selected iron-bearing minerals and other materials derived from analysis of airborne HyMap™ imaging spectrometer (hyperspectral) data of Afghanistan collected in late 2007. This map is one in a series of U.S. Geological Survey/Afghanistan Geological Survey quadrangle maps covering Afghanistan. Flown at an altitude of 50,000 feet (15,240 meters (m)), the HyMap™ imaging spectrometer measured reflected sunlight in 128 channels, covering wavelengths between 0.4 and 2.5 μm. The data were georeferenced, atmospherically corrected and converted to apparent surface reflectance, empirically adjusted using ground-based reflectance measurements, and combined into a mosaic with 23-m pixel spacing. Variations in water vapor and dust content of the atmosphere, in solar angle, and in surface elevation complicated correction; therefore, some classification differences may be present between adjacent flight lines. The reflectance spectrum of each pixel of HyMap™ imaging spectrometer data was compared to the reference materials in a spectral library of minerals, vegetation, water, and other materials. Minerals occurring abundantly at the surface and those having unique spectral features were easily detected and discriminated, while minerals having slightly different compositions but similar spectral features were less easily discriminated; thus, some map classes consist of several minerals having similar spectra, such as “Goethite and jarosite.” A designation of “Not classified” was assigned to the pixel when there was no match with reference spectra.

  13. Towards energy-efficient territories: which choices for the territorial organisation? ADeus' Notes Nr 214. Towards territories producing renewable energies. ADeus' Notes Nr 215, November 2016

    International Nuclear Information System (INIS)

    Pons, Anne; Gendron, Yves; Isenmann, Jean; Masse, Camille; Berlet, Jessica; Mallick, Amandine; Martin, Stephanie; Delahaye, Mathilde; Muller, Lisa

    2016-11-01

    After having outlined that each territory does not possess the same potential in terms of energy efficiency, a first issue of this publication outlines the role of territorial planning to improve performance and efficiency of the built environment, to develop infrastructures and to improve their quality, to organise mobility demand, to put back the car to a right place, to reduce and to optimise goods road transport. It also notices that planning is not enough: individuals must somehow be constrained and encouraged, and changes of practices on the long term must be promoted. A panel of solutions to be adapted to the local context is then proposed for different situations related to mobility and transport. The second issue first outlines how to valorise local energy potentials by promoting energy saving and energy efficiency, by choosing the right energy for the right usage. It shows how to promote interdependency and solidarity between territories as far as energy production and consumption are concerned. It describes how to plan renewable energy sites in town planning documents

  14. Effect of pH, Temperature, and Chemicals on the Endoglucanases and β-Glucosidases from the Thermophilic Fungus Myceliophthora heterothallica F.2.1.4. Obtained by Solid-State and Submerged Cultivation

    Directory of Open Access Journals (Sweden)

    Vanessa de Cássia Teixeira da Silva

    2016-01-01

    Full Text Available This work reports endoglucanase and beta-glucosidase production by the thermophilic fungus Myceliophthora heterothallica in solid-state (SSC and submerged (SmC cultivation. Wheat bran and sugarcane bagasse were used for SSC and cardboard for SmC. Highest endoglucanase production in SSC occurred after 192 hours: 1,170.6 ± 0.8 U/g, and in SmC after 168 hours: 2,642 ± 561 U/g. The endoglucanases and beta-glucosidases produced by both cultivation systems showed slight differences concerning their optimal pH and temperature. The number of endoglucanases was also different: six isoforms in SSC and ten in SmC. Endoglucanase activity remained above 50% after incubation between pH 3.0 and 9.0 for 24 h for both cultivation systems. The effect of several chemicals displayed variation between SSC and SmC isoenzymes. Manganese activated the enzymes from SmC but inhibited those from SSC. For β-glucosidases, maximum production on SmC was 244 ± 48 U/g after 168 hours using cardboard as carbon source. In SSC maximum production reached 10.9 ± 0.3 U/g after 240 h with 1 : 1 wheat bran and sugarcane bagasse. Manganese exerted a significant activation on SSC β-glucosidases, and glucose inhibited the enzymes from both cultivation systems. FeCl3 exerted the strongest inhibition for endoglucanases and β-glucosidases.

  15. Synthesis of 7-[α-(2-amino-[2-14C]thiazol-4-yl)-α-(Z)-methoxyimin oacetamido]-3-(1-methylpyrrolidinio)methyl-3-cephem-4-carboxylate hydrochloride ([14C]cefepime hydrochloride)

    International Nuclear Information System (INIS)

    Standridge, R.T.; Swigor, J.E.

    1993-01-01

    The title compound ([ 14 C]cefepime hydrochloride) was prepared as follows:- [ 14 C]Thiourea was condensed with ethyl 4-bromo-3-oxo-2-methoxyimino-acetate providing ethyl 2-(2-amino-4-[2- 14 C] thiazolyl)-2-methoxyi-minoacetate as the pure Z-isomer. Saponification gave the amino acid this was reacted with 1-hydroxybenzotriazole to give the activated ester. Condensation in situ with 7-amino-3-(1-methylpyrrolidinio) methyl-3-cephem-4-carboxylate yielded the product as the pure sulfate salt. Treatment of the sulfate salt with base provided the zwitterion isolated as the stable N-methyl-2-pyrrolidinone adduct. An aqueous solution of the adduct was converted to the crystalline title compound, [ 14 C]Cefepime hydrochloride hydrate, with hydrochloric acid/acetone. Radiochemical purity was 99.0% and specific activity, 34.2 μCi/mg. Overall yield from [ 14 C]thiourea was 18%. (Author)

  16. Trapping {BW12}2 tungstoborate: synthesis and crystal structure of hybrid [{(H2BW12O42)2O}{Mo6O6S6(OH)4(H2O)2}]14- anion.

    Science.gov (United States)

    Korenev, V S; Abramov, P A; Vicent, C; Mainichev, D A; Floquet, S; Cadot, E; Sokolov, M N; Fedin, V P

    2012-12-28

    Reaction between monolacunary {BW(11)} tungstoborate and oxothiocationic building block, {Mo(2)O(2)S(2)}, results in the formation of a new polyoxothiometalate with a unique architecture in which two [H(2)BW(12)O(43)](9-) tungstoborate subunits are linked together with a hexamolybdate [Mo(V)(6)O(6)S(6)(OH)(4)(H(2)O)(2)](2+) bridge.

  17. Induction of monooxygenases and incorporation of radioactivity from 2-14C-lysine into hepatic microsomes of phenobarbital-treated rats fed a diet deficient in lysine, methionine, threonine and vitamine A, C and E

    International Nuclear Information System (INIS)

    Nurmagambetov, T.Zh.; Amirov, B.B.; Kuanysheva, T.K.; Sharmanov, T.Sh.

    1991-01-01

    The effect of diet on induction of monooxygenases and distribution of label from 2- 14 C-lysine in fractions of liver homogenate, muscle homogenate and blood of male rats treated with phenobarbital (80 mg/rg, three days) was studied. 2- 14 C-lysine was injected intraperitoneally 24 h before the first injection of phenobarbital. It was demonstrated that monooxygenase induction, increase of relative liver weight and incorporation of label from 2- 14 C-lysine into fractions of liver homogenate in phenobarbital-treated rats were more pronounced as compared with the similarly trated rats that were fed a balanced diet. The possibility of mobilization of deficient essential components to liver from other organs and tissues for maintenance of monooxygenase induction is discussed

  18. Induction of monooxygenases and incorporation of radioactivity from 2-14C-lysine into hepatic microsomes of phenobarbital-treated rats fed a diet deficient in lysine, methionine, threonine and vitamines A, C, E

    International Nuclear Information System (INIS)

    Nurmagambetov, T.Zh.; Amirov, B.B.; Kuanysheva, T.G.; Sharmanov, T.Sh.

    1992-01-01

    The effect of diet on induction of monooxygenases and distribution of radioactivity from 2- 14 C-lysine in fractions of liver homogenate, muscle homogenate and blood of male rats treated with phenobarbital was studied. 2- 14 C-lysin was injected intraperitoneally 24 h before the first injection of phenobarbital. It was demonstrated that monooxygenase induction, increase of relative liver weight and incorporation of radioactivity from 2- 14 C-lysine into fractions of liver homogenate in phenobarbital-treated rats fed diet deficient in lysine, methionine, threonine and vitamins A, C, E were more pronounced as compared with the similarly treated rats which were fed a balanced diet. The possibility of mobilization of deficient essencial components to liver from other organs and tissues for maintenance of monooxygenase induction iis discussed

  19. American Recovery and Reinvestment Act (ARRA) FEMP Technical Assistance U.S. Army – Project 214 Analysis of Regulations Associated with Implementation of a Rocky Mountain Secure Smart-Grid

    Energy Technology Data Exchange (ETDEWEB)

    Warwick, William M.

    2010-09-30

    This document describes technical assistance provided by PNNL to further develop a smart grid technologies concept to provide a basis for policies and plans for the US Army. The effort was to analyze the potential to utilize emerging smart grid technologies along with indigenous renewable and other resources to meet the emergency and other power needs of Department of Defense facilities in Colorado and Wyoming.

  20. Charge radii and electromagnetic moments of At-211195

    Science.gov (United States)

    Cubiss, J. G.; Barzakh, A. E.; Seliverstov, M. D.; Andreyev, A. N.; Andel, B.; Antalic, S.; Ascher, P.; Atanasov, D.; Beck, D.; Bieroń, J.; Blaum, K.; Borgmann, Ch.; Breitenfeldt, M.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Derkx, X.; De Witte, H.; Elseviers, J.; Fedorov, D. V.; Fedosseev, V. N.; Fritzsche, S.; Gaffney, L. P.; George, S.; Ghys, L.; Heßberger, F. P.; Huyse, M.; Imai, N.; Kalaninová, Z.; Kisler, D.; Köster, U.; Kowalska, M.; Kreim, S.; Lane, J. F. W.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Marsh, B. A.; Mitsuoka, S.; Molkanov, P. L.; Nagame, Y.; Neidherr, D.; Nishio, K.; Ota, S.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Revill, J. P.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Sandhu, K.; Schweikhard, L.; Sels, S.; Truesdale, V. L.; Van Beveren, C.; Van den Bergh, P.; Wakabayashi, Y.; Van Duppen, P.; Wendt, K. D. A.; Wienholtz, F.; Whitmore, B. W.; Wilson, G. L.; Wolf, R. N.; Zuber, K.

    2018-05-01

    Hyperfine-structure parameters and isotope shifts of At-211195 have been measured for the first time at CERN-ISOLDE, using the in-source resonance-ionization spectroscopy method. The hyperfine structures of isotopes were recorded using a triad of experimental techniques for monitoring the photo-ion current. The Multi-Reflection Time-of-Flight Mass Spectrometer, in connection with a high-resolution electron multiplier, was used as an ion-counting setup for isotopes that either were affected by strong isobaric contamination or possessed a long half-life; the ISOLDE Faraday cups were used for cases with high-intensity beams; and the Windmill decay station was used for short-lived, predominantly α -decaying nuclei. The electromagnetic moments and changes in the mean-square charge radii of the astatine nuclei have been extracted from the measured hyperfine-structure constants and isotope shifts. This was only made possible by dedicated state-of-the-art large-scale atomic computations of the electronic factors and the specific mass shift of atomic transitions in astatine that are needed for these extractions. By comparison with systematics, it was possible to assess the reliability of the results of these calculations and their ascribed uncertainties. A strong deviation in the ground-state mean-square charge radii of the lightest astatine isotopes, from the trend of the (spherical) lead isotopes, is interpreted as the result of an onset of deformation. This behavior bears a resemblance to the deviation observed in the isotonic polonium isotopes. Cases for shape coexistence have been identified in At,199197, for which a significant difference in the charge radii for ground (9 /2- ) and isomeric (1 /2+ ) states has been observed.

  1. Human radiation studies: Remembering the early years: Oral history of Dr. Patricia Wallace Durbin, Ph.D., conducted November 11, 1994

    International Nuclear Information System (INIS)

    1995-07-01

    This report is a transcript of an interview of Dr. Patricia Wallace Durbin by representatives of the US DOE Office of Human Radiation Research. Dr. Durbin was selected for this interview because of her knowledge of the human plutonium injections and her recollections of key figures, especially Joseph Hamilton. After a brief biographical sketch Dr. Durbin discusses her loss of research funding from DOE, her recollections concerning research into strontium metabolism as part of Project Sunshine, her recollections relating to the rationale for studies of human metabolism of radionuclides, her remembrances of Dr. Hamilton's Astatine and Plutonium research, and her experiences in gathering archival records concerning these researches

  2. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ery: 155 GIALGAEDYVRDLRTQRSPEGTELLFARCSILQAARSAGIMAFDTVYSDANNEEGFIREA 214 ... GIALGAEDYVRDLRTQRSPEGTELLFARC...SILQAARSAGIMAFDTVYSDANNEEGFIREA Sbjct: 121 GIALGAEDYVRDLRTQRSPEGTELLFARCSILQAARSAGIMAFDTVYSDANNEEGFIREA 180 ...

  3. Preliminary assessment of errors of radon daughters concentration in air; Wstepna ocena bledow miernika koncentracji produktow rozpadu radonu w powietrzu

    Energy Technology Data Exchange (ETDEWEB)

    Machaj, B. [Institute of Nuclear Chemistry and Technology, Warsaw (Poland)

    1996-12-31

    Employing an earlier elaborated computer program for simulation of depositing radon decay products: {sup 214}Po, {sup 214}Pb, {sup 214}Bi ({sup 214}Po) on air filter and for computing variation of their activity against time, an assessment of errors was carried out of a methods employing measurement of {sup 218}Po + {sup 214}Po alpha activity in three time intervals. Additionally errors of the methods measuring {sup 218}Po + {sup 214}Po alpha activity in three, two and one time intervals, were assessed. A few attempts were also made to measure the alpha activity in different time intervals and to assess their measuring errors. (authors). 10 refs, 4 figs, 14 tabs.

  4. Radiation protection in brachytherapy

    International Nuclear Information System (INIS)

    Benitez, Manuel

    1996-02-01

    It covers technical procedures in medical applications for cancer treatment. Radiation protection principles in brachytherapy. Medical uses in therapy for Sr-90, Cs-137, Co-60, Ra-226, Ir-192, Au-198, Bi-214, Pb-214. (The author)

  5. 75 FR 343 - Fresh Garlic From the People's Republic of China: Initiation of New Shipper Reviews

    Science.gov (United States)

    2010-01-05

    ... from Zhengzhou Huachao Industrial Co., Ltd. (Huachao) in accordance with 19 CFR 351.214(c) and 351.214... establishing the following: (1) the date on which it first shipped fresh garlic for export to the United States...

  6. Synthesis of [2-13C, 2-14C] 2-aminoethanol, [1-13C, 1-14C] 2-chloroethylamine, N,N'-bis([1-13C, 1-14C] 2-chloroethyl)-N-nitrosourea(BCNU) and N-([1-13C, 1-14C] 2-chloroethyl)-N-nitrosourea(CNU)

    International Nuclear Information System (INIS)

    Narayan, R.; Chang, C-j.

    1982-01-01

    [2- 13 C, 2- 14 C]2-Aminoethanol hydrochloride was prepared in good yield from Na*CN in a two step sequence by first converting the Na*CN to OHCH 2 *CN and then reducing the nitrile directly with a solution of borane-tetrahydrofuran complex. The reaction procedure was simple and the pure product could be obtained readily. Using this specifically labelled precursor, the synthesis of [1- 13 C, 1- 14 C]2-chloroethylamine hydrochloride, N-([1- 13 C, 1- 14 C]2-chloroethyl)-N-nitrosourea(CNU) and N,N'-bis([1- 13 C, 1- 14 C]2-chloroethyl)-N-nitrosourea(BCNU) in good yield without isotope scrambling was also reported. (author)

  7. Dietary exposure to benzoates (E210-E213), parabens (E214-E219), nitrites (E249-E250), nitrates (E251-E252), BHA (E320), BHT (E321) and aspartame (E951) in children less than 3 years old in France.

    Science.gov (United States)

    Mancini, F R; Paul, D; Gauvreau, J; Volatier, J L; Vin, K; Hulin, M

    2015-01-01

    This study aimed to estimate the exposure to seven additives (benzoates, parabens, nitrites, nitrates, BHA, BHT and aspartame) in children aged less than 3 years old in France. A conservative approach, combining individual consumption data with maximum permitted levels, was carried out for all the additives. More refined estimates using occurrence data obtained from products' labels (collected by the French Observatory of Food Quality) were conducted for those additives that exceeded the acceptable daily intake (ADI). Information on additives' occurrence was obtained from the food labels. When the ADI was still exceeded, the exposure estimate was further refined using measured concentration data, if available. When using the maximum permitted level (MPL), the ADI was exceeded for benzoates (1.94 mg kg(-1) bw day(-1)), nitrites (0.09 mg kg(-1) bw day(-1)) and BHA (0.39 mg kg(-1) bw day(-1)) in 25%, 54% and 20% of the entire study population respectively. The main food contributors identified with this approach were current foods as these additives are not authorised in specific infant food: vegetable soups and broths for both benzoates and BHA, delicatessen and meat for nitrites. The exposure estimate was significantly reduced when using occurrence data, but in the upper-bound scenario the ADI was still exceeded significantly by the age group 13-36 months for benzoates (2%) and BHA (1%), and by the age group 7-12 months (16%) and 13-36 months (58%) for nitrites. Measured concentration data were available exclusively for nitrites and the results obtained using these data showed that the nitrites' intake was below the ADI for all the population considered in this study. These results suggest that refinement of exposure, based on the assessment of food levels, is needed to estimate the exposure of children to BHA and benzoates for which the risk of exceeding the ADI cannot be excluded when using occurrence data.

  8. Soluções formais no enfrentamento dos problemas da prática escolar: o estranhamento dos professores de educação física escolar DOI:10.5007/2175-8042.2011v23n36p214

    Directory of Open Access Journals (Sweden)

    Carlos Henrique Ferreira Magalhães

    2011-01-01

    Full Text Available Esse estudo tem como objetivo refletir as categorias empíricas constadas no levantamento a respeito das dificuldades dos professores de educação física, recém-formados, no desenvolvimento de suas práticas escolares. A pesquisa foi desenvolvida junto aos professores do Núcleo Regional de Educação de Maringá-PR, por meio de um questionário semi-aberto. Dos 52 questionários respondidos foram extraídas as categorias de análise, a saber: políticas públicas de formação continuada de professores; organização coletiva do trabalho pedagógico; legitimidade da Educação Física; políticas públicas de investimento; participação dos alunos e da família; recursos materiais. O caminho metodológico orientador das análises segue as indicações de Netto (2002 da necessidade de ir aos clássicos e Lessa (1999 para depurar os elementos apresentados na primeira impressão e analisar os seus distintos complexos mediando com a totalidade. As análises permitiram considerar que as indicações realizadas pelos professores de educação física para a superação dos problemas na cotidianidade são soluções formais. Uma solução essencial exige o aporte de uma política radical. (MÉSZÁROS, 2005.

  9. Journalism that Matters: Views from Central and Eastern Europe. By Michał Głowacki, Epp Lauk and Auksė Balčytienė. Bern: Peter Lang, 2014, 214 pp.; ISBN: 978-3-631-65421-7 hb.

    Directory of Open Access Journals (Sweden)

    Elena Rodina

    2015-12-01

    Full Text Available This book is a much-needed contribution to journalistic studies that allows us to have a closer and more nuanced look at media systems and press cultures in the countries of Central and Eastern Europe (CEE from a non-Western perspective. The volume is of high value to anyone who is interested in the diversity that underlies the unifying term of “post-communist media.” Most of its authors rely on rich data collected throughout lengthy periods of time on the territory of Central and Eastern Europe, which allows us to see not only the current state of “Eastern” media, but its development throughout time.

  10. An asymmetric synthesis of (R)-5-(methylamino)-5,6-dihydro-4H-imidazo-[4,5,1-ij]quinolin-2(1H) -one (1) and its [2-14C]-and [6,7-3H2]-labeled forms

    International Nuclear Information System (INIS)

    Heier, R.F.; Moon, M.W.; Stolle, W.T.; Easter, J.A.; Hsi, R.S.P.

    1996-01-01

    (R)-5-(Methylamino)-5,6-dihydro-4H-imidazo [4,5,1-ij)quinolin-2(1H)-one (1) is a dopamine agonist which shows selectivity for the D2 receptor subtype, and is of interest as a potential drug for the treatment of Parkinson's disease. An asymmetric epoxidation approach has been used to prepare 1 in eleven steps (15% overall yield) from 8-nitroquinoline. An advanced intermediate in this synthesis, tert-butyl (R)-methyl(8-amino-1,2,3,4-tetrahydro-3-quinolinyl)carbamate, has been reacted with [ 14 C]phosgene to provide a two-step synthesis of 1 labeled with carbon-14 at the C-2 position (236 μCi/mg). Bromination of 1 gave the dibromo analogue which was reduced in the presence of tritium gas to give 1 labeled with tritium at the C-6 and C-7 positions (28.5 Ci/mmol). In addition to providing syntheses for labeled forms of the drug which are useful in drug disposition and receptor binding studies, this approach also provides a convenient synthesis for the unlabeled form of drug. (author)

  11. Hédelin d’Aubignac, Des Satyres brutes, monstres et démons, Texte établi, présenté et annoté par Gilles Banderier, Grenoble, Jérôme Million, « Petite collection Atopia », 2003, 214 p., bibliographie et glossaire

    Directory of Open Access Journals (Sweden)

    Sophie Houdard

    2010-07-01

    Full Text Available François Hédelin, que l’on connaît mieux sous le nom d’abbé d’Aubignac, a passé son enfance et sa jeunesse à Nemours où son père est Lieutenant Général de la ville. Celui que l’historiographie reconnaîtra pour avoir ouvert le chantier dans les années 1640 de sa célèbre Pratique du Théâtre (1657, signe en 1627 son premier ouvrage, Des Satyres Brutes, Monstres et Demons, de leur nature et adoration. Le jeune avocat se lance dans la carrière juridique et mondaine en satisfaisant la curiosité du...

  12. ORF Alignment: NC_002505 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available IMFDLEDSVALREKDTARMLVFHALQHPMYQEMETVVRVNPLDSEFGIKDLNAVVRXGAK 60 ... Query: 155 GIALGAEDYVRDLRTQRSAEGIELLFARC...SILQAARAAGIMAFDTVYSDANNEEGFLREA 214 ... GIALGAEDYVRDLRTQRSAEGIELLFARCSILQAAR...AAGIMAFDTVYSDANNEEGFLREA Sbjct: 121 GIALGAEDYVRDLRTQRSAEGIELLFARCSILQAARAAGIMAFDTVYSDANNEEGFLREA 180 ...

  13. Glomerular filtration rate after alpha-radioimmunotherapy with 211At-MX35-F(ab')2: a long-term study of renal function in nude mice

    DEFF Research Database (Denmark)

    Back, T.; Haraldsson, B.; Hultborn, R

    2009-01-01

    of the glomerular filtration rate (GFR). The renal toxicity was evaluated at levels close to the dose limit for the bone marrow and well within the range for therapeutic efficacy on tumors. Astatinated MX35-F(ab')(2) monoclonal antibodies were administered intravenously to nude mice. Both non-tumor-bearing animals...... manifested late. Examination of the kidney sections showed histologic changes that were overall subdued. Following alpha-RIT with (211)At-MX35-F(ab')(2) at levels close to the dose limit of severe myelotoxicity, the effects found on renal function were relatively small, with only minor to moderate reductions...... in GFR. These results suggest that a mean absorbed dose to the kidneys of approximately 10 Gy is acceptable, and that the kidneys would not be the primary dose-limiting organ in systemic alpha-RIT when using (211)At-MX35-F(ab')(2) Udgivelsesdato: 2009/12...

  14. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  15. Chemical concentration of a new natural spontaneously fissionable nuclide from solutions with low salt background

    International Nuclear Information System (INIS)

    Korotkin, Yu.S.; Ter-Akop'yan, G.M.; Popeko, A.G.; Drobina, T.P.; Zhuravleva, E.L.

    1982-01-01

    The results of experiments on further concentration of a new natural spontaneously fissionable nuclide, the concentrates of which form the Cheleken geothermal brines have been obtained, are presented. The conclusions are drown about the chemical nature of a new spontaneously fissionable nuclide. It is a chalcophile element which copreipitates with sulphides of copper, lead, arsenic and mercury from weakly acid solutions. The behaviour of the new nuclide in sulphide systems in many respects is similar to the behaviour of polonium, astatine and probably of bismuth. The most probable stable valence of the new nuclide varies from +1 up to +3. The data available on the chemical behaviour of the new nuclide as well as the analysis over contamination by spontaneously fissionable isotopes permit to state that the new natural spontaneously fissionable nuclide does not relate to the known isotopes

  16. Is Electronegativity a Useful Descriptor for the 'Pseudo-Alkali-Metal' NH4?

    International Nuclear Information System (INIS)

    Whiteside, Alexander; Xantheas, Sotiris S.; Gutowski, Maciej S.

    2011-01-01

    Molecular ions in the form of 'pseudo-atoms' are common structural motifs in chemistry, with properties that are transferrable between different compounds. We have determined the electronegativity of the 'pseudo-alkali metal' ammonium (NH4) and evaluated its reliability as a descriptor in comparison to the electronegativities of the alkali metals. The computed properties of its binary complexes with astatine and of selected borohydrides confirm the similarity of NH4 to the alkali metal atoms, although the electronegativity of NH4 is relatively large in comparison to its cationic radius. We paid particular attention to the molecular properties of ammonium (angular anisotropy, geometric relaxation, and reactivity), which can cause deviations from the behaviour expected of a conceptual 'true alkali metal' with this electronegativity. These deviations allow for the discrimination of effects associated with the polyatomic nature of NH4.

  17. Boiling points of the superheavy elements 117 and 118

    International Nuclear Information System (INIS)

    Takahashi, N.

    2001-01-01

    It has been shown that the relativistic effect on the electrons reveal in the heavy element region. What kind of changes will appear in the heavy elements because of the relativistic effects? Can we observe the changes? We observed that the boiling points of astatine and radon are lower than that extrapolated values from lighter elements in the same groups. Systematic behavior of the elements on the boiling point was examined and a new method for the estimation of the boiling points of the superheavy elements in the halogen and rare gases has been found. The estimated values of the elements 117 and 118 are 618 and 247 K, respectively which are considerably lower than those obtained until now. If these values are correct the production of the superheavy elements with heavy ions reaction may be affected. Further, the chemical properties may be fairly different from the lighter elements. (author)

  18. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...... and much less is known of high-LET irradiation. In this paper we investigated the DNA damage response and biological consequences to photons from Cobolt-60 ((60)Co) and alpha particles from (211)At in normal primary thyrocytes of different cell cycle status. For both radiation qualities the intensity...

  19. Fracturas supracondíleas del húmero en niños entre 2 y 14 años. Perfil demográfico y de tratamiento en el Hospital Pablo Tobón Uribe, Medellín, Colombia = Supracondylar fractures of the humerus in children aged 2-14 years. Demographic profile and therapeutic approach at a third-level hospital in Medellín, Colombia

    Directory of Open Access Journals (Sweden)

    Valderrama Molina, Carlos Oliver

    2011-12-01

    Full Text Available Introducción: las fracturas supracondíleas del húmero distal son las lesiones más frecuentes de tratamiento quirúrgico en la población pediátrica. Los informes sobre el perfil demográfico y el enfoque terapéutico de las mismas en Medellín son limitados; este trabajo se llevó a cabo para conocer la epidemiología local de estas lesiones y detectar en el seguimiento los aciertos y errores del tratamiento como base para desarrollar estudios de mayor complejidad.Materiales y métodos: mediante una búsqueda exhaustiva en los registros de historias clíni­cas electrónicas se encontraron 205 casos de fracturas supracondíleas del húmero en niños entre dos y 14 años que ingresaron al Servicio de Urgencias del Hospital Pablo Tobón Uribe entre enero de 2005 y septiembre de 2009. Se analizaron en ellas los aspectos demográficos y terapéuticos.Resultados: el 61,5% de los pacientes fueron varones, la media de la edad fue de 6,6 años, en 62,4% de los casos la fractura afectó el lado izquierdo. La clasificación (Gartland fue como sigue: tipo I: 41,5%; tipo II: 12,2%; tipo III: 46,3%. El 95,6% fueron fracturas cerradas. Se hizo tratamiento quirúrgico en 103 casos (50,2%. El tiempo promedio entre el ingreso y la cirugía fue de 6,7 horas. La técnica quirúrgica más frecuente fue la reducción cerrada con fijación percutánea con clavos cruzados (45,6% de los casos. Se observaron 31 casos (15,1% de le­siones neurológicas, 28 de ellas del nervio ulnar; nueve de las 31 lesiones se registraron en la evaluación posquirúrgica inmediata, todas ellas en pacientes tratados con clavos cruzados. No se registraron lesiones vasculares ni síndromes compartimentales.Conclusión: esta serie presenta el estado actual del perfil demográfico de los pacientes con fracturas supracondíleas del húmero distal en niños y de las modalidades de tratamiento en un hospital de tercer nivel de la ciudad de Medellín. Los resultados pueden ser la base para futuros estudios de mayor elaboración metodológica.

  20. In situ Ge(Li)-spectrometric measurements of gamma radiation from radon daughters under different weather conditions

    International Nuclear Information System (INIS)

    Finck, R.R.; Persson, B.R.R.

    1980-01-01

    The photon fluence from radionuclides in the ground and air was measured continuously with a Ge(Li) spectrometer during several weeks. The most prominent change in photon fluence rate near the ground was obtained during periods of heavy rainfall. Deposition of the short-lived radon daughters 214 Pb and 214 Bi on the ground surface can cause a temporary increase in the external absorbed dose rate of approximately 2μrads/h. The photon fluence from airborne radon daughters can be correlated to the degree of atmospheric stability. During stable conditions the photon fluence increases and the activity ratio 214 Bi/ 214 Pb decreases

  1. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Streptomyces coelicolor ... Length = 117 ... Query: 214 ETPVRDLMAPAAGIVAVDXX...XXXXXXXXXXXXHDRTRLLVRQEDAILGSVHARDVLVXXX 273 ... ETPVRDLMAPAAGIVAVD ... HDRTRLLVRQEDAILGSVHA...RDVLV ... Sbjct: 1 ... ETPVRDLMAPAAGIVAVDAGAEAEEILALAAAHDRTRLLVRQEDAILGSVHARDVLVARA 60 ...

  2. Multivariate regression analysis for determining short-term values of radon and its decay products from filter measurements

    International Nuclear Information System (INIS)

    Kraut, W.; Schwarz, W.; Wilhelm, A.

    1994-01-01

    A multivariate regression analysis is applied to decay measurements of α-resp. β-filter activcity. Activity concentrations for Po-218, Pb-214 and Bi-214, resp. for the Rn-222 equilibrium equivalent concentration are obtained explicitly. The regression analysis takes into account properly the variances of the measured count rates and their influence on the resulting activity concentrations. (orig.) [de

  3. Integrated inventory information system

    Digital Repository Service at National Institute of Oceanography (India)

    Sarupria, J.S.; Kunte, P.D.

    stream_size 5 stream_content_type text/plain stream_name Handbook_Lib_Archives_Inf_Cen_India_7_214.pdf.txt stream_source_info Handbook_Lib_Archives_Inf_Cen_India_7_214.pdf.txt Content-Encoding ISO-8859-1 Content-Type text...

  4. 7 CFR 917.459 - California Peach Grade and Size Regulation.

    Science.gov (United States)

    2010-01-01

    ... inch in length; and mold, brown rot, and decay; and (ii) Free from serious damage due to cuts, skin... Sugar Time (214LC68) I Summer Fling L Summer Kist J Summer Lady L Summerset I Summer Zee L Suncrest G... Snow, Springtreat (60EF32), Sugar Time (214LC68), Supecheight (012-094), Supechnine, Sweet Scarlet...

  5. Ion transfer voltammetry of metformin and phenformin at a polarized ionic liquid-membrane

    Czech Academy of Sciences Publication Activity Database

    Langmaier, Jan; Samec, Zdeněk; Samcová, E.

    2015-01-01

    Roč. 61, č. 3 (2015), s. 214-214 ISSN 0034-6691. [Annual Meeting of the Polarographic Society of Japan /61./. 24.11.2015-25.11.2015, Himeji] R&D Projects: GA ČR(CZ) GA15-03139S Institutional support: RVO:61388955 Keywords : electrochemistry * voltammetry Subject RIV: CG - Electrochemistry

  6. PAEDIATRIC OPHTHALMLOGY

    African Journals Online (AJOL)

    2016-11-04

    Nov 4, 2016 ... versus 6 (21.4%), and blindness 6 (21.4%) versus 7 (25%), P < 0.001. The most common ... Implications for designing preventive health education message. Trop J Health Sci .... game changers in this scenario. Conclusion: ...

  7. About Military Sexual Trauma

    Medline Plus

    Full Text Available ... Health Administration 5,188 views 2:14 Managing Stress with the Moving Forward App: An Overview - Duration: ... 1,852 views 7:19 Maintaining Your Weight Management Efforts - Duration: 0:56. Veterans Health Administration 214 ...

  8. 75 FR 81680 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2010-12-28

    ... Section 214 of the FACT Act as applied to brokers, dealers, and investment companies, as well as... Persons''). As directed by Section 214 of the FACT Act, before a receiving affiliate may make marketing... right to prohibit such marketing. The regulation potentially applies to all of the approximately 21,496...

  9. Balance of the tropospheric ozone and its relation to stratospheric intrusions indicated by cosmogenic radionuclides. Part 14. Final technical report, 1 November 1977-31 January 1984

    International Nuclear Information System (INIS)

    Reiter, R.; Kanter, H.J.; Jaeger, H.; Munzert, K.

    1985-01-01

    The objective was to clarify the effect of stratospheric intrusions on the tropospheric ozone budget. The correlation between stratospheric-tropospheric exchange and solar events was also investigated. Tropospheric ozone was recorded at three different levels. The radioisotopes 7 Be and radon daughter products 214 Pb and 214 Bi were used as tracers to identify the source of ozone

  10. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 214 of 214 ... Vol 23, No 2 (2008), Training for human security, Abstract ... Vol 29, No 2 (2014), University of KwaZulu-Natal's vision of 'African scholarship' and information ... Vol 26, No 2 (2011), Water: An Economic or Social Good?

  11. About Military Sexual Trauma

    Medline Plus

    Full Text Available ... the Misconceptions - Duration: 2:14. Veterans Health Administration 5,188 views 2:14 Managing Stress with the ... 847 views 3:45 Kitchen Knife Skills - Duration: 5:31. Veterans Health Administration 2,605 views 5: ...

  12. Natural and artificial radionuclides in southern of Gulf of Mexico marine sediments

    International Nuclear Information System (INIS)

    Rodriguez-Espinosa, P.F.; Vidal-Lorandi, V.M.V.; Vidal-Lorandi, F.V.

    1999-01-01

    Preliminary results of quantitative analysis of natural and artificial radionuclides in sediment cores of the Southern Gulf of Mexico, reveal the presence of 22.01 Bq/kg 226 Ra, 15.56 Bq/kg 214 Bi, 18.17 Bq/kg 214 Pb, 485.81 Bq/kg 40 K and 2.84 Bq/kg 137 Cs

  13. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    The cavitation erosion is highly dependent on microstructure and mechanical properties. The results show that hot rolled 21-4-N steel is more cavitation erosion resistant than the 13/4 and 21-4-N steels in as cast condition. The eroded surfaces were analysed through optical microscope and scanning electron microscope ...

  14. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. Akhilesh K Chauhan. Articles written in Sadhana. Volume 38 Issue 1 February 2013 pp 25-35. Cavitation erosion resistance of 13/4 and 21-4-N steels · Akhilesh K Chauhan · More Details Abstract Fulltext PDF. Nitrogen strengthened austenitic stainless steel (termed as 21-4-N steel) in as cast and ...

  15. 20 CFR 404.1220 - Identification numbers.

    Science.gov (United States)

    2010-04-01

    .... The special number will also be assigned to an interstate instrumentality if pre-1987 coverage is obtained and SSA will send a Form SSA-214-CD to the interstate instrumentality to notify it of the number.... SSA will send the State a Form SSA-214-CD, “Notice of Identifying Number,” to inform the State of the...

  16. Viis aastat Saviliiva kinnisvarakingitusest. Sundüürnikele läks vaid veidi enam kui veerand elamistest / Kristina Traks

    Index Scriptorium Estoniae

    Traks, Kristina, 1976-

    2011-01-01

    Viis aastat tagasi võitis 214 peret võimaluse osta eluase Tallinnas Kakumäel Saviliiva elamurajoonis. Toona läks 214 majast või korterist sundüürnikele vaid 64. Praeguseks pole enamik loosivõitjaid oma elukohta vahetanud

  17. On the theory of time dilation in chemical kinetics

    Science.gov (United States)

    Baig, Mirza Wasif

    2017-10-01

    The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.

  18. Effect of cetuximab in combination with alpha-radioimmunotherapy in cultured squamous cell carcinomas

    Energy Technology Data Exchange (ETDEWEB)

    Nestor, Marika, E-mail: marika.nestor@bms.uu.s [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden); Sundstroem, Magnus [Unit of Molecular Pathology, Department of Genetics and Pathology, Uppsala University (Sweden); Anniko, Matti [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden)

    2011-01-15

    Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ({sup 211}At-cMAb U36). Effects on {sup 211}At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with {sup 211}At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced {sup 211}At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.

  19. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  20. Development and radiotherapeutic application of 211At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    International Nuclear Information System (INIS)

    Adelstein, S.J.; Zalutsky, M.; Bloomer, W.

    1981-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of 131 I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, 211 At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of 211 At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated

  1. Development and radiotherapeutic application of /sup 211/At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    Energy Technology Data Exchange (ETDEWEB)

    Adelstein, S.J.; Zalutsky, M.; Bloomer, W.

    1981-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.

  2. Alpha particle emitters in medicine

    International Nuclear Information System (INIS)

    Fisher, D.R.

    1989-09-01

    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ( 211 At) and natural bismuth-212 ( 212 Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ( 223 Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs

  3. Studies of Stable Octupole Deformations in the Radium Region

    CERN Multimedia

    2002-01-01

    The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

  4. The radiolabeled monoclonal antibodies in immunoscintigraphy and radioimmunotherapy: current state and perspectives

    International Nuclear Information System (INIS)

    Chatal, J. F.

    2000-01-01

    The antibodies can be satisfactorily labelled with technitium-99 m or indium-111 for tumor immunoscintigraphy. The immunoscintigraphy is not useful for the primary tumor diagnosis. It can be useful for the diagnosis of the some cancer extension and for recurrent tumor visualization. The immunoscintigraphy is widely competed with Positron Emission Tomography (PET) which gives accurate results. In the future the immunoscintigraphy, in pre-therapeutic stage, contribute to the estimation of the dose delivered to the tumor and to normal organs for adopting or not a radioimmunotherapy. The antibodies can also be labeled with Iodine-131 for an application in radioimmunotherapy (RIT). The RIT is efficient in the non-Hodgkin's lymphoma treatment because of their great radiosensitivity. Until now the results have been very modest in solid tumor treatment but methodological and biotechnological progresses have to improve the efficiency especially for the small tumors. In the future iodine-131 which requires the confinement (very expensive) of patients will be substituted by yttrium-90 beta emitter, more energetic than iodine-131 and can be injected in walking case. In the long term, the alpha emitter radionuclides (astatine-211 or bismuth-213) can be used for hematologic cancer treatment. In conclusion the future of radiolabeled monoclonal antibodies is essentially therapeutic. The radioimmunotherapy associated to the chemotherapy give promising perspectives for the radiosensitive cancer treatment and in general small solid tumor treatment (F.M.)

  5. Nuclear and chemical data for life sciences

    International Nuclear Information System (INIS)

    Moumita Maiti; Indian Institute of Technology Roorkee, Roorkee, Uttarakhand

    2013-01-01

    Use of reactor produced radionuclides is popular in life sciences. However, cyclotron production of proton rich radionuclides are being more focused in recent times. These radionuclides have already gained attention in various fields, including life sciences, provided they are obtained in pure form. This article is a representative brief of our contributions in generating nuclear data for the production of proton rich radionuclides of terbium, astatine, technetium, ruthenium, cadmium, niobium, zirconium, rhenium, etc., which may have application in clinical, biological, agriculture studies or in basic research. The chemical data required to separate the product isotopes from the corresponding target matrix have been presented along with a few propositions of radiopharmaceuticals. It also emphasizes on the development of simple empirical technique, based on the nuclear reaction model analysis, to generate reliable nuclear data for the estimation of yield and angular distribution of emitted neutrons and light charged particles from light as well as heavy ion induced reactions on thick stopping targets. These data bear utmost important in radiation dosimetry. (author)

  6. Radiobromination of humanized anti-HER2 monoclonal antibody trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate, a potential label for immunoPET

    Energy Technology Data Exchange (ETDEWEB)

    Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail: vladimir.tolmachev@bms.uu.se

    2005-08-01

    Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.

  7. The in vivo fate of a 211At labelled monoclonal antibody with known specificity in a murine system

    International Nuclear Information System (INIS)

    Vaughan, A.T.M.; Bateman, W.J.; Fisher, D.R.

    1982-01-01

    A monoclonal antibody reactive against the human transferrin receptor has been labelled with the alpha and X ray emitting isotope Astatine 211. The labelling procedure does not affect the ability of the product to bind to the transferrin receptor on the human leukemic cell line HL60. Using a direct binding assay, 211 At labelled antibody can be specifically inhibited from binding to its target cells by excess unlabelled antibody. Furthermore, the binding inhibition demonstrated in this system correlates to enhanced clonogenic survival of these cells, indicating that very few atoms of 211 At/cell are required for cell death. Data obtained from labelled antibody injected into mice show that the labelled product in serum retains the ability to bind to HL60 cells in vitro, although tissue distributions of the injected activity implies that some of the radiolabel is lost from the protein. Despite this loss of label, preliminary experiments on the localization of labelled antibody to HL60 cells growing s/c in nude mice show that tumor tissue has a higher specific activity than all other tissues, other than blood, after 12 hours. This suggests that further work on the nature of label degradation in vivo is warranted in the context of potential therapeutic and diagnostic studies

  8. Effect of cetuximab in combination with alpha-radioimmunotherapy in cultured squamous cell carcinomas

    International Nuclear Information System (INIS)

    Nestor, Marika; Sundstroem, Magnus; Anniko, Matti; Tolmachev, Vladimir

    2011-01-01

    Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ( 211 At-cMAb U36). Effects on 211 At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with 211 At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced 211 At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.

  9. Biological toxicity of intracellular radionuclide decay. Part of a coordinated programme on radiation biology of Auger emitters and their therapeutic applications

    International Nuclear Information System (INIS)

    Hofer, K.G.

    1980-06-01

    Internal radiotherapy should be performed with short-lived radionuclides which emit high LET radiation and short ranged radiation, and accumulated within cancers. Based on these considerations, several radionuclides (tritium, copper-64, gallium-67, iodine-123, iodine 125, iodine-131 and astatine-211) were chosen and their toxicity was assessed using cell division in mammalian cultured cells as a criterion. It was apparent that the toxic effects obtained with 125 I greatly exceeded those observed in cells treated with any other radionuclides. The possible hypotheses to explain the excessive radiosensitivity of 125 I were discussed in relation to microdosimetry calculation. It was also found that the division delay induced by radionuclide decay is primarily due to damage to the cell nucleus but not to the plasma membrane. The key problem remains the development of agents which can serve as carriers for radionuclide accumulation within tumors. Although several promising approaches (Synkavit, tamoxifen, iododeoxyuridine, antibodies, liposomes) were investigated, only 125 I-labelled Synkavit would be desirable for clinical application

  10. 211At-labelling of polymer particles for radiotherapy: synthesis, purification and stability

    International Nuclear Information System (INIS)

    Larsen, R.H.; Hassfjell, S.P.; Hoff, P.; Alstad, J.; Bjoergum, J.

    1993-01-01

    Cyclotron-produced 211 At was distilled from a Bi metal target and coupled to N-succinimidyl-3-(trimethylstannyl)benzoate. The resulting N-succinimidyl-3-( 211 At)astatobenzoate was thereafter coupled to aminated monosized polymer particles with a diameter of 1.8 μm. The total time elapsed from the end of the cyclotron irradiation until the final product was prepared was about 2.5 hours. From 23 to 51% of the target activity at the end of bombardment was measured in the final conjugate. Solid-liquid extraction purification of the astatinated intermediate, using Sep-pak columns (Waters), gave more reproducible yields in the final conjugation step. The 211 At-labelled particles were incubated with fetal calf serum, human serum and human full blood at room temperature. The 211 At activity on the particles was measured before and after three times washing at 4, 24 and 48 hours. The stability was not significantly different from 100% for all media and for all time points. This indicates that 211 At-labelled particles can be stable under in vivo conditions, and may thereby be a promising agent for intracavitary radiotherapy on free-floating cancer cells or surface fixed cells. (Author)

  11. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  12. Development of Reagents for Application of At-211 to Targeted Radionuclide Therapy of Cancer

    International Nuclear Information System (INIS)

    Wilbur, D. Scott

    2011-01-01

    This grant covered only a period of 4 months as the major portion of the award was returned to DOE due to an award of funding from NIH that covered the same research objectives. A letter regarding the termination of the research is attached as the last page of the Final Report. The research conducted was limited due to the short period of this grant, but the results obtained in that period are outlined in the Final Report. The studies addressed in the research effort were directed at a problem that is of critical importance to the in vivo application of the alpha-particle emitting radionuclide At-211. That problem, low in vivo stability of many astatinated molecules, severely limits the use of At-211 in therapeutic applications. The advances sought in the studies were expected to expand the types of biomolecules that can be used as carriers of At-211, and provide improved in vivo targeting of the radiation dose compared with the dose delivered to normal tissue.

  13. Proceedings of transuranium elements

    International Nuclear Information System (INIS)

    Anon.

    1992-01-01

    The identification of the first synthetic elements was established by chemical evidence. Conclusive proof of the synthesis of the first artificial element, technetium, was published in 1937 by Perrier and Segre. An essential aspect of their achievement was the prediction of the chemical properties of element 43, which had been missing from the periodic table and which was expected to have properties similar to those of manganese and rhenium. The discovery of other artificial elements, astatine and francium, was facilitated in 1939-1940 by the prediction of their chemical properties. A little more than 50 years ago, in the spring of 1940, Edwin McMillan and Philip Abelson synthesized element 93, neptunium, and confirmed its uniqueness by chemical means. On August 30, 1940, Glenn Seaborg, Arthur Wahl, and the late Joseph Kennedy began their neutron irradiations of uranium nitrate hexahydrate. A few months later they synthesized element 94, later named plutonium, by observing the alpha particles emitted from uranium oxide targets that had been bombarded with deuterons. Shortly thereafter they proved that is was the second transuranium element by establishing its unique oxidation-reduction behavior. The symposium honored the scientists and engineers whose vision and dedication led to the discovery of the transuranium elements and to the understanding of the influence of 5f electrons on their electronic structure and bonding. This volume represents a record of papers presented at the symposium

  14. المواضيع الإسلامية في الصحافة الحلية صحيفة الفيحاء انموذجاً للفترة من 20/ 4/ 2008 ــ 21/4/ 2009 Islamic topics in the Hilla City press (Al Fayhaa Newspaper as a model for the period from 20/4/2008 - 21/4/2009

    Directory of Open Access Journals (Sweden)

    Hatem Bidwee Obaid م.م .حاتم بديوي عبيد الشمري

    2011-12-01

    Full Text Available According to the Given features that the press enjoyed between the media through its functions and objectives, according to the theory of receiving and repulsion, concerning the nature of the receiving public and that are interested to know Preference conduct what receive of contents that incompatible with his beliefs or consistent with, and is subject content to process selection, so gave theoretical Islamic Media self-responsibility for who does calling focusing on the conscience and faith, So who does contact demands review of values ​​that are consistent with Islamic principles and moral, it is commentary and interpretations and essays and analyzes and news and information not in accordance with inclinations or tendencies media company in which it operates, but according to objective aimed that contribute to achieve stability, guidance and education, knowledge and achievement. All of this leads to highlighting the importance of the role of the media in building contemporary Islamic societies. So came the idea of ​​a researcher to identify the topics published in the Islamic press Ornament and the attention of those who made it. The research was divided into four sections, the first section is a methodological framework for the research, which included the importance of research and his problem and his goal method and procedures of the research and society. The second section was divided into two first: the history of the Islamic press in general in Iraq, and the second topic: the history of the Islamic press in Hilla. The third section has been allocated: the speech Media Islamic and dealt with three topics, the first: the Islamic discourse in general and the press in particular, the second topic: has been allocated for sources Islamic themes, and the third topic: was on the characteristics and attributes of media discourse Islamic. The fourth section: has been allocated for the analytical study of topics published in The Islamic Fayhaa within the period subject to search, and at the end of the researcher Find out some results in addition to the sources relied upon in the search.

  15. The Endophytic Symbiont—Pseudomonas aeruginosa Stimulates the Antioxidant Activity and Growth of Achyranthes aspera L.

    Directory of Open Access Journals (Sweden)

    Khaidem A. Devi

    2017-09-01

    Full Text Available A plant growth promoting bacterial endophyte designated as AL2-14B isolated from the leaves of Achyranthes aspera L. was identified as Pseudomonas aeruginosa based on its phenotypic and physiological features, and 16S rRNA gene sequence analysis. AL2-14B had plant growth stimulating attributes including siderophore and indole acetic acid release, inorganic phosphate solubilization, along with nitrogenase, ammonification, and protease activities. It also exhibited antifungal property against Rhizoctonia solani. The plantlets grown in germ-free condition were inoculated with AL2-14B and studied for the colonization of endophyte. Significant increase in population of AL2-14B between 3rd and 5th days after inoculation was recorded. The treatment of plants with endophytic P. aeruginosa AL2-14B increased nitrogen, phosphorus, potassium (NPK contents in plant by 3.8, 12.59, and 19.15%, respectively. Significant enhancement of shoot and root length, dry leaf, dry shoot and dry root weight, and leaf surface area as compared to control (P < 0.05 was recorded in AL2-14B inoculated plants. The antioxidant activities increased in plants grown in germ-free conditions and inoculated with AL2-14B. The present study emphasizes on the role of diazotrophic endophyte P. aeruginosa AL2-14B in stimulating growth of A. aspera L. and improvement of its medicinal properties. Significant increase in growth and antioxidant content of P. aeruginosa AL2-14B treated plants suggests the possibility of an economical and eco-friendly mean of achieving antioxidants rich, healthier A. aspera plants.

  16. Studies on spatial distribution of indoor radon concentration at Mysore city, India

    International Nuclear Information System (INIS)

    Pruthvi Rani, K.S.; Chandrashekara, M.S.; Paramesh, L.

    2016-01-01

    Radon is a radioactive inert gas, with a half life of 3.82 days. Radium present in soil rocks and building material are the sources of atmospheric radon. Radon and its short-lived decay products ( 218 Po, 214 Pb, 214 Bi, and 214 Po) can be deposited in the lung tissues and give rise to higher radiation doses. Radon is now recognized as the second most important cause of lung cancer after smoking in the general population. In the present investigation a systematic study of the distribution of radon concentration has been carried out in a small room at different co-ordinates and time scales

  17. UK Citizens Lack Simple, Objective Knowledge of the European Union

    DEFF Research Database (Denmark)

    Manners, Ian James

    2017-01-01

    214); ‘A direct European tax will be created’ (EBS 214); ‘National citizenship will disappear’ (EBS 214); and ‘Most of the European budget is spent on administrative and personnel costs’ (EB65) UK respondents were far more likely to answer incorrectly that these were true. This is likely the result...... of disinformation in UK politics and media. The data suggests that not only are UK respondents unable to answer simple questions about the EU, but that they are relatively more likely to answer incorrectly rather than admit they did not know, reflecting disinformation about the EU in the UK. This lack of simple...

  18. Environmental Assessment for Increased Depleted Uranium Use on Target 63-10, Nevada Test and Training Range

    Science.gov (United States)

    2006-09-01

    min. β Bismuth-214 19.9 min. β Polonium -214 1.5 x 10-4 sec. α Lead- 210 22 years β Bismuth- 210 5 days β Polonium - 210 140 days α Lead-206 stable...Uranium-234 2.5 x 105 years α Thorium-230 7.7 x 104 years α Radium-226 1600 years α Radon-222 3.8235 days α Polonium -218 3.05 min. α Lead-214 26.8...the degraded areas where ordnance delivery occurs. This also applies to DU use. These areas do not provide food or habitat resources likely to

  19. On the removal efficiency of padon decay products by fog droplets

    International Nuclear Information System (INIS)

    Girgzhdis, A.I.; Girgzhdene, R.V.; Shopauskas, K.K.

    1978-01-01

    The results of the experimental investigations on quantitative evaluation of the 218 Po and 214 Bi washout efficiency by fog in an aerosol chamber are presented. The radioactivity has been measured by means of α-spectrometric method. Comparison of eXperimental and calculated data is made. The 218 Po and 214 Bi washout efficiency ratio is found to be dependent mainly on the aerosol concentration. The change of 218 Po concentration imitates the process of coagulation of free atoms of light ions, and that of 214 Bi - of aerosol particles by fog droplets

  20. 49 CFR 1248.101 - Commodity codes required.

    Science.gov (United States)

    2010-10-01

    ... oils. 2095 Roasted coffee, including instant coffee. 2096 Shortening, table oils, margarine and other... noodles. 21 Tobacco Products: 211 Cigarettes. 212 Cigars. 213 Chewing and Smoking Tobacco and Snuff. 214...