WorldWideScience

Sample records for astatine 214

  1. Radiochemistry of astatine

    Energy Technology Data Exchange (ETDEWEB)

    Ruth, T J; Dombsky, M; D' Auria, J M; Ward, T E

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs. (DLC)

  2. Discovery of the astatine, radon, francium, and radium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-09-15

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  3. Discovery of the astatine, radon, francium, and radium isotopes

    CERN Document Server

    Fry, C

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Discovery of the astatine, radon, francium, and radium isotopes

    Science.gov (United States)

    Fry, C.; Thoennessen, M.

    2013-09-01

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  5. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Energy Technology Data Exchange (ETDEWEB)

    Uusitalo, J.; Jakobsson, U. [Department of Physics, University of Jyvaeskylae (Finland); Collaboration: RITU-Gamma Gollaboration

    2011-11-30

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  6. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Science.gov (United States)

    Uusitalo, J.; Jakobsson, U.

    2011-11-01

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  7. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  8. Measurement of the first ionization potential of astatine by laser ionization spectroscopy.

    Science.gov (United States)

    Rothe, S; Andreyev, A N; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yuri; Köster, U; Lane, J F W; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt, K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine.

  9. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Jakobsson, U., E-mail: ulrjak@kth.se; Cederwall, B. [KTH, The Division of Nuclear Physics, AlbaNova University Center, SE-10691 Stockholm (Sweden); Uusitalo, J.; Auranen, K.; Badran, H.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; Herzáň, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J. [University of Jyvaskyla, Department of Physics, P.O. Box 35, FI-40014 University of Jyvaskyla (Finland); and others

    2015-10-15

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2{sup +} state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2{sup +} state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2{sup +} state and the spherical 9/2{sup −} ground state in {sup 203}Fr and {sup 205}Fr.

  10. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Science.gov (United States)

    Jakobsson, U.; Uusitalo, J.; Auranen, K.; Badran, H.; Cederwall, B.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; HerzáÅ, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J.; Scholey, C.; Sorri, J.; Stolze, S.

    2015-10-01

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2+ state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2+ state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2+ state and the spherical 9/2- ground state in 203Fr and 205Fr.

  11. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...

  12. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    NARCIS (Netherlands)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Koester, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjoedin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical

  13. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  14. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even sing...... of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies....

  15. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  16. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  17. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  18. 18 CFR 385.214 - Intervention (Rule 214).

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Intervention (Rule 214..., Notices of Tariff or Rate Examination, Orders To Show Cause, Intervention, and Summary Disposition § 385.214 Intervention (Rule 214). (a) Filing. (1) The Secretary of Energy is a party to any proceeding upon...

  19. Adsorption of the astatine species on a gold surface: A relativistic density functional theory study

    Science.gov (United States)

    Demidov, Yuriy; Zaitsevskii, Andréi

    2018-01-01

    We report first-principle based studies of the adsorption interaction of astatine species on a gold surface. These studies are aimed primarily at the support and interpretation of gas chromatographic experiments with superheavy elements, tennessine (Ts, Z = 117), a heavier homologue of At, and possibly its pseudo-homologue nihonium (Nh, Z = 113). We use gold clusters with up to 69 atoms to simulate the adsorption sites and estimate the desorption energies of At & AtOH from a stable gold (1 1 1) surface. To describe the electronic structure of At -Aun and AtOH -Aun complexes, we combine accurate shape-consistent relativistic pseudopotentials and non-collinear two-component relativistic density functional theory. The predicted desorption energies of At and AtOH on gold are 130 ± 10 kJ/mol and 90 ± 10 kJ/mol, respectively. These results confirm the validity of the estimates derived from chromatographic data (147 ± 15 kJ/mol for At, and 100-10+20 kJ/mol for AtOH).

  20. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  1. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  2. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  3. 22 CFR 214.34 - Public participation.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Public participation. 214.34 Section 214.34... Committees § 214.34 Public participation. (a) Each advisory committee meeting is to be open to the public... Federal Register. (e) To facilitate public participation in advisory committee meetings which are to be...

  4. 24 CFR 214.303 - Performance criteria.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Performance criteria. 214.303 Section 214.303 Housing and Urban Development Regulations Relating to Housing and Urban Development... HOUSING COUNSELING PROGRAM Program Administration § 214.303 Performance criteria. To maintain HUD-approved...

  5. 42 CFR 93.214 - Institutional member.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Institutional member. 93.214 Section 93.214 Public... MISCONDUCT Definitions § 93.214 Institutional member. Institutional member or members means a person who is... members may include, but are not limited to, officials, tenured and untenured faculty, teaching and...

  6. 10 CFR 21.4 - Interpretations.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Interpretations. 21.4 Section 21.4 Energy NUCLEAR REGULATORY COMMISSION REPORTING OF DEFECTS AND NONCOMPLIANCE General Provisions § 21.4 Interpretations. Except as specifically authorized by the Commission in writing, no interpretation of the meaning of the...

  7. 49 CFR 214.305 - Compliance dates.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Compliance dates. 214.305 Section 214.305..., DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY Roadway Worker Protection § 214.305 Compliance dates. Each program adopted by a railroad shall comply not later than the date specified in the following...

  8. 20 CFR 802.214 - Intervention.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Intervention. 802.214 Section 802.214 Employees' Benefits BENEFITS REVIEW BOARD, DEPARTMENT OF LABOR RULES OF PRACTICE AND PROCEDURE Prereview Procedures Initial Processing § 802.214 Intervention. (a) If a person or legal entity shows in a written...

  9. 49 CFR 214.323 - Foul time.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Foul time. 214.323 Section 214.323 Transportation... TRANSPORTATION RAILROAD WORKPLACE SAFETY Roadway Worker Protection § 214.323 Foul time. Working limits established on controlled track through the use of foul time procedures shall comply with the following...

  10. 24 CFR 884.214 - Marketing.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Marketing. 884.214 Section 884.214... HOUSING PROJECTS Project Development and Operation § 884.214 Marketing. (a) Compliance with equal opportunity requirements. Marketing of units and selection of Families by the Owner shall be in accordance...

  11. 29 CFR 1603.214 - Evidence.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 4 2010-07-01 2010-07-01 false Evidence. 1603.214 Section 1603.214 Labor Regulations... GOVERNMENT EMPLOYEE RIGHTS ACT OF 1991 Hearings § 1603.214 Evidence. The administrative law judge shall accept relevant non-privileged evidence in accordance with the Federal Rules of Evidence (28 U.S.C...

  12. 23 CFR 646.214 - Design.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Design. 646.214 Section 646.214 Highways FEDERAL HIGHWAY... Projects § 646.214 Design. (a) General. (1) Facilities that are the responsibility of the railroad for maintenance and operation shall conform to the specifications and design standards used by the railroad in its...

  13. 42 CFR 2.14 - Minor patients.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Minor patients. 2.14 Section 2.14 Public Health... ALCOHOL AND DRUG ABUSE PATIENT RECORDS General Provisions § 2.14 Minor patients. (a) Definition of minor... patient acting alone has the legal capacity under the applicable State law to apply for and obtain alcohol...

  14. 33 CFR 214.9 - Requirements.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Requirements. 214.9 Section 214.9 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE EMERGENCY SUPPLIES OF DRINKING WATER § 214.9 Requirements. Providing emergency supplies of clean drinking water...

  15. 24 CFR 214.300 - Counseling services.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Counseling services. 214.300... HOUSING COUNSELING PROGRAM Program Administration § 214.300 Counseling services. (a) Basic requirements. (1) Agencies must provide counseling to current and potential homeowners and tenants to assist them...

  16. 24 CFR 214.103 - Approval criteria.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Approval criteria. 214.103 Section... COUNSELING PROGRAM Approval and Disapproval of Housing Counseling Agencies § 214.103 Approval criteria. The following criteria for approval apply to all agencies, MSOs, and intermediaries, including all local housing...

  17. 24 CFR 92.214 - Prohibited activities.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Prohibited activities. 92.214... Development HOME INVESTMENT PARTNERSHIPS PROGRAM Program Requirements Eligible and Prohibited Activities § 92.214 Prohibited activities. (a) HOME funds may not be used to: (1) Provide project reserve accounts...

  18. 40 CFR 94.214 - Production engines.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Production engines. 94.214 Section 94...) CONTROL OF EMISSIONS FROM MARINE COMPRESSION-IGNITION ENGINES Certification Provisions § 94.214 Production... his/her request, a reasonable number of production engines, as specified by the Administrator. The...

  19. 15 CFR 280.214 - Hearings.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Hearings. 280.214 Section 280.214 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade NATIONAL INSTITUTE OF... proceedings will be taken by reporter or by electronic recording, transcribed and filed with the...

  20. 49 CFR 195.214 - Welding procedures.

    Science.gov (United States)

    2010-10-01

    ... accordance with welding procedures qualified under Section 5 of API 1104 or Section IX of the ASME Boiler and Pressure Vessel Code (incorporated by reference, see § 195.3) . The quality of the test welds used to... 49 Transportation 3 2010-10-01 2010-10-01 false Welding procedures. 195.214 Section 195.214...

  1. 47 CFR 214.3 - Assumptions.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Assumptions. 214.3 Section 214.3 Telecommunication OFFICE OF SCIENCE AND TECHNOLOGY POLICY AND NATIONAL SECURITY COUNCIL PROCEDURES FOR THE USE AND..., will have authority to make new or revised assignments of radio frequencies in accordance with...

  2. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  3. 32 CFR 552.214 - Procedures.

    Science.gov (United States)

    2010-07-01

    ... on the Installation of Aberdeen Proving Ground, Maryland § 552.214 Procedures. (a) Any person or... Ground must submit a written request to the Commander, U.S. Army Garrison, Aberdeen Proving Ground, ATTN: STEAP-CO, 2201 Aberdeen Boulevard, Aberdeen Proving Ground, Maryland 21005-5001. The request must be...

  4. Civil works 513 - 289 - 214: traffic disturbance

    CERN Multimedia

    Optical Fibre Section

    2005-01-01

    The TS/EL group informs you that, in order to create an optical fibre access for the GEANT2 project, the Rutherford road between buildings 289 and 214 will be closed to the public on the 13th of July 2005. Part of the Sophora parking will be closed during the works (week 28, 11th - 15th July). Please respect the road signs put into place. For more information, please contact 160484. Optical Fibre Section, TS/EL

  5. 30 CFR 77.214 - Refuse piles; general.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Refuse piles; general. 77.214 Section 77.214... Installations § 77.214 Refuse piles; general. (a) Refuse piles constructed on or after July 1, 1971, shall be..., tipples, or other surface installations and such piles shall not be located over abandoned openings or...

  6. 34 CFR 300.214-300.219 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 34 Education 2 2010-07-01 2010-07-01 false 300.214-300.219 Section 300.214-300.219 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND... DISABILITIES Local Educational Agency Eligibility §§ 300.214-300.219 ...

  7. 40 CFR 21.4 - Review of application.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Review of application. 21.4 Section 21.4 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL SMALL BUSINESS § 21.4 Review of..., efficiency, or technological standpoint. (c) An application which proposes additions, alterations, or methods...

  8. 48 CFR 214.202-5 - Descriptive literature.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Descriptive literature. 214.202-5 Section 214.202-5 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS... 214.202-5 Descriptive literature. (c) Requirements of invitation for bids. When brand name or equal...

  9. 48 CFR 12.214 - Cost Accounting Standards.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Cost Accounting Standards. 12.214 Section 12.214 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION... Items 12.214 Cost Accounting Standards. Cost Accounting Standards (CAS) do not apply to contracts and...

  10. 12 CFR 214.5 - Accounts with foreign banks.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Accounts with foreign banks. 214.5 Section 214.5 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM RELATIONS WITH FOREIGN BANKS AND BANKERS (REGULATION N) Regulations § 214.5 Accounts with foreign banks. (a...

  11. 29 CFR 825.214 - Employee right to reinstatement.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Employee right to reinstatement. 825.214 Section 825.214... THE FAMILY AND MEDICAL LEAVE ACT OF 1993 Employee Leave Entitlements Under the Family and Medical Leave Act § 825.214 Employee right to reinstatement. General rule. On return from FMLA leave, an...

  12. 25 CFR 214.23 - Plat of mine location.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Plat of mine location. 214.23 Section 214.23 Indians... LANDS, OKLAHOMA, FOR MINING, EXCEPT OIL AND GAS § 214.23 Plat of mine location. Lessees are required, when so requested, to file a plat of their leases showing exact locations of all mines, proposed...

  13. 36 CFR 2.14 - Sanitation and refuse.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Sanitation and refuse. 2.14 Section 2.14 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR RESOURCE PROTECTION, PUBLIC USE AND RECREATION § 2.14 Sanitation and refuse. (a) The following are...

  14. 19 CFR 10.214 - Certificate of Origin.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Certificate of Origin. 10.214 Section 10.214... the African Growth and Opportunity Act § 10.214 Certificate of Origin. (a) General. A Certificate of Origin must be employed to certify that a textile or apparel article being exported from a beneficiary...

  15. 5 CFR 179.214 - Interest, penalties and administrative costs.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Interest, penalties and administrative costs. 179.214 Section 179.214 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS Salary Offset § 179.214 Interest, penalties and administrative costs...

  16. An automated flow system incorporating in-line acid dissolution of bismuth metal from a cyclotron irradiated target assembly for use in the isolation of astatine-211

    Energy Technology Data Exchange (ETDEWEB)

    O’Hara, Matthew J.; Krzysko, Anthony J.; Niver, Cynthia M.; Morrison, Samuel S.; Owsley, Stanley L.; Hamlin, Donald K.; Dorman, Eric F.; Scott Wilbur, D.

    2017-04-01

    Astatine-211 (211At) is a promising cyclotron-produced radionuclide being investigated for use in targeted alpha therapy of blood borne and metastatic cancers, as well as treatment of tumor remnants after surgical resections. The isolation of trace quantities of 211At, produced within several grams of a Bi metal cyclotron target, involves a complex, multi-step procedure: (1) Bi metal dissolution in strong HNO3, (2) distillation of the HNO3 to yield Bi salts containing 211At, (3) dissolution of the salts in strong HCl, (4) solvent extraction of 211At from bismuth salts with diisopropyl ether (DIPE), and (5) back-extraction of 211At from DIPE into NaOH, leading to a purified 211At product. Step (1) has been addressed first to begin the process of automating the onerous 211At isolation process. A computer-controlled Bi target dissolution system has been designed. The system performs in-line dissolution of Bi metal from the target assembly using an enclosed target dissolution block, routing the resulting solubilized 211At/Bi mixture to the subsequent process step. The primary parameters involved in Bi metal solubilization (HNO3 concentration and influent flow rate) were optimized prior to evaluation of the system performance on replicate cyclotron irradiated targets. The results indicate that the system performs reproducibly, having nearly quantitative release of 211At from irradiated targets, with cumulative 211At recoveries that follow a sigmoidal function. The predictable nature of the 211At release profile allows the user to tune the system to meet target processing requirements.

  17. 32 CFR Appendix A to Part 45 - DD Form 214

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false DD Form 214 A Appendix A to Part 45 National... CERTIFICATE OF RELEASE OR DISCHARGE FROM ACTIVE DUTY (DD FORM 214/5 SERIES) Pt. 45, App. A Appendix A to Part 45—DD Form 214 EC23OC91.003 EC23OC91.004 EC23OC91.005 EC23OC91.006 ...

  18. Reagents for astatination of biomolecules. 2. Conjugation of anionic boron cage pendant groups to a protein provides a method for direct labeling that is stable to in vivo deastatination.

    Science.gov (United States)

    Wilbur, D Scott; Chyan, Ming-Kuan; Hamlin, Donald K; Vessella, Robert L; Wedge, Timothy J; Hawthorne, M Frederick

    2007-01-01

    Cancer-targeting biomolecules labeled with 211At must be stable to in vivo deastatination, as control of the 211At distribution is critical due to the highly toxic nature of alpha-particle emission. Unfortunately, no astatinated aryl conjugates have shown in vivo stability toward deastatination when (relatively) rapidly metabolized proteins, such as monoclonal antibody Fab' fragments, are labeled. As a means of increasing the in vivo stability of 211At-labeled proteins, we have been investigating antibody conjugates of boron cage moieties. In this investigation, protein-reactive derivatives containing a nido-carborane (2), a bis-nido-carborane derivative (Venus Flytrap Complex, 3), and four 2-nonahydro-closo-decaborate(2-) derivatives (4-7) were prepared and conjugated with an antibody Fab' fragment such that subsequent astatination and in vivo tissue distributions could be obtained. To aid in determination of stability toward in vivo deastatination, the Fab'-borane conjugates were also labeled with 125I, and that material was coinjected with the 211At-labeled Fab'. For comparison, direct labeling of the Fab' with 125I and 211At was conducted. Direct labeling with Na[125I]I and Chloramine-T gave an 89% radiochemical yield. However, direct labeling of the Fab' with Na[211At]At and Chloramine-T resulted in a yield of Studies to optimize the closo-decaborate(2-) conjugates for protein labeling are underway.

  19. 24 CFR 214.313 - Housing counseling fees.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Housing counseling fees. 214.313... HOUSING COUNSELING PROGRAM Program Administration § 214.313 Housing counseling fees. (a) Participating agencies may charge reasonable and customary fees for housing education and counseling services, as long as...

  20. 49 CFR 214.313 - Responsibility of individual roadway workers.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Responsibility of individual roadway workers. 214... RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY Roadway Worker Protection § 214.313 Responsibility of individual roadway workers. (a) Each roadway worker is responsible for...

  1. 49 CFR 214.345 - Training for all roadway workers.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Training for all roadway workers. 214.345 Section... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY Roadway Worker Protection § 214.345 Training for all roadway workers. The training of all roadway workers shall include, as a minimum, the...

  2. 5 CFR 531.214 - Setting pay upon promotion.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Setting pay upon promotion. 531.214... Changes § 531.214 Setting pay upon promotion. (a) General. An agency must set an employee's payable rate of basic pay upon promotion following the rules in this section, consistent with 5 U.S.C. 5334(b...

  3. 40 CFR 86.214-94 - Analytical gases.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Analytical gases. 86.214-94 Section 86.214-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED... Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty...

  4. 49 CFR 214.319 - Working limits, generally.

    Science.gov (United States)

    2010-10-01

    ... a roadway worker who is qualified in accordance with § 214.353 of this part shall establish or have control over working limits for the purpose of establishing on-track safety. (b) Only one roadway worker..., DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY Roadway Worker Protection § 214.319 Working limits...

  5. 47 CFR 214.6 - Postattack procedures and actions.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Postattack procedures and actions. 214.6 Section 214.6 Telecommunication OFFICE OF SCIENCE AND TECHNOLOGY POLICY AND NATIONAL SECURITY COUNCIL...) Government agencies having need for new radio frequency assignments or for modification of existing...

  6. 48 CFR 452.214-70 - Award by Lot.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Award by Lot. 452.214-70... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 452.214-70 Award by Lot. As prescribed in 414.201-6, insert a provision substantially as follows: Award by Lot (NOV 1996) Subject to the...

  7. 48 CFR 1552.214-71 - Contract award-other factors-formal advertising.

    Science.gov (United States)

    2010-10-01

    ... factors-formal advertising. 1552.214-71 Section 1552.214-71 Federal Acquisition Regulations System... Provisions and Clauses 1552.214-71 Contract award—other factors—formal advertising. As prescribed in 1514.201... Advertising” (FAR 52.214-10), and “Contract Award—Construction” (FAR 52.214-19). All other evaluation...

  8. 31 CFR 800.214 - Foreign government-controlled transaction.

    Science.gov (United States)

    2010-07-01

    ... (Continued) OFFICE OF INVESTMENT SECURITY, DEPARTMENT OF THE TREASURY REGULATIONS PERTAINING TO MERGERS, ACQUISITIONS, AND TAKEOVERS BY FOREIGN PERSONS Definitions § 800.214 Foreign government-controlled transaction...

  9. 47 CFR 90.214 - Transient frequency behavior.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Transient frequency behavior. 90.214 Section 90... PRIVATE LAND MOBILE RADIO SERVICES General Technical Standards § 90.214 Transient frequency behavior... Behavior for Equipment Designed to Operate on 25 kHz Channels t1 4 ±25.0 kHz 5.0 ms 10.0 ms t2 ±12.5 kHz 20...

  10. 40 CFR 262.214 - Laboratory management plan.

    Science.gov (United States)

    2010-07-01

    ...(a), including: (i) Identifying whether the eligible academic entity will use the term “unwanted... Waste Determination and Accumulation of Unwanted Material for Laboratories Owned by Eligible Academic Entities § 262.214 Laboratory management plan. An eligible academic entity must develop and retain a...

  11. Lukas 2:14 vanuit 'n Joods-Christelike perspektief

    African Journals Online (AJOL)

    A concordance to the Septuagint, Vol L Graz: Akademische Druck- u Verlagsanstalt. Jeremias, J 1980. Die sprache des Lukasevangeliums. Gottingen; Vandenhoeck &. Ruprecht. Kilpatrick, R S 1988. The Greek syntax of Luke 2:14. NTS 34,472-475. Maier, G 1991. Lukas-Evangelium, 1 Teil. Neuhausen-Stuttgart: Hanssler.

  12. 41 CFR 101-6.214 - Judicial review.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Judicial review. 101-6... in Programs Receiving Federal Financial Assistance § 101-6.214 Judicial review. Action taken pursuant to section 602 of the Act is subject to judicial review as provided in section 603 of the Act. ...

  13. 33 CFR 214.10 - Types of assistance.

    Science.gov (United States)

    2010-07-01

    ... DEFENSE EMERGENCY SUPPLIES OF DRINKING WATER § 214.10 Types of assistance. The temporary emergency supplies of clean drinking water may be provided through such actions as: (a) The use of water tank trucks to haul clean drinking water from a nearby known safe source to water points established for local...

  14. 27 CFR 24.214 - Spanish type blending sherry.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Spanish type blending... BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Production of Other Than Standard Wine § 24.214 Spanish..., produced under this section, is designated “Spanish Type Blending Sherry.” Upon removal, the shipping...

  15. microRNA-214-mediated UBC9 expression in glioma.

    Science.gov (United States)

    Zhao, Zhiqiang; Tan, Xiaochao; Zhao, Ani; Zhu, Liyuan; Yin, Bin; Yuan, Jiangang; Qiang, Boqin; Peng, Xiaozhong

    2012-11-01

    It has been reported that ubiquitin-conjugating enzyme 9 (Ubc9), the unique enzyme2 in the sumoylation pathway, is up-regulated in many cancers. However, the expression and regulation of UBC9 in glioma remains unknown. In this study, we found that Ubc9 was up-regulated in glioma tissues and cell lines compared to a normal control. UBC9 knockdown by small interfering RNA (siRNA) affected cell proliferation and apoptosis in T98G cells. Further experiments revealed that microRNA (miR)-214 directly targeted the 3' untranslated region (UTR) of UBC9 and that there was an inverse relationship between the expression levels of miR-214 and UBC9 protein in glioma tissues and cells. miR-214 overexpression suppressed the endogenous UBC9 protein and affected T98G cell proliferation. These findings suggest that miR-214 reduction facilitates UBC9 expression and is involved in the regulation of glioma cell proliferation.

  16. microRNA-214-mediated UBC9 expression in glioma

    Directory of Open Access Journals (Sweden)

    Zhiqiang Zhao, Xiaochao Tan, Ani Zhao, Liyuan Zhu, Bin Yin, Jiangang Yuan, Boqin Qiang & Xiaozhong Peng*

    2012-11-01

    Full Text Available It has been reported that ubiquitin-conjugating enzyme 9 (Ubc9,the unique enzyme2 in the sumoylation pathway, is up-regulatedin many cancers. However, the expression and regulation ofUBC9 in glioma remains unknown. In this study, we found thatUbc9 was up-regulated in glioma tissues and cell lines comparedto a normal control. UBC9 knockdown by small interfering RNA(siRNA affected cell proliferation and apoptosis in T98G cells.Further experiments revealed that microRNA (miR-214 directlytargeted the 3' untranslated region (UTR of UBC9 and that therewas an inverse relationship between the expression levels ofmiR-214 and UBC9 protein in glioma tissues and cells. miR-214overexpression suppressed the endogenous UBC9 protein andaffected T98G cell proliferation. These findings suggest thatmiR-214 reduction facilitates UBC9 expression and is involvedin the regulation of glioma cell proliferation

  17. 48 CFR 52.214-21 - Descriptive Literature.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Descriptive Literature. 52....214-21 Descriptive Literature. As prescribed in 14.201-6(p)(1), insert the following provision: Descriptive Literature (APR 2002) (a) Descriptive literature, as used in this provision, means information...

  18. Phenotype abnormality: 214 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 214 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u720i decreased sensitivity... under influence of abscisic acid ... decreased sensitivity toward ... 2-cis-abscisic acid ...

  19. 5 CFR 214.402 - Career reserved positions.

    Science.gov (United States)

    2010-01-01

    ... EXECUTIVE SERVICE Types of Positions § 214.402 Career reserved positions. (a) The head of each agency is... collection of taxes and the preparation or review of interpretative opinions. (2) Career reserved positions also include: (i) Scientific or other highly technical or professional positions where the duties and...

  20. 40 CFR 92.214 - Production locomotives and engines.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Production locomotives and engines. 92... (CONTINUED) CONTROL OF AIR POLLUTION FROM LOCOMOTIVES AND LOCOMOTIVE ENGINES Certification Provisions § 92.214 Production locomotives and engines. Any manufacturer or remanufacturer obtaining certification...

  1. 29 CFR 779.214 - “Business” purpose.

    Science.gov (United States)

    2010-07-01

    ... RETAILERS OF GOODS OR SERVICES Employment to Which the Act May Apply; Enterprise Coverage Common Business Purpose § 779.214 “Business” purpose. The activities described in section 3(r) are included in an enterprise only when they are performed for a “business” purpose. Activities of eleemosynary, religious, or...

  2. 31 CFR 585.214 - Evasions; attempts; conspiracies.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Evasions; attempts; conspiracies. 585... Prohibitions § 585.214 Evasions; attempts; conspiracies. Any transaction for the purpose of, or which has the... set forth in this subpart, is hereby prohibited. Any attempt to violate the prohibitions set forth in...

  3. 48 CFR 52.214-31 - Facsimile Bids.

    Science.gov (United States)

    2010-10-01

    ... identify the bid. (6) Illegibility of bid. (7) Security of bid data. (End of provision) ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Facsimile Bids. 52.214-31... Facsimile Bids. As prescribed in 14.201-6(v), insert the following provision: Facsimile Bids (DEC 1989) (a...

  4. 12 CFR 347.214 - Branch established under section 5 of the International Banking Act.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Branch established under section 5 of the International Banking Act. 347.214 Section 347.214 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION REGULATIONS AND STATEMENTS OF GENERAL POLICY INTERNATIONAL BANKING Foreign Banks § 347.214 Branch established...

  5. 48 CFR 1852.214-70 - Caution to offerors furnishing descriptive literature.

    Science.gov (United States)

    2010-10-01

    ... furnishing descriptive literature. 1852.214-70 Section 1852.214-70 Federal Acquisition Regulations System... CLAUSES Texts of Provisions and Clauses 1852.214-70 Caution to offerors furnishing descriptive literature... Descriptive Literature (DEC 1988) Bidders are cautioned against furnishing as a part of their bids descriptive...

  6. 13 CFR 120.214 - What conditions apply for variable interest rates?

    Science.gov (United States)

    2010-01-01

    ... interest rates? 120.214 Section 120.214 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Policies Specific to 7(a) Loans Maturities; Interest Rates; Loan and Guarantee Amounts § 120.214 What conditions apply for variable interest rates? A Lender may use a variable rate of interest...

  7. 32 CFR Appendix B to Part 45 - DD Form 214ws

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false DD Form 214ws B Appendix B to Part 45 National... CERTIFICATE OF RELEASE OR DISCHARGE FROM ACTIVE DUTY (DD FORM 214/5 SERIES) Pt. 45, App. B Appendix B to Part 45—DD Form 214ws EC23OC91.007 ...

  8. 12 CFR 741.214 - Report of crime or catastrophic act and Bank Secrecy Act compliance.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Report of crime or catastrophic act and Bank Secrecy Act compliance. 741.214 Section 741.214 Banks and Banking NATIONAL CREDIT UNION ADMINISTRATION... Unions § 741.214 Report of crime or catastrophic act and Bank Secrecy Act compliance. Any credit union...

  9. 40 CFR 2.214 - Defense of Freedom of Information Act suits; participation by affected business.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Defense of Freedom of Information Act suits; participation by affected business. 2.214 Section 2.214 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL PUBLIC INFORMATION Confidentiality of Business Information § 2.214 Defense of...

  10. 48 CFR 52.214-34 - Submission of Offers in the English Language.

    Science.gov (United States)

    2010-10-01

    ... the English Language. 52.214-34 Section 52.214-34 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.214-34 Submission of Offers in the English Language. As prescribed in 14.201-6(w), insert the following provision: Submission of Offers in the English Language (APR 1991) Offers submitted...

  11. 48 CFR 52.214-28 - Subcontractor Certified Cost or Pricing Data-Modifications-Sealed Bidding.

    Science.gov (United States)

    2010-10-01

    ... Cost or Pricing Data-Modifications-Sealed Bidding. 52.214-28 Section 52.214-28 Federal Acquisition... Cost or Pricing Data—Modifications—Sealed Bidding (OCT 2010) (a) The requirements of paragraphs (b) and... CONTRACT CLAUSES Text of Provisions and Clauses 52.214-28 Subcontractor Certified Cost or Pricing Data...

  12. microRNA-214-mediated UBC9 expression in glioma

    OpenAIRE

    Zhao, Zhiqiang; Tan, Xiaochao; Zhao, Ani; Zhu, Liyuan; Yin, Bin; Yuan, Jiangang; Qiang, Boqin; Peng, Xiaozhong

    2012-01-01

    It has been reported that ubiquitin-conjugating enzyme 9 (Ubc9), the unique enzyme2 in the sumoylation pathway, is up-regulated in many cancers. However, the expression and regulation of UBC9 in glioma remains unknown. In this study, we found that Ubc9 was up-regulated in glioma tissues and cell lines compared to a normal control. UBC9 knockdown by small interfering RNA (siRNA) affected cell proliferation and apoptosis in T98G cells. Further experiments revealed that microRNA (miR)-214 direct...

  13. MicroRNA-214 suppresses gluconeogenesis by targeting activating transcriptional factor 4.

    Science.gov (United States)

    Li, Kai; Zhang, Jin; Yu, Junjie; Liu, Bin; Guo, Yajie; Deng, Jiali; Chen, Shanghai; Wang, Chunxia; Guo, Feifan

    2015-03-27

    Although the gluconeogenesis pathway is already a target for the treatment of type 2 diabetes, the potential role of microRNAs (miRNAs) in gluconeogenesis remains unclear. Here, we investigated the physiological functions of miR-214 in gluconeogenesis. The expression of miR-214 was suppressed by glucagon via protein kinase A signaling in primary hepatocytes, and miR-214 was down-regulated in the livers of fasted, high fat diet-induced diabetic and leptin receptor-mutated (db/db) mice. The overexpression of miR-214 in primary hepatocytes suppressed glucose production, and silencing miR-214 reversed this effect. Gluconeogenesis was suppressed in the livers of mice injected with an adenovirus expressing miR-214 (Ad-miR-214). Additionally, Ad-miR-214 alleviated high fat diet-induced elevation of gluconeogenesis and hyperglycemia. Furthermore, we found that activating transcription factor 4 (ATF4), a reported target of miR-214, can reverse the suppressive effect of miR-214 on gluconeogenesis in primary hepatocytes, and this suppressive effect was blocked in liver-specific ATF4 knock-out mice. ATF4 regulated gluconeogenesis via affecting forkhead box protein O1 (FOXO1) transcriptional activity. Finally, liver-specific miR-214 transgenic mice exhibited suppressed gluconeogenesis and reduced expression of ATF4, phosphoenolpyruvate carboxykinase, and glucose-6-phosphatase in liver. Taken together, our results suggest that the miR-214-ATF4 axis is a novel pathway for the regulation of hepatic gluconeogenesis. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.

  14. MicroRNA-214 Suppresses Gluconeogenesis by Targeting Activating Transcriptional Factor 4*

    Science.gov (United States)

    Li, Kai; Zhang, Jin; Yu, Junjie; Liu, Bin; Guo, Yajie; Deng, Jiali; Chen, Shanghai; Wang, Chunxia; Guo, Feifan

    2015-01-01

    Although the gluconeogenesis pathway is already a target for the treatment of type 2 diabetes, the potential role of microRNAs (miRNAs) in gluconeogenesis remains unclear. Here, we investigated the physiological functions of miR-214 in gluconeogenesis. The expression of miR-214 was suppressed by glucagon via protein kinase A signaling in primary hepatocytes, and miR-214 was down-regulated in the livers of fasted, high fat diet-induced diabetic and leptin receptor-mutated (db/db) mice. The overexpression of miR-214 in primary hepatocytes suppressed glucose production, and silencing miR-214 reversed this effect. Gluconeogenesis was suppressed in the livers of mice injected with an adenovirus expressing miR-214 (Ad-miR-214). Additionally, Ad-miR-214 alleviated high fat diet-induced elevation of gluconeogenesis and hyperglycemia. Furthermore, we found that activating transcription factor 4 (ATF4), a reported target of miR-214, can reverse the suppressive effect of miR-214 on gluconeogenesis in primary hepatocytes, and this suppressive effect was blocked in liver-specific ATF4 knock-out mice. ATF4 regulated gluconeogenesis via affecting forkhead box protein O1 (FOXO1) transcriptional activity. Finally, liver-specific miR-214 transgenic mice exhibited suppressed gluconeogenesis and reduced expression of ATF4, phosphoenolpyruvate carboxykinase, and glucose-6-phosphatase in liver. Taken together, our results suggest that the miR-214-ATF4 axis is a novel pathway for the regulation of hepatic gluconeogenesis. PMID:25657009

  15. MiR-214 suppressed ovarian cancer and negatively regulated semaphorin 4D.

    Science.gov (United States)

    Liu, Yang; Zhou, Honglin; Ma, Lan; Hou, Youfang; Pan, Jing; Sun, Chunyi; Yang, Yingying; Zhang, Jie

    2016-06-01

    Ovarian cancer is one of the most common human malignancies in women. MiR-214 and semaphorin 4D (sema 4D) were found to be abhorrently expressed and involved in the progress of several kinds of malignant cancers. This study is aimed to investigate the cellular role of miR-214 and demonstrate that miR-214 negatively regulated sema 4D in ovarian cancer cells. The data showed that miR-214 expression was consistently lower in ovarian cancer tissues and cells than those in the normal controls. Over-expression of miR-214 in ovarian cancer SKOV-3 cells inhibited cell proliferation and induced apoptosis. It was suggested that miR-214 functioned as the tumor suppressor in ovarian cancer. Bioinformatic analysis indicated that miR-214 possibly regulated sema 4D by binding the sema 4D messenger RNA (mRNA) 3'-untranslated region (UTR). Sema 4D mRNA and protein levels were up-regulated in ovarian cancer tissues and SKOV-3 cells. Up-regulation of miR-214 in SKOV-3 cell line suppressed the sema 4D expression in both protein and nucleic acid levels. While, down-regulation of miR-214 in SKOV-3 cells would increase sema 4D protein and nucleic acid expression levels. The effects of miR-214 up- and down-regulation on luciferase activities of wild-type (WT) sema 4D 3'-UTR were completely removed upon introduction of mutation in 3'-UTR of WT sema 4D. Therefore, the data also demonstrated that sema 4D was the direct target of miR-214 and was negatively regulated by miR-214 in ovarian cancer cells.

  16. Quantification of the {sup 214} Pb and {sup 214} Bi decay products before and after to reach the secular equilibria with the {sup 226} Ra; Cuantificacion de los productos de decaimiento {sup 214} Pb y {sup 214} Bi antes y despues de alcanzar el equilibrio secular con el {sup 226} Ra

    Energy Technology Data Exchange (ETDEWEB)

    Quintero P, E.; Rojas M, V.P.; Cervantes N, M.L.; Gaso P, M.I. [Gerencia de Seguridad Radiologica, ININ, A.P. 18-1027, 11801 Mexico D.F. (Mexico)

    2002-07-01

    In this work a comparison between the {sup 226} Ra concentration and its decay products ({sup 214} Pb and {sup 214} Bi) in soil samples is presented before and after that the decay mentioned products reach the equilibria with the radium. Moreover, the obtained daughter/father ratio is presented; and the correction factor for the calculus of the {sup 214} Pb and {sup 214} Bi quantification without being necessary to wait until that the secular equilibria has been established. For the quantification of the concentration of the three radionuclides the gamma spectrometry technique was used. (Author)

  17. Cardiac hypertrophy and dysfunction induced by overexpression of miR-214 in vivo.

    Science.gov (United States)

    Yang, Tao; Gu, Haihua; Chen, Xiaofan; Fu, Shaozhi; Wang, Cheng; Xu, Hongfei; Feng, Qiang; Ni, Yiming

    2014-12-01

    An increasing number of studies have demonstrated the critical role of microRNAs in the pathogenesis of cardiac hypertrophy and dysfunction. This study evaluated whether miR-214 plays a pivotal role in the development of cardiac hypertrophy and heart failure. In human tissues, miR-214 overexpression was determined to promote cardiac hypertrophy. We predicted miR-214 direct target by bioinformatics database and verifed it using luciferase dual reporting system. We silenced miR-214 using a specific antagomir in a pressure-overload mouse model of heart failure. Analysis of transgenic mice with cardiomyocyte-specific overexpression of miR-214 indicated that their hearts were 21% heavier than wild-type hearts and expressed several biochemical and functional markers consistent with dilated cardiomyopathy. These findings include enlarged left ventricular internal diameters, wall thinning, reduced ejection fraction, fractional shortening, and an increased fetal gene expression. The enhancer of zeste homolog 2 (EZH2) was confirmed as a direct target of miR-214 in cardiomyocytes. In vivo silencing of miR-214 using a specific antagomir rescued cardiac EZH2 expression and prevented cardiac hypertrophy and dysfunction. Taken together, these results suggest that miR-214 may induce pathologic cardiac hypertrophy in part by reducing EZH2 messenger RNA levels. MiR-214 may therefore be a potential therapeutic target for treating certain cardiac disease states. Copyright © 2014 Elsevier Inc. All rights reserved.

  18. 46 CFR 199.214 - Immersion suits and thermal protective aids.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Immersion suits and thermal protective aids. 199.214... Passenger Vessels § 199.214 Immersion suits and thermal protective aids. (a) Each passenger vessel must... an immersion suit. (c) The immersion suits and thermal protective aids required under paragraphs (a...

  19. 23 CFR 973.214 - Indian lands congestion management system (CMS).

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Indian lands congestion management system (CMS). 973.214... HIGHWAYS MANAGEMENT SYSTEMS PERTAINING TO THE BUREAU OF INDIAN AFFAIRS AND THE INDIAN RESERVATION ROADS PROGRAM Bureau of Indian Affairs Management Systems § 973.214 Indian lands congestion management system...

  20. Cavitation erosion resistance of 13/4 and 21-4-N steels

    Indian Academy of Sciences (India)

    The cavitation erosion is highly dependent on microstructure and mechanical properties. The results show that hot rolled 21-4-N steel is more cavitation erosion resistant than the 13/4 and 21-4-N steels in as cast condition. The eroded surfaces were analysed through optical microscope and scanning electron microscope ...

  1. 49 CFR 214.529 - In-service failure of primary braking system.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false In-service failure of primary braking system. 214... Maintenance Machines and Hi-Rail Vehicles § 214.529 In-service failure of primary braking system. (a) In the event of a total in-service failure of its primary braking system, an on-track roadway maintenance...

  2. CLOSURE REPORT FOR CORRECTIVE ACTION UNIT 214: BUNKERS AND STORAGE AREAS NEVADA TEST SITE, NEVADA

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2006-09-01

    The purpose of this Closure Report is to document that the closure of CAU 214 complied with the Nevada Division of Environmental Protection-approved Corrective Action Plan closure requirements. The closure activities specified in the Corrective Action Plan were based on the approved corrective action alternatives presented in the CAU 214 Corrective Action Decision Document.

  3. 49 CFR 214.347 - Training and qualification for lone workers.

    Science.gov (United States)

    2010-10-01

    ... RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY Roadway Worker Protection § 214.347 Training and qualification for lone workers. Each lone worker shall be trained and qualified... 49 Transportation 4 2010-10-01 2010-10-01 false Training and qualification for lone workers. 214...

  4. 25 CFR 214.21 - Inspection of lessees' books and records.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Inspection of lessees' books and records. 214.21 Section... OSAGE RESERVATION LANDS, OKLAHOMA, FOR MINING, EXCEPT OIL AND GAS § 214.21 Inspection of lessees' books... premises for the purpose of inspection, and their books and records showing manner of operations and...

  5. Infectious pancreatic necrosis virus enters CHSE-214 cells via macropinocytosis.

    Science.gov (United States)

    Levican, Jorge; Miranda-Cárdenas, Camila; Soto-Rifo, Ricardo; Aguayo, Francisco; Gaggero, Aldo; León, Oscar

    2017-06-08

    Infectious pancreatic necrosis virus (IPNV) is a non-enveloped virus belonging to the Birnaviridae family. IPNV produces an acute disease in salmon fingerlings, with high mortality rates and persistent infection in survivors. Although there are reports of IPNV binding to various cells, the viral receptor and entry pathways remain unknown. The aim of this study was to determine the endocytic pathway that allows for IPNV entry. We observed that IPNV stimulated fluid uptake and virus particles co-localysed with the uptake marker dextran in intracellular compartments, suggesting a role for macropinocytosis in viral entry. Consistent with this idea, viral infection was significantly reduced when the Na+/H+ exchanger NHE1 was inhibited with 5-(N-Ethyl-N-isopropyl) amiloride (EIPA). Neither chlorpromazine nor filipin complex I affected IPNV infection. To examine the role of macropinocytosis regulators, additional inhibitors were tested. Inhibitors of the EGFR pathway and the effectors Pak1, Rac1 and PKC reduced viral infection. Together, our results indicate that IPNV is mainly internalized into CHSE-214 cells by macropinocytosis.

  6. 49 CFR 214.525 - Towing with on-track roadway maintenance machines or hi-rail vehicles.

    Science.gov (United States)

    2010-10-01

    ... or hi-rail vehicles. 214.525 Section 214.525 Transportation Other Regulations Relating to... SAFETY On-Track Roadway Maintenance Machines and Hi-Rail Vehicles § 214.525 Towing with on-track roadway maintenance machines or hi-rail vehicles. (a) When used to tow pushcars or other maintenance-of-way equipment...

  7. 49 CFR 214.521 - Flagging equipment for on-track roadway maintenance machines and hi-rail vehicles.

    Science.gov (United States)

    2010-10-01

    ... maintenance machines and hi-rail vehicles. 214.521 Section 214.521 Transportation Other Regulations Relating... WORKPLACE SAFETY On-Track Roadway Maintenance Machines and Hi-Rail Vehicles § 214.521 Flagging equipment for on-track roadway maintenance machines and hi-rail vehicles. Each on-track roadway maintenance machine...

  8. Dynamic regulation of uncoupling protein 2 expression by microRNA-214 in hepatocellular carcinoma.

    Science.gov (United States)

    Yu, Guangsheng; Wang, Jianlu; Xu, Kesen; Dong, Jiahong

    2016-07-01

    Gemcitabine (GEM), a commonly used chemotherapeutic agent in hepatocellular carcinoma (HCC) patients, uses oxidative stress induction as a common effector pathway. However, GEM alone or in combination with oxaliplatin hardly renders any survival benefits to HCC patients. We have recently shown that this is part due to the overexpression of the mitochondrial uncoupling protein 2 (UCP2) that in turn mediates resistance to GEM in HCC patients. However, not much is known about regulatory mechanisms underlying UCP2 overexpression in HCC. Differential protein expression in HCC cell lines did not show a concomitant change in UCP2 transcript level, indicating post-transcriptional or post-translational regulatory mechanism. In situ analysis revealed that UCP2 is a putative target of miR-214 miR-214 expression is significantly down-regulated in HCC patient samples as compared with normal adjacent tissues and in cell line, human hepatoblastoma cells (HuH6), with high UCP2 protein expression. We demonstrated using miR-214 mimic and antagomir that the miRNA targeted UCP2 expression by directly targeting the wild-type, but not a miR-214 seed mutant, 3' UTR of UCP2 Overexpression of miR-214 significantly attenuated cell proliferation. Finally, analysis in 20 HCC patients revealed an inverse correlation in expression of UCP2 and miR-214 (Pearson's correlation coefficient, r=-0.9792). Cumulatively, our data indicate that in the context of HCC, miR-214 acts as a putative tumour suppressor by targeting UCP2 and defines a novel mechanism of regulation of UCP2. © 2016 The Author(s).

  9. MicroRNA-214 Promotes Apoptosis in Canine Hemangiosarcoma by Targeting the COP1-p53 Axis.

    Directory of Open Access Journals (Sweden)

    Kazuki Heishima

    Full Text Available MicroRNA-214 regulates both angiogenic function in endothelial cells and apoptosis in various cancers. However, the regulation and function of miR-214 is unclear in canine hemangiosarcoma, which is a spontaneous model of human angiosarcoma. The expression and functional roles of miR-214 in canine hemangiosarcoma were presently explored by performing miRNA TaqMan qRT-PCR and transfecting cells with synthetic microRNA. Here, we report that miR-214 was significantly down-regulated in the cell lines used and in clinical samples of canine hemangiosarcoma. Restoration of miR-214 expression reduced cell growth and induced apoptosis in canine hemangiosarcoma cell lines through transcriptional activation of p53-regulated genes although miR-214 had a slight effect of growth inhibition on normal endothelial cells. We identified COP1, which is a critical negative regulator of p53, as a novel direct target of miR-214. COP1 was overexpressed and the specific COP1 knockdown induced apoptosis through transcriptional activation of p53-regulated genes as well as did miR-214-transfection in HSA cell lines. Furthermore, p53 knockdown abolished the miR-214-COP1-mediated apoptosis; thus, miR-214 and COP1 regulated apoptosis through controlling p53 in HSA. In conclusion, miR-214 functioned as a tumor suppressor in canine hemangiosarcoma by inducing apoptosis through recovering the function of p53. miR-214 down-regulation and COP1 overexpression is likely to contribute to tumorigenesis of HSA. Therefore, targeting miR-214-COP1-p53 axis would possibly be a novel effective strategy for treatment of canine hemangiosarcoma and capable of being applied to the development of novel therapeutics for human angiosarcoma.

  10. MicroRNA-214 Promotes Apoptosis in Canine Hemangiosarcoma by Targeting the COP1-p53 Axis.

    Science.gov (United States)

    Heishima, Kazuki; Mori, Takashi; Sakai, Hiroki; Sugito, Nobuhiko; Murakami, Mami; Yamada, Nami; Akao, Yukihiro; Maruo, Kohji

    2015-01-01

    MicroRNA-214 regulates both angiogenic function in endothelial cells and apoptosis in various cancers. However, the regulation and function of miR-214 is unclear in canine hemangiosarcoma, which is a spontaneous model of human angiosarcoma. The expression and functional roles of miR-214 in canine hemangiosarcoma were presently explored by performing miRNA TaqMan qRT-PCR and transfecting cells with synthetic microRNA. Here, we report that miR-214 was significantly down-regulated in the cell lines used and in clinical samples of canine hemangiosarcoma. Restoration of miR-214 expression reduced cell growth and induced apoptosis in canine hemangiosarcoma cell lines through transcriptional activation of p53-regulated genes although miR-214 had a slight effect of growth inhibition on normal endothelial cells. We identified COP1, which is a critical negative regulator of p53, as a novel direct target of miR-214. COP1 was overexpressed and the specific COP1 knockdown induced apoptosis through transcriptional activation of p53-regulated genes as well as did miR-214-transfection in HSA cell lines. Furthermore, p53 knockdown abolished the miR-214-COP1-mediated apoptosis; thus, miR-214 and COP1 regulated apoptosis through controlling p53 in HSA. In conclusion, miR-214 functioned as a tumor suppressor in canine hemangiosarcoma by inducing apoptosis through recovering the function of p53. miR-214 down-regulation and COP1 overexpression is likely to contribute to tumorigenesis of HSA. Therefore, targeting miR-214-COP1-p53 axis would possibly be a novel effective strategy for treatment of canine hemangiosarcoma and capable of being applied to the development of novel therapeutics for human angiosarcoma.

  11. 25 CFR 170.214 - How does award of an emergency/disaster project affect projects on the FPL?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false How does award of an emergency/disaster project affect projects on the FPL? 170.214 Section 170.214 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER INDIAN RESERVATION ROADS PROGRAM Indian Reservation Roads Program Funding Irr High Priority Project (irrhpp) § 170.214 How does...

  12. Lifetime measurements of 214Po and 212Po with the CTF liquid scintillator detector at LNGS

    Energy Technology Data Exchange (ETDEWEB)

    Bellini, G.; Benziger, J.; Bick, D.; Bonfini, G.; Bravo, D.; Buizza Avanzini, M.; Caccianiga, B.; Cadonati, L.; Calaprice, F.; Carraro, C.; Cavalcante, P.; Chavarria, A.; Chepurnov, A.; Chubakov, V.; D’Angelo, D.; Davini, S.; Derbin, A.; Etenko, A.; Fomenko, K.; Franco, D.; Galbiati, C.; Gazzana, S.; Ghiano, C.; Giammarchi, M.; Göger-Neff, M.; Goretti, A.; Grandi, L.; Guardincerri, E.; Hardy, S.; Ianni, Aldo; Ianni, Andrea; Kobychev, V.; Korablev, D.; Korga, G.; Koshio, Y.; Kryn, D.; Laubenstein, M.; Lewke, T.; Lissia, Marcello; Litvinovich, E.; Loer, B.; Lombardi, F.; Lombardi, P.; Ludhova, L.; Machulin, I.; Manecki, S.; Maneschg, W.; Manuzio, G.; Meindl, Q.; Meroni, E.; Miramonti, L.; Misiaszek, M.; Montanari, D.; Mosteiro, P.; Mantovani, F.; Muratova, V.; Nisi, S.; Oberauer, L.; Obolensky, M.; Ortica, F.; Otis, K.; Pallavicini, M.; Papp, L.; Perasso, L.; Perasso, S.; Pocar, A.; Ranucci, G.; Razeto, A.; Re, A.; Romani, A.; Rossi, N.; Sabelnikov, A.; Saldanha, R.; Salvo, C.; Schönert, S.; Simgen, H.; Skorokhvatov, M.; Smirnov, O.; Sotnikov, A.; Sukhotin, S.; Suvorov, Y.; Tartaglia, R.; Testera, G.; Vogelaar, R. B.; von Feilitzsch, F.; Winter, J.; Wojcik, M.; Wright, A.; Wurm, M.; Xhixha, G.; Xu, J.; Zaimidoroga, O.; Zavatarelli, S.; Zuzel, G.

    2013-07-01

    We have studied the alpha decays of 214Po into 210Pb and of 212Po into 208Pb tagged by the coincidence with the preceding beta decays from 214Bi and 212Bi, respectively. The employed 222Rn, 232Th, and 220Rn sources were sealed inside quartz vials and inserted in the Counting Test Facility at the underground Gran Sasso National Laboratory in Italy. We find that the mean lifetime of 214Po is (236.00 +- 0.42(stat) +- 0.15(syst)) \\mu s and that of 212Po is (425.1 +- 0.9(stat) +- 1.2(syst)) ns. Our results, obtained from data with signal-to-background ratio larger than 1000, reduce the overall uncertainties and are compatible with previous measurements.

  13. miR-214 promotes the proliferation and invasion of osteosarcoma cells through direct suppression of LZTS1

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Zhengyu [Department of Orthopedics, Shanghai Jiao Tong University Affiliated Sixth People’s Hospital, Shanghai (China); Wang, Tao, E-mail: wangtaohappy2010@sohu.com [Department of Orthopedics, Shanghai Jiao Tong University Affiliated Sixth People’s Hospital, Shanghai (China)

    2014-06-27

    Highlights: • miR-214 is upregulated in human OS tissues and inversely correlated with LZTS1 expression. • miR-214 directly targets LZTS1 by binding to its 3′-UTR. • miR-214 promotes OS cell proliferation, invasion and tumor growth. • Overexpression of LZTS1 reverses miR-214-induced proliferation and invasion of OS cells. - Abstract: Previous studies have shown that miR-214 functions either as an oncogene or a tumor suppressor in various human cancer types. The role of this microRNA in osteosarcoma (OS) is presently unclear. Here, we demonstrated that miR-214 is frequently upregulated in OS specimens, compared with noncancerous bone tissues. Bioinformatics analysis further revealed leucine zipper, putative tumor suppressor 1 (LZTS1) as a potential target of miR-214. Expression patterns of miR-214 were inversely correlated with those of LZTS1 mRNA and protein in OS tissues. Data from reporter assays showed that miR-214 directly binds to the 3′-untranslated region (3′-UTR) of LZTS1 mRNA and suppresses expression at both transcriptional and translational levels. In functional assays, miR-214 promoted OS cell proliferation, invasion and tumor growth in nude mice, which could be reversed by overexpression of LZTS1. Taken together, our data provide compelling evidence that miR-214 functions as an onco-miRNA in OS, and its oncogenic effects are mediated chiefly through downregulation of LZTS1.

  14. 9 CFR 93.214 - Import permit and declaration for poultry.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Import permit and declaration for... IMPORTATION OF CERTAIN ANIMALS, BIRDS, FISH, AND POULTRY, AND CERTAIN ANIMAL, BIRD, AND POULTRY PRODUCTS; REQUIREMENTS FOR MEANS OF CONVEYANCE AND SHIPPING CONTAINERS Poultry Canada 6 § 93.214 Import permit and...

  15. 49 CFR 214.333 - Informational line-ups of trains.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Informational line-ups of trains. 214.333 Section... Informational line-ups of trains. (a) A railroad is permitted to include informational line-ups of trains in its... in effect on March 14, 1996. (b) Each procedure for the use of informational line-ups of trains found...

  16. CT-guided percutaneous spine biopsy in suspected infection or malignancy. A study of 214 patients

    Energy Technology Data Exchange (ETDEWEB)

    Rehm, J.; Veith, S.; Kauczor, H.U.; Weber, M.A. [Heidelberg Univ. (Germany). Inst. of Diagnostic and Interventional Radiology; Akbar, M. [Heidelberg Univ. (Germany). Dept. of Orthopaedic Surgery and Rehabilitation Medicine

    2016-12-15

    To retrospectively determine the effectiveness and accuracy of CT-guided percutaneous biopsy of malignant and inflammatory bone lesions of the spine and to assess the reliability of pre-biopsy CT and MRI. 214 patients with lesions of the spine, which were suspicious either for being malignant or inflammatory, underwent CT-guided biopsy for pathological and/or microbiological detection. Biopsy samples were sent for histological examination in 128/214 patients, for microbiological analysis in 17/214 patients and for both analyses in 69/214 patients. Retrospectively, the diagnostic accuracy and sensitivity/specificity of the pre-interventional imaging (CT and MRI) were determined. In addition, the influence of the biopsy on subsequent patient management was assessed. The accuracy was 94.4% for histopathological analysis and 97.7% for microbiological analysis. In 25% of cases the microbiological analysis revealed an underlying pathogen that was not significantly affected by pre-biopsy antibiotic therapy. The sensitivity/specificity of the pre-biopsy cross-sectional imaging concerning suspected malignancy was 69%/78%. For suspected infection, the sensitivity/specificity of pre-biopsy imaging was 81%/44%. In 52% of all cases, the biopsy result changed subsequent patient management. Percutaneous CT-guided spine biopsy is a useful and reliable diagnostic procedure to establish a definitive diagnosis but with a relatively low yield of microorganisms in the case of infection.

  17. 49 CFR 214.335 - On-track safety procedures for roadway work groups.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false On-track safety procedures for roadway work groups... Protection § 214.335 On-track safety procedures for roadway work groups. (a) No employer subject to the...-track safety of the roadway work group that on-track safety is provided. (c) Roadway work groups engaged...

  18. 49 CFR 214.337 - On-track safety procedures for lone workers.

    Science.gov (United States)

    2010-10-01

    ...: (1) By a lone worker who has been trained, qualified, and designated to do so by the employer in... 49 Transportation 4 2010-10-01 2010-10-01 false On-track safety procedures for lone workers. 214... RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY Roadway Worker Protection...

  19. 8 CFR 214.4 - Denial of certification, denial of recertification or withdrawal of SEVP certification.

    Science.gov (United States)

    2010-01-01

    ... school will be notified of the reasons and appeal rights if a petition for certification is denied, in accordance with the provisions of 8 CFR 103.3(a)(1)(iii). No fee is required with appeals related to SEVP... qualified professional personnel. (xiv) Failure to limit advertising in the manner prescribed in 8 CFR 214.3...

  20. 49 CFR 214.503 - Good-faith challenges; procedures for notification and resolution.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Good-faith challenges; procedures for notification... Roadway Maintenance Machines and Hi-Rail Vehicles § 214.503 Good-faith challenges; procedures for... vehicle shall inform the employer whenever the employee makes a good-faith determination that the machine...

  1. 20 CFR 416.214 - You are disabled and drug addiction or alcoholism is a contributing factor material to the...

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false You are disabled and drug addiction or alcoholism is a contributing factor material to the determination of disability. 416.214 Section 416.214 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SUPPLEMENTAL SECURITY INCOME FOR THE AGED, BLIND, AND DISABLED Eligibility Reasons Why You May Not...

  2. Heterogeneous patterns of amplification of the NUP214-ABL1 fusion gene in T-cell acute lymphoblastic leukemia.

    NARCIS (Netherlands)

    Graux, C.; Stevens-Kroef, M.J.P.L.; Lafage, M.; Dastugue, N.; Harrison, C.J.; Mugneret, F.; Bahloula, K.; Struski, S.; Gregoire, M.J.; Nadal, N.; Lippert, E.; Taviaux, S.; Simons, A.; Kuiper, R.P.; Moorman, A.V.; Barber, K.; Bosly, A.; Michaux, L.; Berghe, P. van den; Lahortiga, I.; Keersmaecker, K. De; Wlodarska, I.; Cools, J.; Hagemeijer, A.; Poirel, H.A.

    2009-01-01

    Episomes with the NUP214-ABL1 fusion gene have been observed in 6% of T-ALL. In this multicentric study we collected 27 cases of NUP214-ABL1-positive T-ALL. Median age was 15 years with male predominance. Outcome was poor in 12 patients. An associated abnormality involving TLX1 or TLX3 was found in

  3. 8 CFR 214.12 - Preliminary enrollment of schools in the Student and Exchange Visitor Information System (SEVIS).

    Science.gov (United States)

    2010-01-01

    ... Student and Exchange Visitor Information System (SEVIS). 214.12 Section 214.12 Aliens and Nationality... of schools in the Student and Exchange Visitor Information System (SEVIS). (a) Private elementary and... schools are eligible for preliminary enrollment in Student and Exchange Visitor Information System (SEVIS...

  4. 48 CFR 52.214-27 - Price Reduction for Defective Certified Cost or Pricing Data-Modifications-Sealed Bidding.

    Science.gov (United States)

    2010-10-01

    ... Defective Certified Cost or Pricing Data-Modifications-Sealed Bidding. 52.214-27 Section 52.214-27 Federal... Certified Cost or Pricing Data—Modifications—Sealed Bidding. As prescribed in 14.201-7(b), insert the following clause: Price Reduction for Defective Certified Cost or Pricing Data—Modifications—Sealed Bidding...

  5. Rotigotine polyoxazoline conjugate SER-214 provides robust and sustained antiparkinsonian benefit.

    Science.gov (United States)

    Eskow Jaunarajs, Karen L; Standaert, David G; Viegas, Tacey X; Bentley, Michael D; Fang, Zhihao; Dizman, Bekir; Yoon, Kunsang; Weimer, Rebecca; Ravenscroft, Paula; Johnston, Tom H; Hill, Michael P; Brotchie, Jonathan M; Moreadith, Randall W

    2013-10-01

    Currently available dopaminergic drugs such as levodopa and dopamine (DA) receptor agonists impart considerable improvement in Parkinson's disease (PD) motor symptoms but often lead to significant motor complications including "wearing-off" and dyskinesia. Such complications are believed to stem from the pulsatile nature of dopaminergic stimulation with these agents. Continuous dopaminergic drug delivery using polyoxazoline (POZ) polymer conjugation may improve motor symptoms, while avoiding development of side effects. The purposes of the current study are to characterize the in vitro and in vivo pharmacokinetics of POZ conjugation of a U.S. Food and Drug Administration (FDA)-approved DA agonist, rotigotine, and to evaluate their effects in an established rat model of PD. After determination of release profiles of several POZ-conjugated constructs ("fast": SER-212; "moderate": SER-213; and "slow": SER-214) using in vitro hydrolysis, normal male Sprague-Dawley rats were used for determination of the pharmacokinetic profile of both acute and chronic exposure. Finally, a separate group of rats was rendered hemiparkinsonian using intracranial 6-hydroxydopamine (6-OHDA) infusions, treated acutely with POZ-rotigotine, and assessed for rotational behavior and antiparkinsonian benefit using the cylinder test. POZ-rotigotine formulations SER-213 and SER-214 led to substantial pharmacokinetic improvement compared to unconjugated rotigotine. In addition, SER-214 led to antiparkinsonian effects in DA-lesioned rats that persisted up to 5 days posttreatment. Repeated weekly dose administration of SER-214 to normal rats for up to 12 weeks demonstrated highly reproducible pharmacokinetic profiles. The continuous dopaminergic stimulation profile afforded by SER-214 could represent a significant advance in the treatment of PD, with potential to be a viable, once-per-week therapy for PD patients. © 2013 Movement Disorder Society.

  6. The Oncogenic Fusion Proteins SET-Nup214 and Sequestosome-1 (SQSTM1)-Nup214 Form Dynamic Nuclear Bodies and Differentially Affect Nuclear Protein and Poly(A)+ RNA Export.

    Science.gov (United States)

    Port, Sarah A; Mendes, Adélia; Valkova, Christina; Spillner, Christiane; Fahrenkrog, Birthe; Kaether, Christoph; Kehlenbach, Ralph H

    2016-10-28

    Genetic rearrangements are a hallmark of several forms of leukemia and can lead to oncogenic fusion proteins. One example of an affected chromosomal region is the gene coding for Nup214, a nucleoporin that localizes to the cytoplasmic side of the nuclear pore complex (NPC). We investigated two such fusion proteins, SET-Nup214 and SQSTM1 (sequestosome)-Nup214, both containing C-terminal portions of Nup214. SET-Nup214 nuclear bodies containing the nuclear export receptor CRM1 were observed in the leukemia cell lines LOUCY and MEGAL. Overexpression of SET-Nup214 in HeLa cells leads to the formation of similar nuclear bodies that recruit CRM1, export cargo proteins, and certain nucleoporins and concomitantly affect nuclear protein and poly(A) + RNA export. SQSTM1-Nup214, although mostly cytoplasmic, also forms nuclear bodies and inhibits nuclear protein but not poly(A) + RNA export. The interaction of the fusion proteins with CRM1 is RanGTP-dependent, as shown in co-immunoprecipitation experiments and binding assays. Further analysis revealed that the Nup214 parts mediate the inhibition of nuclear export, whereas the SET or SQSTM1 part determines the localization of the fusion protein and therefore the extent of the effect. SET-Nup214 nuclear bodies are highly mobile structures, which are in equilibrium with the nucleoplasm in interphase and disassemble during mitosis or upon treatment of cells with the CRM1-inhibitor leptomycin B. Strikingly, we found that nucleoporins can be released from nuclear bodies and reintegrated into existing NPC. Our results point to nuclear bodies as a means of preventing the formation of potentially insoluble and harmful protein aggregates that also may serve as storage compartments for nuclear transport factors. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.

  7. Zebrafish miR-214 modulates Hedgehog signaling to specify muscle cell fate

    OpenAIRE

    Flynt, Alex S.; Li, Nan; Thatcher, Elizabeth J.; Solnica-Krezel, Lilianna; Patton, James G

    2007-01-01

    Numerous microRNAs (miRNAs) have been discovered in the genomes of higher eukaryotes, and functional studies indicate that they are important during development. However, little is known concerning the function of individual miRNAs. We approached this problem in zebrafish by combining identification of miRNA expression, functional analyses and experimental validation of potential targets. We show that miR-214 is expressed during early segmentation stages in somites and that varying its expres...

  8. 48 CFR 52.214-25 - Step Two of Two-Step Sealed Bidding.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Step Two of Two-Step... Clauses 52.214-25 Step Two of Two-Step Sealed Bidding. As prescribed in 14.201-6(t), insert the following provision: Step Two of Two-Step Sealed Bidding (APR 1985) (a) This invitation for bids is issued to initiate...

  9. Closure Report for Corrective Action Unit 214: Bunkers and Storage Areas, Nevada Test Site, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    NSTec Environmental Restoration

    2006-09-01

    Corrective Action Unit (CAU) 214 is located in Areas 5, 11, and 25 of the Nevada Test Site (NTS). CAU 214 is listed in the Federal Facility Agreement and Consent Order (FFACO, 1996) as ''Corrective Action Unit 214: Bunkers and Storage Areas,'' and is comprised of nine Corrective Action Sites (CASs): {sm_bullet} CAS 05-99-01, Fallout Shelters {sm_bullet} CAS 11-22-03, Drum {sm_bullet} CAS 25-23-01, Contaminated Materials {sm_bullet} CAS 25-23-19, Radioactive Material Storage {sm_bullet} CAS 25-34-03, Motor Dr/Gr Assembly (Bunker) {sm_bullet} CAS 25-34-04, Motor Dr/Gr Assembly (Bunker) {sm_bullet} CAS 25-34-05, Motor Dr/Gr Assembly (Bunker) {sm_bullet} CAS 25-99-12, Fly Ash Storage {sm_bullet} CAS 25-99-18, Storage Area The Nevada Division of Environmental Protection (NDEP)-approved corrective action alternative for CASs 11-22-03, 25-34-03, 25-34-04, 25-34-05, 25-99-12, and 25-99-18 is No Further Action. Closure activities included: {sm_bullet} Removing and disposing of the fly ash and surrounding wooden structure at CAS 25-99-12 as a best management practice The NDEP-approved corrective action alternative for CAS 05-99-01 in CAU 214 is Clean Closure. Closure activities included: {sm_bullet} Removing and disposing of soil contaminated with the pesticide dieldrin The NDEP-approved corrective action alternative for CASs 25-23-01 and 25-23-19 is Closure in Place with Administrative Controls. Closure activities included: {sm_bullet} Removing and disposing of soil contaminated with chromium and soil impacted with the pesticides chlordane and heptachlor {sm_bullet} Implementing use restrictions (UR) at both CASs as detailed in the CAU 214 Corrective Action Plan (CAP) (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office [NNSA/NSO], 2005) {sm_bullet} Posting UR warning signs around CASs 25-23-01 and 25-23-19 on the existing chain link fence

  10. 49 CFR 214.509 - Required visual illumination and reflective devices for new on-track roadway maintenance machines.

    Science.gov (United States)

    2010-10-01

    ... TRANSPORTATION RAILROAD WORKPLACE SAFETY On-Track Roadway Maintenance Machines and Hi-Rail Vehicles § 214.509... lighting is otherwise provided; (c) An operative 360-degree intermittent warning light or beacon mounted on...

  11. Leukemia-Associated Nup214 Fusion Proteins Disturb the XPO1-Mediated Nuclear-Cytoplasmic Transport Pathway and Thereby the NF-κB Signaling Pathway.

    Science.gov (United States)

    Saito, Shoko; Cigdem, Sadik; Okuwaki, Mitsuru; Nagata, Kyosuke

    2016-07-01

    Nuclear-cytoplasmic transport through nuclear pore complexes is mediated by nuclear transport receptors. Previous reports have suggested that aberrant nuclear-cytoplasmic transport due to mutations or overexpression of nuclear pore complexes and nuclear transport receptors is closely linked to diseases. Nup214, a component of nuclear pore complexes, has been found as chimeric fusion proteins in leukemia. Among various Nup214 fusion proteins, SET-Nup214 and DEK-Nup214 have been shown to be engaged in tumorigenesis, but their oncogenic mechanisms remain unclear. In this study, we examined the functions of the Nup214 fusion proteins by focusing on their effects on nuclear-cytoplasmic transport. We found that SET-Nup214 and DEK-Nup214 interact with exportin-1 (XPO1)/CRM1 and nuclear RNA export factor 1 (NXF1)/TAP, which mediate leucine-rich nuclear export signal (NES)-dependent protein export and mRNA export, respectively. SET-Nup214 and DEK-Nup214 decreased the XPO1-mediated nuclear export of NES proteins such as cyclin B and proteins involved in the NF-κB signaling pathway by tethering XPO1 onto nuclear dots where Nup214 fusion proteins are localized. We also demonstrated that SET-Nup214 and DEK-Nup214 expression inhibited NF-κB-mediated transcription by abnormal tethering of the complex containing p65 and its inhibitor, IκB, in the nucleus. These results suggest that SET-Nup214 and DEK-Nup214 perturb the regulation of gene expression through alteration of the nuclear-cytoplasmic transport system. Copyright © 2016, American Society for Microbiology. All Rights Reserved.

  12. A study of the weldability and weld related microstructure of cabot alloy 214

    Science.gov (United States)

    Cieslak, M. J.; Stephens, J. J.; Carr, M. J.

    1988-03-01

    The weldability and weld metal microstructure of Cabot Alloy 214 have been investigated with a variety of experimental and analytical techniques. These include Varestraint hot crack testing, hot ductility testing, pulsed Nd:YAG laser welding, scanning and analytical electron microscopy, electron microprobe analysis, and X-ray diffraction. A heat of Alloy 214 containing intentionally alloyed B (0.003 wt pct) and Zr (0.07 wt pct) was much more sensitive to both fusion zone hot cracking as quantified by the Varestraint test and to simulated heat-affected-zone (HAZ) cracking as quantified by hot ductility testing than a heat of Alloy 214 containing no intentionally added B (0.0002 wt pct) or Zr (0.02 wt pct). Scanning electron microscopy of the high B and Zr alloy showed the presence of dendritically-shaped, Zr-rich constituents in interdendritic regions in the gas-tungsten-arc (GTA) welds. Electron microprobe analysis of these welds revealed a segregation pattern of Cr, Al, Mn, and Zr enrichment in interdendritic regions and Ni and Fe enrichment in dendrite core regions. Analytical electron microscopy revealed the presence of ZrX (X = B, C, N, O), M23C6, and γ' in the fusion zone of GTA weld specimens, γ' was also found in the as-received base metal and in the GTA weld HAZ. X-ray diffraction analysis of extractions from the high B and Zr GTA weld metal also indicated the presence of a ZrX-type constituent. The results of this study are in qualitative agreement with earlier work performed on alloys such as NIMONIC 90 and INCONEL 718∗ relative to the detrimental effect of B and Zr additions on fusion zone and HAZ hot cracking susceptibility.

  13. Work in the area of buildings 513 - 289 - 214 - Disruption to traffic

    CERN Multimedia

    Optical Fibre Section, TS/EL

    2005-01-01

    The TS/EL group wishes to inform you that, in order to create an optical fibre access for the GEANT2 project, Route Rutherford will be closed to the public between Buildings 289 and 214 on 13 July 2005. Part of the Sophora car park will also be closed while the work is in progress (week 28: 11 - 15 July). You are requested to comply with the road signs in place. For more information, please call 160484. Optical Fibre Section, TS/EL

  14. Heterogeneous patterns of amplification of the NUP214-ABL1 fusion gene in T-cell acute lymphoblastic leukemia.

    Science.gov (United States)

    Graux, C; Stevens-Kroef, M; Lafage, M; Dastugue, N; Harrison, C J; Mugneret, F; Bahloula, K; Struski, S; Grégoire, M J; Nadal, N; Lippert, E; Taviaux, S; Simons, A; Kuiper, R P; Moorman, A V; Barber, K; Bosly, A; Michaux, L; Vandenberghe, P; Lahortiga, I; De Keersmaecker, K; Wlodarska, I; Cools, J; Hagemeijer, A; Poirel, H A

    2009-01-01

    Episomes with the NUP214-ABL1 fusion gene have been observed in 6% of T-ALL. In this multicentric study we collected 27 cases of NUP214-ABL1-positive T-ALL. Median age was 15 years with male predominance. Outcome was poor in 12 patients. An associated abnormality involving TLX1 or TLX3 was found in all investigated cases. Fluorescent in situ hybridization revealed a heterogeneous pattern of NUP214-ABL1 amplification. Multiple episomes carrying the fusion were detected in 24 patients. Episomes were observed in a significant number of nuclei in 18 cases, but in only 1-5% of nuclei in 6. In addition, intrachromosomal amplification (small hsr) was identified either as the only change or in association with episomes in four cases and two T-ALL cell lines (PEER and ALL-SIL). One case showed insertion of apparently non-amplified NUP214-ABL1 sequences at 14q12. The amplified sequences were analyzed using array-based CGH.These findings confirm that the NUP214-ABL1 gene requires amplification for oncogenicity; it is part of a multistep process of leukemogenesis; and it can be a late event present only in subpopulations. Data also provide in vivo evidence for a model of episome formation, amplification and optional reintegration into the genome. Implications for the use of kinase inhibitors are discussed.

  15. Lifetime measurements of {sup 214}Po and {sup 212}Po with the CTF liquid scintillator detector at LNGS

    Energy Technology Data Exchange (ETDEWEB)

    Bellini, G.; Buizza Avanzini, M.; Caccianiga, B.; D' Angelo, D.; Giammarchi, M.; Lombardi, P.; Ludhova, L.; Meroni, E.; Miramonti, L.; Perasso, L.; Ranucci, G.; Re, A. [Universita Milano (Italy); INFN, Dipartimento di Fisica, Milano (Italy); Benziger, J. [Princeton University, Chemical Engineering Department, Princeton, NJ (United States); Bick, D. [Universitaet Hamburg, Institut fuer Experimentalphysik, Hamburg (Germany); Bonfini, G.; Cavalcante, P.; Gazzana, S.; Ghiano, C.; Ianni, Aldo; Korga, G.; Koshio, Y.; Laubenstein, M.; Lombardi, F.; Nisi, S.; Razeto, A.; Rossi, N.; Tartaglia, R. [INFN, Laboratori Nazionali del Gran Sasso, Assergi (Italy); Bravo, D.; Hardy, S.; Manecki, S.; Vogelaar, R.B. [Virginia Polytechnic Institute and State University, Physics Department, Blacksburg, VA (United States); Cadonati, L.; Otis, K.; Pocar, A. [University of Massachusetts, Physics Department, Amherst, MA (United States); Calaprice, F.; Chavarria, A.; Galbiati, C.; Goretti, A.; Grandi, L.; Ianni, Andrea; Loer, B.; Mosteiro, P.; Saldanha, R.; Wright, A.; Xu, J. [Princeton University, Physics Department, Princeton, NJ (United States); Carraro, C.; Davini, S.; Guardincerri, E.; Manuzio, G.; Pallavicini, M.; Perasso, S.; Salvo, C.; Testera, G.; Zavatarelli, S. [Universita Genova (Italy); INFN, Dipartimento di Fisica, Genova (Italy); Chepurnov, A. [Lomonosov Moscow State University, Institute of Nuclear Physics, Moscow (Russian Federation); Chubakov, V.; Mantovani, F.; Xhixha, G. [Universita Ferrara (Italy); INFN, Dipartimento di Fisica, Ferrara (Italy); Derbin, A.; Muratova, V. [St. Petersburg Nuclear Physics Institute, Gatchina (Russian Federation); Etenko, A.; Litvinovich, E.; Machulin, I.; Sabelnikov, A.; Skorokhvatov, M.; Sukhotin, S. [NRC Kurchatov Institute, Moscow (Russian Federation); Fomenko, K. [INFN, Laboratori Nazionali del Gran Sasso, Assergi (Italy); Joint Institute for Nuclear Research, Dubna (Russian Federation); Franco, D.; Kryn, D.; Obolensky, M. [Obs de Paris, Sorbonne, APC, Univ. Paris Diderot, CNRS/IN2P3, CEA/Irfu, Paris Cite (France); Goeger-Neff, M.; Lewke, T.; Meindl, Q.; Oberauer, L.; Feilitzsch, F. von; Winter, J.; Wurm, M. [Technische Universitaet Muenchen, Physik Department, Garching (Germany); Kobychev, V. [Kiev Institute for Nuclear Research, Kiev (Ukraine); Korablev, D.; Smirnov, O.; Sotnikov, A.; Zaimidoroga, O. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Lissia, Marcello [INFN, Sezione di Cagliari, Monserrato (Italy); Maneschg, W.; Simgen, H. [Max-Plank-Institut fuer Kernphysik, Heidelberg (Germany); Misiaszek, M.; Wojcik, M. [Jagiellonian University, M. Smoluchowski Institute of Physics, Krakow (Poland); Montanari, D. [Fermi National Accelerator Laboratory, Batavia, IL (United States); Ortica, F.; Romani, A. [Universita Perugia (Italy); INFN, Dipartimento di Chimica, Perugia (Italy); Papp, L. [INFN, Laboratori Nazionali del Gran Sasso, Assergi (Italy); Virginia Polytechnic Institute and State University, Physics Department, Blacksburg, VA (United States); Schoenert, S. [Technische Universitaet Muenchen, Physik Department, Garching (Germany); Max-Plank-Institut fuer Kernphysik, Heidelberg (Germany); Suvorov, Y. [INFN, Laboratori Nazionali del Gran Sasso, Assergi (Italy); NRC Kurchatov Institute, Moscow (Russian Federation); Zuzel, G. [Max-Plank-Institut fuer Kernphysik, Heidelberg (Germany); Jagiellonian University, M. Smoluchowski Institute of Physics, Krakow (Poland); Collaboration: Borexino Collaboration

    2013-07-15

    We have studied the {alpha}-decays of {sup 214}Po into {sup 210}Pb and of {sup 212}Po into {sup 208}Pb tagged by the coincidence with the preceding {beta}-decays from {sup 214}Bi and {sup 212}Bi, respectively. The {sup 222}Rn, {sup 232}Th, and {sup 220}Rn sources used were sealed inside quartz vials and inserted in the Counting Test Facility at the underground Gran Sasso National Laboratory in Italy. We find that the mean lifetime of {sup 214}Po is (236.00 {+-} 0.42(stat) {+-} 0.15(syst)) {mu}s and that of {sup 212}Po is (425.1 {+-} 0.9(stat) {+-} 1.2(syst)) ns. Our results, obtained from data with signal-to-background ratio larger than 1000, reduce the overall uncertainties and are compatible with previous measurements. (orig.)

  16. Nuclear distributions of NUP62 and NUP214 suggest architectural diversity and spatial patterning among nuclear pore complexes.

    Directory of Open Access Journals (Sweden)

    Yayoi Kinoshita

    Full Text Available The shape of nuclei in many adherent cultured cells approximates an oblate ellipsoid, with contralateral flattened surfaces facing the culture plate or the medium. Observations of cultured cell nuclei from orthogonal perspectives revealed that nucleoporin p62 (NUP62 and nucleoporin 214 (NUP214 are differentially distributed between nuclear pore complexes on the flattened surfaces and peripheral rim of the nucleus. High resolution stimulated emission depletion (STED immunofluorescence microscopy resolved individual NPCs, and suggested both heterogeneity and microheterogeneity in NUP62 and NUP214 immunolabeling among in NPC populations. Similar to nuclear domains and interphase chromosome territories, architectural diversity and spatial patterning of NPCs may be an intrinsic property of the nucleus that is linked to the functions and organization of underlying chromatin.

  17. Inhibitors of Eicosanoid Biosynthesis Influencing the Transcripts Level of sHSP21.4 Gene Induced by Pathogen Infections, in Antheraea pernyi

    OpenAIRE

    Zhang, Congfen; Dai, Lishang; Wang, Lei; Qian, Cen; Wei, Guoqing; Li, Jun; Zhu, Baojian; Liu, Chaoliang

    2015-01-01

    Small heat shock proteins (sHSPs) can regulate protein folding and protect cells from stress. To investigate the role of sHSPs in the silk-producing insect Antheraea pernyi response to microorganisms, a sHsp gene termed as Ap-sHSP21.4, was identified. This gene encoded a 21.4 kDa protein which shares the conserved structure of insect sHsps and belongs to sHSP21.4 family. Ap-sHSP21.4 was highly expressed in fat body and up-regulated in midgut and fat body of A. pernyi challenged with Escherich...

  18. Nonlinear absorbance amplification using a diffuse reflectance cell: total organic carbon monitoring at 214 nm.

    Science.gov (United States)

    Li, Yin-Huan; Shelor, C Phillip; Dasgupta, Purnendu K

    2015-01-20

    We present an absorption spectrometric method using a polytetrafluoroethylene (PTFE) cell as a diffuse reflector. The system was used for monitoring ultrapure water. All compounds absorb to some degree at low UV wavelengths, and the absorption at 214 nm from a zinc lamp source was monitored using a charge-coupled device (CCD) spectrometer. The absorption was interpreted in terms of total organic carbon present. The cell acts as a nonlinear absorbance amplifier, improving both the limit of detection (LOD) and the dynamic range. Potassium hydrogen phthalate (KHP) and glucose were used to evaluate the system and provided respective LODs of 46.5 ng/L and 4.5 mg/L as carbon. Although the physical path length was 25 cm, a maximum effective path length of 280 cm was observed at the lowest tested KHP concentrations. The system is intended for real-time monitoring of ultrapure water.

  19. Henoch-Schönlein purpura in childhood: Review of 214 patients

    Directory of Open Access Journals (Sweden)

    İlhan Tan

    2012-03-01

    Full Text Available Objectives: Due to involvement of various systems andclinical variety of in Henoch-Schönlein purpura (HSP, inthis study, it was aimed to investigate clinical and laboratoryfeatures of children with HSP.Materials and methods: Hospital records of 214 childrenwith HSP followed up between 2000 and 2007 at DicleUniversity Hospital Pediatrics Clinics were retrospectivelyevaluated. Diagnosis was made based on the HSP criteriaof American College of Rheumatology. Age, gender,clinical findings, laboratory variables, applied treatments,and outcome were recorded.Results: Totally 214 HSP patients (121 male, 93 femalewith the mean age of 9.0 ± 3.2 years (range, 2-16 wereincluded. There was a history of upper respiratory tractinfection in 136 children (63.6%. There was abdominalpain in 62.1% of patients, vomiting in 22.1%, and occultblood in stool or melena in 25.4%. Three patients underwentoperation due to intusception. Joint involvementwas seen in 117 (54.7% and craniofacial edema in 73(34.3% of patients. Renal involvement as hematuria wasseen in 63 (29.4% children, proteinuria in 57 (26.6%,leukocyturia (9.8%, and nephritic/nephritic proteinuria infive patients. Increased IgA and C3 levels were found in35 (16.0% and 41 (19.3%, respectively; and decreasedC3 in 23 (10.7%. Benzathine penicillin and penicillin Vwere used in 114 (53.5% of children, non-steroidal antiinflammatorydrugs in 128 (59.8% and parenteral/oralcorticosteroids in 86 (40.2%. Immonusuppressives weregiven to 5 patients with nephrotic proteinuria following renalbiopsy.Conclusions: Gastrointestinal and renal involvement inchildren with HSP, rarely lead to major complications. JClin Exp Invest 2012; 3(1: 91-95

  20. Thermodynamic Critical Field and Superconducting Fluctuation of Vortices for High Temperature Cuprate Superconductor: La-214

    Energy Technology Data Exchange (ETDEWEB)

    Finnemore, Douglas K. [Iowa State Univ., Ames, IA (United States)

    2001-01-01

    Thermodynamics has been studied systematically for the high temperature cuprate superconductor La2-xSrxCuO4-δ, La-214, in the entire superconductive region from strongly underdoped to strongly overdoped regimes. Magnetization studies with H $\\parallel$ c have been made in order to investigate the changes in free energy of the system as the number of carriers is reduced. Above the superconducting transition temperature, the normal-state magnetization exhibits a two-dimensional Heisenberg antiferromagnetic behavior. Below Tc, magnetization data are thermodynamically reversible over large portions of the H-T plane, so the free energy is well defined in these regions. As the Sr concentration is varied over the wide range from 0.060 (strongly underdoped) to 0.234 (strongly overdoped), the free energy change goes through a maximum at the optimum doped in a manner similar to the Tc0 vs. x curve. The density of states, N(0), remains nearly constant in the overdoped and optimum doped regimes, taking a broad maximum around x = 0.188, and then drops abruptly towards zero in the underdoped regime. The La2-xSrxCuO4 (La-214) system displays the fluctuating vortex behavior with the characteristic of either 2D or 3D fluctuations as indicated by clearly identifiable crossing points T* close to Tc. The dimensional character of the fluctuations depends on both applied magnetic fields and the density of charge carriers. The dimensional crossover from 2D to 3D occurs in the strongly underdoped regime when the c-axis coherence distance ξc becomes comparable to the spacing between adjacent CuO2 layers s at sufficiently high magnetic field near Hc2.

  1. Solution structure and dynamics of the I214V mutant of the rabbit prion protein.

    Directory of Open Access Journals (Sweden)

    Yi Wen

    Full Text Available BACKGROUND: The conformational conversion of the host-derived cellular prion protein (PrP(C into the disease-associated scrapie isoform (PrP(Sc is responsible for the pathogenesis of transmissible spongiform encephalopathies (TSEs. Various single-point mutations in PrP(Cs could cause structural changes and thereby distinctly influence the conformational conversion. Elucidation of the differences between the wild-type rabbit PrP(C (RaPrP(C and various mutants would be of great help to understand the ability of RaPrP(C to be resistant to TSE agents. METHODOLOGY/PRINCIPAL FINDINGS: We determined the solution structure of the I214V mutant of RaPrP(C(91-228 and detected the backbone dynamics of its structured C-terminal domain (121-228. The I214V mutant displays a visible shift of surface charge distribution that may have a potential effect on the binding specificity and affinity with other chaperones. The number of hydrogen bonds declines dramatically. Urea-induced transition experiments reveal an obvious decrease in the conformational stability. Furthermore, the NMR dynamics analysis discloses a significant increase in the backbone flexibility on the pico- to nanosecond time scale, indicative of lower energy barrier for structural rearrangement. CONCLUSIONS/SIGNIFICANCE: Our results suggest that both the surface charge distribution and the intrinsic backbone flexibility greatly contribute to species barriers for the transmission of TSEs, and thereby provide valuable hints for understanding the inability of the conformational conversion for RaPrP(C.

  2. Reciprocal regulation of miR-214 and PTEN by high glucose regulates renal glomerular mesangial and proximal tubular epithelial cell hypertrophy and matrix expansion.

    Science.gov (United States)

    Bera, Amit; Das, Falguni; Ghosh-Choudhury, Nandini; Mariappan, Meenalakshmi M; Kasinath, Balakuntalam S; Ghosh Choudhury, Goutam

    2017-10-01

    Aberrant expression of microRNAs (miRs) contributes to diabetic renal complications, including renal hypertrophy and matrix protein accumulation. Reduced expression of phosphatase and tensin homolog (PTEN) by hyperglycemia contributes to these processes. We considered involvement of miR in the downregulation of PTEN. In the renal cortex of type 1 diabetic mice, we detected increased expression of miR-214 in association with decreased levels of PTEN and enhanced Akt phosphorylation and fibronectin expression. Mesangial and proximal tubular epithelial cells exposed to high glucose showed augmented expression of miR-214. Mutagenesis studies using 3'-UTR of PTEN in a reporter construct revealed PTEN as a direct target of miR-214, which controls its expression in both of these cells. Overexpression of miR-214 decreased the levels of PTEN and increased Akt activity similar to high glucose and lead to phosphorylation of its substrates glycogen synthase kinase-3β, PRAS40, and tuberin. In contrast, quenching of miR-214 inhibited high-glucose-induced Akt activation and its substrate phosphorylation; these changes were reversed by small interfering RNAs against PTEN. Importantly, respective expression of miR-214 or anti-miR-214 increased or decreased the mammalian target of rapamycin complex 1 (mTORC1) activity induced by high glucose. Furthermore, mTORC1 activity was controlled by miR-214-targeted PTEN via Akt activation. In addition, neutralization of high-glucose-stimulated miR-214 expression significantly inhibited cell hypertrophy and expression of the matrix protein fibronectin. Finally, the anti-miR-214-induced inhibition of these processes was reversed by the expression of constitutively active Akt kinase and hyperactive mTORC1. These results uncover a significant role of miR-214 in the activation of mTORC1 that contributes to high-glucose-induced mesangial and proximal tubular cell hypertrophy and fibronectin expression.

  3. 49 CFR 214.519 - Floors, decks, stairs, and ladders of on-track roadway maintenance machines.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Floors, decks, stairs, and ladders of on-track... SAFETY On-Track Roadway Maintenance Machines and Hi-Rail Vehicles § 214.519 Floors, decks, stairs, and ladders of on-track roadway maintenance machines. Floors, decks, stairs, and ladders of on-track roadway...

  4. 48 CFR 52.214-23 - Late submissions, modifications, revisions, and withdrawals of technical proposals under two-step...

    Science.gov (United States)

    2010-10-01

    ..., modifications, revisions, and withdrawals of technical proposals under two-step sealed bidding. 52.214-23... Late submissions, modifications, revisions, and withdrawals of technical proposals under two-step..., Modifications, Revisions, and Withdrawals of Technical Proposals Under Two-Step Sealed Bidding (NOV 1999) (a...

  5. MicroRNA-214 and MicroRNA-126 Are Potential Biomarkers for Malignant Endothelial Proliferative Diseases

    Science.gov (United States)

    Heishima, Kazuki; Mori, Takashi; Ichikawa, Yukie; Sakai, Hiroki; Kuranaga, Yuki; Nakagawa, Takayuki; Tanaka, Yuiko; Okamura, Yasuhiko; Masuzawa, Mikio; Sugito, Nobuhiko; Murakami, Mami; Yamada, Nami; Akao, Yukihiro; Maruo, Kohji

    2015-01-01

    Malignant endothelial proliferative diseases including human angiosarcoma (AS) and canine hemangiosarcoma (HSA) are serious diseases with a grave prognosis. Establishing liquid biopsy-based biomarkers for screening has definite clinical utility; however, plasma miRNAs up- or down-regulated in these sarcomas have been unclear. For identifying possible diagnostic plasma miRNAs for these sarcomas, we investigated whether plasma miR-214 and miR-126, which miRNAs play important roles in angiogenesis and tumorigenesis, were elevated in malignant endothelial proliferative diseases. For this investigation, human angiosarcoma and canine hemangiosarcoma cell lines and clinical plasma samples of canine hemangiosarcoma were examined by performing miRNA qRT-PCR. We report here that human angiosarcoma and canine hemangiosarcoma cell lines over-secreted miR-214 and miR-126 via microvesicles; in addition, their levels in the plasma samples from canines with hemangiosarcoma were increased. Moreover, the surgical resection of primary tumors decreased the levels of plasma miR-214 and miR-126. Our findings suggest that these malignant endothelial proliferative diseases over-secreted miR-214 and miR-126, thus suggesting that these miRNAs have potential as diagnostic biomarkers for malignant endothelial proliferative diseases in canine and possible in human angiosarcoma. PMID:26512652

  6. MicroRNA-214 and MicroRNA-126 Are Potential Biomarkers for Malignant Endothelial Proliferative Diseases

    Directory of Open Access Journals (Sweden)

    Kazuki Heishima

    2015-10-01

    Full Text Available Malignant endothelial proliferative diseases including human angiosarcoma (AS and canine hemangiosarcoma (HSA are serious diseases with a grave prognosis. Establishing liquid biopsy-based biomarkers for screening has definite clinical utility; however, plasma miRNAs up- or down-regulated in these sarcomas have been unclear. For identifying possible diagnostic plasma miRNAs for these sarcomas, we investigated whether plasma miR-214 and miR-126, which miRNAs play important roles in angiogenesis and tumorigenesis, were elevated in malignant endothelial proliferative diseases. For this investigation, human angiosarcoma and canine hemangiosarcoma cell lines and clinical plasma samples of canine hemangiosarcoma were examined by performing miRNA qRT-PCR. We report here that human angiosarcoma and canine hemangiosarcoma cell lines over-secreted miR-214 and miR-126 via microvesicles; in addition, their levels in the plasma samples from canines with hemangiosarcoma were increased. Moreover, the surgical resection of primary tumors decreased the levels of plasma miR-214 and miR-126. Our findings suggest that these malignant endothelial proliferative diseases over-secreted miR-214 and miR-126, thus suggesting that these miRNAs have potential as diagnostic biomarkers for malignant endothelial proliferative diseases in canine and possible in human angiosarcoma.

  7. 19 CFR 351.214 - New shipper reviews under section 751(a)(2)(B) of the Act.

    Science.gov (United States)

    2010-04-01

    ... COMMERCE ANTIDUMPING AND COUNTERVAILING DUTIES Antidumping and Countervailing Duty Procedures § 351.214 New... month. (3) Example. An order is published in January. The anniversary month would be January, and the... section, the Secretary will issue preliminary results of review (see § 351.221(b)(4)) within 180 days...

  8. 30 CFR 250.214 - What geological and geophysical (G&G) information must accompany the EP?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What geological and geophysical (G&G... and Information Contents of Exploration Plans (ep) § 250.214 What geological and geophysical (G&G) information must accompany the EP? The following G&G information must accompany your EP: (a) Geological...

  9. 42 CFR 57.214 - Repayment of loans made after November 17, 1971, for failure to complete a program of study.

    Science.gov (United States)

    2010-10-01

    ..., for failure to complete a program of study. 57.214 Section 57.214 Public Health PUBLIC HEALTH SERVICE... after November 17, 1971, for failure to complete a program of study. In the event that the Secretary... eligible education loan was made upon certification by a health professions school that the individual...

  10. Restoration of microRNA-214 expression reduces growth of myeloma cells through positive regulation of P53 and inhibition of DNA replication.

    Science.gov (United States)

    Misiewicz-Krzeminska, Irena; Sarasquete, María E; Quwaider, Dalia; Krzeminski, Patryk; Ticona, Fany V; Paíno, Teresa; Delgado, Manuel; Aires, Andreia; Ocio, Enrique M; García-Sanz, Ramón; San Miguel, Jesús F; Gutiérrez, Norma C

    2013-04-01

    MicroRNA have been demonstrated to be deregulated in multiple myeloma. We have previously reported that miR-214 is down-regulated in multiple myeloma compared to in normal plasma cells. The functional role of miR-214 in myeloma pathogenesis was explored by transfecting myeloma cell lines with synthetic microRNA followed by gene expression profiling. Putative miR-214 targets were validated by luciferase reporter assay. Ectopic expression of miR-214 reduced cell growth and induced apoptosis of myeloma cells. In order to identify the potential direct target genes of miR-214 which could be involved in the biological pathways regulated by this microRNA, gene expression profiling of the H929 myeloma cell line transfected with precursor miR-214 was carried out. Functional analysis revealed significant enrichment for DNA replication, cell cycle phase and DNA binding. miR-214 directly down-regulated the expression of PSMD10, which encodes the oncoprotein gankyrin, and ASF1B, a histone chaperone required for DNA replication, by binding to their 3'-untranslated regions. In addition, gankyrin inhibition induced an increase of P53 mRNA levels and subsequent up-regulation of CDKN1A (p21Waf1/Cip1) and BAX transcripts, which are direct transcriptional targets of p53. In conclusion, MiR-214 functions as a tumor suppressor in myeloma by positive regulation of p53 and inhibition of DNA replication.

  11. Inhibitors of eicosanoid biosynthesis influencing the transcripts level of sHSP21.4 gene induced by pathogen infections, in Antheraea pernyi.

    Science.gov (United States)

    Zhang, Congfen; Dai, Lishang; Wang, Lei; Qian, Cen; Wei, Guoqing; Li, Jun; Zhu, Baojian; Liu, Chaoliang

    2015-01-01

    Small heat shock proteins (sHSPs) can regulate protein folding and protect cells from stress. To investigate the role of sHSPs in the silk-producing insect Antheraea pernyi response to microorganisms, a sHsp gene termed as Ap-sHSP21.4, was identified. This gene encoded a 21.4 kDa protein which shares the conserved structure of insect sHsps and belongs to sHSP21.4 family. Ap-sHSP21.4 was highly expressed in fat body and up-regulated in midgut and fat body of A. pernyi challenged with Escherichia coli, Beauveria bassiana and nuclear polyhedrosis virus (NPV), which was determined by quantitative real-time PCR. Meanwhile, knock down of Ap-sHSP21.4 with dsRNA result in the decrease at the expression levels of several immune response-related genes (defensin, Dopa decarboxylase, Toll1, lysozyme and Kazal-type serine protease inhibitor). Additionally, the impact of eicosanoid biosynthesis on the expression of Ap-sHSP21.4 response to NPV was determined using qPCR, inhibitors of eicosanoid biosynthesis significantly suppress Ap-HSP21.4 expression upon NPV challenge. All together, Ap-sHSP21.4 was involved in the immunity of A. pernyi against microorganism and possibly mediated by eicosanoids pathway. These results will shed light in the understanding of the pathogen-host interaction in A. pernyi.

  12. System for Automated Geoscientific Analyses (SAGA) v. 2.1.4

    Science.gov (United States)

    Conrad, O.; Bechtel, B.; Bock, M.; Dietrich, H.; Fischer, E.; Gerlitz, L.; Wehberg, J.; Wichmann, V.; Böhner, J.

    2015-02-01

    The System for Automated Geoscientific Analyses (SAGA) is an open-source Geographic Information System (GIS), mainly licensed under the GNU General Public License. Since its first release in 2004, SAGA has rapidly developed from a specialized tool for digital terrain analysis to a comprehensive and globally established GIS platform for scientific analysis and modeling. SAGA is coded in C++ in an object oriented design and runs under several operating systems including Windows and Linux. Key functional features of the modular organized software architecture comprise an application programming interface for the development and implementation of new geoscientific methods, an easily approachable graphical user interface with many visualization options, a command line interpreter, and interfaces to scripting and low level programming languages like R and Python. The current version 2.1.4 offers more than 700 tools, which are implemented in dynamically loadable libraries or shared objects and represent the broad scopes of SAGA in numerous fields of geoscientific endeavor and beyond. In this paper, we inform about the system's architecture, functionality, and its current state of development and implementation. Further, we highlight the wide spectrum of scientific applications of SAGA in a review of published studies with special emphasis on the core application areas digital terrain analysis, geomorphology, soil science, climatology and meteorology, as well as remote sensing.

  13. Nonnatural amino acid incorporation into the methionine 214 position of the metzincin Pseudomonas aeruginosa alkaline protease

    Directory of Open Access Journals (Sweden)

    Honek John F

    2005-10-01

    Full Text Available Abstract Background The alkaline protease from Pseudomonas aeruginosa (AprA is a member of the metzincin superfamily of metalloendoproteases. A key feature of these proteases is a conserved methionine-containing 1,4-tight β turn at the base of the active site zinc binding region. Results To explore the invariant methionine position in this class of protease, incorporation of a nonnatural fluorinated methionine, L-difluoromethionine (DFM, into this site was accomplished. Although overproduction of the N-terminal catalytic fragment of AprA resulted in protein aggregates which could not be resolved, successful heterologous production of the entire AprA was accomplished in the presence and absence of the nonnatural amino acid. DFM incorporation was found to only slightly alter the enzyme kinetics of AprA. In addition, differential scanning calorimetry indicated no significant alteration in the thermal stability of the modified enzyme. Conclusion Although invariant in all metzincin proteases, the methionine 214 position in AprA can be successfully replaced by the nonnatural amino acid DFM resulting in little effect on protein structure and function. This study indicates that the increased size of the methyl group by the introduction of two fluorines is still sufficiently non-sterically demanding, and bodes well for the application of DFM to biophysical studies of protein structure and function in this class of protease.

  14. Correlation between inflammatory infiltrate and epithelial lining in 214 cases of periapical cysts

    Directory of Open Access Journals (Sweden)

    Barbara Albertini Roquim Alcantara

    2013-12-01

    Full Text Available The aim of this study was to evaluate the prevalence of periapical cysts, identify their clinical and microscopic features and correlate their microscopic features with the inflammatory infiltrate present in the lesion site. A total of 214 cases were collected over a 10-year period. Clinical data, including gender, age, race, symptoms and location of the lesion, were recorded. Two independent examiners with no prior knowledge of the patients' clinical data conducted the microscopic evaluations. Statistical analyses were performed using Fisher's or chi-square tests at a 5% level of significance. The results showed that periapical cysts were more prevalent in white women, with a mean age of 35 years, and in the anterosuperior region. The majority of the lesions were lined by atrophic cystic epithelium, which was associated with moderate inflammatory infiltrate in the cystic capsule (p < 0.01, with a diffuse localization pattern (p = 0.03 and absence of neutrophils (p = 0.01. Our findings suggest that periapical cysts lined by atrophic epithelium are related to the presence of moderate mononuclear inflammatory infiltrate.

  15. Plastic deformation and fracture behaviour of 21/4 Cr-1 Mo pressure-vessel steel

    Energy Technology Data Exchange (ETDEWEB)

    Holzmann, M.; Vlach, B.; Man, J.; Bilek, Z.

    1989-01-01

    During the heat treatment of steel plates and forgings of large thicknesses, microstructures with various volume fractions of ferrite appear. Plastic properties and fracture behaviour of these mixed microstructures are a function of ferrite content. The influence of ferrite content in the range from 0% to 54% in the bainitic-ferritic microstructure on mechanical properties and fracture behaviour of 21/4 Cr-1 Mo steel was examined. The yield stress was found to decrease linearly with the volume fraction of ferrite. The tensile strength was independent of ferrite content up to 25%, after which the tensile strength decreased. Using the Charpy test it has been found that the critical ferrite content-25%-exists in a mixed microstructure, at which the propagation and initiation transition temperatures attain the highest values. The fracture toughness tests gave the same results. Increasing the volume fraction of ferrite, the cleavage fracture toughness/temperature curves were shifted to higher temperatures. Simultaneously, the ductile-brittle fracture toughness transition temperature was raised reaching the highest value for the critical ferrite content. The fracture behaviour could be tentatively explained through the influence of ferrite volume fraction on both the cleavage fracture stress and the stress level at the crack tip.

  16. Mapping the Primate Visual System with [2-14C]Deoxyglucose

    Science.gov (United States)

    Macko, Kathleen A.; Jarvis, Charlene D.; Kennedy, Charles; Miyaoka, Mikoto; Shinohara, Mami; Sokoloff, Louis; Mishkin, Mortimer

    1982-10-01

    The [2-14C]deoxyglucose method was used to identify the cerebral areas related to vision in the rhesus monkey (Macaca mulatta). This was achieved by comparing glucose utilization in a visually stimulated with that in a visually deafferented hemisphere. The cortical areas related to vision included the entire expanse of striate, prestriate, and inferior temporal cortex as far forward as the temporal pole, the posterior part of the inferior parietal lobule, and the prearcuate and inferior prefrontal cortex. Subcortically, in addition to the dorsal lateral geniculate nucleus and superficial layers of the superior colliculus, the structures related to vision included large parts of the pulvinar, caudate, putamen, claustrum, and amygdala. These results, which are consonant with a model of visual function that postulates an occipito-temporo-prefrontal pathway for object vision and an occipito-parieto-prefrontal pathway for spatial vision, reveal the full extent of those pathways and identify their points of contact with limbic, striatal, and diencephalic structures.

  17. MiR-214 inhibits cell migration, invasion and promotes the drug sensitivity in human cervical cancer by targeting FOXM1.

    Science.gov (United States)

    Wang, Jian-Mei; Ju, Bao-Hui; Pan, Cai-Jun; Gu, Yan; Li, Meng-Qi; Sun, Li; Xu, Yan-Ying; Yin, Li-Rong

    2017-01-01

    MicroRNAs (miRNAs) play key roles in progression of cervical cancer. In the present study, we investigated the role of miR-214 in the process of migration, invasion and drug sensitivity to cisplatin in cervical cancer. We detected the differential expression of miR-214 in 19 cases cervical cancer tissues and normal tissues as well as 4 cervical cancer cells and one normal cervical cells by Real-time PCR. Then, wound healing assay, transwell invasion assay and MTT were used to detect the effects of migration, invasion and sensitivity to cisplatin of cervical cancer when miR-214 was overexpressed. Western blot, immunofluorescence and Flow Cytometry were used to detect the mechanism of migration, invasion and sensitivity to cisplatin. Next, bioinformatics analysis was used to find the target of miR-214. Through the luciferase reporter assay, Real-time PCR and western blot, we confirmed the binding relationship of miR-214 and FOXM1. In cervical cancer tissues, the expression of FOXM1 was detected by western blot and Immunohistochemistry. We also knocked down FOXM1 in cervical cancer cells, wound healing assay, transwell invasion assay and MTT were performed to detect the migration, invasion and sensitivity to cisplatin abilities of FOXM1. Western blot and Flow Cytometry were used to detect the mechanism of migration, invasion and sensitivity to cisplatin by FOXM1. Finally, we performed rescue expriments to confirm the function relationship between miR-214 and FOXM1. 1. Our results showed that miR-214 was frequently downregulated in tumor tissues and cancer cells especially in CIN III and cervical cancer stages. 2. Overexpression of miR-214 significantly inhibited migration and invasion of cervical cancer cells and prompted the sensitivity to cisplatin. 3. FOXM1 was identified as a target of miR-214 and down-regulated by miR-214. 4. Knocking down FOXM1 could inhibited migration and invasion of cervical cancer cells and prompted the sensitivity to cisplatin. 5. FOXM1 was

  18. Impact of HIV-1 reverse transcriptase polymorphism F214L on virological response to thymidine analogue-based regimens in antiretroviral therapy (ART)-naive and ART-experienced patients

    DEFF Research Database (Denmark)

    Ceccherini-Silberstein, Francesca; Cozzi-Lepri, Alessandro; Ruiz, Lidia

    2007-01-01

    A negative association between the polymorphism F214L and type 1 thymidine analogue (TA) mutations (TAMs) has been observed. However, the virological response to TAs according to the detection of F214L has not been evaluated....

  19. Detection of Helicobacter pylori infection by examination of human breath odor using electronic nose Bloodhound-214ST

    Science.gov (United States)

    Shnayder, E. P.; Moshkin, M. P.; Petrovskii, D. V.; Shevela, A. I.; Babko, A. N.; Kulikov, V. G.

    2009-05-01

    Our aim was to examine the possibility of use e-nose Bloodhound-214ST to determine presence or absence of H. pylori infection using exhalation samples of patients. Breath samples were collected twice: at baseline and after oral administration of 500 mg of urea. H. pylori status of patients was confirmed by antral biopsy. Using two approaches for the data analysis we showed the possibility to distinguish H. pylori free and infected patients.

  20. The effects of aging on the microstructure, hardness and fracture behavior of 2{1/4}Cr-1Mo steel

    Energy Technology Data Exchange (ETDEWEB)

    Norris, S.D.; Parker, J.D. [Univ. of Wales, Swansea (United Kingdom). Dept. of Materials Engineering

    1995-12-01

    The effect of laboratory aging on the microstructure and properties of 2{1/4}Cr-1Mo low alloy steel has been investigated. Microstructural changes have been characterized using metallographic techniques and by undertaking selected mechanical tests. Results obtained indicate that precipitate coarsening leads to a reduction in hardness and an increase in brittle ductile transition temperature. Similar changes were observed in material which had been subjected to long term service under elevated temperature conditions.

  1. Combined aberrant expression of microRNA-214 and UBC9 is an independent unfavorable prognostic factor for patients with gliomas.

    Science.gov (United States)

    Wang, Shuai; Jiao, Baohua; Geng, Shaomei; Ma, Shucheng; Liang, Zhaohui; Lu, Shengkui

    2014-01-01

    MicroRNA-214 (miR-214) plays an important role in tumor cell proliferation, migration and invasion, as well as tumor angiogenesis. Ubiquitin-conjugating enzyme 9 (UBC9) is implicated in regulating several critical cancer-related pathways. Recent study has demonstrated that miR-214 reduction may facilitate UBC9 expression and may be involved in the regulation of glioma cell proliferation. The aim of this study was to clarify the clinical significance of miR-214 and UBC9 in human glioma, which has not been fully elucidated. Quantitative real-time polymerase chain reaction analysis was used to characterize the expression patterns of miR-214 and UBC9 mRNA in 108 glioma and 20 normal brain tissues. The associations of miR-214 and UBC9 mRNA expressions with clinicopathological factors and prognosis of glioma patients were also statistically analyzed. Compared with normal brain tissues, the expression levels of miR-214 and UBC9 mRNA in glioma tissues were significantly downregulated and upregulated, respectively (both P UBC9 mRNA expression in glioma tissues (r = -0.61, P = 0.01). Additionally, the combined miR-214 downregulation and UBC9 upregulation (miR-214-low/UBC9-high) was significantly associated with advanced pathological grade (P = 0.008). Moreover, Kaplan-Meier survival and Cox regression analyses showed that the glioma patients with miR-214-low/UBC9-high expression had poorest overall survival (P UBC9-high was an independent prognostic indicator of glioma (P = 0.01). Furthermore, subgroup analyses showed that miR-214-low/UBC9-high expression was significantly associated with poor overall survival in glioma patients with high pathological grades (for grade III-IV: P UBC9 may contribute to the development and the clinical outcome of glioma, and are valuable prognostic factors for glioma patients. A combined detection of miR-214/UBC9 expression may benefit us in predicting the prognosis of patients with advanced gliomas.

  2. SCN1Bb R214Q found in 3 patients: 1 with Brugada syndrome and 2 with lone atrial fibrillation

    DEFF Research Database (Denmark)

    Olesen, Morten S; Holst, Anders G; Haunsø, Stig

    2012-01-01

    BACKGROUND: SCN1Bb encodes the ß-subunit of the sodium channel. A mutation in SCN1Bb R214Q has recently been shown both to increase the Kv4.3 current and to decrease the sodium current. The variant was suggested to increase the susceptibility to Brugada syndrome (BrS). OBJECTIVE: To sequence...... a population of BrS and early-onset lone atrial fibrillation (AF) patients for the R214Q mutation in the SCN1Bb gene. METHODS: The coding sequence and splice junctions of SCN1Bb were bidirectionally sequenced by using Big Dye chemistry in 192 early-onset lone AF patients and 22 BrS patients. RESULTS: Three......) and has not previously been reported in conjunction to AF. CONCLUSION: Three patients of 192 young lone AF and 22 BrS patients carried the nonsynonymous R214Q mutations in SCN1Bb, thereby indicating that this variant increases the susceptibility to both BrS and AF....

  3. Inhibitors of eicosanoid biosynthesis influencing the transcripts level of sHSP21.4 gene induced by pathogen infections, in Antheraea pernyi.

    Directory of Open Access Journals (Sweden)

    Congfen Zhang

    Full Text Available Small heat shock proteins (sHSPs can regulate protein folding and protect cells from stress. To investigate the role of sHSPs in the silk-producing insect Antheraea pernyi response to microorganisms, a sHsp gene termed as Ap-sHSP21.4, was identified. This gene encoded a 21.4 kDa protein which shares the conserved structure of insect sHsps and belongs to sHSP21.4 family. Ap-sHSP21.4 was highly expressed in fat body and up-regulated in midgut and fat body of A. pernyi challenged with Escherichia coli, Beauveria bassiana and nuclear polyhedrosis virus (NPV, which was determined by quantitative real-time PCR. Meanwhile, knock down of Ap-sHSP21.4 with dsRNA result in the decrease at the expression levels of several immune response-related genes (defensin, Dopa decarboxylase, Toll1, lysozyme and Kazal-type serine protease inhibitor. Additionally, the impact of eicosanoid biosynthesis on the expression of Ap-sHSP21.4 response to NPV was determined using qPCR, inhibitors of eicosanoid biosynthesis significantly suppress Ap-HSP21.4 expression upon NPV challenge. All together, Ap-sHSP21.4 was involved in the immunity of A. pernyi against microorganism and possibly mediated by eicosanoids pathway. These results will shed light in the understanding of the pathogen-host interaction in A. pernyi.

  4. NKTR-214, an Engineered Cytokine with Biased IL2 Receptor Binding, Increased Tumor Exposure, and Marked Efficacy in Mouse Tumor Models.

    Science.gov (United States)

    Charych, Deborah H; Hoch, Ute; Langowski, John L; Lee, Steve R; Addepalli, Murali K; Kirk, Peter B; Sheng, Dawei; Liu, Xiaofeng; Sims, Paul W; VanderVeen, Laurie A; Ali, Cherie F; Chang, Thomas K; Konakova, Marina; Pena, Rhoneil L; Kanhere, Rupesh S; Kirksey, Yolanda M; Ji, Chunmei; Wang, Yujun; Huang, Jicai; Sweeney, Theresa D; Kantak, Seema S; Doberstein, Stephen K

    2016-02-01

    Aldesleukin, recombinant human IL2, is an effective immunotherapy for metastatic melanoma and renal cancer, with durable responses in approximately 10% of patients; however, severe side effects limit maximal dosing and thus the number of patients able to receive treatment and potential cure. NKTR-214 is a prodrug of conjugated IL2, retaining the same amino acid sequence as aldesleukin. The IL2 core is conjugated to 6 releasable polyethylene glycol (PEG) chains. In vivo, the PEG chains slowly release to generate active IL2 conjugates. We evaluated the bioactivity and receptor binding of NKTR-214 and its active IL2 conjugates in vitro; the tumor immunology, tumor pharmacokinetics, and efficacy of NKTR-214 as a single agent and in combination with anti-CTLA-4 antibody in murine tumor models. Tolerability was evaluated in non-human primates. In a murine melanoma tumor model, the ratio of tumor-killing CD8(+) T cells to Foxp3(+) regulatory T cells was greater than 400 for NKTR-214 compared with 18 for aldesleukin, supporting preferential activation of the IL2 receptor beta over IL2 receptor alpha, due to the location of PEG molecules. NKTR-214 provides a 500-fold greater exposure of the tumor to conjugated IL2 compared with aldesleukin. NKTR-214 showed efficacy as a single agent and provided durable immunity that was resistant to tumor rechallenge in combination with anti-CTLA-4 antibody. NKTR-214 was well tolerated in non-human primates. These data support further evaluation of NKTR-214 in humans for a variety of tumor types, adding to the repertoire of potent and potentially curative cancer immunotherapies. ©2016 American Association for Cancer Research.

  5. Comment on: “Zero-temperature conductance of parallel T-shape double quantum dots” [Physica E 39 (2007) 214

    Science.gov (United States)

    Cornaglia, P. S.

    2008-06-01

    In a recent paper [Physica E 39 (2007) 214, arXiv:0708.1842v1] Crisan, Grosu, and Tifrea revisited the problem of the conductance through a double-quantum-dot molecule connected to electrodes in a T-shape configuration. The authors obtained an expression for the conductance that disagrees with previous results in the literature. We point out an error in their derivation of the conductance formula and show that it gives unphysical results even for non-interacting quantum dots.

  6. LW-214, a newly synthesized flavonoid, induces intrinsic apoptosis pathway by down-regulating Trx-1 in MCF-7 human breast cells.

    Science.gov (United States)

    Pan, Di; Li, Wei; Miao, Hanchi; Yao, Jing; Li, Zhiyu; Wei, Libin; Zhao, Li; Guo, Qinglong

    2014-02-15

    In this study, the anticancer effect of LW-214, a newly synthesized flavonoid, against MCF-7 human breast cancer cells and the underlying mechanisms were investigated. LW-214 triggered the mitochondrial apoptotic pathway by increasing Bax/Bcl-2 ratio, loss of mitochondrial membrane potential (ΔΨm) and caspase-9 activation, degradation of poly (ADP-ribose) polymerase (PARP), cytochrome c (Cyt c) release and apoptosis-inducing factor (AIF) transposition. Further research revealed that both the reactive oxygen species (ROS) generation and the apoptosis signal regulating kinase 1 (ASK1) activation by LW-214 were induced by down-regulating the thioredoxin-1 (Trx-1) expression. The ROS elevation and ASK1 activation induced a sustained phosphorylation of c-Jun N-terminal kinase (JNK), while SP600125, as known as JNK inhibitor, almost reversed LW-214-induced apoptosis in MCF-7 cells. Overexpression of Trx-1 in MCF-7 cells attenuated LW-214-mediated apoptosis as well as the JNK activation and reversed the expression of mitochondrial apoptosis-related protein. Accordingly, the in vivo study showed that LW-214 exhibited a potential antitumor effect in BALB/c species mice inoculated MCF-7 tumor with low systemic toxicity, and the mechanism was the same as in vitro study. Taken together, these findings indicated that LW-214 may down-regulated Trx-1 function, causing intracellular ROS generation and releasing the ASK1, and lead to JNK activation, which consequently induced the mitochondrial apoptosis in vitro and in vivo. Copyright © 2013 Elsevier Inc. All rights reserved.

  7. Long Non-Coding RNA KCNQ1OT1 Promotes Cataractogenesis via miR-214 and Activation of the Caspase-1 Pathway

    Directory of Open Access Journals (Sweden)

    Xin Jin

    2017-05-01

    Full Text Available Background/Aims: KCNQ1OT1 regulates the expression of tissue-specific imprinted genes within the Kcnq1 domain. Imprinted genes are positive regulators of apoptosis, one of the forms of cell death related to cataract formation, and thus may provide novel therapeutic targets for cataract treatment. Here, we studied the role of non-coding RNAs(ncRNA in cataract formation. Methods: Human lens epithelium cells (HLECs were treated with H2O2, and the expression of KCNQ1OT1 and miR-214 was detected by qRT-PCR. The expression of caspase-1 was detected using qRT-PCR, western blot and immunostaining. To confirm our findings in cell cultures, we analysed KCNQ1OT1, miR-214, and caspase-1 expression in lens anterior capsules of both cataract patients and normal controls by qRT-PCR and western blot analysis. Results: We found that the expression of KCNQ1OT1 was increased in both human cataract lens anterior capsular samples and SRA01/04 cell lines treated with H2O2. Knockdown of KCNQ1OT1 expression significantly suppressed H2O2-induced SRA01/04 cell pyroptosis in vitro, which is the critical step in cataract formation. The expression of microRNA-214 (miR-214 was also decreased in cataract lens anterior capsular tissues and H2O2-induced SRA01/04 cell lines. Knockdown of KCNQ1OT1 significantly increased the expression of miR-214. Conclusions: We demonstrated for the first time that caspase-1 is a functional downstream target of miR-214, and knockdown of KCNQ1OT1 reduced the expression of caspase-1. These results provide evidence that the KCNQ1OT1-miR-214-caspase-1 regulatory network is a novel mechanism for promoting cataract formation.

  8. MiR-214 targets β-catenin pathway to suppress invasion, stem-like traits and recurrence of human hepatocellular carcinoma.

    Directory of Open Access Journals (Sweden)

    Hongping Xia

    Full Text Available The down-regulation of miR-214 has previously been observed in human hepatocellular carcinoma (HCC. Here, we demonstrated the down-regulation of miR-214 is associated with cell invasion, stem-like traits and early recurrence of HCC. Firstly, we validated the suppression of miR-214 in human HCC by real-time quantitative RT-PCR (qRT-PCR in 20 paired tumor and non-tumor liver tissues of HCC patients and 10 histologically normal liver tissues from colorectal cancer patients with liver metastases. Further qRT-PCR analysis of 50 HCC tissues from an independent cohort of HCC patients of whom 29 with early recurrent disease (<2 years and 21 with late recurrent disease demonstrated that the suppression of miR-214 was significantly more suppressed in samples from HCC patients with early recurrent disease compared those from patients with no recurrence. Re-expression of miR-214 significantly suppressed the growth of HCC cells in vitro and reduced their tumorigenicity in vivo. The enhancer of zeste homologue 2 (EZH2 and β-catenin (CTNNB1 was identified as two potential direct downstream targets of miR-214 through bioinformatics analysis and experimentally validated the miRNA-target interactions with a dual-firefly luciferase reporter assay. In corroborate with this, both EZH2 and CTNNB1 are found to be significantly overexpressed in human HCC biopsies. Since EZH2 can regulate CTNNB1, CTNNB1 can also be an indirect target of miR-214 through EZH2. Silencing EZH2 or CTNNB1 expression suppressed the growth and invasion of HCC cells and induced E-cadherin (CDH1, known to inhibit cell invasion and metastasis. Furthermore, the silencing of miR-214 or overexpression of EZH2 increased EpCAM(+ stem-like cells through the activation of CTNNB1. Interestingly, the up-regulation of EZH2, CTNNB1 and the down-regulation of CDH1 in HCC patients correlated with early recurrent disease and can be an independent predictor of poor survival. Therefore, miR-214 can directly or

  9. Modeling the receptor pharmacology, pharmacokinetics, and pharmacodynamics of NKTR-214, a kinetically-controlled interleukin-2 (IL2) receptor agonist for cancer immunotherapy.

    Science.gov (United States)

    Charych, Deborah; Khalili, Samira; Dixit, Vidula; Kirk, Peter; Chang, Thomas; Langowski, John; Rubas, Werner; Doberstein, Stephen K; Eldon, Michael; Hoch, Ute; Zalevsky, Jonathan

    2017-01-01

    Cytokines are potent immune modulating agents but are not ideal medicines in their natural form due to their short half-life and pleiotropic systemic effects. NKTR-214 is a clinical-stage biologic that comprises interleukin-2 (IL2) protein bound by multiple releasable polyethylene glycol (PEG) chains. In this highly PEG-bound form, the IL2 is inactive; therefore, NKTR-214 is a biologic prodrug. When administered in vivo, the PEG chains slowly release, creating a cascade of increasingly active IL2 protein conjugates bound by fewer PEG chains. The 1-PEG-IL2 and 2-PEG-IL2 species derived from NKTR-214 are the most active conjugated-IL2 species. Free-IL2 protein is undetectable in vivo as it is eliminated faster than formed. The PEG chains on NKTR-214 are located at the region of IL2 that contacts the alpha (α) subunit of the heterotrimeric IL2 receptor complex, IL2Rαβγ, reducing its ability to bind and activate the heterotrimer. The IL2Rαβγ complex is constitutively expressed on regulatory T cells (Tregs). Therefore, without the use of mutations, PEGylation reduces the affinity for IL2Rαβγ to a greater extent than for IL2Rβγ, the receptor complex predominant on CD8 T cells. NKTR-214 treatment in vivo favors activation of CD8 T cells over Tregs in the tumor microenvironment to provide anti-tumor efficacy in multiple syngeneic models. Mechanistic modeling based on in vitro and in vivo kinetic data provides insight into the mechanism of NKTR-214 pharmacology. The model reveals that conjugated-IL2 protein derived from NKTR-214 occupy IL-2Rβγ to a greater extent compared to free-IL2 protein. The model accurately describes the sustained in vivo signaling observed after a single dose of NKTR-214 and explains how the properties of NKTR-214 impart a unique kinetically-controlled immunological mechanism of action.

  10. Modeling the receptor pharmacology, pharmacokinetics, and pharmacodynamics of NKTR-214, a kinetically-controlled interleukin-2 (IL2 receptor agonist for cancer immunotherapy.

    Directory of Open Access Journals (Sweden)

    Deborah Charych

    Full Text Available Cytokines are potent immune modulating agents but are not ideal medicines in their natural form due to their short half-life and pleiotropic systemic effects. NKTR-214 is a clinical-stage biologic that comprises interleukin-2 (IL2 protein bound by multiple releasable polyethylene glycol (PEG chains. In this highly PEG-bound form, the IL2 is inactive; therefore, NKTR-214 is a biologic prodrug. When administered in vivo, the PEG chains slowly release, creating a cascade of increasingly active IL2 protein conjugates bound by fewer PEG chains. The 1-PEG-IL2 and 2-PEG-IL2 species derived from NKTR-214 are the most active conjugated-IL2 species. Free-IL2 protein is undetectable in vivo as it is eliminated faster than formed. The PEG chains on NKTR-214 are located at the region of IL2 that contacts the alpha (α subunit of the heterotrimeric IL2 receptor complex, IL2Rαβγ, reducing its ability to bind and activate the heterotrimer. The IL2Rαβγ complex is constitutively expressed on regulatory T cells (Tregs. Therefore, without the use of mutations, PEGylation reduces the affinity for IL2Rαβγ to a greater extent than for IL2Rβγ, the receptor complex predominant on CD8 T cells. NKTR-214 treatment in vivo favors activation of CD8 T cells over Tregs in the tumor microenvironment to provide anti-tumor efficacy in multiple syngeneic models. Mechanistic modeling based on in vitro and in vivo kinetic data provides insight into the mechanism of NKTR-214 pharmacology. The model reveals that conjugated-IL2 protein derived from NKTR-214 occupy IL-2Rβγ to a greater extent compared to free-IL2 protein. The model accurately describes the sustained in vivo signaling observed after a single dose of NKTR-214 and explains how the properties of NKTR-214 impart a unique kinetically-controlled immunological mechanism of action.

  11. Production and assay of cellulolytic enzyme activity of Enterobacter cloacae WPL 214 isolated from bovine rumen fluid waste of Surabaya abbatoir, Indonesia

    Directory of Open Access Journals (Sweden)

    W. P. Lokapirnasari

    2015-03-01

    Full Text Available Aim: This study aims to produce and assay cellulolytic enzyme activity (endo-(1,4-β-D-glucanase, exo-(1,4-β-Dglucanase, and β-glucosidase, at optimum temperature and optimum pH of Enterobacter cloacae WPL 214 isolated from bovine rumen fluid waste of Surabaya Abbatoir, Indonesia. Materials and Methods: To produce enzyme from a single colony of E. cloacae WPL 214, 98 × 1010 CFU/ml of isolates was put into 20 ml of liquid medium and incubated in a shaker incubator for 16 h at 35°C in accordance with growth time and optimum temperature of E. cloacae WPL 214. Further on, culture was centrifuged at 6000 rpm at 4°C for 15 min. Pellet was discarded while supernatant containing cellulose enzyme activity was withdrawn to assay endo-(1,4-β-D-glucanase, exo-(1,4-β-D-glucanase, and β-glucosidase. Results: Cellulase enzyme of E. cloacae WPL 214 isolates had endoglucanase activity of 0.09 U/ml, exoglucanase of 0.13 U/ml, and cellobiase of 0.10 U/ml at optimum temperature 35°C and optimum pH 5. Conclusion: E. cloacae WPL 214 isolated from bovine rumen fluid waste produced cellulose enzyme with activity as cellulolytic enzyme of endo-(1,4-β-D-glucanase, exo-(1,4-β-D-glucanase and β-glucosidase.

  12. Evaluation of drought response of two poplar clones (Populus x canadensis Monch 'I-214' and P. deltoides Marsh. 'Dvina') through high resolution analysis of stem growth.

    Science.gov (United States)

    Giovannelli, Alessio; Deslauriers, Annie; Fragnelli, Giuseppe; Scaletti, Luciano; Castro, Gaetano; Rossi, Sergio; Crivellaro, Alan

    2007-01-01

    Different irrigation effects on stem radius variation (DeltaR) and maximum daily shrinkage (MDS) in Populus deltoides 'Dvina' and Populusxcanadensis 'I-214' were studied to assess differences in drought tolerance between clones. One-year-old trees growing in concrete tanks were submitted to two irrigation regimes (natural rainfall and irrigation) from 24 June to 10 August, and DeltaR was monitored by automatic point dendrometers. Independently of the irrigation regime, 'Dvina' showed a higher stem radial increment than 'I-214'. In both clones, the first response to changed soil water content was a significant increase in MDS, whilst DeltaR decreased about 20 d later when pre-dawn leaf water potential (Psipd) dropped below -0.4 MPa. However, they displayed different strategies to overcome drought. 'Dvina' maintained a positive DeltaR for longer than 'I-214', which had lower leaf Psipd and greater leaf abscission at the end of the drought period. After irrigation resumed, 'Dvina' showed a higher capacity to restore stem growth. 'I-214' was probably unable to recover secondary growth because of higher leaf abscission during drought stress and the production of newly expanded leaves during recovery. It is concluded that the larger radial growth of 'Dvina' derived from a better water use (carbon uptake versus water loss) than 'I-214' under limited water availability.

  13. Twelve-year experience of radioembolization for colorectal hepatic metastases in 214 patients: survival by era and chemotherapy.

    Science.gov (United States)

    Lewandowski, Robert J; Memon, Khairuddin; Mulcahy, Mary F; Hickey, Ryan; Marshall, Karen; Williams, Melissa; Salzig, Krystina; Gates, Vanessa L; Atassi, Bassel; Vouche, Michael; Atassi, Rohi; Desai, Kush; Hohlastos, Elias; Sato, Kent; Habib, Ali; Kircher, Sheetal; Newman, Steven B; Nimeiri, Halla; Benson, Al B; Salem, Riad

    2014-10-01

    The aim of this study was to analyze the safety, treatment characteristics and survival outcomes of Yttrium-90 (Y90) radioembolization for unresectable colorectal carcinoma (CRC) liver metastases refractory to standard of care therapy. A total of 214 patients with CRC metastases were treated with Y90 radioembolization over 12 years. Toxicity was assessed using National Cancer Institute common terminology criteria. Overall survival was analyzed from date of diagnosis of primary cancer, hepatic metastases and from the first Y90. Uni/multivariate analyses were performed. Substratification by era of chemotherapeutics was performed. Most patients were male (60 %) and 3 g/dL as independent predictors of survival. In this largest metastatic CRC series published to date, Y90 radioembolization was found to be safe; survival varied by prior therapy. Further studies are required to further refine the role of Y90 in metastatic CRC.

  14. Degradation of Triazine-2-(14C Metsulfuron-Methyl in Soil from an Oil Palm Plantation.

    Directory of Open Access Journals (Sweden)

    B S Ismail

    Full Text Available Triazine-2-(14C metsulfuron-methyl is a selective, systemic sulfonylurea herbicide. Degradation studies in soils are essential for the evaluation of the persistence of pesticides and their breakdown products. The purpose of the present study was to investigate the degradation of triazine-2-(14C metsulfuron-methyl in soil under laboratory conditions. A High Performance Liquid Chromatograph (HPLC equipped with an UV detector and an on-line radio-chemical detector, plus a Supelco Discovery column (250 x 4.6 mm, 5 μm, and PRP-1 column (305 x 7.0 mm, 10 μm was used for the HPLC analysis. The radioactivity was determined by a Liquid Scintillation Counter (LSC in scintillation fluid. The soil used was both sterilized and non-sterilized in order to observe the involvement of soil microbes. The estimated DT50 and DT90 values of metsulfuron-methyl in a non-sterile system were observed to be 13 and 44 days, whereas in sterilized soil, the DT50 and DT90 were 31 and 70 days, respectively. The principal degradation product after 60 days was CO2. The higher cumulative amount of (14CO2 in (14C-triazine in the non-sterilized soil compared to that in the sterile system suggests that biological degradation by soil micro-organisms significantly contributes to the dissipation of the compound. The major routes of degradation were O-demethylation, sulfonylurea bridge cleavage and the triazine "ring-opened."

  15. Degradation of Triazine-2-14C Metsulfuron–Methyl in Soil from an Oil Palm Plantation

    Science.gov (United States)

    B. S., Ismail

    2015-01-01

    Triazine-2-14C metsulfuron–methyl is a selective, systemic sulfonylurea herbicide. Degradation studies in soils are essential for the evaluation of the persistence of pesticides and their breakdown products. The purpose of the present study was to investigate the degradation of triazine-2-14C metsulfuron–methyl in soil under laboratory conditions. A High Performance Liquid Chromatograph (HPLC) equipped with an UV detector and an on-line radio-chemical detector, plus a Supelco Discovery column (250 x 4.6 mm, 5 μm), and PRP–1 column (305 x 7.0 mm, 10 μm) was used for the HPLC analysis. The radioactivity was determined by a Liquid Scintillation Counter (LSC) in scintillation fluid. The soil used was both sterilized and non-sterilized in order to observe the involvement of soil microbes. The estimated DT50 and DT90 values of metsulfuron-methyl in a non-sterile system were observed to be 13 and 44 days, whereas in sterilized soil, the DT50 and DT90 were 31 and 70 days, respectively. The principal degradation product after 60 days was CO2. The higher cumulative amount of 14CO2 in 14C- triazine in the non-sterilized soil compared to that in the sterile system suggests that biological degradation by soil micro-organisms significantly contributes to the dissipation of the compound. The major routes of degradation were O-demethylation, sulfonylurea bridge cleavage and the triazine “ring-opened.” PMID:26437264

  16. Degradation of Triazine-2-(14)C Metsulfuron-Methyl in Soil from an Oil Palm Plantation.

    Science.gov (United States)

    Ismail, B S; Eng, O K; Tayeb, M A

    2015-01-01

    Triazine-2-(14)C metsulfuron-methyl is a selective, systemic sulfonylurea herbicide. Degradation studies in soils are essential for the evaluation of the persistence of pesticides and their breakdown products. The purpose of the present study was to investigate the degradation of triazine-2-(14)C metsulfuron-methyl in soil under laboratory conditions. A High Performance Liquid Chromatograph (HPLC) equipped with an UV detector and an on-line radio-chemical detector, plus a Supelco Discovery column (250 x 4.6 mm, 5 μm), and PRP-1 column (305 x 7.0 mm, 10 μm) was used for the HPLC analysis. The radioactivity was determined by a Liquid Scintillation Counter (LSC) in scintillation fluid. The soil used was both sterilized and non-sterilized in order to observe the involvement of soil microbes. The estimated DT50 and DT90 values of metsulfuron-methyl in a non-sterile system were observed to be 13 and 44 days, whereas in sterilized soil, the DT50 and DT90 were 31 and 70 days, respectively. The principal degradation product after 60 days was CO2. The higher cumulative amount of (14)CO2 in (14)C-triazine in the non-sterilized soil compared to that in the sterile system suggests that biological degradation by soil micro-organisms significantly contributes to the dissipation of the compound. The major routes of degradation were O-demethylation, sulfonylurea bridge cleavage and the triazine "ring-opened."

  17. High expression of miR-214 is associated with a worse disease-specific survival of the triple-negative breast cancer patients.

    Science.gov (United States)

    Kalniete, Dagnija; Nakazawa-Miklaševiča, Miki; Štrumfa, Ilze; Āboliņš, Arnis; Irmejs, Arvīds; Gardovskis, Jānis; Miklaševičs, Edvīns

    2015-01-01

    Hereditary triple-negative breast cancer patients have better recurrence-free survival than triple-negative sporadic ones. High expression of some of the miRNAs is related to worse overall and disease-free survival of triple-negative breast cancer patients. The attempt to associate expression level of some miRNA in triple-negative hereditary and sporadic breast cancers to disease specific survival was performed in this study. Study group was made of 18 triple-negative breast cancer patients harboring the BRCA1 gene mutations and 32 triple-negative sporadic breast cancer patients. Quantitative amount of mir-10b, mir-21, mir-29a, mir-31, and mir-214 by real-time PCR was assessed. The disease-specific survival in relation of high and low levels of some of the miRNAs was analyzed using Log-rank (Mantel-Cox) test. MiR-214 showed significantly higher expression level in sporadic tissues than in hereditary ones (p = 0.0005). Triple-negative breast cancer patients with high level of miR-214 showed significantly worse disease-specific survival than patients with low level (p = 0.0314). Our finding suggests that miR-214 possibly could be used as a potential prognostic biomarker for triple-negative breast cancer patients.

  18. 49 CFR 214.353 - Training and qualification of roadway workers who provide on-track safety for roadway work groups.

    Science.gov (United States)

    2010-10-01

    ... territory of the railroad upon which the roadway worker is qualified. (b) Initial and periodic qualification... 49 Transportation 4 2010-10-01 2010-10-01 false Training and qualification of roadway workers who... RAILROAD WORKPLACE SAFETY Roadway Worker Protection § 214.353 Training and qualification of roadway workers...

  19. Planck intermediate results. VI. The dynamical structure of PLCKG214.6+37.0, a Planck discovered triple system of galaxy clusters

    NARCIS (Netherlands)

    Planck Collaboration, [Unknown; Ade, P. A. R.; Aghanim, N.; Arnaud, M.; Ashdown, M.; Atrio-Barandela, F.; Aumont, J.; Baccigalupi, C.; Balbi, A.; Banday, A. J.; Barreiro, R. B.; Bartlett, J. G.; Battaner, E.; Benabed, K.; Benoît, A.; Bernard, J.-P.; Bersanelli, M.; Bhatia, R.; Bikmaev, I.; Böhringer, H.; Bonaldi, A.; Bond, J. R.; Borrill, J.; Bouchet, F. R.; Bourdin, H.; Burenin, R.; Burigana, C.; Cabella, P.; Cardoso, J.-F.; Castex, G.; Catalano, A.; Cayón, L.; Chamballu, A.; Chiang, L.-Y.; Chon, G.; Christensen, P. R.; Clements, D. L.; Colafrancesco, S.; Colombi, S.; Colombo, L. P. L.; Comis, B.; Coulais, A.; Crill, B. P.; Cuttaia, F.; Da Silva, A.; Dahle, H.; Danese, L.; Davis, R. J.; de Bernardis, P.; de Gasperis, G.; de Zotti, G.; Delabrouille, J.; Démoclès, J.; Diego, J. M.; Dolag, K.; Dole, H.; Donzelli, S.; Doré, O.; Dörl, U.; Douspis, M.; Dupac, X.; Efstathiou, G.; Enßlin, T. A.; Eriksen, H. K.; Finelli, F.; Flores-Cacho, I.; Forni, O.; Frailis, M.; Franceschi, E.; Frommert, M.; Galeotta, S.; Ganga, K.; Génova-Santos, R. T.; Giard, M.; Gilfanov, M.; Giraud-Héraud, Y.; González-Nuevo, J.; Górski, K. M.; Gregorio, A.; Gruppuso, A.; Hansen, F. K.; Harrison, D.; Heinämäki, P.; Hempel, A.; Henrot-Versillé, S.; Hernández-Monteagudo, C.; Herranz, D.; Hildebrandt, S. R.; Hivon, E.; Hobson, M.; Holmes, W. A.; Hurier, G.; Jaffe, T. R.; Jaffe, A. H.; Jagemann, T.; Jones, W. C.; Juvela, M.; Keihänen, E.; Khamitov, I.; Kisner, T. S.; Kneissl, R.; Knoche, J.; Knox, L.; Kunz, M.; Kurki-Suonio, H.; Lagache, G.; Lähteenmäki, A.; Lamarre, J.-M.; Lasenby, A.; Lawrence, C. R.; Le Jeune, M.; Leonardi, R.; Lilje, P. B.; López-Caniego, M.; Luzzi, G.; Macías-Pérez, J. F.; Maino, D.; Mandolesi, N.; Maris, M.; Marleau, F.; Marshall, D. J.; Martínez-González, E.; Masi, S.; Massardi, M.; Matarrese, S.; Mazzotta, P.; Mei, S.; Melchiorri, A.; Melin, J.-B.; Mendes, L.; Mennella, A.; Mitra, S.; Miville-Deschênes, M.-A.; Moneti, A.; Montier, L.; Morgante, G.; Mortlock, D.; Munshi, D.; Murphy, J. A.; Naselsky, P.; Nati, F.; Natoli, P.; Nørgaard-Nielsen, H. U.; Noviello, F.; Novikov, D.; Novikov, I.; Osborne, S.; Pajot, F.; Paoletti, D.; Pasian, F.; Patanchon, G.; Perdereau, O.; Perotto, L.; Perrotta, F.; Piacentini, F.; Piat, M.; Pierpaoli, E.; Piffaretti, R.; Plaszczynski, S.; Pointecouteau, E.; Polenta, G.; Ponthieu, N.; Popa, L.; Poutanen, T.; Pratt, G. W.; Prunet, S.; Puget, J.-L.; Rachen, J. P.; Rebolo, R.; Reinecke, M.; Remazeilles, M.; Renault, C.; Ricciardi, S.; Riller, T.; Ristorcelli, I.; Rocha, G.; Roman, M.; Rosset, C.; Rossetti, M.; Rubiño-Martín, J. A.; Rusholme, B.; Sandri, M.; Savini, G.; Scott, D.; Smoot, G. F.; Starck, J.-L.; Sudiwala, R.; Sunyaev, R.; Sutton, D.; Suur-Uski, A.-S.; Sygnet, J.-F.; Tauber, J. A.; Terenzi, L.; Toffolatti, L.; Tomasi, M.; Tristram, M.; Tuovinen, J.; Valenziano, L.; Van Tent, B.; Vielva, P.; Villa, F.; Vittorio, N.; Wade, L. A.; Wandelt, B. D.; Welikala, N.; Yvon, D.; Zacchei, A.; Zaroubi, S.; Zonca, A.

    The survey of galaxy clusters performed by Planck through the Sunyaev-Zeldovich effect has already discovered many interesting objects, thanks to its full sky coverage. One of the SZ candidates detected inthe early months of the mission near to the signal-to-noise threshold, PLCKG214.6+37.0, was

  20. Planck intermediate results : VI. The dynamical structure of PLCKG214.6+37.0, a Planck discovered triple system of galaxy clusters

    NARCIS (Netherlands)

    Ade, P. A. R.; Aghanim, N.; Arnaud, M.; Ashdown, M.; Atrio-Barandela, F.; Aumont, J.; Baccigalupi, C.; Balbi, A.; Banday, A. J.; Barreiro, R. B.; Bartlett, J. G.; Battaner, E.; Benabed, K.; Benoit, A.; Bernard, J. -P.; Bersanelli, M.; Bhatia, R.; Bikmaev, I.; Boehringer, H.; Bonaldi, A.; Bond, J. R.; Borrill, J.; Bouchet, F. R.; Bourdin, H.; Burenin, R.; Burigana, C.; Cabella, P.; Cardoso, J.-F.; Castex, G.; Catalano, A.; Cayon, L.; Chamballu, A.; Chiang, L. -Y; Chon, G.; Christensen, P. R.; Clements, D. L.; Colafrancesco, S.; Colombi, S.; Colombo, L. P. L.; Comis, B.; Coulais, A.; Crill, B. P.; Cuttaia, F.; Da Silva, A.; Dahle, H.; Danese, L.; Davis, R. J.; de Bernardis, P.; de Gasperis, G.; de Zotti, G.; Delabrouille, J.; Democles, J.; Diego, J. M.; Dolag, K.; Dole, H.; Donzelli, S.; Dore, O.; Doerl, U.; Douspis, M.; Dupac, X.; Efstathiou, G.; Ensslin, T. A.; Eriksen, H. K.; Finelli, F.; Flores-Cacho, I.; Forni, O.; Frailis, M.; Franceschi, E.; Frommert, M.; Galeotta, S.; Ganga, K.; Genova-Santos, R. T.; Giard, M.; Gilfanov, M.; Giraud-Heraud, Y.; Gonzalez-Nuevo, J.; Gorski, K. M.; Gregorio, A.; Gruppuso, A.; Hansen, F. K.; Harrison, D.; Heinamaki, P.; Hempel, A.; Henrot-Versille, S.; Hernandez-Monteagudo, C.; Herranz, D.; Hildebrandt, S. R.; Hivon, E.; Hobson, M.; Holmes, W. A.; Hurier, G.; Jaffe, T. R.; Jaffe, A. H.; Jagemann, T.; Jones, W. C.; Juvela, M.; Keihaenen, E.; Khamitov, I.; Kisner, T. S.; Kneissl, R.; Knoche, J.; Knox, L.; Kunz, M.; Kurki-Suonio, H.; Lagache, G.; Lahteenmaki, A.; Lamarre, J. -M.; Lasenby, A.; Lawrence, C. R.; Le Jeune, M.; Leonardi, R.; Lilje, P. B.; Lopez-Caniego, M.; Luzzi, G.; Macias-Perez, J. F.; Maino, D.; Mandolesi, N.; Maris, M.; Marleau, F.; Marshall, D. J.; Martinez-Gonzalez, E.; Masi, S.; Massardi, M.; Matarrese, S.; Mazzotta, P.; Mei, S.; Melchiorri, A.; Melin, J. -B.; Mendes, L.; Mennella, A.; Mitra, S.; Miville-Deschenes, M. -A.; Moneti, A.; Montier, L.; Morgante, G.; Mortlock, D.; Munshi, D.; Murphy, J. A.; Naselsky, P.; Nati, F.; Natoli, P.; Norgaard-Nielsen, H. U.; Noviello, F.; Novikov, D.; Novikov, I.; Osborne, S.; Pajot, F.; Paoletti, D.; Pasian, F.; Patanchon, G.; Perdereau, O.; Perotto, L.; Perrotta, F.; Piacentini, F.; Piat, M.; Pierpaoli, E.; Piffaretti, R.; Plaszczynski, S.; Pointecouteau, E.; Polenta, G.; Ponthieu, N.; Popa, L.; Poutanen, T.; Pratt, G. W.; Prunet, S.; Puget, J. -L.; Rachen, J. P.; Rebolo, R.; Reinecke, M.; Remazeilles, M.; Renault, C.; Ricciardi, S.; Riller, T.; Ristorcelli, I.; Rocha, G.; Roman, M.; Rosset, C.; Rossetti, M.; Rubino-Martin, J. A.; Rusholme, B.; Sandri, M.; Savini, G.; Scott, D.; Smoot, G. F.; Starck, J. -L.; Sudiwala, R.; Sunyaev, R.; Sutton, D.; Suur-Uski, A. -S.; Sygnet, J. -F.; Tauber, J. A.; Terenzi, L.; Toffolatti, L.; Tomasi, M.; Tristram, M.; Tuovinen, J.; Valenziano, L.; Van Tent, B.; Vielva, P.; Villa, F.; Vittorio, N.; Wade, L. A.; Wandelt, B. D.; Welikala, N.; Yvon, D.; Zacchei, A.; Zaroubi, S.; Zonca, A.

    The survey of galaxy clusters performed by Planck through the Sunyaev-Zeldovich effect has already discovered many interesting objects, thanks to its full sky coverage. One of the SZ candidates detected in the early months of the mission near to the signal-to-noise threshold, PLCKG214.6+37.0, was

  1. Absolute quantification of regional cerebral glucose utilization in mice by 18F-FDG small animal PET scanning and 2-14C-DG autoradiography.

    Science.gov (United States)

    Toyama, Hiroshi; Ichise, Masanori; Liow, Jeih-San; Modell, Kendra J; Vines, Douglass C; Esaki, Takanori; Cook, Michelle; Seidel, Jurgen; Sokoloff, Louis; Green, Michael V; Innis, Robert B

    2004-08-01

    The purpose of this study was to evaluate the feasibility of absolute quantification of regional cerebral glucose utilization (rCMR(glc)) in mice by use of (18)F-FDG and a small animal PET scanner. rCMR(glc) determined with (18)F-FDG PET was compared with values determined simultaneously by the autoradiographic 2-(14)C-DG method. In addition, we compared the rCMR(glc) values under isoflurane, ketamine and xylazine anesthesia, and awake states. Immediately after injection of (18)F-FDG and 2-(14)C-DG into mice, timed arterial samples were drawn over 45 min to determine the time courses of (18)F-FDG and 2-(14)C-DG. Animals were euthanized at 45 min and their brain was imaged with the PET scanner. The brains were then processed for 2-(14)C-DG autoradiography. Regions of interest were manually placed over cortical regions on corresponding coronal (18)F-FDG PET and 2-(14)C-DG autoradiographic images. rCMR(glc) values were calculated for both tracers by the autoradiographic 2-(14)C-DG method with modifications for the different rate and lumped constants for the 2 tracers. Average rCMR(glc) values in cerebral cortex with (18)F-FDG PET under normoglycemic conditions (isoflurane and awake) were generally lower (by 8.3%) but strongly correlated with those of 2-(14)C-DG (r(2) = 0.95). On the other hand, under hyperglycemic conditions (ketamine/xylazine) average cortical rCMR(glc) values with (18)F-FDG PET were higher (by 17.3%) than those with 2-(14)C-DG. Values for rCMR(glc) and uptake (percentage injected dose per gram [%ID/g]) with (18)F-FDG PET were significantly lower under both isoflurane and ketamine/xylazine anesthesia than in the awake mice. However, the reductions of rCMR(glc) were markedly greater under isoflurane (by 57%) than under ketamine and xylazine (by 19%), whereas more marked reductions of %ID/g were observed with ketamine/xylazine (by 54%) than with isoflurane (by 37%). These reverse differences between isoflurane and ketamine/xylazine may be due to

  2. [Essential thrombocythemia: baseline characteristics and risk factors for survival and thrombosis in a series of 214 patients].

    Science.gov (United States)

    Angona, Anna; Alvarez-Larrán, Alberto; Bellosillo, Beatriz; Martínez-Avilés, Luz; Garcia-Pallarols, Francesc; Longarón, Raquel; Ancochea, Àgueda; Besses, Carles

    2015-03-15

    Two prognostic models to predict overall survival and thrombosis-free survival have been proposed: International Prognostic Score for Essential Thrombocythemia (IPSET) and IPSET-Thrombosis, respectively, based on age, leukocytes count, history of previous thrombosis, the presence of cardiovascular risk factors and the JAK2 mutational status. The aim of the present study was to assess the clinical and biological characteristics at diagnosis and during evolution in essential thrombocythemia (ET) patients as well as the factors associated with survival and thrombosis and the usefulness of these new prognostic models. We have evaluated the clinical data and the mutation status of JAK2, MPL and calreticulin of 214 ET patients diagnosed in a single center between 1985 and 2012, classified according to classical risk stratification, IPSET and IPSET-Thrombosis. With a median follow-up of 6.9 years, overall survival was not associated with any variable by multivariate analysis. Thrombotic history and leukocytes>10×10(9)/l were associated with thrombosis-free survival (TFS). In our series, IPSET prognostic systems of survival and thrombosis did not provide more clinically relevant information regarding the classic risk of thrombosis stratification. Thrombotic history and leukocytosis>10×10(9)/l were significantly associated with lower TFS, while the prognostic IPSET-Thrombosis system did not provide more information than classical thrombotic risk assessment. Copyright © 2014 Elsevier España, S.L.U. All rights reserved.

  3. Generation of optical OFDM signals using 21.4 GS/s real time digital signal processing.

    Science.gov (United States)

    Benlachtar, Yannis; Watts, Philip M; Bouziane, Rachid; Milder, Peter; Rangaraj, Deepak; Cartolano, Anthony; Koutsoyannis, Robert; Hoe, James C; Püschel, Markus; Glick, Madeleine; Killey, Robert I

    2009-09-28

    We demonstrate a field programmable gate array (FPGA) based optical orthogonal frequency division multiplexing (OFDM) transmitter implementing real time digital signal processing at a sample rate of 21.4 GS/s. The QPSK-OFDM signal is generated using an 8 bit, 128 point inverse fast Fourier transform (IFFT) core, performing one transform per clock cycle at a clock speed of 167.2 MHz and can be deployed with either a direct-detection or a coherent receiver. The hardware design and the main digital signal processing functions are described, and we show that the main performance limitation is due to the low (4-bit) resolution of the digital-to-analog converter (DAC) and the 8-bit resolution of the IFFT core used. We analyze the back-to-back performance of the transmitter generating an 8.36 Gb/s optical single sideband (SSB) OFDM signal using digital up-conversion, suitable for direct-detection. Additionally, we use the device to transmit 8.36 Gb/s SSB OFDM signals over 200 km of uncompensated standard single mode fiber achieving an overall BER<10(-3).

  4. Novel ZEB2-BCL11B Fusion Gene Identified by RNA-Sequencing in Acute Myeloid Leukemia with t(2;14(q22;q32.

    Directory of Open Access Journals (Sweden)

    Synne Torkildsen

    Full Text Available RNA-sequencing of a case of acute myeloid leukemia with the bone marrow karyotype 46,XY,t(2;14(q22;q32[5]/47,XY,idem,+?4,del(6(q13q21[cp6]/46,XY[4] showed that the t(2;14 generated a ZEB2-BCL11B chimera in which exon 2 of ZEB2 (nucleotide 595 in the sequence with accession number NM_014795.3 was fused to exon 2 of BCL11B (nucleotide 554 in the sequence with accession number NM_022898.2. RT-PCR together with Sanger sequencing verified the presence of the above-mentioned fusion transcript. All functional domains of BCL11B are retained in the chimeric protein. Abnormal expression of BCL11B coding regions subjected to control by the ZEB2 promoter seems to be the leukemogenic mechanism behind the translocation.

  5. In vitro activity of solithromycin and its metabolites, CEM-214 and N-acetyl-CEM-101, against 100 clinical Ureaplasma spp. isolates compared with azithromycin.

    Science.gov (United States)

    Furfaro, Lucy L; Spiller, O Brad; Keelan, Jeffrey A; Payne, Matthew S

    2015-09-01

    There is a strong association between vaginal and/or amniotic fluid Ureaplasma spp. colonisation and risk of preterm birth. The novel fluoroketolide antibiotic solithromycin (CEM-101) is active against Ureaplasma spp. in vitro. Evidence from ex vivo and in vivo models suggests that, unlike most macrolide antibiotics, solithromycin readily crosses the placenta. Solithromycin metabolism varies according to species; in pregnant sheep, the bioactive metabolites CEM-214 and N-acetyl-CEM-101 (NAc-CEM-101) have been shown to accumulate in the amniotic cavity following maternal solithromycin administration, potentially contributing to its antimicrobial effects. To determine the antimicrobial activity of these metabolites against Ureaplasma spp., the effects of solithromycin, CEM-214, NAc-CEM-101 and the comparator azithromycin were tested on a collection of 100 clinical Ureaplasma spp. isolates from the UK and Australia using a modified 96-well broth microdilution method. MIC90 values observed for the combined cohort were: solithromycin, 0.125 mg/L; CEM-214, 0.5mg/L; NAc-CEM-101, 0.5mg/L; and azithromycin, 2mg/L. Solithromycin showed 34-fold greater activity against Ureaplasma spp. isolates than azithromycin, whilst CEM-214 and NAc-CEM-101 possessed ca. 22% and 17% of the activity of solithromycin, respectively, significantly greater than that of azithromycin. One bacterial isolate showed resistance to azithromycin (MIC=16 mg/L) but had a much lower MIC for solithromycin (MIC=0.25mg/L). In conclusion, the metabolites of solithromycin had reduced, but still potent, activity against 100 clinical Ureaplasma spp. isolates in vitro. This may be important in some instances such as pregnancy, however studies to determine levels of the metabolites in these settings are required. Copyright © 2015 Elsevier B.V. and the International Society of Chemotherapy. All rights reserved.

  6. A homozygous nonsense mutation (c.214C->A) in the biliverdin reductase alpha gene (BLVRA) results in accumulation of biliverdin during episodes of cholestasis.

    Science.gov (United States)

    Nytofte, Nikolaj S; Serrano, Maria A; Monte, Maria J; Gonzalez-Sanchez, Ester; Tumer, Zeynep; Ladefoged, Karin; Briz, Oscar; Marin, Jose J G

    2011-04-01

    Green jaundice is a rare finding usually associated with end-stage liver disease. OBJECTIVE The authors investigated two unrelated Inuit women from different geographical areas in Greenland who had episodes of green jaundice associated with biliary obstruction. The crises were accompanied by increased biochemical markers of cholestasis, together with absent or moderate hyperbilirubinaemia. In contrast, high-performance liquid chromatography tandem mass spectrometry showed hypercholanaemia and high concentrations of biliverdin IXα in serum, urine, bile and milk. Hyperbiliverdinaemia disappeared after surgical correction of the cholestasis. Analysis of the coding sequence of the biliverdin reductase alpha (BVRα) gene (BLVRA) detected three single-nucleotide polymorphisms: c.90G→A, c.214C→A and c.743A→C, which result in p.Ala3Thr, p.Ser44X and p.Gly220Gly, respectively. With the use of TaqMan probes, homozygosity for c.214C→A was found in both patients. Both parents of one of these patients were heterozygous for the inactivating mutation. Her brother was homozygous for normal alleles. Although her sister was also homozygous for the c.214C→A mutation, she had never had hyperbiliverdinaemia or cholestasis. With the use of human liver RNA, the BVRα coding sequence was cloned, and the variant containing c.214C→A was generated by site-directed mutagenesis. Both proteins were expressed in human hepatoma liver cells and Xenopus laevis oocytes. Immunoblotting, immunofluorescence and functional assays of BVRα activity revealed that the mutated sequence generates a truncated protein with no catalytic activity. This is the first report of a homozygous BLVRA inactivating mutation indicating that the complete absence of BVRα activity is a non-lethal condition, the most evident phenotypic characteristic of which is the appearance of green jaundice accompanying cholestasis episodes.

  7. Ten-year experiences with Tracheostomy at a University teaching hospital in Northwestern Tanzania: A retrospective review of 214 cases

    Directory of Open Access Journals (Sweden)

    Gilyoma Japhet M

    2011-11-01

    Full Text Available Abstract Background Tracheostomy remains a very important life saving surgical procedure worldwide and particularly in our environment where patients present late in upper airway obstruction. Little work has been done on this subject in our environment and therefore it was necessary to conduct this study to describe our own experiences with tracheostomy, outlining the common indications and outcome of tracheostomized patients in our setting and compare our results with those from other centers in the world. Methods This was a 10-year retrospective study which was conducted at Bugando Medical Centre from January 2001 to December 2010. Data were retrieved from patients' files kept in the Medical record department and analyzed using SPSS computer software version 15.0. Ethical approval to conduct the study was obtained from relevant authority before the commencement of the study. Results A total of 214 patients were studied. The male to female ratio was 3.1: 1. The majority of patients were in the 3rd decade of life. The most common indication for tracheostomy was upper airway obstruction secondary to traumatic causes in 55.1% of patients, followed by upper airway obstruction due to neoplastic causes in 39.3% of cases. The majority of tracheostomies (80.4% were performed as an emergency. Transverse skin crease incision was employed in all the cases. Post-tracheostomy complication rate was 21.5%. Complication rate was significantly higher in emergency tracheostomy than in electives (P Conclusion Upper airway obstruction secondary to trauma and laryngeal tumors still remains the most common indication for tracheostomy in our centre and tracheostomy is still a life saving procedure in the surgical management of airway despite complications which are seen more commonly in paediatric patients. Most of tracheostomy related complications can be avoided by meticulous attention to the details of the technique and postoperative tracheostomy care by skilled

  8. Twelve-year experience of radioembolization for colorectal hepatic metastases in 214 patients: survival by era and chemotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Lewandowski, Robert J.; Memon, Khairuddin; Hickey, Ryan; Gates, Vanessa L.; Atassi, Bassel; Vouche, Michael; Atassi, Rohi; Desai, Kush; Hohlastos, Elias; Sato, Kent; Habib, Ali [Robert H. Lurie Comprehensive Cancer Center, Department of Radiology, Section of Interventional Radiology, Northwestern Memorial Hospital, Chicago, IL (United States); Mulcahy, Mary F.; Kircher, Sheetal; Newman, Steven B.; Nimeiri, Halla; Benson, Al B. [Northwestern University, Department of Medicine, Division of Hematology and Oncology, Robert H. Lurie Comprehensive Cancer Center, Chicago, IL (United States); Marshall, Karen; Williams, Melissa; Salzig, Krystina; Salem, Riad [Robert H. Lurie Comprehensive Cancer Center, Department of Radiology, Section of Interventional Radiology, Northwestern Memorial Hospital, Chicago, IL (United States); Northwestern University, Department of Medicine, Division of Hematology and Oncology, Robert H. Lurie Comprehensive Cancer Center, Chicago, IL (United States)

    2014-10-15

    The aim of this study was to analyze the safety, treatment characteristics and survival outcomes of Yttrium-90 (Y90) radioembolization for unresectable colorectal carcinoma (CRC) liver metastases refractory to standard of care therapy. A total of 214 patients with CRC metastases were treated with Y90 radioembolization over 12 years. Toxicity was assessed using National Cancer Institute common terminology criteria. Overall survival was analyzed from date of diagnosis of primary cancer, hepatic metastases and from the first Y90. Uni/multivariate analyses were performed. Substratification by era of chemotherapeutics was performed. Most patients were male (60 %) and <65 years old (61 %). Of them, 98 % had been exposed to chemotherapy. Grade 3 lymphocyte, bilirubin, albumin, ALP and AST toxicities were observed in 39 %, 11 %, 10 %, 8 % and 4 % of patients, respectively. Grade 4 lymphocyte and ALP toxicities were observed in 5 % and 3 % of patients, respectively. Median overall survival was 43.0, 34.6, and 10.6 months from date of diagnosis of primary cancer, hepatic metastases and first Y90, respectively. Survival was significantly longer in patients: (1) who received ≤2 cytotoxic drugs (n = 104) than those who received 3 (n = 110) (15.2 vs. 7.5 months, p = 0.0001); and (2) who received no biologic agents (n = 52) compared with those that did (n = 162) (18.6 vs. 9.4 months, p = 0.0001). Multivariate analyses identified ≤2 cytotoxic agents, no exposure to biologics, ECOG 0, tumor burden <25 %, lack of extrahepatic disease and albumin >3 g/dL as independent predictors of survival. In this largest metastatic CRC series published to date, Y90 radioembolization was found to be safe; survival varied by prior therapy. Further studies are required to further refine the role of Y90 in metastatic CRC. (orig.)

  9. One-phonon octupole vibrational states in {sup 211}At, {sup 212}Rn, {sup 213}Fr and {sup 214}Ra with N = 126

    Energy Technology Data Exchange (ETDEWEB)

    Hwang, J.K.; Hamilton, J.H.; Ramayya, A.V. [Vanderbilt University, Physics Department, Nashville, TN (United States)

    2013-12-15

    Excited high spin states in {sup 211}At, {sup 212}Rn, {sup 213}Fr and {sup 214}Ra with N = 126 are reorganized and interpreted in terms of the stretched weak coupling of an octupole 3{sup -} phonon. Nearly identical sequences of levels with {Delta}I = 3 and the parity change are found, for the first time, up to 25{sup -} for 20 states of {sup 214}Ra, up to 35{sup -} for 36 states of {sup 212}Rn and up to 53/2{sup +} for 16 states of {sup 213}Fr. The stretched weak coupling of an octupole phonon is extended up to the highest excitation energy of 11355 keV for {sup 212}Rn which has the largest experimental B(E3) value of 44.1(88) W.u. for the 11{sup -} {yields} 8{sub 2}{sup +} transition. The stretched weak coupling of an octupole 3{sup -} phonon needs to be considered when single particle configurations are assigned to high spin states. Average octupole excitation energies of 657(51) keV for {sup 211}At, 1101(28) keV for {sup 212}Rn, 667(25) keV for {sup 213}Fr, and 709(25) keV for {sup 214}Ra are obtained. The calculated level energies are in a good agreement with the experimental level energies within the error limit of 4.3%. (orig.)

  10. Elements of structure and productivity of clone I-214 (Populus×euramericana (Dode Guinier plantations on the river Sava alluvium

    Directory of Open Access Journals (Sweden)

    Andrašev Siniša

    2010-01-01

    Full Text Available Two experimental plantations of Euramerican poplar (Populus×euramericana (Dode Guinier - clone I-214 were researched on the river Sava alluvium in Srem. Three sample plots were established in each of the plantations, aged 31 years. The soil type was humofluvisol (alluvial semigley, planting space 6×6 m. The plantations were established with 278 rooted cuttings per hectare, and the number of trees at the age of 31 accounted for 46.5-60.6%. The constructed height curves, mean stand height (hg and upper (hg20% heights show that the study plantations were established on different site classes, which was significantly reflected on other plantation growth elements and productivity. However, there was no significant effect of site class on the variability (sd and cv and shape of diameter structure (α3 and α4. The constructed models of diameter structure for each site class (by Weibull function differ by location parameter (a, and do not differ by parameter of scale (b and shape (c. The tree and plantation growth elements show a high production potential of the clone I-214 which indicates that, on optimal soils and with the provided technological measures in the stage of nursery production and in the stage of plantation establishment, clone I-214 presents the good base for high production effects.

  11. The rate commitment to ISO 214 standard among the persian abstracts of approved research projects at school of health management and medical informatics, Isfahan University of Medical Sciences, Isfahan, Iran

    National Research Council Canada - National Science Library

    Ahmad Papi; Davoud Khalaji; Hasan Rizi; Ahmad Shabani; Akbar Hassanzadeh

    2014-01-01

    .... The present research aimed to evaluate the rate of Commitment to ISO 214 Standard among the Persian abstracts of approved research projects at School of Health Management and Medical Informatics...

  12. A Functional Variant at the miR-214 Binding Site in the Methylenetetrahydrofolatereductase Gene Alters Susceptibility to Gastric Cancer in a Chinese Han Population

    Directory of Open Access Journals (Sweden)

    Qiaoyun Chen

    2015-05-01

    Full Text Available Background and Aims: Single nucleotide polymorphisms in miRNA binding sites, which are located in mRNA 3' untranslated regions (3'-UTRs, were recently found to influence microRNA-target interactions. Specifically, such polymorphisms can modulatebinding affinity or create or destroy miRNA-binding sites; such variants have also been found to be associated with cancer risk. In this study, we explored the effect of a functional variant at the miR-214 binding site in the methylenetetrahydrofolate reductase gene (rs114673809 on gastric cancer (GC risk in a hospital-based case-control study in a Chinese Han population. Methods and Results: We genotyped the rs114673809 polymorphism in 345 gastric cancer patients and 376 cancer-free controls using the polymerase chain reaction restriction fragment length polymorphism (PCR-RFLP technique. The functions of rs114673809 were investigated using a luciferase activity assay and validated by immunoblotting. We found that participants carrying the rs114673809 AA genotype or A allele had a significantly increased risk of gastric cancer (OR = 1.667, 95% CI = 1.044-2.660, P = 0.034; OR = 1.261, 95% CI = 1.017-1.563, P = 0.037, respectively compared to those carrying the GG genotype and G allele. In addition, rs114673809 modified the binding of hsa-miR-214 to MTHFR as well as MTHFR protein levels in gastric cancer patients. Conclusion: Our data suggested that rs114673809, which is located at the miR-214 binding site in the 3'-UTR of MTHFR, may play an important role in the development of gastric cancer in a Chinese Han population.

  13. Inhibition of microRNA-214-5p promotes cell survival and extracellular matrix formation by targeting collagen type IV alpha 1 in osteoblastic MC3T3-E1 cells

    Science.gov (United States)

    Li, Q. S.; Meng, F. Y.; Zhao, Y. H.; Jin, C. L.; Tian, J.

    2017-01-01

    Objectives This study aimed to investigate the functional effects of microRNA (miR)-214-5p on osteoblastic cells, which might provide a potential role of miR-214-5p in bone fracture healing. Methods Blood samples were obtained from patients with hand fracture or intra-articular calcaneal fracture and from healthy controls (HCs). Expression of miR-214-5p was monitored by qRT-PCR at day 7, 14 and 21 post-surgery. Mouse osteoblastic MC3T3-E1 cells were transfected with antisense oligonucleotides (ASO)-miR-214-5p, collagen type IV alpha 1 (COL4A1) vector or their controls; thereafter, cell viability, apoptotic rate, and the expression of collagen type I alpha 1 (COL1A1), type II collagen (COL-II), and type X collagen (COL-X) were determined. Luciferase reporter assay, qRT-PCR, and Western blot were performed to ascertain whether COL4A1 was a target of miR-214-5p. Results Plasma miR-214-5p was highly expressed in patients with bone fracture compared with HCs after fracture (p COL4A1 was a target of miR-214-5p, and was negatively regulated by miR-214-5p (p COL4A1 showed a similar impact on cell viability, apoptotic rate, and COL1A1, COL-II, and COL-X expressions inhibiting miR-214-5p (p COL4A1. Cite this article: Q. S. Li, F. Y. Meng, Y. H. Zhao, C. L. Jin, J. Tian, X. J. Yi. Inhibition of microRNA-214-5p promotes cell survival and extracellular matrix formation by targeting collagen type IV alpha 1 in osteoblastic MC3T3-E1 cells. Bone Joint Res 2017;6:464–471. DOI: 10.1302/2046-3758.68.BJR-2016-0208.R2 PMID:28784704

  14. SOLVENT HOLD TANK SAMPLE RESULTS FOR MCU-14-135/136 AND MCU-14-214/215/216: FEBRUARY AND MARCH 2014 MONTHLY SAMPLES

    Energy Technology Data Exchange (ETDEWEB)

    Fondeur, F.; Taylor-Pashow, K.

    2014-06-30

    SRNL received two sets of SHT samples (MCU-14-135-136 in February 2014 and MCU-14-214-216 in March 2014) for analysis. The samples were analyzed for composition. As with the previous solvent sample results, these analyses indicate that the solvent does not require Isopar® L trimming at this time. However, the addition of TiDG (suppressor) to the blended solvent is recommended. Evidence of possible (slight) isomerization of the solvent, probably Isopar®L or TiDG degradation products, was observed.

  15. Multigenerational effects of whole body exposure to 2.14 GHz W-CDMA cellular phone signals on brain function in rats.

    Science.gov (United States)

    Shirai, Tomoyuki; Imai, Norio; Wang, Jianqing; Takahashi, Satoru; Kawabe, Mayumi; Wake, Kanako; Kawai, Hiroki; Watanabe, So-Ichi; Furukawa, Fumio; Fujiwara, Osamu

    2014-10-01

    The present experimental study was carried out with rats to evaluate the effects of whole body exposure to 2.14 GHz band code division multiple access (W-CDMA) signals for 20 h a day, over three generations. The average specific absorption rate (SAR, in unit of W/kg) for dams was designed at three levels: high (CDMA signals for 20 h/day did not cause any adverse effects on the F1 , F2 , and F3 offspring. © 2014 Wiley Periodicals, Inc.

  16. Uso de reguladores no controle do crescimento e no desempenho agronômico da cultura da soja cultivar CD 214 RR

    OpenAIRE

    Buzzello, Gederson Luiz

    2012-01-01

    O acamamento de plantas provoca perdas significativas no rendimento de grãos da cultura da soja e por isso estratégias de manejo para minimizar o acamamento são importante necessidade na agricultura atual. O objetivo desse trabalho foi estudar ação de reguladores de crescimento vegetal sobre o acamamento e outras características agronômicas da cultivar de soja CD 214 RR, em épocas de semeadura e densidades distintas. Foram conduzidos dois experimentos na Estação Experimental da Unive...

  17. Isotope Shifts of the $6d\\,^2$D$_{3/2}\\,$ - $7p\\,^2$P$_{1/2}\\,$ Transition in Trapped Short-Lived $^{209-214}$Ra$^+$

    CERN Document Server

    Giri, G S; Berg, J E van den; Böll, O; Dammalapati, U; van der Hoek, D J; Jungmann, K; Kruithof, W L; Müller, S; Portela, M Nuñez; Onderwater, C J G; Santra, B; Timmermans, R G E; Wansbeek, L W; Willmann, L; Wilschut, H W

    2011-01-01

    Laser spectroscopy of short-lived radium isotopes in a linear Paul trap has been performed. The isotope shifts of the $6d\\,^2$D$_{3/2}\\,$ - $7p\\,^2$P$_{1/2}\\,$ transition in $^{209-214}$Ra$^+$ were measured, which are sensitive to the short range part of the atomic wavefunctions. The results are essential experimental input for improving the precision of atomic structure calculation. This is indispensable for parity violation in Ra$^+$ aiming at the determination of the weak mixing angle.

  18. Micro RNA-214 contributes to proteasome independent downregulation of beta catenin in Huntington's disease knock-in striatal cell model STHdhQ111/Q111.

    Science.gov (United States)

    Ghatak, Supratim; Raha, Sanghamitra

    2015-04-10

    Role of beta catenin in Huntington's disease (HD) is not clear. Previous studies on HD reported varied levels of beta catenin. In the present study we showed that beta catenin is post transcriptionally down-regulated in mutant huntingtin knock-in cell model STHdhQ111/Q111. This in turn leads to decreased level of wnt/beta catenin responsive genes. We observed that Gsk3beta or Gsk3beta (phospho Ser 9) is unaltered in HD and this down-regulation of beta catenin is independent of proteasomal degradation. Finally, we showed that the overexpression of miR-214 leads to the down-regulation of beta catenin at protein level only and reduces its transcriptional activity. We concluded that, miR-214 contributes to the processes that result in proteasome independent post transcriptional down-regulation of beta catenin in STHdhQ111/Q111, probably through inhibition of protein synthesis from beta catenin mRNA. Copyright © 2015 Elsevier Inc. All rights reserved.

  19. Mechanotransduction in bone tissue: The A214V and G171V mutations in Lrp5 enhance load-induced osteogenesis in a surface-selective manner.

    Science.gov (United States)

    Niziolek, Paul J; Warman, Matthew L; Robling, Alexander G

    2012-09-01

    Mechanotransduction in bone requires components of the Wnt signaling pathway to produce structurally adapted bone elements. In particular, the Wnt co-receptor LDL-receptor-related protein 5 (LRP5) appears to be a crucial protein in the mechanotransduction cascades that translate physical tissue deformation into new bone formation. Recently discovered missense mutations in LRP5 are associated with high bone mass (HBM), and the altered function of these proteins provide insight into LRP5 function in many skeletal processes, including mechanotransduction. We further investigated the role of LRP5 in bone cell mechanotransduction by applying mechanical stimulation in vivo to two different mutant mouse lines, which harbor HBM-causing missense mutations in Lrp5. Axial tibia loading was applied to mature male Lrp5 G171V and Lrp5 A214V knock-in mice, and to their wild type controls. Fluorochrome labeling revealed that 3 days of loading resulted in a significantly enhanced periosteal response in the A214V knock in mice, whereas the G171V mice exhibited a lowered osteogenic threshold on the endocortical surface. In summary, our data further highlight the importance of Lrp5 in bone cell mechanotransduction, and indicate that the HBM-causing mutations in Lrp5 can alter the anabolic response to mechanical stimulation in favor of increased bone gain. Copyright © 2012 Elsevier Inc. All rights reserved.

  20. Expression of Clu and Tgfb1 during murine tooth development: effects of in-vivo transfection with anti-miR-214.

    Science.gov (United States)

    Khan, Qalb-E-Saleem; Sehic, Amer; Khuu, Cuong; Risnes, Steinar; Osmundsen, Harald

    2013-08-01

    Expression of clusterin (Clu) in the murine first molar tooth germ was markedly increased at postnatal developmental stages. The time-course of expression of this gene paralleled those of other genes encoding proteins involved during the secretory phase of odontogenesis, as described previously. Immunohistochemical studies of clusterin in murine molar tooth germs suggested this protein to be located in outer enamel epithelium, regressing enamel organ, secretory ameloblasts, and the dental epithelium connecting the tooth to the oral epithelium at an early eruptive stage. Immunolabelling of transforming growth factor beta-1 (TGF-β1) revealed it to be located close to clusterin. The levels of expression of Clu and Tgfb1 were markedly decreased following in-vivo transfection with anti-miR-214. In contrast, the expression of several genes associated with regulation of growth and development were increased by this treatment. We suggest that clusterin has functions during secretory odontogenesis and the early eruptive phase. Bioinformatic analysis after treatment with anti-miR-214 suggested that, whilst cellular activities associated with tooth mineralization and eruption were inhibited, activities associated with an alternative developmental activity (i.e. biosynthesis of contractile proteins) appeared to be stimulated. These changes probably occur through regulation mediated by a common cluster of transcription factors and support suggestions that microRNAs (miRNAs) are highly significant as regulators of differentiation during odontogenesis. © 2013 Eur J Oral Sci.

  1. Low temperature induces different cold sensitivity in two poplar clones (Populus x canadensis Monch 'I-214' and P. deltoides Marsh. 'Dvina').

    Science.gov (United States)

    Cocozza, Claudia; Lasserre, Bruno; Giovannelli, Alessio; Castro, Gaetano; Fragnelli, Giuseppe; Tognetti, Roberto

    2009-01-01

    Changes of stem diameter were continuously monitored during winter in two field-grown poplar clones, using automatic point dendrometers. The objective of this study was to find an analytical solution to seasonal synchronization of stem diameter oscillations and low air temperatures. The study identified to what extent and with what frequency low air temperature induced stem diameter variation in 'Dvina' (P. deltoides) and 'I-214' (Populus x canadensis) poplar clones, after exposure to summer drought. The patterns of reversible stem shrinkage were related to the cycles of low air temperature. Hourly and daily evidence showed that 'I-214' was more sensitive to low air temperatures than 'Dvina'. The analysis of raw data and graphic details implemented with the study of derivative tests allowed an increase in the general sensitivity of the investigation applied to describe the response of poplar clones to environmental conditions. Given these diameter fluctuation patterns, automatic point dendrometers were confirmed to be a reliable non-invasive method for testing the sensitivity of diameter variation to cold temperature. Variation in rate and duration of daily stem shrinkage in response to low air temperature in winter appeared to occur independently of the effects of water deficit suffered by plants the previous summer.

  2. t(6;9)(p22;q34)/DEK-NUP214-rearranged pediatric myeloid leukemia: an international study of 62 patients.

    Science.gov (United States)

    Sandahl, Julie Damgaard; Coenen, Eva A; Forestier, Erik; Harbott, Jochen; Johansson, Bertil; Kerndrup, Gitte; Adachi, Souichi; Auvrignon, Anne; Beverloo, H Berna; Cayuela, Jean-Michel; Chilton, Lucy; Fornerod, Maarten; de Haas, Valérie; Harrison, Christine J; Inaba, Hiroto; Kaspers, Gertjan J L; Liang, Der-Cherng; Locatelli, Franco; Masetti, Riccardo; Perot, Christine; Raimondi, Susana C; Reinhardt, Katarina; Tomizawa, Daisuke; von Neuhoff, Nils; Zecca, Marco; Zwaan, C Michel; van den Heuvel-Eibrink, Marry M; Hasle, Henrik

    2014-05-01

    Acute myeloid leukemia with t(6;9)(p22;q34) is listed as a distinct entity in the 2008 World Health Organization classification, but little is known about the clinical implications of t(6;9)-positive myeloid leukemia in children. This international multicenter study presents the clinical and genetic characteristics of 62 pediatric patients with t(6;9)/DEK-NUP214-rearranged myeloid leukemia; 54 diagnosed as having acute myeloid leukemia, representing myeloid leukemia, and eight as having myelodysplastic syndrome. The t(6;9)/DEK-NUP214 was associated with relatively late onset (median age 10.4 years), male predominance (sex ratio 1.7), French-American-British M2 classification (54%), myelodysplasia (100%), and FLT3-ITD (42%). Outcome was substantially better than previously reported with a 5-year event-free survival of 32%, 5-year overall survival of 53%, and a 5-year cumulative incidence of relapse of 57%. Hematopoietic stem cell transplantation in first complete remission improved the 5-year event-free survival compared with chemotherapy alone (68% versus 18%; Pmyeloid leukemia with a high risk of relapse, high frequency of FLT3-ITD, and a specific gene expression signature.

  3. MicroRNA profiling in prostate cancer--the diagnostic potential of urinary miR-205 and miR-214.

    Directory of Open Access Journals (Sweden)

    Anvesha Srivastava

    Full Text Available Prostate cancer (PCa is the most common type of cancer in men in the United States, which disproportionately affects African American descents. While metastasis is the most common cause of death among PCa patients, no specific markers have been assigned to severity and ethnic biasness of the disease. MicroRNAs represent a promising new class of biomarkers owing to their inherent stability and resilience. In the present study, we investigated potential miRNAs that can be used as biomarkers and/or therapeutic targets and can provide insight into the severity and ethnic biasness of PCa. PCR array was performed in FFPE PCa tissues (5 Caucasian American and 5 African American and selected differentially expressed miRNAs were validated by qRT-PCR, in 40 (15 CA and 25 AA paired PCa and adjacent normal tissues. Significantly deregulated miRNAs were also analyzed in urine samples to explore their potential as non-invasive biomarker for PCa. Out of 8 miRNAs selected for validation from PCR array data, miR-205 (p<0.0001, mir-214 (p<0.0001, miR-221(p<0.001 and miR-99b (p<0.0001 were significantly downregulated in PCa tissues. ROC curve shows that all four miRNAs successfully discriminated between PCa and adjacent normal tissues. MiR-99b showed significant down regulation (p<0.01 in AA PCa tissues as compared to CA PCa tissues and might be related to the aggressiveness associated with AA population. In urine, miR-205 (p<0.05 and miR-214 (p<0.05 were significantly downregulated in PCa patients and can discriminate PCa patients from healthy individuals with 89% sensitivity and 80% specificity. In conclusion, present study showed that miR-205 and miR-214 are downregulated in PCa and may serve as potential non-invasive molecular biomarker for PCa.

  4. The rate commitment to ISO 214 standard among the persian abstracts of approved research projects at school of health management and medical informatics, Isfahan University of Medical Sciences, Isfahan, Iran.

    Science.gov (United States)

    Papi, Ahmad; Khalaji, Davoud; Rizi, Hasan Ashrafi; Shabani, Ahmad; Hassanzadeh, Akbar

    2014-01-01

    Commitment to abstracting standards has a very significant role in information retrieval. The present research aimed to evaluate the rate of Commitment to ISO 214 Standard among the Persian abstracts of approved research projects at School of Health Management and Medical Informatics, Isfahan University of Medical Sciences, Isfahan, Iran. This descriptive study used a researcher-made checklist to collect data, which was then analyzed through content analysis. The studied population consisted of 227 approved research projects in the School of Health Management and Medical Informatics, Isfahan University of Medical Sciences during 2001-2010. The validity of the checklist was measured by face and content validity. Data was collected through direct observations. Statistical analyzes including descriptive (frequency distribution and percent) and inferential statistics (Chi-square test) were performed in SPSS-16. The highest and lowest commitment rates to ISO 214 standard were in using third person pronouns (100%) and using active verbs (34/4%), respectively. In addition, the highest commitment rates to ISO 214 standard (100%) related to mentioning third person pronouns, starting the abstract with a sentence to explain the subject of the research, abstract placement, and including keyword in 2009. On the other hand, during 2001-2003, the lowest commitment rate was observed in reporting research findings (16/7%). Moreover, various educational groups differed significantly only in commitment to study goals, providing research findings, and abstaining from using abbreviations, signs, and acronyms. Furthermore, educational level of the corresponding author was significantly related with extracting the keywords from the text. Other factors of ISO 214 standard did not have significant relations with the educational level of the corresponding author. In general, a desirable rate of commitment to ISO 214 standard was observed among the Persian abstracts of approved research

  5. Prediction of Molar Extinction Coefficients of Proteins and Peptides Using UV Absorption of the Constituent Amino Acids at 214 nm To Enable Quantitative Reverse Phase High-Performance Liquid Chromatography-Mass Spectrometry Analysis

    NARCIS (Netherlands)

    Kuipers, B.J.H.; Gruppen, H.

    2007-01-01

    The molar extinction coefficients of 20 amino acids and the peptide bond were measured at 214 nm in the presence of acetonitrile and formic acid to enable quantitative comparison of peptides eluting from reversed-phase high-performance liquid chromatography, once identified with mass spectrometry

  6. MicroRNA-98 and microRNA-214 post-transcriptionally regulate enhancer of zeste homolog 2 and inhibit migration and invasion in human esophageal squamous cell carcinoma

    Directory of Open Access Journals (Sweden)

    Huang Sheng-Dong

    2012-08-01

    Full Text Available Abstract Background The enhancer of zeste homolog 2 (EZH2 was found to be overexpressed and associated with tumor metastasis in esophageal squamous cell carcinoma (ESCC. On the other hand, it was reported that miR-26a, miR-98, miR-101, miR-124, miR-138 and miR-214 could inhibit the expression of EZH2 in some tumors. However, the role of miRNAs in the regulation of EZH2 expression in human ESCC has not been documented. The aim of this study was to determine the role of these miRNAs in the regulation of tumor metastasis via EZH2 overexpression in human ESCC. Methods and results The expression of these miRNAs and EZH2 mRNA were examined by qPCR and the expression of EZH2 protein was detected by western blot. The role of these miRNAs in migration and invasion was studied in ESCC cell line (Eca109 transfected with miRNA mimics or cotransfected with miRNA mimics and pcDNA-EZH2 plasmid (without the 3’-UTR of EZH2. Through clinical investigation, we found that miR-98 and miR-214 expression was significantly lower in ESCC tissues than in matched normal tissues, and the expression level of miR-98 and miR-214 was inversely correlated to EZH2 protein expression and the clinical features such as pathological grade, tumor stage and lymph node metastasis in ESCC. In Eca109 cells, overexpression of miR-98 and miR-214 significantly inhibited the migration and invasion of ESCC cells, which was reversed by transfection of EZH2. Conclusions These findings suggest that decreased expression of miR-98 and miR-214 might promote metastasis of human ESCC by inducing accumulation of EZH2 protein.

  7. A Strategy for Interpretation of Microearthquake Tomography Results in the Salton Sea Geothermal Field Based upon Rock Physics Interpretations of State 2-14 Borehole Logs

    Energy Technology Data Exchange (ETDEWEB)

    Bonner, B; Hutchings, L; Kasameyer, P

    2006-06-14

    We devise a strategy for analysis of Vp and Vs microearthquake tomography results in the Salton Sea geothermal field to identify important features of the geothermal reservoir. We first interpret rock properties in State 2-14 borehole based upon logged core through the reservoir. Then, we interpret seismic recordings in the well (Daley et al., 1988) to develop the strategy. We hypothesize that mapping Poisson's ratio has two applications for the Salton Sea geothermal reservoir: (1) to map the top of the reservoir, and (2) as a diagnostic for permeable zones. Poisson's ratio can be obtained from Vp and Vs. In the State 2-14 borehole, Poisson's ratio calculated from large scale averages ({approx} 150 m) shows a monotonic decrease with depth to about 1300 m, at which point it increases with depth. Our model is that the monotonic decrease is due to compaction, and the increase below 1300 m is due to the rocks being hydrothermally altered. We hypothesize we can map the depth to alteration by identifying the transition from decreasing to increasing values; and thus, map the top of the reservoir, which is associated with a known increase in sulfite, chlorite, and epidote alteration that may be indicative of hydrothermal activity. We also observe (from Daley et. al. plots) an anomalous drop in Poisson's ratio at a depth of about 900 m, within a sandstone formation. The sandstone has a P-wave velocity significantly higher than the siltstone above it but a lower velocity in the lower half of the formation relative to the upper half. We interpret the relative decrease in velocity to be due to fracturing and chemical alteration caused by permeability. We conclude that using Vp and Vs tomography results to obtain images of Poisson's ratio has the potential to identify significant features in the geothermal reservoir in this geologic setting. Seismic attenuation tomography results (mapped as Qp and Qs) should also be useful for evaluating geothermal

  8. Study of the background of the neutrinoless double {beta} decay with the detector NEMO 2: contribution arising from the radon diffusion and internal pollution of the source {sup 214}Bi have been estimated; Etude du bruit de fond de la double-desintegration {beta} sans emission de neutrino dans le detecteur NEMO 2: contribution du radon ambiant et mesure de la pollution interne de la source en {sup 214}Bi

    Energy Technology Data Exchange (ETDEWEB)

    Mauger, F.

    1995-02-01

    The NEMO experiment is designed to understand the nature of the neutrino by studying the double beta decay of Mo-100 which is related to the Majorana neutrino effective mass. In this kind of experiment a good understanding of the different sources of background is crucial as only few events are expected per year at the required level of sensitivity. In this thesis we present the main theoretical and experimental aspects of the measurement of the neutrinoless double beta decay of Mo-100 with the prototype detector NEMO2. The goal of this study is to obtain a realistic interpretation of the few events detected at high energy in the two-electron channel as a background to neutrinoless double beta decay. In particular, the contribution arising from Bi-214 has been investigated. These events have been selected and analysed by means of the beta-alpha decays of Bi-214 into Pb-210. The events are characterized by a delayed track in the wire chamber and the corresponding signal is rather clean. The study has demonstrated the diffusion of Rn-222 into the detector and its contribution to Bi-214 pollution has been estimated. A measurement of the Bi-214 internal contamination of the source has been made as well as an estimation of the Bi-214 deposit due to Rn-222. As a result of this study it appears that, under the conditions of the NEMO2 experiment, the Bi and Rn contributions are of the same order of magnitude as the background induced at high energy by two-neutrino double beta decay. In conclusion, the backgrounds of the neutrinoless double beta decay of Mo-100 are well understood in the NEMO2 experiment leading to an extrapolation for the NEMO3 experiment. (authors).

  9. Slow subcutaneous infusion of flumazenil for the treatment of long-term, high-dose benzodiazepine users: a review of 214 cases.

    Science.gov (United States)

    Faccini, Marco; Leone, Roberto; Opri, Sibilla; Casari, Rebecca; Resentera, Chiara; Morbioli, Laura; Conforti, Anita; Lugoboni, Fabio

    2016-10-01

    Despite the first reports concerning benzodiazepine dependence being published in the early 1960s literature, the risk of benzodiazepine addiction is still greatly debated. The severe discomfort and life threatening complications usually experienced by long-term benzodiazepine users who suddenly interrupt benzodiazepine intake have led to the development of several detoxification protocols. A successful strategy used by our Addiction Unit is abrupt benzodiazepine cessation by administering flumazenil slow subcutaneous infusion (FLU-SSI) with an elastomeric pump. Although some studies proved the efficacy of flumazenil infusion more than 20 years ago, only a few centres in the world offer this method to their patients. This paper reports the data related to 214 subjects addicted to high doses of benzodiazepine and treated with the FLU-SSI method between 2012 and 2014. This technique is less invasive and requires less nursing intervention than intravenous infusion. Our data support FLU-SSI as a possible efficient strategy for the treatment of patients with long-term, high-dose benzodiazepine addiction, and could become a routine therapy as long as the necessary further studies on dose, duration of infusion and safety issues are carried out. © The Author(s) 2016.

  10. Use of a dynamic self-regulating prosthesis (P.A.D.) in inguinal hernia repair: our first experience in 214 patients.

    Science.gov (United States)

    Ferranti, Fabrizio; Marzano, Marco; Quintiliani, Alberto

    2009-01-01

    Numerous techniques exist for inguinal hernia treatment. Currently, open mesh tension-free repair is regarded as the repair method of choice. In particular Lichtenstein repair is the most common procedure performed, although several articles have reported long-lasting postoperative pain and a higher recurrence rate than originally reported. This study describes the P.A.D. (Protesi Autoregolantesi Dinamica) prosthesis implantation technique and reports postoperative complications and long-term results. From June 2002 to May 2005 a total of 214 patients underwent P.A.D. prosthesis inguinal repair. All patients were male, with a mean age of 51 years. All hernias were treated via an open inguinal approach using the original technique described by Valenti, with slight modifications. A total of 171'patients (80%) were available to follow-up 3 years after surgery. Early postoperative complications occurred in 14 patients (8.4%). Four patients (12.1%), who had undergone regional anaesthesia, developed urinary retention. Wound infection occurred in 3 patients (1.4%). There were two direct recurrences (0.93%) whereas chronic postoperative inguinal pain was reported in 4.2% of patients. Within the limitations of a short follow-up, our results show that the P.A.D. prosthesis procedure is a reliable technique with a low recurrence rate and low postoperative morbidity.

  11. The metabolome of [2-14C](−)-epicatechin in humans: implications for the assessment of efficacy, safety, and mechanisms of action of polyphenolic bioactives

    Science.gov (United States)

    Ottaviani, Javier I.; Borges, Gina; Momma, Tony Y.; Spencer, Jeremy P. E.; Keen, Carl L.; Crozier, Alan; Schroeter, Hagen

    2016-01-01

    Diet is a major life style factor affecting human health, thus emphasizing the need for evidence-based dietary guidelines for primary disease prevention. While current recommendations promote intake of fruit and vegetables, we have limited understanding of plant-derived bioactive food constituents other than those representing the small number of essential nutrients and minerals. This limited understanding can be attributed to some extent to a lack of fundamental data describing the absorption, distribution, metabolism and excretion (ADME) of bioactive compounds. Consequently, we selected the flavanol (−)-epicatechin (EC) as an example of a widely studied bioactive food constituent and investigated the ADME of [2-14C](−)-epicatechin (300 μCi, 60 mg) in humans (n = 8). We demonstrated that 82 ± 5% of ingested EC was absorbed. We also established pharmacokinetic profiles and identified and quantified >20 different metabolites. The gut microbiome proved to be a key driver of EC metabolism. Furthermore, we noted striking species-dependent differences in the metabolism of EC, an insight with significant consequences for investigating the mechanisms of action underlying the beneficial effects of EC. These differences need to be considered when assessing the safety of EC intake in humans. We also identified a potential biomarker for the objective assessment of EC intake that could help to strengthen epidemiological investigations. PMID:27363516

  12. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  13. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  14. Targeted Inhibition of the miR-199a/214 Cluster by CRISPR Interference Augments the Tumor Tropism of Human Induced Pluripotent Stem Cell-Derived Neural Stem Cells under Hypoxic Condition

    Directory of Open Access Journals (Sweden)

    Yumei Luo

    2016-01-01

    Full Text Available The human induced pluripotent stem cell (hiPSC provides a breakthrough approach that helps overcoming ethical and allergenic challenges posed in application of neural stem cells (NSCs in targeted cancer gene therapy. However, the tumor-tropic capacity of hiPSC-derived NSCs (hiPS-NSCs still has much room to improve. Here we attempted to promote the tumor tropism of hiPS-NSCs by manipulating the activity of endogenous miR-199a/214 cluster that is involved in regulation of hypoxia-stimulated cell migration. We first developed a baculovirus-delivered CRISPR interference (CRISPRi system that sterically blocked the E-box element in the promoter of the miR-199a/214 cluster with an RNA-guided catalytically dead Cas9 (dCas9. We then applied this CRISPRi system to hiPS-NSCs and successfully suppressed the expression of miR-199a-5p, miR-199a-3p, and miR-214 in the microRNA gene cluster. Meanwhile, the expression levels of their targets related to regulation of hypoxia-stimulated cell migration, such as HIF1A, MET, and MAPK1, were upregulated. Further migration assays demonstrated that the targeted inhibition of the miR-199a/214 cluster significantly enhanced the tumor tropism of hiPS-NSCs both in vitro and in vivo. These findings suggest a novel application of CRISPRi in NSC-based tumor-targeted gene therapy.

  15. Corrective Action Investigation Plan for Corrective Action Unit 214: Bunkers and Storage Areas Nevada Test Site, Nevada: Revision 0, Including Record of Technical Change No. 1 and No. 2

    Energy Technology Data Exchange (ETDEWEB)

    U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office

    2003-05-16

    This Corrective Action Investigation Plan contains the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office's approach to collect the data necessary to evaluate corrective action alternatives appropriate for the closure of Corrective Action Unit (CAU) 214 under the Federal Facility Agreement and Consent Order. Located in Areas 5, 11, and 25 of the Nevada Test Site, CAU 214 consists of nine Corrective Action Sites (CASs): 05-99-01, Fallout Shelters; 11-22-03, Drum; 25-99-12, Fly Ash Storage; 25-23-01, Contaminated Materials; 25-23-19, Radioactive Material Storage; 25-99-18, Storage Area; 25-34-03, Motor Dr/Gr Assembly (Bunker); 25-34-04, Motor Dr/Gr Assembly (Bunker); and 25-34-05, Motor Dr/Gr Assembly (Bunker). These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives (CAAs). The suspected contaminants and critical analyte s for CAU 214 include oil (total petroleum hydrocarbons-diesel-range organics [TPH-DRO], polychlorinated biphenyls [PCBs]), pesticides (chlordane, heptachlor, 4,4-DDT), barium, cadmium, chronium, lubricants (TPH-DRO, TPH-gasoline-range organics [GRO]), and fly ash (arsenic). The land-use zones where CAU 214 CASs are located dictate that future land uses will be limited to nonresidential (i.e., industrial) activities. The results of this field investigation will support a defensible evaluation of viable corrective action alternatives that will be presented in the corrective action decision document.

  16. Tracer studies on the incorporation of [2-14C]-DL-mevalonate into chlorophylls a and b, alpha-chaconine, and alpha-solanine of potato sprouts.

    Science.gov (United States)

    Kozukue, N; Tsuchida, H; Friedman, M

    2001-01-01

    Chlorophyll and glycoalkaloids are synthesized in different parts of the potato plant including leaves, tubers, and sprouts. Although light stimulates the biosynthesis of both constituents, the question of whether the two biosynthetic pathways are under the same genetic control has not been resolved. This study investigated the dynamics of incorporation of labeled [2-(14)C]-DL-mavalonate into chlorophyll a, chlorophyll b, and the glycoalkaloids alpha-chaconine and alpha-solanine in potato sprouts after 7 and 14 days of storage in the light and in the dark. No chlorophyll synthesis occurred in the dark. Fractionation of the "glycoalkaloid" extract followed by high-performance liquid chromatography produced four peaks. The fractions were collected and analyzed for radioactivity. About 80% of the radioactivity resided in fraction 1, the composition of which is unknown. Two of the fractions, with 1-14% of the original label, were alpha-chaconine and alpha-solanine. The radioactivity derived from mevalonate largely resides in unidentified compound(s) eluting as a single peak on the HPLC column before the peaks associated with the glycoalkaloids. The specific radioactivity of alpha-chaconine and alpha-solanine increased approximately 2-fold in going from 7 to 14 days of exposure in the light and in the dark. These and additional observations point to the near identity of the dynamics of biosynthesis of the two glycoalkaloids. These data also implicate a non-mevalonate pathway for the synthesis of both chlorophylls and the glycoalkaloids and are consistent with independent genetic control of the concurrent formation of the two classes of compounds during greening of potatoes.

  17. Femtosecond stage of electron transfer in reaction centers of the triple mutant SL178K/GM203D/LM214H of Rhodobacter sphaeroides.

    Science.gov (United States)

    Yakovlev, A G; Shkuropatova, T A; Shkuropatova, V A; Shuvalov, V A

    2010-04-01

    Coherent processes in an initial phase of charge transfer in reaction centers (RCs) of the triple mutant S(L178)K/G(M203)D/L(M214)H of Rhodobacter sphaeroides were investigated by difference (light - dark) absorption spectroscopy with 18 fsec time resolution. Electron transfer in the B cofactor branch is activated in this mutant, while the A-branch electron transfer is slowed in comparison with native RCs of Rba. sphaeroides. A bulk of absorption difference spectra was analyzed in the 940-1060 nm range (stimulated emission of excited bacteriochlorophyll dimer P* and absorption of bacteriochlorophyll anions B(A)(-) and beta(-), where beta is a bacteriochlorophyll substituting the native bacteriopheophytin H(A)) and in the 735-775 nm range (bleaching of the absorption band of the bacteriopheophytin H(B) in the B-branch) in the -0.1 to 4 psec range of delays with respect to the moment of photoexcitation of P at 870 nm. Spectra were measured at 293 and 90 K. The kinetics of P* stimulated emission at 940 nm shows its decay with a time constant of approximately 14 psec at 90 K and approximately 18 psec at 293 K, which is accompanied by oscillations with a frequency of approximately 150 cm(-1). A weak absorption band is found at 1018 nm that is formed approximately 100 fsec after excitation of P and reflects the electron transfer from P* to beta and/or B(A) with accumulation of the P(+)beta(-) and/or P(+)B(A)(-) states. The kinetics of DeltaA at 1018 nm contains the oscillations at approximately 150 cm(-1) and distinct low-frequency oscillations at 20-100 cm(-1); also, the amplitude of the oscillations at 150 cm(-1) is much smaller at 293 than at 90 K. The oscillations in the kinetics of the 1018 nm band do not contain a 32 cm(-1) mode that is characteristic for native Rba. sphaeroides RCs having water molecule HOH55 in their structure. The DeltaA kinetics at 751 nm reflects the electron transfer to H(B) with formation of the P(+)H(B)(-) state. The oscillatory part of

  18. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  19. Paleomagnetism of Basaltic Lava Flows in Coreholes ICPP 213, ICPP-214, ICPP-215, and USGS 128 Near the Vadose Zone Research Park, Idaho Nuclear Technology and Engineering Center, Idaho National Engineering and Environmental Laboratory, Idaho

    Science.gov (United States)

    Champion, Duane E.; Herman, Theodore C.

    2003-01-01

    A paleomagnetic study was conducted on basalt from 41 lava flows represented in about 2,300 ft of core from coreholes ICPP-213, ICPP-214, ICPP-215, and USGS 128. These wells are in the area of the Idaho Nuclear Technology and Engineering Center (INTEC) Vadose Zone Research Park within the Idaho National Engineering and Environmental Laboratory (INEEL). Paleomagnetic measurements were made on 508 samples from the four coreholes, which are compared to each other, and to surface outcrop paleomagnetic data. In general, subhorizontal lines of correlation exist between sediment layers and between basalt layers in the area of the new percolation ponds. Some of the basalt flows and flow sequences are strongly correlative at different depth intervals and represent important stratigraphic unifying elements. Some units pinch out, or thicken or thin even over short separation distances of about 1,500 ft. A more distant correlation of more than 1 mile to corehole USGS 128 is possible for several of the basalt flows, but at greater depth. This is probably due to the broad subsidence of the eastern Snake River Plain centered along its topographic axis located to the south of INEEL. This study shows this most clearly in the oldest portions of the cored sections that have differentially subsided the greatest amount.

  20. 49 CFR 214.113 - Head protection.

    Science.gov (United States)

    2010-10-01

    ... impact, or from falling or flying objects, or from electrical shock and burns, shall be provided and... and penetration of falling and flying objects, or from high voltage electrical shock and burns shall conform to the national consensus standards for industrial head protection (American National Standards...

  1. Publications | Page 214 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ethiopian Canadian physiotherapist with clinical and/or academic expertise for a volunteer 3-6 week assignment to train faculty at Ethiopia... Redesigning the World Trade Organization for the Twenty-First Century. Rather than simply analyzing the current functioning of the WTO, its problems and challenges, this volume is ...

  2. Publications | Page 214 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Absence of dry season Plasmodium parasitaemia, but high rates of reported acute respiratory infection and diarrhoea in preschool-aged children in Kaédi, southern Mauritania (open access). As a ''hot spot'' for climate change, the epidemiology of malaria in the River Gorgol valley, southern Mauritania, requires particular ...

  3. Proclamation No. 214, 3 February 1988.

    Science.gov (United States)

    1988-01-01

    This Proclamation declares the second week of February 1988 and every year thereafter as Respect and Care for Life Week. The text of the Proclamation, including its preamble, is as follows: "Whereas, the UN Declaration on Rights of the Child provides that 'the Child, by reason of his physical and mental immaturity, needs special safeguards and care, including appropriate legal protection, before as well as after birth'; Whereas, Section 12, Article 2 of the Constitution provides that it is the policy of the State to 'protect the life of the mother and the life of the unborn from conception'; Whereas, available statistics detail the frightening losses of innocent human lives by abortion; and Whereas, in pursuance of the above constitutional mandate and in support of the UN universal declaration and in order to instill the same, as well as the value and sacredness of human life, in the minds and hearts of the Filipino people and thereby help reverse the above statistical trend, it becomes imperative to set aside a period of time for them to ponder and focus attention on their moral and constitutional obligations to protect human life or one's inherent right to life; Now, Therefore, I, Corazon C. Aquino, President of the Philippines, by virtue of the powers vested in me by law, do hereby declare the second week of February 1988 and every year thereafter as "Respect and Care for Life Week" under the auspices of the Department of Social Welfare and Development and Pro-Life Philippines, and other involved entities or organization[s]." full text

  4. 214 Using Appropriate Strategies to Improve Students ...

    African Journals Online (AJOL)

    User

    2011-07-21

    Jul 21, 2011 ... 1983). Skilled readers make connections between texts, from the text to the outside world, and from the text to their own experience while reading. They tend to make mental pictures of what they are reading and ask questions to themselves and to their instructors to enhance their understanding of the text.

  5. 49 CFR 214.7 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... not limited to, rope grabs, ripstitch lanyards, specially woven lanyards, tearing or deforming... structure supporting one or more railroad tracks above land or water with a span length of 12 feet or more...

  6. BDML Metadata: 214 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available NC-SA 0.150 f5a7a976-0215-4b87-8dfd-5a952cc85fe2 0.105 x 0.105 x 0.5 (micrometer), 40 (second) http://ssbd.qbic.riken.jp/data.../source/Ce_KK_P002/RNAi_T20G5.1_040907_01/ http://ssbd.qbic.riken.jp/data.../bdml/Ce_KK_P002/RNAi_T20G5.1_040907_01.bdml0.15.xml http://ssbd.qbic.riken.jp/data/pdpml/Ce_KK_P00...2.pdpml0.05.xml http://ssbd.qbic.riken.jp/search/f5a7a976-0215-4b87-8dfd-5a952cc85fe2/ http://ssbd.qbic.riken.jp/omero/webclient/?show=dataset-157 ...

  7. Publications | Page 214 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The report assesses challenges facing the wider uses of renewable energy technologies in water services. Promotion of pro-poor renewable-based water pumping options in East Africa such as treadle pumps, wind pumps and ram pumps (examined in this report), will demand collaboration between the... Industrial clusters ...

  8. 24 CFR 214.311 - Funding.

    Science.gov (United States)

    2010-04-01

    ... Internet or other electronic media. (b) Local funding sources. HUD recommends that approved agencies seek and secure funding from funding sources that may include local and state governments, private foundations, and lending or real estate organizations. Agencies must assure that such arrangements do not...

  9. 31 CFR 0.214 - Nondiscrimination.

    Science.gov (United States)

    2010-07-01

    ... official business on the basis of race, color, religion, national origin, sex, sexual orientation, age, or disability. Sexual harassment is a form of sex discrimination and is prohibited by this section. (b) An...

  10. 214 Using Appropriate Strategies to Improve Students ...

    African Journals Online (AJOL)

    User

    2011-07-21

    Jul 21, 2011 ... requires good possession of reading comprehension skills. .... strategies that can be taught that reliably improve comprehension (National. Reading Panel ..... Guest comment: Teaching writing to teach physics. American ...

  11. 47 CFR 15.214 - Cordless telephones.

    Science.gov (United States)

    2010-10-01

    ... Cordless telephones. (a) For equipment authorization, a single application form, FCC Form 731, may be filed... protection against unintentional access to the public switched telephone network by the base unit and... network shall occur only if the code transmitted by the handset matches code set in the base unit...

  12. Fungal Planet description sheets: 214–280

    NARCIS (Netherlands)

    Crous, P.W.; Shivas, R.G.; Quaedvlieg, W.; Bank, van der M.; Zhang, Y.; Summerell, B.A.; Guarro, J.; Wingfield, M.J.; Wood, A.R.; Alfenas, A.C.; Braun, U.; Cano-Lira, J.F.; Garcia, D.; Marin-Felix, Y.; Alvarado, P.; Andrade, J.P.; Armengol, J.; Assefa, A.; Breeÿen, den A.; Camele, I.; Cheewangkoon, R.; Souza, De J.T.; Duong, T.A.; Esteve-Raventós, F.; Fournier, J.; Frisullo, S.; García-Jiménez, J.; Gardiennet, A.; Gené, J.; Hernández-Restrepo, M.; Hirooka, Y.; Hospenthal, D.R.; King, A.; Lechat, C.; Lombard, L.; Mang, S.M.; Marbach, P.A.S.; Marincowitz, S.; Montaño-Mata, N.J.; Moreno, G.; Perez, C.A.; Pérez Sierra, A.M.; Robertson, J.L.; Roux, J.; Rubio, E.; Schumacher, R.K.; Stchigel, A.M.; Sutton, D.A.; Tan, Y.P.; Thompson, E.H.; Vanderlinde, E.; Walker, A.K.; Walker, D.M.; Wickes, B.L.; Wong, P.T.W.; Groenewald, J.Z.

    2014-01-01

    Novel species of microfungi described in the present study include the following from South Africa: Cercosporella dolichandrae from Dolichandra unguiscati, Seiridium podocarpi from Podocarpus latifolius, Pseudocercospora parapseudarthriae from Pseudarthria hookeri, Neodevriesia coryneliae from

  13. Fungal Planet description sheets: 214-280.

    Science.gov (United States)

    Crous, P W; Shivas, R G; Quaedvlieg, W; van der Bank, M; Zhang, Y; Summerell, B A; Guarro, J; Wingfield, M J; Wood, A R; Alfenas, A C; Braun, U; Cano-Lira, J F; García, D; Marin-Felix, Y; Alvarado, P; Andrade, J P; Armengol, J; Assefa, A; den Breeÿen, A; Camele, I; Cheewangkoon, R; De Souza, J T; Duong, T A; Esteve-Raventós, F; Fournier, J; Frisullo, S; García-Jiménez, J; Gardiennet, A; Gené, J; Hernández-Restrepo, M; Hirooka, Y; Hospenthal, D R; King, A; Lechat, C; Lombard, L; Mang, S M; Marbach, P A S; Marincowitz, S; Marin-Felix, Y; Montaño-Mata, N J; Moreno, G; Perez, C A; Pérez Sierra, A M; Robertson, J L; Roux, J; Rubio, E; Schumacher, R K; Stchigel, A M; Sutton, D A; Tan, Y P; Thompson, E H; van der Linde, E; Walker, A K; Walker, D M; Wickes, B L; Wong, P T W; Groenewald, J Z

    2014-06-01

    Novel species of microfungi described in the present study include the following from South Africa: Cercosporella dolichandrae from Dolichandra unguiscati, Seiridium podocarpi from Podocarpus latifolius, Pseudocercospora parapseudarthriae from Pseudarthria hookeri, Neodevriesia coryneliae from Corynelia uberata on leaves of Afrocarpus falcatus, Ramichloridium eucleae from Euclea undulata and Stachybotrys aloeticola from Aloe sp. (South Africa), as novel member of the Stachybotriaceae fam. nov. Several species were also described from Zambia, and these include Chaetomella zambiensis on unknown Fabaceae, Schizoparme pseudogranati from Terminalia stuhlmannii, Diaporthe isoberliniae from Isoberlinia angolensis, Peyronellaea combreti from Combretum mossambiciensis, Zasmidium rothmanniae and Phaeococcomyces rothmanniae from Rothmannia engleriana, Diaporthe vangueriae from Vangueria infausta and Diaporthe parapterocarpi from Pterocarpus brenanii. Novel species from the Netherlands include: Stagonospora trichophoricola, Keissleriella trichophoricola and Dinemasporium trichophoricola from Trichophorum cespitosum, Phaeosphaeria poae, Keissleriella poagena, Phaeosphaeria poagena, Parastagonospora poagena and Pyrenochaetopsis poae from Poa sp., Septoriella oudemansii from Phragmites australis and Dendryphion europaeum from Hedera helix (Germany) and Heracleum sphondylium (the Netherlands). Novel species from Australia include: Anungitea eucalyptorum from Eucalyptus leaf litter, Beltraniopsis neolitseae and Acrodontium neolitseae from Neolitsea australiensis, Beltraniella endiandrae from Endiandra introrsa, Phaeophleospora parsoniae from Parsonia straminea, Penicillifer martinii from Cynodon dactylon, Ochroconis macrozamiae from Macrozamia leaf litter, Triposporium cycadicola, Circinotrichum cycadis, Cladosporium cycadicola and Acrocalymma cycadis from Cycas spp. Furthermore, Vermiculariopsiella dichapetali is described from Dichapetalum rhodesicum (Botswana), Ophiognomonia acadiensis from Picea rubens (Canada), Setophoma vernoniae from Vernonia polyanthes and Penicillium restingae from soil (Brazil), Pseudolachnella guaviyunis from Myrcianthes pungens (Uruguay) and Pseudocercospora neriicola from Nerium oleander (Italy). Novelties from Spain include: Dendryphiella eucalyptorum from Eucalyptus globulus, Conioscypha minutispora from dead wood, Diplogelasinospora moalensis and Pseudoneurospora canariensis from soil and Inocybe lanatopurpurea from reforested woodland of Pinus spp. Novelties from France include: Kellermania triseptata from Agave angustifolia, Zetiasplozna acaciae from Acacia melanoxylon, Pyrenochaeta pinicola from Pinus sp. and Pseudonectria rusci from Ruscus aculeatus. New species from China include: Dematiocladium celtidicola from Celtis bungeana, Beltrania pseudorhombica, Chaetopsina beijingensis and Toxicocladosporium pini from Pinus spp. and Setophaeosphaeria badalingensis from Hemerocallis fulva. Novel genera of Ascomycetes include Alfaria from Cyperus esculentus (Spain), Rinaldiella from a contaminated human lesion (Georgia), Hyalocladosporiella from Tectona grandis (Brazil), Pseudoacremonium from Saccharum spontaneum and Melnikomyces from leaf litter (Vietnam), Annellosympodiella from Juniperus procera (Ethiopia), Neoceratosperma from Eucalyptus leaves (Thailand), Ramopenidiella from Cycas calcicola (Australia), Cephalotrichiella from air in the Netherlands, Neocamarosporium from Mesembryanthemum sp. and Acervuloseptoria from Ziziphus mucronata (South Africa) and Setophaeosphaeria from Hemerocallis fulva (China). Several novel combinations are also introduced, namely for Phaeosphaeria setosa as Setophaeosphaeria setosa, Phoma heteroderae as Peyronellaea heteroderae and Phyllosticta maydis as Peyronellaea maydis. Morphological and culture characteristics along with ITS DNA barcodes are provided for all taxa.

  14. 28 CFR 2.14 - Subsequent proceedings.

    Science.gov (United States)

    2010-07-01

    ... year reconsideration hearing shall be advanced only: (1) For superior program achievement under the provisions of § 2.60; or (2) For other clearly exceptional circumstances. (iii) Retard or rescind a... retard the parole date for purpose of release planning as provided by § 2.28(e); (iii) Retard the parole...

  15. GPCR Interaction: 214 [GRIPDB[Archive

    Lifescience Database Archive (English)

    Full Text Available s controlled by RTP4, which governs their membrane targeting and functional activity. 18836069 ELISA, Immunoblotting, Coimmunoprecipi...tation, Western blotting, SEAP assay NP_000905.3 ...

  16. 24 CFR 214.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ..., with established curriculum and instructional goals provided in a group or classroom setting, covering topics applicable to groups of people such as, but not limited to: (1) Renter rights; (2) The homebuying.... Housing counseling work plan. A participating agency's plan to provide housing counseling activities and...

  17. 4 CFR 21.4 - Protective orders.

    Science.gov (United States)

    2010-01-01

    ... material, as well as other information the release of which could result in a competitive advantage to one... the applicant is not involved in competitive decision-making for any firm that could gain a competitive advantage from access to the protected information and that there will be no significant risk of...

  18. The effects of height and BMI on prostate cancer incidence and mortality: a Mendelian randomization study in 20,848 cases and 20,214 controls from the PRACTICAL consortium.

    Science.gov (United States)

    Davies, Neil M; Gaunt, Tom R; Lewis, Sarah J; Holly, Jeff; Donovan, Jenny L; Hamdy, Freddie C; Kemp, John P; Eeles, Rosalind; Easton, Doug; Kote-Jarai, Zsofia; Al Olama, Ali Amin; Benlloch, Sara; Muir, Kenneth; Giles, Graham G; Wiklund, Fredrik; Gronberg, Henrik; Haiman, Christopher A; Schleutker, Johanna; Nordestgaard, Børge G; Travis, Ruth C; Neal, David; Pashayan, Nora; Khaw, Kay-Tee; Stanford, Janet L; Blot, William J; Thibodeau, Stephen; Maier, Christiane; Kibel, Adam S; Cybulski, Cezary; Cannon-Albright, Lisa; Brenner, Hermann; Park, Jong; Kaneva, Radka; Batra, Jyotsna; Teixeira, Manuel R; Pandha, Hardev; Lathrop, Mark; Smith, George Davey; Martin, Richard M

    2015-11-01

    Epidemiological studies suggest a potential role for obesity and determinants of adult stature in prostate cancer risk and mortality, but the relationships described in the literature are complex. To address uncertainty over the causal nature of previous observational findings, we investigated associations of height- and adiposity-related genetic variants with prostate cancer risk and mortality. We conducted a case-control study based on 20,848 prostate cancers and 20,214 controls of European ancestry from 22 studies in the PRACTICAL consortium. We constructed genetic risk scores that summed each man's number of height and BMI increasing alleles across multiple single nucleotide polymorphisms robustly associated with each phenotype from published genome-wide association studies. The genetic risk scores explained 6.31 and 1.46% of the variability in height and BMI, respectively. There was only weak evidence that genetic variants previously associated with increased BMI were associated with a lower prostate cancer risk (odds ratio per standard deviation increase in BMI genetic score 0.98; 95% CI 0.96, 1.00; p = 0.07). Genetic variants associated with increased height were not associated with prostate cancer incidence (OR 0.99; 95% CI 0.97, 1.01; p = 0.23), but were associated with an increase (OR 1.13; 95 % CI 1.08, 1.20) in prostate cancer mortality among low-grade disease (p heterogeneity, low vs. high grade increased BMI were associated with an increase (OR 1.08; 95 % CI 1.03, 1.14) in all-cause mortality among men with low-grade disease (p heterogeneity = 0.03). We found little evidence of a substantial effect of genetically elevated height or BMI on prostate cancer risk, suggesting that previously reported observational associations may reflect common environmental determinants of height or BMI and prostate cancer risk. Genetically elevated height and BMI were associated with increased mortality (prostate cancer-specific and all-cause, respectively) in men with

  19. 49 CFR 571.214 - Standard No. 214; Side impact protection.

    Science.gov (United States)

    2010-10-01

    ... lumbar supports so that they are set in their released, i.e., full back position. S8.3.35th Percentile... vehicle and is positive to the vehicle front end and negative to the rear end. The Y-axis is positive to.... S3Definitions. Contoured means, with respect to a door, that the lower portion of its front or rear edge is...

  20. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  1. Reductive activation of the prodrug 1,2-bis(methylsulfonyl)-1-(2-chloroethyl)-2-[[1-(4-nitrophenyl)ethoxy]carbonyl]hydrazine (KS119) selectively occurs in oxygen-deficient cells and overcomes O(6)-alkylguanine-DNA alkyltransferase mediated KS119 tumor cell resistance.

    Science.gov (United States)

    Baumann, Raymond P; Penketh, Philip G; Ishiguro, Kimiko; Shyam, Krishnamurthy; Zhu, Yong L; Sartorelli, Alan C

    2010-06-01

    1,2-Bis(methylsulfonyl)-1-(2-chloroethyl)-2-[[1-(4-nitrophenyl)ethoxy]carbonyl]hydrazine (KS119) is a prodrug of the 1,2-bis(sulfonyl)hydrazine class of antineoplastic agents designed to exploit the oxygen-deficient regions of cancerous tissue. Thus, under reductive conditions in hypoxic cells this agent decomposes to produce the reactive intermediate 1,2-bis(methylsulfonyl)-1-(2-chloroethyl)hydrazine (90CE), which in turn generates products that alkylate the O(6)-position of guanine in DNA. Comparison of the cytotoxicity of KS119 in cultured cells lacking O(6)-alkylguanine-DNA alkyltransferase (AGT) to an agent such as Onrigin, which through base catalyzed activation produces the same critical DNA G-C cross-link lesions by the generation of 90CE, indicates that KS119 is substantially more potent than Onrigin under conditions of oxygen deficiency, despite being incompletely activated. In cell lines expressing relatively large amounts of AGT, the design of the prodrug KS119, which requires intracellular activation by reductase enzymes to produce a cytotoxic effect, results in an ability to overcome resistance derived from the expression of AGT. This appears to derive from the ability of a small portion of the chloroethylating species produced by the activation of KS119 to slip through the cellular protection afforded by AGT to generate the few DNA G-C cross-links that are required for tumor cell lethality. The findings also demonstrate that activation of KS119 under oxygen-deficient conditions is ubiquitous, occurring in all of the cell lines tested thus far, suggesting that the enzymes required for reductive activation of this agent are widely distributed in many different tumor types. 2010. Published by Elsevier Inc.

  2. Parenting and Career Development. ERIC Digest No. 214.

    Science.gov (United States)

    Kerka, Sandra

    Research indicates that parenting styles, family functioning, and parent-child interaction influence career development. The authoritative parenting style is associated with self-confidence, persistence, social competence, academic success, and psychosocial development; parents provide a warm family climate, set standards, and promote independence…

  3. 14 CFR 21.4 - ETOPS reporting requirements.

    Science.gov (United States)

    2010-01-01

    ... the sources and content of data that it will use for its system. The data must be adequate to evaluate...: reporting, tracking, and resolving problems. The holder of a type certificate for an airplane-engine... in paragraph (a)(6) of this section. (1) The system must identify how the type certificate holder...

  4. 9 CFR 113.214 - Parvovirus Vaccine, Killed Virus (Canine).

    Science.gov (United States)

    2010-01-01

    ... production. All serials of vaccine shall be prepared from the first through the fifth passage from the Master...) The immunogenicity of vaccine prepared in accordance with the Outline of Production shall be... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Parvovirus Vaccine, Killed Virus...

  5. 34 CFR 685.214 - Closed school discharge.

    Science.gov (United States)

    2010-07-01

    ... a teach-out at another school or by transferring academic credits or hours earned at the closed... the school's closing with any third party, such as the holder of a performance bond or a tuition... promptly suspends any efforts to collect from the borrower on any affected loan. The Secretary may continue...

  6. 214 VARIATIONS IN THE FIBRE LENGTH OF RUBBER WOOD ...

    African Journals Online (AJOL)

    2010-09-02

    Sep 2, 2010 ... Makurdi Benue State. Correspondence: greenwatchinitiative@yahoo.com. ABSTRACT. Variations in the fibre length of rubber wood were investigated to determine suitability of the wood fibres for some industrial utilization. The fibre lengths were sampled according to main effects such as plantations effects ...

  7. 28 CFR 2.214 - Probable cause hearing and determination.

    Science.gov (United States)

    2010-07-01

    ... adverse witnesses (i.e., witnesses who have given information upon which revocation may be based) at a... confrontation. Whenever a probable cause hearing is postponed to secure the appearance of adverse witnesses (or...

  8. Die skrywer. Esta Steyn. Kaapstad: Tafelberg, 2012. 214 pp. ISBN ...

    African Journals Online (AJOL)

    Twee belangrike verskille tussen hierdie roman en byvoorbeeld verskeie hedendaagse ontspan- ningsromans in Duits, is die Christelike ele- mente en die humor. Die straatslim Anabella wat twee plaaswerkers aansê om nie die Here se naam te misbruik nie, toon kenmerke van die heldin in 'n Afrikaanse liefdesverhaal.

  9. 18 CFR 157.214 - Increase in storage capacity.

    Science.gov (United States)

    2010-04-01

    ... measuring point where the total volume injected or withdrawn is measured. (4) Results of any tracer program... isopachous contour maps showing the location of the wells, the location and extent of the gas bubble in the... bubbles are known to exist. This map need not be filed if there is no material change from the map...

  10. 48 CFR 52.214-5 - Submission of Bids.

    Science.gov (United States)

    2010-10-01

    ... authorized by the solicitation. (e) Bids submitted by electronic commerce shall be considered only if the electronic commerce method was specifically stipulated or permitted by the solicitation. (End of provision) ... submitted by electronic means) (1) addressed to the office specified in the solicitation, and (2) showing...

  11. 38 CFR 21.214 - Furnishing supplies for special programs.

    Science.gov (United States)

    2010-07-01

    ... merchandise or goods, expendable items required for day-to-day operations, and items which are consumed on the...) Stocking a farm for animal husbandry operations. (Authority: 38 U.S.C. 3104(a)(12)) ...

  12. Dicty_cDB: CHA214 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EST296610 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD1C15,...EST301524 tomato root during/after fruit set, Cornell University Lycopersicon esculentum cDNA clone cLEX2H3, mRNA

  13. Dicty_cDB: CHN214 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LGHCKSFIVGKFNQLVDP*iftnhlyy*hvgmkkmaylpnfkr*tlsqtkt fgqmkqnl*npkvkspltciahqclilislliiqltlkniqlisyqivqyyqvedi...--- ---GCKFTTLGHCKSFIVGKFNQLVDP*iftnhlyy*hvgmkkmaylpnfkr*tlsqtkt fgqmkqnl*npkvkspltciahqclilislliiqltlkniqli

  14. Dicty_cDB: AFI214 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ahrpppkcslrcppkhecrinhfgeeccvks rndcltcedlncerkglhcamktvpiikkivxksssmlfhypll Translated Amino Acid sequence ...ppkcslrcppkhecrinhfgeeccvks rndcltcedlncerkglhcamktvpiikkivxksssmlfhypll Frame B: sn*kknnn*ls*k*knnkgccf*kil

  15. 50 CFR 226.214 - Critical habitat for Gulf sturgeon.

    Science.gov (United States)

    2010-10-01

    ... in Louisiana and Walthall, Hancock, Pearl River, Marion, Lawrence, Simpson, Copiah, Hinds, Rankin...: Pascagoula River System in Forrest, Perry, Greene, George, Jackson, Clarke, Jones, and Wayne Counties... confluence with the Chickasawhay River, George County, Mississippi is included. The main stem of the...

  16. 48 CFR 633.214-70 - Alternative dispute resolution.

    Science.gov (United States)

    2010-10-01

    ... this claim for ADR. In every dispute, the first step toward resolution shall be unassisted negotiations... presentations, settlement negotiations are conducted. The neutral advisor may assist the parties in negotiating... process in which a neutral and impartial third party assists the Government and the contractor in conflict...

  17. Dicty_cDB: SHK214 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available v*slvlwmvqmlkspkklvkriclslvyvqvklklxvkk*qtkkstl thvfkrysliln*vhlvhqmfsdqswtllifsdfylsiqdfplyldsqasvdelwkdqsa...SL*yqstnfnrwvpk pxvxvt*nsl*mvv*slvlwmvqmlkspkklvkriclslvyvqvklklxvkk*qtkkstl thvfkrysliln*vhlvhqmfsdqswtllifsdf

  18. Dicty_cDB: VFO214 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DQLSDDPIIHSHLTELYSNLLEQNLCRIIEPFSRVEISHIAKLIDLPVDVVERKLSLMIL DKKYNGILDQGTGTLIVFEEQKEDKLFNCSLETIGALSRVVIY...DQLSDDPIIHSHLTELYSNLLEQNLCRIIEPFSRVEISHIAKLIDLPVDVVERKLSLMIL DKKYNGILDQGTGTLIVFEEQKEDKLFNCSLETIGALSRVVIY

  19. 30_210 - 214_Tanko_Effect of Rutin

    African Journals Online (AJOL)

    pc

    2017-06-01

    Jun 1, 2017 ... characterized by hyperglycemia due to an absolute relative insulin ... As regards to the reference drug 2mg/kg glibenclam. (p<0.05) ... Diabetic-induced le to excess mobilization to under utilization of. 2003). Diabetes also fe expectancy, significant ed quality of life. In 2005 eople died from diabetes s (WHO ...

  20. All projects related to | Page 214 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-04-01

    Project. Development luminaries like Jeffrey Sachs and Muhammad Yunus espouse the importance of broadband networks for promoting development. But where's the evidence to support the theory? Start Date: April 1, 2012. End Date: September 27, 2013. Topic: MEXICO, INFORMATION TECHNOLOGY, NETWORKS, ...

  1. Dicty_cDB: SLG214 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available viavvllevivevlleeiavvlleaiaavlhhlvaivevlqeviavvlleaiavvllevi avvlleaivevlqvvtvevlleeiaavlhhlvaileviaavlleviaavlleaivevlqv...leviaavlleaivevlqv vtvevlleeivevtvvphlqeviavg*qvvllvvivevlleeivalqpeeivvllvv--- Frame B: **rwcywr**w

  2. Dicty_cDB: VSC214 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available musculus chitobiase, di-N-acet... 81 1e-14 (Q8R242) RecName: Full=Di-N-acetylchitobiase; EC=3.2.1......rerio chitobiase, di-N-acety... 79 4e-14 BC095064_1( BC095064 |pid:none) Danio rerio chitobiase, di-N-acety...BC072723_1( BC072723 |pid:none) Danio rerio chitobiase, di-N-acety... 78 1e-13 AK314640_1( AK314640 |pid:none)

  3. Human factors assessment of SC-214 message set

    Science.gov (United States)

    2010-08-18

    This is a presentation that was given at the Communication Navigation and Surveillance (CNS) Task Force Meeting. It discusses a review of current literature, analysis of Pilot Deviations and ASRS reports involving data link communications, and discus...

  4. Dicty_cDB: SFL214 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available inq*syiy* ifqrwlth*rv*lwnykiapthyynqlllqpifkqhsfilmspf*LVLSHVVQVCKEKDL LKVNVSIFKEQGEALNKYASRGVKVLVVG...inq*syiy* ifqrwlth*rv*lwnykiapthyynqlllqpifkqhsfilmspf*LVLSHVVQVCKEKDL LKVNVSIFKEQGEALNKYASRGVKVLVVG

  5. Dicty_cDB: SSB214 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1.18 Translated Amino Acid sequence knisyl*flifiyifiyyiytpfftyllnyfiikkiikikyniif**FKKLKKKKTQKKK KNQTFVNYCK...yifiyyiytpfftyllnyfiikkiikikyniif**FKKLKKKKTQKKK KNQTFVNYCKKKKKQKQKEKTMDLNKEW--- Frame C: kiyhiysf*ylfiylfii

  6. Dicty_cDB: VFJ214 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available stnvlvqeslprkstselntsnhqtpwllt*nvskkt kklslkprkpvngsmldvtqlhqrtvslstqetlnslksnqsntnfyykli*ksgg*ygs i...stnvlvqeslprkstselntsnhqtpwllt*nvs kktkklslkprkpvngsmldvtqlhqrtvslstqetlnslksnqsntnfyykli*ksgg* *gsi

  7. 27 CFR 9.214 - Haw River Valley.

    Science.gov (United States)

    2010-04-01

    ... the unnamed road known locally as Baynes Road 2 miles to its intersection with North Carolina State Highway 119 at Baynes in Caswell County; then (16) Proceed generally south-southeast along North Carolina...

  8. Publications | Page 214 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, de la mise en commun des connaissances et de la formation. Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons à ...

  9. 214 VARIATIONS IN THE FIBRE LENGTH OF RUBBER WOOD ...

    African Journals Online (AJOL)

    2010-09-02

    . Nigerian grown rubber in south eastern state of Abia, so as to relate the wood quality with a range of industrial usefulness of the species and the possibility of controlling the wood fibre features silviculturally and genetically.

  10. Dicty_cDB: CHE214 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mosome 4 clone RP11-632F23 map 4, WORKING DRAFT SEQUENCE, 27 unordered pieces. 32 0.020 7 AY533599 |AY533599.1 Diabr...2 0.020 3 AY533603 |AY533603.1 Diabrotica virgifera virgifera 12S ribosomal RNA gene, partial sequence; mito...chondrial. 32 0.021 3 AY533602 |AY533602.1 Diabrotica virgifera zeae 12S ribosomal RNA gene, partial sequenc

  11. 13 CFR 400.214 - Participations in guaranteed loans.

    Science.gov (United States)

    2010-01-01

    ... loans; (3) Steel company suppliers or customers, who are interested in participating as a means of commencing or solidifying the supplier or customer relationship with the borrower; or (4) Any other entity...

  12. Cavitation erosion resistance of 13/4 and 21-4-N steels

    Indian Academy of Sciences (India)

    operating efficiency of the turbine. Considering the cost of electrical energy, even a relatively small change in the operating efficiency can be very expensive. Cavitation causes surface pene- tration damage of up to 10 mm per year to critical components such as impellors, turbine blades, and casings (Simoneau 1984).

  13. 42 CFR 421.214 - Advance payments to suppliers furnishing items or services under Part B.

    Science.gov (United States)

    2010-10-01

    ... maintain a financial system of data in accordance with the Statement of Federal Financial Accounting... 42 Public Health 3 2010-10-01 2010-10-01 false Advance payments to suppliers furnishing items or... Advance payments to suppliers furnishing items or services under Part B. (a) Scope and applicability. This...

  14. 40 CFR 421.214 - Standards of performance for new sources.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Standards of performance for new... for any 1 day Maximum for monthly average mg/kg (pounds per million pounds) of molybdenum sulfide... range of 7.5 to 10.0 at all times. (b) Roaster SO2 scrubber. NSPS for the Primary Molybdenum and Rhenium...

  15. 47 CFR 63.21 - Conditions applicable to all international Section 214 authorizations.

    Science.gov (United States)

    2010-10-01

    ... continuing accuracy of the certifications made in its application. Whenever the substance of any such... of this chapter. Except as specified in § 20.15(d) of this chapter with respect to commercial mobile... carrier in the course of its normal business dealings, unless the competing U.S. carrier provides its...

  16. African Crop Science Journal, Vol. 13. No. 3, pp. 209-214, 2005 ...

    African Journals Online (AJOL)

    was observed at all concentrations of copper oxycloride. However, they were not significantly different from each other. The pathogen produced highest number ofpycnidia in medium amended with copper oxycloride, showing its ineffectiveness in reducing inoculum of the disease. These findings suggest that copper.

  17. Page 1 214 . . . . .V. SiVARAMAKRISHNAN v – “ . . a. 0-002387 X* , 0 ...

    Indian Academy of Sciences (India)

    for number of wavelengths A 5780 to A 2848 A. The following dispersion formula for magneto-optic rotation which fits the experimental data to 4% has been proposed using the same absorption frequencies that are respon- sible for refractive dispersion, e 1 ſ 0-001915 A2 {}• 004664 A3 where V is in radians and Å in microns ...

  18. 48 CFR 52.214-26 - Audit and Records-Sealed Bidding.

    Science.gov (United States)

    2010-10-01

    ...: Audit and Records—Sealed Bidding (OCT 2010) (a) As used in this clause, records includes books... modification; or (4) Performance of the modification. (c) Comptroller General. In the case of pricing any... claims arising under or relating to the performance of this contract shall be made available until...

  19. 8 CFR 214.13 - SEVIS fee for certain F, J, and M nonimmigrants.

    Science.gov (United States)

    2010-01-01

    ... Student and Exchange Visitor Program (SEVP) in advance of obtaining nonimmigrant status as an F or M... reclassification by the Student and Exchange Visitor Program during that nonimmigrant's course of study. (5) Re... Student and Exchange Visitor Program). (2) For purposes of reinstatement to valid J program status...

  20. 23 CFR 450.214 - Development and content of the long-range statewide transportation plan.

    Science.gov (United States)

    2010-04-01

    ...., transportation, safety, economic development, social and environmental effects, or energy) that were relevant to... providers of transportation, representatives of users of public transportation, representatives of users of... freight transportation services, and other interested parties with a reasonable opportunity to comment on...

  1. Archaeological Investigations at Site 45-DO-214, Chief Joseph Dam Project, Washington.

    Science.gov (United States)

    1984-01-01

    Arti fact N CoL S N GoL N CotL N coo N Lithic Formed Objects Projectile point 34 44.7 39 27.8 34 30.1 13 18.3 120 Blface 32 42.1 71 50.7 54 47.9 23 32.4...and R.M. Storm 1970 A Key tothe Nicrotlnae of the Pacific Northwest. Corval IIs, Oregon State University Book Stores. Mills, J.E., and C. Osborne 1952...western reptiles and amphibians. Houghton Mifflin, Boston. Stewart, H. 1977 Indian fishing. Early methods on the Northwest Coast. University of

  2. Tank 214-AW-105, grab samples, analytical results for the finalreport

    Energy Technology Data Exchange (ETDEWEB)

    Esch, R.A.

    1997-02-20

    This document is the final report for tank 241-AW-105 grab samples. Twenty grabs samples were collected from risers 10A and 15A on August 20 and 21, 1996, of which eight were designated for the K Basin sludge compatibility and mixing studies. This document presents the analytical results for the remaining twelve samples. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DO). The results for the previous sampling of this tank were reported in WHC-SD-WM-DP-149, Rev. 0, 60-Day Waste Compatibility Safety Issue and Final Results for Tank 241-A W-105, Grab Samples 5A W-95-1, 5A W-95-2 and 5A W-95-3. Three supernate samples exceeded the TOC notification limit (30,000 microg C/g dry weight). Appropriate notifications were made. No immediate notifications were required for any other analyte. The TSAP requested analyses for polychlorinated biphenyls (PCB) for all liquids and centrifuged solid subsamples. The PCB analysis of the liquid samples has been delayed and will be presented in a revision to this document.

  3. Workshop on Survey Methods in Education Research: Facilitator's Guide and Resources. REL 2017-214

    Science.gov (United States)

    Walston, Jill; Redford, Jeremy; Bhatt, Monica P.

    2017-01-01

    This Workshop on Survey Methods in Education Research tool consists of a facilitator guide and workshop handouts. The toolkit is intended for use by state or district education leaders and others who want to conduct training on developing and administering surveys. The facilitator guide provides materials related to various phases of the survey…

  4. Tank 241-AX-103, cores 212 and 214 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Steen, F.H.

    1998-02-05

    This document is the analytical laboratory report for tank 241-AX-103 push mode core segments collected between July 30, 1997 and August 11, 1997. The segments were subsampled and analyzed in accordance with the Tank 241-AX-103 Push Mode Core Sampling and Analysis Plan (TSAP) (Comer, 1997), the Safety Screening Data Quality Objective (DQO) (Dukelow, et al., 1995) and the Data Quality Objective to Support Resolution of the Organic Complexant Safety Issue (Organic DQO) (Turner, et al., 1995). The analytical results are included in the data summary table (Table 1). None of the samples submitted for Differential Scanning Calorimetry (DSC), Total Alpha Activity (AT), plutonium 239 (Pu239), and Total Organic Carbon (TOC) exceeded notification limits as stated in the TSAP (Conner, 1997). The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group in accordance with the Memorandum of Understanding (Schreiber, 1997) and not considered in this report.

  5. 9 CFR 381.214 - Movement of poultry or other article detained; removal of official marks.

    Science.gov (United States)

    2010-01-01

    ... INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE AGENCY ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY... may be moved from the place at which it is located when so detained, for refrigeration or freezing, or...

  6. Electrical Experiments. VT-214-11. Part One. Grade 11. Revised.

    Science.gov (United States)

    Connecticut State Dept. of Education, Hartford. Div. of Vocational Education.

    Designed for eleventh-grade students, this activity book contains nineteen electrical experiments. Experiments focus on topics such as commercial application of electromagnets, electromagnetic instruments, and commercial generators. Each experiment follows a typical format that includes the following parts: purpose, material used, procedure,…

  7. 77 FR 214 - Revisions to the California State Implementation Plan, San Joaquin Valley Unified Air Pollution...

    Science.gov (United States)

    2012-01-04

    ... roots to biomass rather than landfill or compost. Nonetheless, at this time, we do not have sufficient... environmental effects with practical, appropriate, and legally permissible methods under Executive Order 12898... may take effect, the agency promulgating the rule must submit a rule report, which includes a copy of...

  8. Brief 72 Nuclear Engineering Enrollments and Degrees Survey, 2013 Data (2-14)

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2014-02-15

    The survey includes degrees granted between September 1, 2012 and August 31, 2013. Enrollment information refers to the fall term 2013. The enrollments and degrees data include students majoring in nuclear engineering or in an option program equivalent to a major. Thirty-two academic programs reported having nuclear engineering programs during 2013, and data was received from all thirty-two programs. The data for two nuclear engineering programs include enrollments and degrees in health physics options that are also reported in the health physics enrollments and degrees data.

  9. Page 1 Pramana, Vol. 23, No. 2, August 1984, pp. 205–214, (C ...

    Indian Academy of Sciences (India)

    Abstract. A review of some recent papers on gauge theories of weak and strong gravity is presented. For weak gravity, SL(2, C) gauge theory along with tetrad formulation is described which yields massless spin-2 gauge fields (quanta gravitons). Next a unified SL(2n,C) model is discussed along with Higgs fields. Its internal ...

  10. 49 CFR Appendix A to Part 214 - Schedule of Civil Penalties 1

    Science.gov (United States)

    2010-10-01

    ...,500 5,000 (2) Failure to remove from service 2,500 5,000 (3) Failure to protect from deterioration 2,500 5,000 (4) Failure to inspect and remove 5,000 10,000 (5) Failure to train 5,000 10,000 (6) Failure... Fall protection: (i) Failure to provide fall protection $5,000 $10,000 (ii) Failure to use fall...

  11. 33 CFR 110.214 - Los Angeles and Long Beach harbors, California.

    Science.gov (United States)

    2010-07-01

    ... Small Craft Note e. P Long Beach Harbor ......do Note f. Q ......do ......do Notes c, g. Notes: a.... (ii) No vessel while carrying, loading, or unloading division 1.1 or 1.2 materials as defined in 49... (explosive) materials as defined in 49 CFR 173.50, or Cargoes of Particular Hazard (COPH) as defined in 33...

  12. Electrical Experiments. VT-214-10-1. Part One. Grade 10. Experiments 1-63 Revised.

    Science.gov (United States)

    Connecticut State Dept. of Education, Hartford. Div. of Vocational Education.

    Designed for tenth-grade students, this activity book contains sixty-three electrical experiments. Experiments focus on topics such as the direction of flow of electricity in an electric circuit, comparison of heating effect using different amounts of current, comparison of heating effects of electric current in conductors of different sizes, and…

  13. 8 CFR 214.3 - Approval of schools for enrollment of F and M nonimmigrants.

    Science.gov (United States)

    2010-01-01

    ... students under section 101(a)(15)(F)(i) of the Act: (A) A college or university, i.e., an institution of... computer problems on the part of SEVIS cause an error in the student's record, the DSO may request the... transcripts or other records of courses taken, proof of financial responsibility for the student, and other...

  14. 47 CFR 63.09 - Definitions applicable to international Section 214 authorizations.

    Science.gov (United States)

    2010-10-01

    ... of the ownership percentages for each link in the vertical ownership chain and application of the... any link in the chain that is equal to or exceeds 50 percent or represents actual control, it shall be...

  15. Energy analysis handbook. CAC document 214. [Combining process analysis with input-output analysis

    Energy Technology Data Exchange (ETDEWEB)

    Bullard, C. W.; Penner, P. S.; Pilati, D. A.

    1976-10-01

    Methods are presented for calculating the energy required, directly and indirectly, to produce all types of goods and services. Procedures for combining process analysis with input-output analysis are described. This enables the analyst to focus data acquisition cost-effectively, and to achieve a specified degree of accuracy in the results. The report presents sample calculations and provides the tables and charts needed to perform most energy cost calculations, including the cost of systems for producing or conserving energy.

  16. 214 Cross Reactivity Between Cypress Pollen and Plant Food in Queretaro, Mexico

    OpenAIRE

    Medina-Hernández, Alejandra; Sosa Ferreyra, Carlos Fancisco; Lelo de Larrea, Guadalupe Zaldívar

    2012-01-01

    Background Food allergy prevalence is growing continuously. Reasons are unknown. It is suggested that environmental factors have a greater impact than genetic. The hay may be responsible for developing food allergy to plants. The geographical and climatological condition of Querétaro city, and having a large industrial corridor are risk factors for development allergic problems. In Mexico there are no prevalence studies on food allergy and therefore the most common food allergens. The objecti...

  17. Page 1 214 - W. D. PURI REFERENCES Busck, A. and Heinrich, C ...

    Indian Academy of Sciences (India)

    7. Head capsule, mouth parts (Lateral view). PLATE VIV. FIG. 1. Head and mouth parts: A, Dorsal; B, Ventral; C, Anterior tentorial pits, lacinia and pilifers; D, Labial palpus; E, Maxillary palpus; F, Pilifer. -. FIG. 2. Male antenna. FIG. 3. Female antenna. FIGS. 4, 5, 6 & 7. Parts of the male antenna. FIGs. 8, 9, 10 & 11. Parts of the ...

  18. Page 1 214 G. M. Nabar and C. W. Padmanabhan apparatus used is ...

    Indian Academy of Sciences (India)

    Method A: Oxidation of cellulose by a mixture of nitrogen dioxide and oxygen under pressure.-The various parts of the apparatus are dried in a current of hot air and assembled as shown in Fig. A. Cotton yarn in the form of a hank is suspended from the hook. The drying tower contains, fused calcium nitrate as the desiccant.

  19. 23 CFR 972.214 - Federal lands congestion management system (CMS).

    Science.gov (United States)

    2010-04-01

    ... means the level at which transportation system performance is no longer acceptable due to traffic... for congestion (e.g., level of service); (ii) Identify the causes of congestion; (iii) Include... combinations of strategies for each area: (A) Transportation demand management measures; (B) Traffic...

  20. 23 CFR 970.214 - Federal lands congestion management system (CMS).

    Science.gov (United States)

    2010-04-01

    ... modes. (2) For portions of the NPS transportation system within transportation management areas (TMAs... 23 Highways 1 2010-04-01 2010-04-01 false Federal lands congestion management system (CMS). 970... LANDS HIGHWAYS NATIONAL PARK SERVICE MANAGEMENT SYSTEMS National Park Service Management Systems § 970...

  1. 8 CFR 214.14 - Alien victims of certain qualifying criminal activity.

    Science.gov (United States)

    2010-01-01

    ... the United States: Rape; torture; trafficking; incest; domestic violence; sexual assault; abusive... 2000 of the Victims of Trafficking and Violence Protection Act of 2000, div. B, Violence Against Women Act of 2000, tit. V, Pub. L. 106-386, 114 Stat. 1464, (2000), amended by Violence Against Women and...

  2. Olfactory bulbectomy reduces cerebral glucose utilization: 2-[14C]deoxyglucose autoradiographic study.

    Science.gov (United States)

    Skelin, Ivan; Sato, Hiroki; Diksic, Mirko

    2008-07-30

    The olfactory bulbectomized (OBX) rat is an extensively investigated animal model of depression. In the present study the effects of olfactory bulbectomy in drug-naive adult male Sprague-Dawley rats (200-240 g) on global (gCGU) and regional cerebral glucose (rCGU) utilization was evaluated. Two weeks following surgery, the autoradiographic measurement of CGU using [14C]-2-deoxyglucose was employed. The levels of CGU in the OBX and sham-operated rats were compared in 40 brain regions. Statistical methods indicate significantly lower levels of global (overall) CGU in the OBX group than in the sham group. Discriminant analysis was done on the z-scores to remove animal to animal variability. The following thirteen regions were identified by the stepwise discriminant analysis of the z-scores as significantly contributing to the differences between the sham and OBX: amygdala, cingulate cortex, caudate putamen at the level of globus pallidus, caudate putamen-lateral part, dorsal subiculum, dorsal thalamus, hypothalamus, median raphe, somatosensory cortex, substantia nigra, ventral hippocampus, ventral tegmental area and the ventral thalamus. The pattern of changes in the rCGU following OBX does not completely correlate with the pattern of connectivity of the olfactory bulbs, however, many regions with direct connection to the olfactory bulbs (e.g., amygdala, hypothalamus, ventral hippocampus, and ventral tegmental area) were found to be important for differentiation. No left to right asymmetries in the rCGU were found. The data suggest that there are very important regional differences in glucose utilization between the OBX and sham operated rats, which points to the need to study antidepressants in an animal model of depression rather than in normal animals.

  3. 40 CFR 63.214 - What are the requirements I must comply with?

    Science.gov (United States)

    2010-07-01

    ... National Emission Standards for Hazardous Air Pollutants for Polyvinyl Chloride and Copolymers Production... that manufacture polymerized vinyl chloride, except as specified in paragraphs (a)(1) and (2) of this...

  4. 76 FR 19714 - Airworthiness Directives; Airbus Model A320-214, -232, and -233 Airplanes

    Science.gov (United States)

    2011-04-08

    ..., during landing phase (nose landing gear extended), the roll control would only be provided by the left... system loss, during landing phase (nose landing gear extended), the roll control would only be provided... emergency electrical configuration combined with a Green and Yellow hydraulic system loss, during landing...

  5. 76 FR 50113 - Airworthiness Directives; Airbus Model A320-214, -232, and -233 Airplanes

    Science.gov (United States)

    2011-08-12

    ... and Yellow hydraulic system loss, during landing phase (nose landing gear extended), the roll control... a Green and Yellow hydraulic system loss, during landing phase (nose landing gear extended), the..., during landing phase (nose landing gear extended), the roll control would only be provided by the left...

  6. African Crop Science Journal, Vol. 13. No. 3, pp. 209-214, 2005 ...

    African Journals Online (AJOL)

    10, 25,50, 100 ppm de chacun, et les extraits liquide de feuille (10% w/v) de quatre plantes indigènes, sauge de broussaille (Lippia ... L'extrait de liquide de feuille de W. ugandensis était le plus effectif et avait complètement inhibé la croissance de mycélien ... agitated thoroughly and 20 ml of thc mixture dispenscdinto cach ...

  7. Adsorption geometry of Cu( 1 1 0 )-(12 × 2)-14Xe

    Science.gov (United States)

    Caragiu, M.; Seyller, Th.; Diehl, R. D.

    2003-08-01

    Low-energy electron diffraction was used to study the adsorption geometry of Xe on Cu(1 1 0). At low temperatures, a higher-order commensurate (12 × 2) structure can be formed that consists of rows of Xe atoms aligned along the direction of the rows on Cu(1 1 0), and having a spacing between the rows equal to the Cu row spacing. A dynamical LEED study of this structure at 20 K indicates that the rows of Xe atoms are localized on top of the Cu substrate rows. The lateral registry of the Xe rows along the Cu rows includes 2 Xe atoms per (12 × 2) unit cell in atop positions above Cu atoms, with the others in lower-symmetry sites. The average Xe-Cu interlayer spacing is 3.3 ± 0.1 Å and there is a small degree (0.1 Å) of vertical rumple in both the overlayer and the top substrate layer. The substrate surface with adsorbed Xe has essentially the same relaxation as the clean surface. The analysis of the adatom vibrations in this structure indicates that the isotropically-averaged rms vibration amplitude is 0.2 Å for Xe, while that of the top-layer Cu atoms is 0.04 Å.

  8. 8 CFR 214.11 - Alien victims of severe forms of trafficking in persons.

    Science.gov (United States)

    2010-01-01

    ... result in serious harm to or physical restraint against any person; or the abuse or threatened abuse of the legal process. Commercial sex act means any sex act on account of which anything of value is given...; or the abuse or threatened abuse of legal process. Accordingly, involuntary servitude includes “a...

  9. 8 CFR 214.15 - Certain spouses and children of lawful permanent residents.

    Science.gov (United States)

    2010-01-01

    ... Port-of-Entry and has a current priority date but does not have a pending immigrant visa abroad or... approval of: (1) A relative visa petition; (2) The availability of an immigrant visa number; or (3) Lawful permanent resident (LPR) status through adjustment of status or an immigrant visa. (b) Aliens already in the...

  10. High-Temperature Intergranular Crack Growth in Martensitic 2-1/4 Cr1Mo Steel,

    Science.gov (United States)

    1987-01-01

    jump-distance. At high stress intensities, reater than 48-55 HPam ,-the mo.e of fracture changes to interranular microvoid coalescence (IGMVC), and is...size dependent. It is suggested that as the applied strss intensity rises to a level 48-55 HPam " voids nucleated on the smal:. sulphides adjacent to

  11. High-Temperature Intergranular Crack Growth in Martensitic 2-1/4 Cr-1Mo Steel,

    Science.gov (United States)

    1987-01-01

    between 48 and 55 HPam ) . Most importantly from figs 3 and 4. it can be seen that, as the final austenitising temperature prior to quenching decreases, the...cavitation (around carbides) occurred at all strass intensities greater than K - 40 HPam , and crack growth rates greater than da/dt - 3.10 -. ms , whereas...3 -1 . For the 1300-900 WQ condition, fine cavitation was obsarved for stress intensities between K - 42-55 HPam % and crack growth rates -5 -4 -1

  12. 8 CFR 214.2 - Special requirements for admission, extension, and maintenance of status.

    Science.gov (United States)

    2010-01-01

    ... in the same household as the principal alien who is an officer or employee assigned to a diplomatic... Diplomatic Relations or other international agreements does not apply to these dependents with respect to..., or essential skills; and (C) The work is consistent with the terms and conditions of the activity...

  13. Electrical Experiments. VT-214-12-3. Part III. Basic Electronics.

    Science.gov (United States)

    Connecticut State Dept. of Education, Hartford. Div. of Vocational Education.

    Designed for high school electronics students, this third document in a series of six electrical learning activity packages focuses on basic electronics. An introductory section gives the objective for the activities, an introduction, and an outline of the content. The remainder of the activity book is comprised of information sheets and job…

  14. 40 CFR 98.214 - Monitoring and QA/QC requirements.

    Science.gov (United States)

    2010-07-01

    ... based on sampling and chemical analysis using a suitable method such as using an x-ray fluorescence... plant instruments used for accounting purposes including purchase records or direct measurement, such as... subpart) must be determined annually from monthly measurements using the same plant instruments used for...

  15. 8 CFR 214.7 - Habitual residence in the territories and possessions of the United States and consequences thereof.

    Science.gov (United States)

    2010-01-01

    ...) rely for financial support. (7) Self-supporting means: (i) Having a lawful occupation of a current and... not been self-supporting for a period exceeding 60 consecutive days for reasons other than a lawful... has become a dependent of another habitual resident or becomes self-supporting; or (ii) The dependent...

  16. Precision and within- and between-day variation of bioimpedance parameters in children aged 2-14 years

    DEFF Research Database (Denmark)

    Andersen, Trine B; Jødal, Lars; Arveschoug, Anne

    2011-01-01

    BACKGROUND & AIMS: Bioimpedance spectroscopy (BIS) offers the possibility to perform rapid estimates of fluid distribution and body composition. Few studies, however, have addressed the precision and biological variation in a pediatric population. Our objectives were to evaluate precision, variat...

  17. 75 FR 66828 - Eleventh Meeting: RTCA Special Committee 214: Working Group 78: Standards for Air Traffic Data...

    Science.gov (United States)

    2010-10-29

    ... Martin Information Systems and Global Solutions, 9231 Corporate Blvd., Rockville, Maryland 20850. Host... the ATMAC recs (meeting October 28th). Benefits Oceanic/Continental Integration Approach. Now TORS(OCL.... Review Dates and Locations 2011 Plenary and SG Meetings. Any Other Business. Adjourn. Day 5, Friday...

  18. 8 CFR 214.6 - Citizens of Canada or Mexico seeking temporary entry under NAFTA to engage in business activities...

    Science.gov (United States)

    2010-01-01

    ... Canada or Mexico who is engaged in the trade of goods, the provision of services, or the conduct of... —Agriculturist (including Agronomist)—Baccalaureate or Licenciatura Degree. —Animal Breeder—Baccalaureate or Licenciatura Degree. —Animal Scientist—Baccalaureate or Licenciatura Degree. —Apiculturist—Baccalaureate or...

  19. Observation of Hydrological Processes Using Remote Sensing. Chapter 2.14; Volume 2: The Science of Hydrology

    Science.gov (United States)

    Wilder, Peter (Editor); Su, Z.; Robeling, R. A.; Schulz, J.; Holleman, I.; Levizzani, V.; Timmermans, W. J.; Rott, H.; Mognard-Campbell, N.; de Jeu, R.; hide

    2011-01-01

    Improving water management can make a significant contribution to achieving most of the Millennium Development Goals established by the UN General Assembly in 2000, especially those related to poverty, hunger, and major diseases. The World Summit on Sustainable Development (WSSD) in 2002 recognized this need. Water and sanitation in particular received great attention from the Summit. The Johannesburg Plan of Implementation recommended to improve water resources management and scientific understanding of the water cycle through joint cooperation and research. For this purpose, it is recommended to promote knowledge sharing, provide capacity building, and facilitate the transfer of technology including remote-sensing (RS) and satellite technologies, especially to developing countries and countries with economies in transition, and to support these countries in their efforts to monitor and assess the quantity and quality of water resources, for example, by establishing and/or further developing national monitoring networks and water resources databases and by developing relevant national indicators. The Johannesburg Plan also adopted integrated water resources management as the overarching concept in addressing and solving water-related issues. As a result of the commitments made in the Johannesburg Plan of Implementation, several global and regional initiatives have emerged. Current international initiatives such as the Global Monitoring for Environment and Security (GMES) program of the European Commission and the European Space Agency (ESA), and the Global Earth Observation System of Systems (GEOSS) 10-Year Implementation Plan, have all identified Earth observation (EO) of the water cycle as the key in helping to solve the world s water problems. The availability of spatial information on water quantity and quality will also enable closure of the water budget at river basin and continental scales to the point where effective water management is essential (e.g., as requested by the European Union s Water Framework Directive (WFD), as well as national policies). Geo-information science and EO are vital in achieving a better understanding of the water cycle and better monitoring, analysis, prediction, and management of the world s water resources. The major components of the water cycle of the Earth system and their possible observations are presented. Such observations are essential to understand the global water cycle and its variability, both spatially and temporally, and can only be achieved consistently by means of EOs. Additionally, such observations are essential to advance our understanding of coupling between the terrestrial, atmospheric, and oceanic branches of the water cycle, and how this coupling may influence climate variability and predictability. Water resources management directly interferes with the natural water cycle in the forms of building dams, reservoirs, water transfer systems, and irrigation systems that divert and redistribute part of the water storages and fluxes on land. The water cycle is mainly driven and coupled to the energy cycle in terms of phase changes of water (changes among liquid, water vapor, and solid phases) and transport of water by winds in addition to gravity and diffusion processes. The water-cycle components can be observed with in situ sensors as well as airborne and satellite sensors in terms of radiative quantities. Processing and conversion of these radiative signals are necessary to retrieve the water-cycle components.

  20. Oahu Photomosaic 2000 (213-214w-0516) - Orthorectification and Mosaicing of Color Aerial Photography Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Habitat maps of the main Hawaiian Islands were created by visual interpretation of aerial photos and hyperspectral imagery using the Habitat Digitizer extension....

  1. Oahu Photomosaic 2000 (213-214e-0516) - Orthorectification and Mosaicing of Color Aerial Photography Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Habitat maps of the main Hawaiian Islands were created by visual interpretation of aerial photos and hyperspectral imagery using the Habitat Digitizer extension....

  2. 9 CFR 205.214 - Litigation as to whether a system is operating in compliance with the Section.

    Science.gov (United States)

    2010-01-01

    ... as to whether a system is operating in compliance with the Section. (a) The requirements for a system... certification, is operating in compliance, thus whether it is a “central filing system” as defined, could be... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Litigation as to whether a system is...

  3. 214 Fractal Structure in Volumetric Contrast Enhancement of Malignant Gliomas Correlates With Oxidative Metabolic Pathway Gene Expression.

    Science.gov (United States)

    Miller, Kai; Berendsen, Sharon; Seute, Tatjana; Yeom, Kristen; Hayden, Melanie Gephart; Grant, Gerald A; Robe, Pierre

    2016-08-01

    Fractal structure is found throughout many processes in nature, and often arises from sets of simple rules. We examined the contrast enhancement pattern in glioblastoma brain tumor MRIs for evidence of fractal structure, which might then be compared with expression of specific gene sets obtained from surgical specimens of each tumor. Volumetric T1 postcontrast imaging was obtained in 39 patients prior to surgical resection of pathology-confirmed glioblastoma lesions. For each tumor, we calculated the fractal dimension (Minkowski Bouligand dimension) using a box-counting (cubic scaling) approach. RNA expression microarray data from resected tissue were explored by gene set enrichment analysis (GSEA). We found robust evidence for fractal structure in the contrast enhancement pattern, with an average fractal dimension of 2.17 ± 0.10, with a visually apparent split at 2.10. GSEA analysis showed a definitive association between this split in fractal dimension and 6 gene sets (of 4080), all 6 of which are linked to mitochondrial respiration/ATP production pathways. There is fractal structure in the volumetric enhancement pattern of glioblastoma tumors, with dimension approximately 2.15. Variation in this fractal dimension, and therefore the complexity of contrast enhancement it reflects, is specifically associated with genetic correlates of a shift to glycolytic metabolism in tumor cells. Drugs that shift glioblastoma to oxidative metabolism have recently been identified as independent therapeutic agents as well as sensitizing agents for irradiation. Therefore, a radiogenomic marker of glucose metabolism, such as this fractal structure in enhancement, might help to guide individualized therapy.

  4. Orthorectification and Mosaicking of Color Aerial Photography for the Main Eight Hawaiian Islands: Oahu (213-214e-0516)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Habitat maps of the main Hawaiian Islands were created by visual interpretation of aerial photos and hyperspectral imagery using the Habitat Digitizer extension....

  5. SU-F-J-214: Dose Reduction by Spatially Optimized Image Quality Via Fluence Modulated Proton CT (FMpCT)

    Energy Technology Data Exchange (ETDEWEB)

    De Angelis, L; Landry, G; Dedes, G; Parodi, K [Ludwig-Maximilians-Universitaet Muenchen (LMU Munich), Garching b. Muenchen (Germany); Hansen, D [Aarhus University Hospital, Aarhus, Jutland (Denmark); Rit, S [University Lyon, Lyon, Auvergne-Rhone-Alpes (France); Belka, C [LMU Munich, Munich (Germany)

    2016-06-15

    Purpose: Proton CT (pCT) is a promising imaging modality for reducing range uncertainty in image-guided proton therapy. Range uncertainties partially originate from X-ray CT number conversion to stopping power ratio (SPR) and are limiting the exploitation of the full potential of proton therapy. In this study we explore the concept of spatially dependent fluence modulated proton CT (FMpCT), for achieving optimal image quality in a clinical region of interest (ROI), while reducing significantly the imaging dose to the patient. Methods: The study was based on simulated ideal pCT using pencil beam (PB) scanning. A set of 250 MeV protons PBs was used to create 360 projections of a cylindrical water phantom and a head and neck cancer patient. The tomographic images were reconstructed using a filtered backprojection (FBP) as well as an iterative algorithm (ITR). Different fluence modulation levels were investigated and their impact on the image was quantified in terms of SPR accuracy as well as noise within and outside selected ROIs, as a function of imaging dose. The unmodulated image served as reference. Results: Both FBP reconstruction and ITR without total variation (TV) yielded image quality in the ROIs similar to the reference images, for modulation down to 0.1 of the full proton fluence. The average dose was reduced by 75% for the water phantom and by 40% for the patient. FMpCT does not improve the noise for ITR with TV and modulation 0.1. Conclusion: This is the first work proposing and investigating FMpCT for producing optimal image quality for treatment planning and image guidance, while simultaneously reducing imaging dose. Future work will address spatial resolution effects and the impact of FMpCT on the quality of proton treatment plans for a prototype pCT scanner capable of list mode data acquisition. Acknowledgement: DFG-MAP DFG - Munich-Centre for Advanced Photonics (MAP)

  6. Page 1 214 D. P. Verna, B. Kumar and H C Verma and by (6), N U(n ...

    Indian Academy of Sciences (India)

    A TCP crystal can be imagined to be a combination of two simple tetragonal crystals having same lattice parameters displaced with respect to one another by (a/2, af2, c/2). The regular site for one subcrystal is the centre of a cell of other subcrystal. The EFG at a regular site in TCP crystal can therefore be obtained by adding ...

  7. 43 CFR 21.4 - Occupancy under permit of privately owned cabins on recreation areas and conservation areas.

    Science.gov (United States)

    2010-10-01

    ... involuntary transfers of cabin site permits, including by sale, devise, inheritance, or otherwise, may be... the land or any special rights or equities, other than the right to remove the improvement at any time... right but afford only a limited license to occupy the land, pending a greater public use. (4) Upon...

  8. 76 FR 58078 - Thirteenth Meeting: RTCA Special Committee 214: Working Group 78: Standards for Air Traffic Data...

    Science.gov (United States)

    2011-09-19

    ... Information Additional information and all the documents to be considered can be found in the Web site http... Standards (MOPS) for Aircraft VDL Mode 2 Physical, Link and Network Layer for release for final review and...

  9. Orthorectification and Mosaicking of Color Aerial Photography for the Main Eight Hawaiian Islands: Oahu (213-214w-0516)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Habitat maps of the main Hawaiian Islands were created by visual interpretation of aerial photos and hyperspectral imagery using the Habitat Digitizer extension....

  10. MTLRP genetic polymorphism (214C>A) was associated with Type 2 diabetes in Caucasian population: a meta-analysis

    Science.gov (United States)

    2014-01-01

    Background Previous studies reported the relation between MTLRP genetic polymorphism and type 2 diabetes, however, the conclusion were conflicting. In the present study, we performed a meta-analysis to reveal this association. Methods Literature retrieval, selection and assessment, data extraction, and meta-analyses were performed according to the RevMan 5.0 guidelines. In the meta-analysis, we utilized random-effect model or fixed-effect model to pool the Odds ratio (OR) according to the test of heterogeneity. Results A total of nine case–control studies included 4460 type 2 diabetes patients and 4114 healthy control subjects were analyzed. We did not found association between the MTLRP polymorphism and type 2 diabetes risk in the overall population (CC vs CA + AA: OR = 1.02; 95% CI: 0.89-1.17, P = 0.77; A vs C: OR = 1.02; 95% CI: 0.84-0.96, P = 0.62). However, in subgroup analyses stratified by ethnicity, we found significant association of MTLRP polymorphism with type 2 diabetes in Caucasians (CC vs CA + AA: OR = 1.27; 95% CI: 1.02-1.57, P = 0.03; A vs C: OR = 0.74, 95% CI: 0.60–0.91, P = 0.005). Conclusion The MTLRP polymorphism was associated with type 2 diabetes in Caucasians. PMID:25095788

  11. Derivation of Soil Screening Guidelines for Gross Alpha/Beta Radioactivity for United States Air Force Deployment Sites

    Science.gov (United States)

    2007-04-19

    the emission of 7 alpha particles and 4 beta particles. Three radionuclides ( francium -223, astatine-215, and polonium-211) are not listed below...no no Uranium-233 159,200 y alpha yes no Thorium-229 7,300 y alpha yes no Radium-225 14.9 d beta no no Actinium-225 10.0 d alpha no no Francium

  12. δ37Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine.

  13. δ³⁷Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine. This thesis presents the first chlorine

  14. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  15. Planck intermediate results: VI. The dynamical structure of PLCKG214.6+37.0, a Planck discovered triple system of galaxy clusters

    DEFF Research Database (Denmark)

    Bartlett, J.G.; Cardoso, J.-F.; Castex, G.

    2013-01-01

    components has allowed us to build a template model to extract the total SZ signal of this system with Planck data. We have partly reconciled the discrepancy between the expected SZ signal derived from X-rays and the observed one, which are now consistent within 1.2σ. We measured the redshift of the three...... components with the iron lines in the X-ray spectrum, and confirm that the three clumps are likely part of the same supercluster structure. The analysis of the dynamical state of the three components, as well as the absence of detectable excess X-ray emission, suggests that we are witnessing the formation...

  16. The Effect of Morphaction on the Kinetics of Indol-3yl-Acetic Acid-2-14C Transport in Zea Mays L. Coleoptile Segments

    DEFF Research Database (Denmark)

    Naqvi, S. M.

    1972-01-01

    This paper elucidates the effects of chloroflurenol (morphactin, IT 3456) treatment on the kinetics of 14C-IAA transport through Zea mays L. (cv. Orla-266) coleoptile segments. Maximum inhibition of transport was achieved when chloroflurenol remained in contact with the tissue segments for at least...... 20 min or more. The treatment, without materially affecting the 14C-IAA-transport polarity, or uptake, significantly reduced the velocity from 20.5 mm h−1 to 8.79 mm h−1 and also the intensity from 919 (ct/min) h−1 to 413 (ct/min) h−1....

  17. Crystal structure of 2-{[1-(4-bromobenzyl-1H-1,2,3-triazol-4-yl]methoxy}naphthalene-1,4-dione

    Directory of Open Access Journals (Sweden)

    Rajamani Raja

    2015-04-01

    Full Text Available In the title compound, C20H14BrN3O3, the benzene ring makes dihedral angles of 71.30 (11 and 68.95 (14° with the naphthalene ring system and the triazole ring, respectively. The latter two ring systems are coplanar, with a dihedral angle of 2.92 (12°. The O atoms deviate from the naphthalene ring system by 0.029 (2 and −0.051 (2 Å. In the crystal, molecules are linked by C—H...O and C—H...N hydrogen bonds, forming ribbons parallel to (10-1. The ribbons are linked via C—H...O and π–π stacking interactions [centroid–centroid distance = 3.4451 (14 Å], forming slabs parallel to the bc plane.

  18. Corrigendum to "New constraints on kinetic isotope effects during CO2(aq) hydration and hydroxylation: Revisiting theoretical and experimental data" [Geochim. Cosmochim. Acta 214 (2017) 246-265

    Science.gov (United States)

    Sade, Ziv; Halevy, Itay

    2018-03-01

    The authors regret an error in the derivation of the link between KFFs and isotopic rate constants of CO2 hydration (Section 2.2). Considering the subset of isotopologues, C16O16O, C18O16O, H216O and H218O, there are four possible forward reactions: C16O16O + H216O → H2C16O16O16O,

  19. Two-dimensional structure of poly[[[μ2-1,4-bis(pyridin-4-ylbutane]bis(μ4-pentanedioatodicopper(II] acetonitrile disolvate

    Directory of Open Access Journals (Sweden)

    Do Nam Lee

    2017-10-01

    Full Text Available In the title compound, {[Cu2(μ4-C5H6O42(μ2-C14H16N2]·2CH3CN}n, the Cu2 dinuclear units are connected by glutartate ligands, forming one-dimensional double chains. These chains, are in turn bridged by 1,4-bis(pyridin-4-ylbutane ligands to form a two-dimensional layer structure parallel to (112. The carboxylate groups of the glutarate ligand bridge two copper(II ions, forming a paddle-wheel-type Cu2(CO24 dinuclear secondary building unit. A crystallographic inversion centre is located midway between two CuII ions, with a Cu...Cu distance of 2.639 (3 Å. The coordination geometry of the unique CuII ion is slightly disorted square pyramidal, formed by four equatorial carboxylate O atoms and an axial pyridyl N atom.

  20. SU-E-T-214: Comparison of Treatment Techniques for Dupuytren’s Contracture and Risk Assessment of Normal Tissue Complications

    Energy Technology Data Exchange (ETDEWEB)

    Arentsen, L; Lopater, Z; Dusenbery, K; Gerbi, B [University of Minnesota, Minneapolis, MN (United States)

    2015-06-15

    Purpose: Duputren’s contracture (DC) is a benign disease characterized by abnormal thickening of the fascial surfaces of the hands or feet causing curling of the surface, functional impairment, weakness, and pain. The purpose of the investigation is to describe the radiation treatment approaches, compare these techniques, and discuss the potential side effects and complications of these techniques. Methods: Early stage DC has been treated with 120 kVp X rays but also with high-energy electrons or photons. High-energy electrons have been the radiation of choice but severe contracture of the hand makes it difficult to produce a plan with acceptable dose uniformity. High-energy photons can overcome this difficulty either by directing a beam onto the palmer or back of the surface of the hand, including bolus to maximize the surface dose. We calculated the dose to the bone for the 120 kVp treatment using published %DD data and mass energy absorption coefficients for bone and muscle. Results: The dose to underlying bone from megavoltage photons and electrons is essentially the same, but dose to the bone for using 120 kVp can be 4–5 times greater due to the photoelectric effect. For the 30 Gy dose deliver using this technique, the dose to the bone could be 84–105 Gy after taking the penetration of the beam into account. After radiotherapy, there is often decreased osteoblastic activity and vascular fibrosis that leads to osteitis, atrophy, and decreased metabolic bone activity. Incidence of fractures occurs routinely above 60 Gy with higher doses potentially leading to higher incidences of bone complications. Conclusion: Radiation therapy for DC using low-energy X rays can deliver a prohibitively high dose to the underlying bone potentially leading to severe bone complications.

  1. Creep-Rupture Properties and Corrosion Behaviour of 21/4 Cr-1 Mo Steel and Hastelloy X-Alloys in Simulated HTGR Environment

    DEFF Research Database (Denmark)

    Lystrup, Aage; Rittenhouse, P. L.; DiStefano, J. R.

    Hastelloy X and 2/sup 1///sub 4/ Cr-1 Mo steel are being considered as structural alloys for components of a High-Temperature Gas-Cooled Reactor (HTGR) system. Among other mechanical properties, the creep behavior of these materials in HTGR primary coolant helium must be established to form part...... of the design criteria. This report describes the simulated HTGR-helium environmental creep facilities, summarizes preliminary creep properties of 2/sup 1///sub 4/ Cr-1 Mo steel and Hastelloy X generated in HTGR helium and compares these with data obtained by testing in air. Some corrosion characteristics...

  2. NCG56/214: Reglamento de R??gimen Interno del Departamento de Bioqu??mica y Biolog??a Molecular I (Facultad de Ciencias)

    OpenAIRE

    Universidad de Granada

    2012-01-01

    Reglamento de R??gimen Interno del Departamento de Bioqu??mica y Biolog??a Molecular I (Facultad de Ciencias). Aprobado en sesi??n extraordinaria del Consejo de Gobierno de la Universidad de Granada celebrada el 20 de febrero de 2012.

  3. Nonlinear reflection of a nanosecond laser pulse from thin aluminum film in the temperature range 2-14 kK

    Science.gov (United States)

    Karabutov, A. A.; Kaptilniy, A. G.; Ksenofontov, D. M.; Makarov, V. A.; Cherepetskaya, E. B.; Podymova, N. B.

    2015-11-01

    This letter aims to experimentally demonstrate the possibility of measuring the temporal dependencies of the surface temperature of an aluminum film confined by a transparent dielectric in the range below and above the critical temperature of aluminum (from 2 kK to 14 kK). Such temperatures are achieved under the action of a powerful linearly-polarized laser pulse of one nanosecond in duration onto the film’s surface. To find the temporal dependencies of the temperature of the aluminum film the nonlinear reflection coefficient of its irradiated surface is measured to determine the radiation of a Q-switched Nd:YAG laser at the fundamental wavelength.

  4. A data base and analysis program for shuttle main engine dynamic pressure measurements. Appendix C: Data base plots for SSME tests 902-214 through 902-314

    Science.gov (United States)

    Coffin, T.

    1986-01-01

    A dynamic pressure data base and data base management system developed to characterize the Space Shuttle Main Engine (SSME) dynamic pressure environment is reported. The data base represents dynamic pressure measurements obtained during single engine hot firing tests of the SSME. Software is provided to permit statistical evaluation of selected measurements under specified operating conditions. An interpolation scheme is included to estimate spectral trends with SSME power level. Flow Dynamic Environments in High Performance Rocket Engines are described.

  5. A homozygous nonsense mutation (c.214C->A) in the biliverdin reductase alpha gene (BLVRA) results in accumulation of biliverdin during episodes of cholestasis

    DEFF Research Database (Denmark)

    Nytofte, Nikolaj S; Serrano, Maria A; Monte, Maria J

    2011-01-01

    Green jaundice is a rare finding usually associated with end-stage liver disease. OBJECTIVE The authors investigated two unrelated Inuit women from different geographical areas in Greenland who had episodes of green jaundice associated with biliary obstruction....

  6. T(6;9)(p22;q34)/DEK-NUP214-rearranged pediatric myeloid leukemia: An international study of 62 patients

    NARCIS (Netherlands)

    J.D. Sandahl (Julie Damgaard); E.A. Coenen (Eva); E. Forestier (Erik); J. Harbott (Jochen); B. Johansson (Bert); G. Kerndrup (Gitte); S. Adachi (Susumu); A. Auvrignon (Anne); H.B. Beverloo (Berna); J.-M. Cayuela (Jean-Michel); L. Chilton (Lucy); M.W.J. Fornerod (Maarten); V. de Haas (Valerie); C.J. Harrison (Christine); H. Inaba (Hiroto); G.J. Kaspers (Gertjan); D. Liang (Der); F. Locatelli (Franco); R. Masetti (Riccardo); C. Perot (Christine); S.C. Raimondi (Susana); K. Reinhardt (Katarina); D. Tomizawa (Daisuke); N. von Neuhoff (Nils); M. Zecca (Marco); C.M. Zwaan (Christian Michel); M.M. van den Heuvel-Eibrink (Marry); H. Hasle (Henrik)

    2014-01-01

    textabstractAcute myeloid leukemia with t(6;9)(p22;q34) is listed as a distinct entity in the 2008 World Health Organization classification, but little is known about the clinical implications of t(6;9)-positive myeloid leukemia in children. This international multicenter study presents the clinical

  7. Zn induced in-gap electronic states in La214 probed by uniform magnetic susceptibility: relevance to the suppression of superconducting T c

    Science.gov (United States)

    Islam, R. S.; Naqib, S. H.

    2018-02-01

    Substitution of isovalent non-magnetic defects, such as Zn, in the CuO2 plane strongly modifies the magnetic properties of strongly electron correlated hole doped cuprate superconductors. The reason for enhanced uniform magnetic susceptibility, χ, in Zn substituted cuprates is debatable. Generally the defect induced magnetic behavior has been analyzed mainly in terms of two somewhat contrasting scenarios. The first one is due to independent localized moments appearing in the vicinity of Zn arising because of the strong electronic/magnetic correlations present in the host compound and the second one is due to transfer of quasiparticle (QP) spectral weight and creation of weakly localized low-energy electronic states associated with each Zn atom in place of an in-plane Cu. If the second scenario is correct, one should expect a direct correspondence between Zn induced suppression of the superconducting transition temperature, T c, and the extent of the enhanced magnetic susceptibility at low temperature. In this case, the low-T enhancement of χ would be due to weakly localized QP states at low energy and these electronic states will be precluded from taking part in Cooper pairing. We explore this second possibility by analyzing the χ(T) data for La2‑x Sr x Cu1‑y Zn y O4 with different hole contents, p (=x), and Zn concentrations (y) in this paper. The results of our analysis support this scenario.

  8. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  9. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita

    2011-01-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  10. Production cross section of At radionuclides from 7Li+natPb and 9Be+natTl reactions

    Science.gov (United States)

    Maiti, Moumita; Lahiri, Susanta

    2011-12-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from 6,7Li- and 9Be-induced reactions on natural lead and thallium targets, respectively. The production of astatine radionuclides were investigated experimentally with two heavy-ion-induced reactions: 9Be + natTl and 7Li + natPb. Formation cross sections of the evaporation residues, 207,208,209,210At, produced in the (HI,xn) channel, were measured by the stacked-foil technique followed by off-line γ spectrometry at low incident energies (<50 MeV). Measured excitation functions were interpreted in terms of a compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach models. Measured cross-section values are lower than the respective theoretical predictions.

  11. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    Energy Technology Data Exchange (ETDEWEB)

    Koziorowski, J

    1998-10-01

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on {sup 211}At and {sup 124}I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[{sup 211}At]astato-2`-deoxyuridine (AUdR) and N-succinimidyl-4-[{sup 211}At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [{sup 124}I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[{sup 124}I]iodo-2`-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for

  12. Effect of pH, Temperature, and Chemicals on the Endoglucanases and β-Glucosidases from the Thermophilic Fungus Myceliophthora heterothallica F.2.1.4. Obtained by Solid-State and Submerged Cultivation

    Directory of Open Access Journals (Sweden)

    Vanessa de Cássia Teixeira da Silva

    2016-01-01

    Full Text Available This work reports endoglucanase and beta-glucosidase production by the thermophilic fungus Myceliophthora heterothallica in solid-state (SSC and submerged (SmC cultivation. Wheat bran and sugarcane bagasse were used for SSC and cardboard for SmC. Highest endoglucanase production in SSC occurred after 192 hours: 1,170.6 ± 0.8 U/g, and in SmC after 168 hours: 2,642 ± 561 U/g. The endoglucanases and beta-glucosidases produced by both cultivation systems showed slight differences concerning their optimal pH and temperature. The number of endoglucanases was also different: six isoforms in SSC and ten in SmC. Endoglucanase activity remained above 50% after incubation between pH 3.0 and 9.0 for 24 h for both cultivation systems. The effect of several chemicals displayed variation between SSC and SmC isoenzymes. Manganese activated the enzymes from SmC but inhibited those from SSC. For β-glucosidases, maximum production on SmC was 244 ± 48 U/g after 168 hours using cardboard as carbon source. In SSC maximum production reached 10.9 ± 0.3 U/g after 240 h with 1 : 1 wheat bran and sugarcane bagasse. Manganese exerted a significant activation on SSC β-glucosidases, and glucose inhibited the enzymes from both cultivation systems. FeCl3 exerted the strongest inhibition for endoglucanases and β-glucosidases.

  13. Gravity, deformation and the Earth's crust, as studied by centrifuged models : H. Ramberg. Acad. Press, London and New York N.Y., 1967, 214 pp., 125 illus., £2.17.6

    NARCIS (Netherlands)

    Bemmelen, R.W. van

    There is a real need in the science of tectonophysics for a book which analyses the role of gravity in tectonic deformations. The concept of “gravity tectonics” has for a long time and with increasing emphasis been advanced by many geologists, However, their approaches to this idea were

  14. Synthesis and evaluation of 17alpha-20E-21-(4-substituted phenyl)-19-norpregna-1,3,5(10),20-tetraene-3,17beta-diols as probes for the estrogen receptor alpha hormone binding domain.

    Science.gov (United States)

    Hanson, Robert N; Lee, Choon Young; Friel, Carolyn J; Dilis, Robert; Hughes, Alun; DeSombre, Eugene R

    2003-07-03

    As part of our program to develop probes for the hormone binding domain of the estrogen receptor alpha (ERalpha), we prepared a series of 4-para-substituted phenylvinyl estradiol derivatives using a combination of solution and solid-phase Pd(0)-catalyzed methods. The compounds 5a-j were evaluated for their binding affinity using the ERalpha hormone binding domain (HDB) isolated from transfected BL21 cells. The results indicated that although the new compounds were somewhat lower in relative binding affinity (RBA at 25 degrees C is 1-60%) than estradiol (100%), most had higher affinity than the unsubstituted parent phenylvinyl estradiol (RBA = 9%). Because the substituents did not generate a structure-activity relationship directly based on physicochemical properties, the series was evaluated using molecular modeling and molecular dynamics to determine key interactions between the ligand, especially the para substituent, and the protein. The results suggest that the observed relative binding affinities are directly related to the calculated binding energies and that amino acids juxtaposed to the para position play a significant but not dominant role in binding. In conclusion, we have identified the 17alpha-E-(4-substituted phenyl)vinyl estradiols as a class of ligands that retain significant affinity for the ERalpha-HBD. In particular, 4-substitution tends to increase receptor affinity compared to the unsubstituted analogue, as exemplified by 5e (4-COCH(3)), which had the highest RBA value (60%) of the series. Palladium(0)-catalyzed coupling reactions on solid support or in solution using suitably substituted iodo arenes and 17alpha-E-tributylstannylvinyl estradiols offer a flexible approach to their preparation. Molecular modeling studies of the receptor suggest that there exists additional ligand accessible regions within the ERalpha-HBD to generate interactions that may enhance receptor affinity or modify efficacy in developing new therapeutic agents. Studies to undertake modification in the properties and/or position of the aryl substituents in subsequent series to further define that role are in progress.

  15. P. Cornut, T. Bauler et E. Zaccaï (dir., 2007, Environnement et inégalités sociales, Bruxelles, Editions de l’Université de Bruxelles, 214 p.

    Directory of Open Access Journals (Sweden)

    Bruno Villalba

    2007-12-01

    Full Text Available Historiquement, les situations de précarité sociale ne sont pas déconnectées des préoccupations environnementales ; cependant, comme le rappellent les trois coordinateurs de l’ouvrage, Pierre Cornut, Tom Bauler et Edwin Zaccaï, dans une introduction de synthèse critique, la justice s’est construite sur un référentiel social, délaissant les questions environnementales. Progressivement, la question d’une connexion entre les deux domaines s’est renforcée, au point d’aboutir à des champs théoriqu...

  16. American Recovery and Reinvestment Act (ARRA) FEMP Technical Assistance U.S. Army – Project 214 Analysis of Regulations Associated with Implementation of a Rocky Mountain Secure Smart-Grid

    Energy Technology Data Exchange (ETDEWEB)

    Warwick, William M.

    2010-09-30

    This document describes technical assistance provided by PNNL to further develop a smart grid technologies concept to provide a basis for policies and plans for the US Army. The effort was to analyze the potential to utilize emerging smart grid technologies along with indigenous renewable and other resources to meet the emergency and other power needs of Department of Defense facilities in Colorado and Wyoming.

  17. Kris Vassilev.– Le récit de vengeance au XIXe siècle. Toulouse : éditions Toulouse PU Mirail, 2008, 214 p. ( ISBN : 978-2-85816-932-0, 25 euros

    Directory of Open Access Journals (Sweden)

    Christian Vicente

    2009-05-01

    Full Text Available Sommaire : Prologue : vengeance et narration Colomba : la vengeance entre classicisme et romantisme Vengeance et récit dans Le Comte de Monte-Cristo La cousine Bette, ou la vengeance en échec Actions et récits dans La Vengeance d'une femme « Tu es donc mon pire ennemi, que tu veux m’enlever ma vengeance ? » dit Malatesta à Isotta, dans la pièce Malatesta d’Henry de Montherlant.

  18. Efeito da maturação gonadal sobre a energia dos músculos de duas espécies de piranhas do reservatório do rio Manso, Estado de Mato Grosso - DOI: 10.4025/actascibiolsci.v28i3.214 Gonadal maturation effect on muscular energy in two species of piranhas (Serrasalmus marginatus and S. maculatus from rio Manso reservoir, Mato Grosso State - DOI: 10.4025/actascibiolsci.v28i3.214

    Directory of Open Access Journals (Sweden)

    Wladimir Marques Domingues

    2007-11-01

    Full Text Available Com o intuito de investigar a alocação de energia e a correlação entre esta e o fator de condição (K de duas espécies de piranhas, Serrasalmus marginatus e S. maculatus, do reservatório do rio Manso, Estado de Mato Grosso (localizado entre os paralelos 14º 52’ de latitude sul e 55º 48’ de longitude oeste. As coletas foram realizadas entre setembro de 2002 e março de 2004. As amostras de músculos de indivíduos de ambos os sexos, pertencentes a diferentes estádios de maturação gonadal e ambientes, tiveram a determinação do conteúdo energético em bomba calorimétrica e os resultados comparados com o K. Houve diferenças significativas entre os estádios de maturação apenas para os machos. As duas espécies utilizam distintamente a energia obtida do alimento. A maturação gonadal exerceu efeito sobre a alocação energética e o K, enquanto este não se correlacionou com a energia armazenada nos músculos.Aiming to investigate the allocation of energy and the correlation between this energy and the condition factor (K of two piranhas species, Serrasalmus marginatus and S. maculatus, from the reservoir of the Manso river, (located among the parallels 14°52' south latitude and 55°48' west longitude. The collections were carried between September, 2002 and March, 2004. The muscle samples of individuals from both genders belonging to different stages of gonadal maturation and environment had their energy content determined by a calorimetric pump and the results compared with K. There were significant differences among the maturation stages only for the males. The two species make distinct use of the energy obtained from the food. The gonadal maturation had an effect on the allocation of energy and K. It did not correlated with the energy stored in the muscles.

  19. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...

  20. ORF Alignment: NC_002935 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GSQGTTLTAAGQIVVQHARTIIRGYHDLEAAFRNLGD 60 ... Query: 155 AGIHHSVVAHDELIVVCTPDHPMAQLDHVTITDLSTTALITREKGSGTRICLERA...LGQPP 214 ... AGIHHSVVAHDELIVVCTPDHPMAQLDHVTITDLSTTALITREKGSGTRICLERALGQPP... Sbjct: 121 AGIHHSVVAHDELIVVCTPDHPMAQLDHVTITDLSTTALITREKGSGTRICLERALGQPP 180 ...

  1. Gclust Server: 48009 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 48009 Bsu_BSU23530=spoIIM Cluster Sequences Related Sequences(8) 214 required for dissolution...quences Related Sequences(8) Sequence length 214 Representative annotation required for dissolution

  2. ORF Alignment: NC_003063 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available KEIAALLNVSKTPVREAIIRLSEEGFVTVVPQGGTYISPIDV 60 ... Query: 155 KTIFAAARLPGAWSVVNQAKGEMDR...MRHLKRVFAVRRTEKVIEEHEAIVDGIESGDVEAA 214 ... KTIFAAARLPGAWSVVNQAKGEMDRMRHLKRVFAVRRTEKVIEEHEAIVDGIESG...DVEAA Sbjct: 121 KTIFAAARLPGAWSVVNQAKGEMDRMRHLKRVFAVRRTEKVIEEHEAIVDGIESGDVEAA 180 ...

  3. ORF Alignment: NC_000911 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ct: 1 ... IVWHKEKEVAQRRELVPLVKLQSLVKDMTPPLDFVGALRQSPRQPALIAEVKKASPSKGI 60 ... Query: 155 IYLARSRGADAVLLIAAILSDKDLRYFLKIIEGLGMAALVEVHTLEEMD...RVLALDGVQLI 214 ... IYLARSRGADAVLLIAAILSDKDLRYFLKIIEGLGMAALVEVHTLEEMDR...VLALDGVQLI Sbjct: 121 IYLARSRGADAVLLIAAILSDKDLRYFLKIIEGLGMAALVEVHTLEEMDRVLALDGVQLI 180

  4. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    Directory of Open Access Journals (Sweden)

    Ali BAYRAM

    1998-03-01

    Full Text Available In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 10, 50 and 259 mm/min. Strength properties of dual-phase steels were investigated depending on annealing temperature, ratio of martensite and loading rate.

  5. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  6. Nuclear and in-source laser spectroscopy with the ISAC yield station

    Energy Technology Data Exchange (ETDEWEB)

    Kunz, Peter, E-mail: pkunz@triumf.ca; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning [TRIUMF, 4004 Wesbrook Mall, Vancouver, British Columbia V6T 2A3 (Canada); Andreoiu, Corina; Wong, Fiona [Department of Chemistry, Simon Fraser University, Burnaby, British Columbia V5A 1S6 (Canada)

    2014-05-15

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10{sup 11} ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of {sup 46}K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  7. Nuclear and in-source laser spectroscopy with the ISAC yield station.

    Science.gov (United States)

    Kunz, Peter; Andreoiu, Corina; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning; Wong, Fiona

    2014-05-01

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10(11) ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of (46)K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  8. Radiopharmaceutical chemistry of targeted radiotherapeutics, part 4: Strategies for211At labeling at high activities and radiation doses of211At α-particles.

    Science.gov (United States)

    Pozzi, Oscar R; Zalutsky, Michael R

    2017-03-01

    Alpha particles are radiation of high energy and short range, properties that can lead to radiolysis-mediated complications in labeling chemistry at the high radioactivity levels required for clinical application. In previous papers in this series, we have shown that radiation dose has a profound effect on the astatine species that are present in the labeling reaction and their suitability for the synthesis of N-succinimidyl 3-[ 211 At]astatobenzoate. The purpose of this study was to evaluate the effects of adding N-chlorosuccinimide (NCS) to the methanol solution used for initial isolation of 211 At after distillation, a process referred to as 211 At stabilization, on 211 At chemistry after exposure to high radiation doses. High performance liquid chromatography was used to evaluate the distribution of 211 At species present in methanol in the 500-65,000Gy radiation dose range and the synthesis of SAB from N-succinimidyl 3-(tri-n-butylstannyl)benzoate in the 500-120,000Gy radiation dose range using different 211 At timeactivity combinations under conditions with/without 211 At stabilization. In the absence of NCS stabilization, a reduced form of astatine, At(2), increased with increasing radiation dose, accounting for about half the total activity by about 15,000Gy, while with stabilization, At(2) accounted for 60,000Gy. SAB yields without stabilization rapidly declined with increasing dose, falling to ~20% at about 5000Gy while with stabilization, yields >80% were obtained with 211 At solutions stored for more than 23h and receiving radiation doses >100,000Gy. Adding NCS to the methanol solution used for initial isolation of 211 At is a promising strategy for countering the deleterious effects of radiolysis on 211 At chemistry. This strategy could facilitate the ability to perform 211 At labeling at sites remote from its production and at the high activity levels required for clinical applications. Copyright © 2016 Elsevier Inc. All rights reserved.

  9. Dietary exposure to benzoates (E210-E213), parabens (E214-E219), nitrites (E249-E250), nitrates (E251-E252), BHA (E320), BHT (E321) and aspartame (E951) in children less than 3 years old in France.

    Science.gov (United States)

    Mancini, F R; Paul, D; Gauvreau, J; Volatier, J L; Vin, K; Hulin, M

    2015-01-01

    This study aimed to estimate the exposure to seven additives (benzoates, parabens, nitrites, nitrates, BHA, BHT and aspartame) in children aged less than 3 years old in France. A conservative approach, combining individual consumption data with maximum permitted levels, was carried out for all the additives. More refined estimates using occurrence data obtained from products' labels (collected by the French Observatory of Food Quality) were conducted for those additives that exceeded the acceptable daily intake (ADI). Information on additives' occurrence was obtained from the food labels. When the ADI was still exceeded, the exposure estimate was further refined using measured concentration data, if available. When using the maximum permitted level (MPL), the ADI was exceeded for benzoates (1.94 mg kg(-1) bw day(-1)), nitrites (0.09 mg kg(-1) bw day(-1)) and BHA (0.39 mg kg(-1) bw day(-1)) in 25%, 54% and 20% of the entire study population respectively. The main food contributors identified with this approach were current foods as these additives are not authorised in specific infant food: vegetable soups and broths for both benzoates and BHA, delicatessen and meat for nitrites. The exposure estimate was significantly reduced when using occurrence data, but in the upper-bound scenario the ADI was still exceeded significantly by the age group 13-36 months for benzoates (2%) and BHA (1%), and by the age group 7-12 months (16%) and 13-36 months (58%) for nitrites. Measured concentration data were available exclusively for nitrites and the results obtained using these data showed that the nitrites' intake was below the ADI for all the population considered in this study. These results suggest that refinement of exposure, based on the assessment of food levels, is needed to estimate the exposure of children to BHA and benzoates for which the risk of exceeding the ADI cannot be excluded when using occurrence data.

  10. Marc Fleurbaey, Capitalisme ou démocratie ? L’alternative du xxie siècle, Paris, Grasset, 2006, 214 pages, 13,50 €.Caroline Guibet Lafaye, Justice sociale et éthique individuelle, Laval, Presses de l’Université, 2006, 441 pages, 32 €.

    Directory of Open Access Journals (Sweden)

    Vincent Bourdeau

    2009-04-01

    Full Text Available S’il est un champ de la philosophie qui a connu un essor considérable dans les pays anglo-saxons et qui demeure encore trop peu exploré en France, c’est bien celui de la philosophie économique. Ce terme ne désigne pas une « épistémologie » de la science économique, même si certains spécialistes de « philosophie économique » peuvent travailler aussi ce domaine, mais plutôt une approche philosophique des problèmes économiques et sociaux, en dialogue avec les débats des économistes, en particuli...

  11. For Non-expert Clinical Searches, Google Scholar Results are Older with Higher Impact while PubMed Results Offer More Breadth. A Review of: Nourbakhsh, E. F., Nugent, R. F., Wang, H. F., Cevik, C. F., & Nugent, K. (2012. Medical literature searches: A comparison of PubMed and Google Scholar. Health Information and Libraries Journal, 29(3, 214-222.

    Directory of Open Access Journals (Sweden)

    Carol Perryman

    2013-06-01

    Full Text Available Objectives – To compare PubMed and Google Scholar results for content relevance and article qualityDesign – Bibliometric study.Setting – Department of Internal Medicine at Texas Tech University Health Sciences Center.Methods – Four clinical searches were conducted in both PubMed and Google Scholar. Search methods were described as “real world” (p. 216 behaviour, with the searchers familiar with content, though not expert at retrieval techniques. The first 20 results from each search were evaluated forrelevance to the initial question, as well as for quality.Relevance was determined based on one author’s subjective assessment of information in the title and abstract, when available, and then tested by two other authors, with discrepancies discussed and resolved. Items were assigned to one of three categories: relevant, possibly relevant, and not relevant to the question, with reviewer agreement measured using a weighted kappa statistic. The quality of items found to be ‘relevant’ and ‘possibly relevant’ was measured by impact factor ratings from Thomsen Reuters (ISI Web of Knowledge, when available, as well as information obtained by SCOPUS on the number of times items were cited.Main Results – Google Scholar results were judged to be more relevant and of higher quality than results obtained from PubMed. Google Scholar results are also older on average, while PubMed retrieved items from a larger number of unique journals.Conclusion – In agreement with earlier research, the authors recommended that searchers use both PubMed and Google Scholar to improve on the quality and relevance of results. Searches in the two resources identify unique items based upon the ranking algorithms involved.

  12. Journalism that Matters: Views from Central and Eastern Europe. By Michał Głowacki, Epp Lauk and Auksė Balčytienė. Bern: Peter Lang, 2014, 214 pp.; ISBN: 978-3-631-65421-7 hb.

    Directory of Open Access Journals (Sweden)

    Elena Rodina

    2015-12-01

    Full Text Available This book is a much-needed contribution to journalistic studies that allows us to have a closer and more nuanced look at media systems and press cultures in the countries of Central and Eastern Europe (CEE from a non-Western perspective. The volume is of high value to anyone who is interested in the diversity that underlies the unifying term of “post-communist media.” Most of its authors rely on rich data collected throughout lengthy periods of time on the territory of Central and Eastern Europe, which allows us to see not only the current state of “Eastern” media, but its development throughout time.

  13. Hédelin d’Aubignac, Des Satyres brutes, monstres et démons, Texte établi, présenté et annoté par Gilles Banderier, Grenoble, Jérôme Million, « Petite collection Atopia », 2003, 214 p., bibliographie et glossaire

    Directory of Open Access Journals (Sweden)

    Sophie Houdard

    2010-07-01

    Full Text Available François Hédelin, que l’on connaît mieux sous le nom d’abbé d’Aubignac, a passé son enfance et sa jeunesse à Nemours où son père est Lieutenant Général de la ville. Celui que l’historiographie reconnaîtra pour avoir ouvert le chantier dans les années 1640 de sa célèbre Pratique du Théâtre (1657, signe en 1627 son premier ouvrage, Des Satyres Brutes, Monstres et Demons, de leur nature et adoration. Le jeune avocat se lance dans la carrière juridique et mondaine en satisfaisant la curiosité du...

  14. Download this PDF file

    African Journals Online (AJOL)

    2005-05-12

    life. Radium _ l 226 .1. 500 years. (I “1'. R d. $1 on 222 3.8 days on1 y. Polonium 21 8 31min. 0c v. If“ 21.4 27min. 6 v. Bismuth 214 19.9min. 6 v V. P°1°nium 214 1mm“1 sec. (1 l y. Lead 2 1 0 22 years. fi v v. Bismuth 2 w 5 days.

  15. 76 FR 62694 - Appeal of Decisions Relating to Occupancy or Use of National Forest System Lands and Resources

    Science.gov (United States)

    2011-10-11

    ... Forest Service 36 CFR Parts 212, 214, 215, 218, 222, 228, 241, 251, 254, and 292 RIN 0596--AB45 Appeal of.... 214.10 Dismissal of an appeal. Sec. 251.93 Resolution of issues..... Sec. 214.15 Resolution of issues... noncompliance pursuant to 36 CFR part 228, subpart A or D, or part 292, subpart D, F, or G; (2) Approval or...

  16. A wavelength tunable photon source with sealed inner volume

    DEFF Research Database (Denmark)

    2014-01-01

    (214) being a sealed volume, and forming a bonding interface (212) which is gas-tight, so that the first mirror (106) is placed in the inner volume (214) so the first mirror (106) may move within the inner volume (214). The method provides a relatively simple way of obtaining a tunable photon source...... where the inner volume is sealed. The invention furthermore relates to a corresponding photon source, and use of such photon source....

  17. 76 FR 11686 - Registration Requirement for Petitioners Seeking to File H-1B Petitions on Behalf of Aliens...

    Science.gov (United States)

    2011-03-03

    ... (LCA) in the occupational specialty in which the alien will be employed. See 8 CFR 214.2(h)(4)(i)(B)(1) and 8 CFR 214.2(h)(1)(ii)(B)(3). Upon certification of the LCA, the employer may then file an H-1B... three years and may not exceed the validity period of the LCA. See 8 CFR 214.2(h)(9)(iii)(A)(1). Prior...

  18. Fracturas supracondíleas del húmero en niños entre 2 y 14 años. Perfil demográfico y de tratamiento en el Hospital Pablo Tobón Uribe, Medellín, Colombia = Supracondylar fractures of the humerus in children aged 2-14 years. Demographic profile and therapeutic approach at a third-level hospital in Medellín, Colombia

    Directory of Open Access Journals (Sweden)

    Valderrama Molina, Carlos Oliver

    2011-12-01

    Full Text Available Introducción: las fracturas supracondíleas del húmero distal son las lesiones más frecuentes de tratamiento quirúrgico en la población pediátrica. Los informes sobre el perfil demográfico y el enfoque terapéutico de las mismas en Medellín son limitados; este trabajo se llevó a cabo para conocer la epidemiología local de estas lesiones y detectar en el seguimiento los aciertos y errores del tratamiento como base para desarrollar estudios de mayor complejidad.Materiales y métodos: mediante una búsqueda exhaustiva en los registros de historias clíni­cas electrónicas se encontraron 205 casos de fracturas supracondíleas del húmero en niños entre dos y 14 años que ingresaron al Servicio de Urgencias del Hospital Pablo Tobón Uribe entre enero de 2005 y septiembre de 2009. Se analizaron en ellas los aspectos demográficos y terapéuticos.Resultados: el 61,5% de los pacientes fueron varones, la media de la edad fue de 6,6 años, en 62,4% de los casos la fractura afectó el lado izquierdo. La clasificación (Gartland fue como sigue: tipo I: 41,5%; tipo II: 12,2%; tipo III: 46,3%. El 95,6% fueron fracturas cerradas. Se hizo tratamiento quirúrgico en 103 casos (50,2%. El tiempo promedio entre el ingreso y la cirugía fue de 6,7 horas. La técnica quirúrgica más frecuente fue la reducción cerrada con fijación percutánea con clavos cruzados (45,6% de los casos. Se observaron 31 casos (15,1% de le­siones neurológicas, 28 de ellas del nervio ulnar; nueve de las 31 lesiones se registraron en la evaluación posquirúrgica inmediata, todas ellas en pacientes tratados con clavos cruzados. No se registraron lesiones vasculares ni síndromes compartimentales.Conclusión: esta serie presenta el estado actual del perfil demográfico de los pacientes con fracturas supracondíleas del húmero distal en niños y de las modalidades de tratamiento en un hospital de tercer nivel de la ciudad de Medellín. Los resultados pueden ser la base para futuros estudios de mayor elaboración metodológica.

  19. Interlibrary Loan Rates for Academic Libraries in the United States of America Have Increased Despite the Availability of Electronic Databases, but Fulfilment Rates Have Decreased. A Review of: Williams, J. A., & Woolwine, D. E. (2011. Interlibrary loan in the United States: An analysis of academic libraries in a digital age. Journal of Interlibrary Loan, Document Delivery & Electronic Reserve, 21(4, 165-183. doi: 10.1080/1072303X.2011.602945

    Directory of Open Access Journals (Sweden)

    Kathryn Oxborrow

    2012-12-01

    Full Text Available Objectives – To determine the number of interlibrary loan (ILL requests in academiclibraries in the United States of America over the period 1997-2008, and how various factors have influenced these rates. These factors included electronic database subscriptions,size of print journal and monograph collections, and the presence of link resolvers.Data were collected from libraries as both lenders and borrowers. The study also lookedat whether the number of professional staff in an ILL department had changed during theperiod studied, and whether ILL departments led by a professional librarian correlated positively with rates of ILL.Design – Online questionnaire.Setting – Academic library members of the Online Computer Library Center (OCLC ILL scheme in the United States of America.Subjects – A total of 442 academic library members of the OCLC ILL scheme.Methods – An electronic questionnaire was sent to 1433 academic library memberinstitutions of the OCLC ILL scheme. Datawere collected for libraries as both lending andborrowing institutions. Data were analyzed using a statistical software package,specifically to calculate Spearman’s rank correlations between the variables and rates of ILL.Main Results – Responses to the electronic questionnaire were received from 442 (31% academic libraries. There was an overall increase in the number of ILL requests in the period 1997-2008. The number of ILL requests which were unfulfilled also increased during this period. There was a positive correlation between rates of ILL and all of the variables investigated, with the strongest correlations with size of print monograph collections and size of print journal collections. The numbers of staff in ILL departments remained relatively static during the period covered by the study, although the majority of staff working in ILL was composed of paraprofessionals. There was a weak positive correlation between numbers of ILL requests and whether ILL departments were headed by a professional librarian.Conclusions – Access to full text electronic databases has not decreased the numbers of ILL requests in academic libraries in the United States of America. In fact, ILL requests have increased, probably due to the fact that students and staff of academic libraries now have access to a larger number of citations through online databases and other information sources. The authors suggest that the increase in unfulfilled ILL requests is also due to this increased access. Libraries with large print collections are more likely to receive ILL requests precisely because they have more material to lend out, and may make more ILL requests due to the research output of their presumably larger institutions. There may be a higher number of ILL requests fulfilled by departments headed by a professional librarian because a librarian has more knowledge of sources to fulfil requests.

  20. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available in [Entamoeba histolytica HM-1:IMSS] ... Length = 214 ... Query: 67 ... IMPSLPKEFSNAIDELKRGKCNSQIGISELLKSLR...TEWLGDEVVNGFIELLQNKRIGFLN 126 ... IMPSLPKEFSNAIDELKRGKCNSQIGISELLKSLRTEWLGDEVVNGFIELLQNKRIGFLN Sbjct: 1 ... IMPSLPKEFSNAIDEL

  1. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available [Rhodopseudomonas palustris CGA009] ... Length = 214 ... Query: 1 ... MELLTPAEMDR...ADLLTIAGGSSGFALMLHAGRHVAQAAIEMADEGPILVIAGPGNNGGDG 60 ... MELLTPAEMDRADLLTIAGGSSGFALMLHAGRHVAQAAIEM...ADEGPILVIAGPGNNGGDG Sbjct: 1 ... MELLTPAEMDRADLLTIAGGSSGFALMLHAGRHVAQAAIEMADEGPILVIAGPGNNGGDG 60 ... Query: 121 S

  2. Variables cognitivas e ingreso universitario: predictores del rendimiento academico

    National Research Council Canada - National Science Library

    Elvira-Valdes, Maria Antonieta; Pujol, Lydia

    2014-01-01

    ... universitario, sobre el rendimiento academico de los estudiantes. La muestra estuvo constituida por 214 estudiantes voluntarios, cursantes del ciclo basico de carreras tecnologicas de la Universidad Simon Bolivar...

  3. Detection of the introgression loci in Triticum aestivum transferred ...

    African Journals Online (AJOL)

    ... of A. tauschii SQ-214 introgression loci in the two derived populations. The result shows that 82.35% loci of A. tauschii SQ-214 were detected in BC1F2 population, while the frequency of introgression loci was 51.47% in the advanced lines of BC1F2-F7 after artificial selection for stripe rust resistance and agronomic traits.

  4. About Military Sexual Trauma

    Medline Plus

    Full Text Available ... PTSD? (Whiteboard Video) - Duration: 3:38. Veterans Health Administration 327,043 views 3:38 Veterans and PTSD: Challenging the Misconceptions - Duration: 2:14. Veterans Health Administration 2,861 views 2:14 VA Voluntary Service ...

  5. NCBI nr-aa BLAST: CBRC-XTRO-01-1486 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-1486 ref|YP_575900.1| protein of unknown function DUF214 [Nitrobacter ...hamburgensis X14] gb|ABE61440.1| protein of unknown function DUF214 [Nitrobacter hamburgensis X14] YP_575900.1 0.33 25% ...

  6. 15 CFR 30.52 - Foreign Trade Zones.

    Science.gov (United States)

    2010-01-01

    ... into a FTZ, the zone operator is required to file CBP-214, “Application for Foreign Trade Zone... through the AFTZRP. Companies operating in FTZs interested in reporting CBP-214 statistical information... month. Participation in the Census Bureau program does not relieve companies of the responsibility to...

  7. NCBI nr-aa BLAST: CBRC-XTRO-01-0526 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0526 ref|YP_524495.1| protein of unknown function DUF214 [Rhodoferax ferrireduce...ns T118] gb|ABD70964.1| protein of unknown function DUF214 [Rhodoferax ferrireducens DSM 15236] YP_524495.1 0.0 67% ...

  8. NCBI nr-aa BLAST: CBRC-DRER-17-0045 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-17-0045 ref|YP_921174.1| protein of unknown function DUF214 [Thermofilum ...pendens Hrk 5] gb|ABL79171.1| protein of unknown function DUF214 [Thermofilum pendens Hrk 5] YP_921174.1 2.1 32% ...

  9. 78 FR 54884 - Combined Notice Of Filings #2

    Science.gov (United States)

    2013-09-06

    .... Description: 1765R6 KCP&L-GMO NITSA and NOAs to be effective 8/1/ 2013. Filed Date: 8/29/13 Accession Number... Rules 211 and 214 of the Commission's Regulations (18 CFR 385.211 and 385.214) on or before 5:00 p.m...

  10. 78 FR 65634 - Combined Notice of Filings #2

    Science.gov (United States)

    2013-11-01

    ...: Southwest Power Pool, Inc. Description: 1765R7 KCP&L-GMO NITSA and two NOAs to be effective 10/1/2013. Filed... Rules 211 and 214 of the Commission's Regulations (18 CFR 385.211 and 385.214) on or before 5:00 p.m...

  11. 77 FR 31842 - Combined Notice of Filings #1

    Science.gov (United States)

    2012-05-30

    ... Company submits tariff filing per 35.13(a)(2)(iii: RS 136, Joint Operating Agreement (GMO) to be effective... Rules 211 and 214 of the Commission's Regulations (18 CFR 385.211 and Sec. 385.214) on or before 5:00 p...

  12. 78 FR 77116 - Combined Notice of Filings #1

    Science.gov (United States)

    2013-12-20

    ..., Inc. Description: Southwest Power Pool, Inc. submits tariff filing per 35.13(a)(2)(iii: KCPL and GMO... under Section 204 of the Federal Power Act and Part 34 of the Commission's Regulations. Filed Date: 12... 214 of the Commission's Regulations (18 CFR 385.211 and 385.214) on or before 5:00 p.m. Eastern time...

  13. 40 CFR 52.1677 - Compliance schedules.

    Science.gov (United States)

    2010-07-01

    ... owner or operator of any coke oven battery subject to the requirements of Part 214, sections 214.2 and... operator of a coke oven battery subject to paragraph (d)(9) of this section shall be subject to the... Affected, which appears in the Finding Aids section of the printed volume and on GPO Access. ...

  14. The Economic Effects of 9/11: A Retrospective Assessment

    Science.gov (United States)

    2002-09-27

    Shapiro, “Cities and Welfare: The Impact of Terrorism on Urban Form,” Journal of Urban Economics , vol. 51, no. 2, March 2002, p. 214. 75 Edward L. Glaeser...and Jesse M. Shapiro, “Cities and Welfare: The Impact of Terrorism on Urban Form,” Journal of Urban Economics , vol. 51, no. 2, March 2002, p. 214. 76

  15. 75 FR 56491 - Technical Amendments for Marine Spark-Ignition Engines and Vessels

    Science.gov (United States)

    2010-09-16

    ..., 2000 Traverwood Drive, Ann Arbor, Michigan 48105; telephone number: 734-214-4532; fax number: 734-214... Industry Classification System (NAICS). \\b\\ Standard Industrial Classification (SIC) system code. III... tanks that will allow for this solution. Specifically, we are proposing to revise the text in Sec. 1060...

  16. 78 FR 16701 - Agency Information Collection Activities: Application for Foreign Trade Zone and/or Status...

    Science.gov (United States)

    2013-03-18

    ... Foreign Trade Zone and/or Status Designation, and Application for Foreign Trade Zone Activity Permit... approval in accordance with the Paperwork Reduction Act: Application for Foreign Trade Zone Admission and/or Status Designation, and Application for Foreign Trade Zone Activity Permit (CBP Forms 214, 214A...

  17. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 214 of 214 ... Vol 25, No 1 (2010), Towards a pro-health food-selection model for gatekeepers in Bulawayo high-density suburbs in Zimbabwe, Abstract. N Sophonie, MN Monique ... Vol 19, No 1 (2004), Women's social status and social justice in contemporary Tswana society, Abstract. Nthabiseng A Phaladze ...

  18. 49 CFR 218.105 - Additional operational requirements for hand-operated main track switches.

    Science.gov (United States)

    2010-10-01

    ... § 214.323, or train coordination under § 214.325, when a roadway worker qualified to operate hand-operated main track switches is granted permission by the roadway worker in charge to occupy or otherwise..., or a roadway worker in charge. (c) Additional job briefing requirements for hand-operated main track...

  19. On a Semi-Coercive Quasi-Variational Inequality.

    Science.gov (United States)

    1980-06-01

    Roma, Italy. 2Departement de Mathematique , C.P.214, Universite Libre de Bruxelles, 1050 Bruxl~e BA~q~um, sponsored by the United States Army under...di Roma, 00100 Roma, Italy. 2 Departement de Mathematique , C.P.214, Universite Libre de Bruxelles, 1050 Bruxelles, Belgium, sponsored by the United

  20. Notification and Consultation of Projects in Transboundary Water ...

    African Journals Online (AJOL)

    Abiy Chelkeba

    Margaret J. Vick, 'The Senegal River Basin: A Retrospective and Prospective look at. Legal Regime', Natural Resources Journal, Vol. 46, p. 214. 52 Margaret J. Vick, supra note 50, p. 214. 53. See Lake Lanoux Arbitration (1957), Spain vs France, 24 I.L.R. 101, 111-12 (hereinafter referred as Lake Lanoux Arbitration).

  1. Integrated inventory information system

    Digital Repository Service at National Institute of Oceanography (India)

    Sarupria, J.S.; Kunte, P.D.

    stream_size 5 stream_content_type text/plain stream_name Handbook_Lib_Archives_Inf_Cen_India_7_214.pdf.txt stream_source_info Handbook_Lib_Archives_Inf_Cen_India_7_214.pdf.txt Content-Encoding ISO-8859-1 Content-Type text...

  2. NCBI nr-aa BLAST: CBRC-XTRO-01-0526 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0526 ref|YP_547798.1| protein of unknown function DUF214 [Polaromonas ...sp. JS666] gb|ABE42900.1| protein of unknown function DUF214 [Polaromonas sp. JS666] YP_547798.1 0.0 66% ...

  3. NCBI nr-aa BLAST: CBRC-XTRO-01-0526 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0526 ref|YP_981084.1| protein of unknown function DUF214 [Polaromonas ...naphthalenivorans CJ2] gb|ABM36163.1| protein of unknown function DUF214 [Polaromonas naphthalenivorans CJ2] YP_981084.1 0.0 65% ...

  4. Alpha particle emitters in medicine

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, D.R.

    1989-09-01

    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ({sup 211}At) and natural bismuth-212 ({sup 212}Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ({sup 223}Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs.

  5. α decay of the very neutron-deficient isotopes 197-199Fr

    Science.gov (United States)

    Kalaninová, Z.; Andreyev, A. N.; Antalic, S.; Heßberger, F. P.; Ackermann, D.; Andel, B.; Drummond, M. C.; Hofmann, S.; Huyse, M.; Kindler, B.; Lane, J. F. W.; Liberati, V.; Lommel, B.; Page, R. D.; Rapisarda, E.; Sandhu, K.; Šáro, Š.; Thornthwaite, A.; Van Duppen, P.

    2013-04-01

    Decay properties of the very neutron-deficient isotopes 197-199Fr were studied at the velocity filter Separator for Heavy Ion reaction Products (SHIP) at GSI in Darmstadt. The isotopes were produced in the 2n-4n evaporation channels of the fusion-evaporation reaction 60Ni+141Pr → 201Fr*. Improved α-decay properties of 199Fr were determined and the possible existence of two α-decaying states in this nucleus is discussed. For the isotope 198Fr a broad α-decay energy distribution was detected in the range of (7470-7930) keV and two α-decaying states were observed with half-lives of 1.1(7) and 15(3) ms. The new isotope 197Fr was identified based on the observation of one α-decay chain yielding Eα=7728(15) keV and T1/2=0.6-0.3+3.0 ms. The systematics of reduced α-decay widths are presented for neutron-deficient francium, radon, and astatine isotopes.

  6. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Directory of Open Access Journals (Sweden)

    Sherif S Nafee

    Full Text Available Thallium (81(217Tl, Bismuth (83(217Bi, Astatine (85(217At, Francium (87(217Fr, Actinium (89(217Ac and Protactinium (91(217Pa are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221Fr-, (221Ac- and (221Pa-α-decays.

  7. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Science.gov (United States)

    Nafee, Sherif S; Shaheen, Salem A; Al-Ramady, Amir M

    2016-01-01

    Thallium (81(217)Tl, Bismuth (83(217)Bi), Astatine (85(217)At), Francium (87(217)Fr), Actinium (89(217)Ac) and Protactinium (91(217)Pa) are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α) has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF) calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221)Fr-, (221)Ac- and (221)Pa-α-decays.

  8. On the theory of time dilation in chemical kinetics

    Science.gov (United States)

    Baig, Mirza Wasif

    2017-10-01

    The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.

  9. SPECT assay of radiolabeled monoclonal antibodies. Progress report, September 1, 1992--August 24, 1993

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1993-08-20

    The overall goal of this project is to improve the effectiveness of single photon emission computed tomography (SPECT) to image and quantify radiolabeled monoclonal antibodies. During the past year, we have made significant progress toward this goal, and this report summarizes that work. Our efforts have been mainly directed along three fronts. First, we have developed and tested new reconstruction methods including three-dimensional iterative algorithms that model non-uniform attenuation and distance-dependent detector response. Both fan beam and parallel beam collimator geometries have been modeled and novel ways of improving the efficiency of the computationally intensive methods have been introduced. Second, an ultra-high resolution, small field-of-view pinhole collimator has been constructed and evaluated. Reconstructed spatial resolution of 1 to 3 mm (FWHM) has been achieved in phantom scans with a useful field-of-view of 9 to 10 cm. Finally, we have investigated the ability of SPECT to image and quantify astatine-211 distributions. Reconstructed images of phantom data demonstrated quantitative accuracy to within 10% with proper attenuation and scatter compensation.

  10. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    Science.gov (United States)

    Marsh, B. A.; Andel, B.; Andreyev, A. N.; Antalic, S.; Atanasov, D.; Barzakh, A. E.; Bastin, B.; Borgmann, Ch.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Dehairs, M.; Derkx, X.; De Witte, H.; Fedorov, D. V.; Fedosseev, V. N.; Focker, G. J.; Fink, D. A.; Flanagan, K. T.; Franchoo, S.; Ghys, L.; Huyse, M.; Imai, N.; Kalaninova, Z.; Köster, U.; Kreim, S.; Kesteloot, N.; Kudryavtsev, Yu.; Lane, J.; Lecesne, N.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Molkanov, P. L.; Nicol, T.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Schweikhard, L.; Seliverstov, M. D.; Sels, S.; Sjödin, A. M.; Truesdale, V.; Van Beveren, C.; Van Duppen, P.; Wendt, K.; Wienholtz, F.; Wolf, R. N.; Zemlyanoy, S. G.

    2013-12-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar free ionization using the Laser Ion Source Trap, LIST (Po); isobar selective particle identification using the multi-reflection time-of-flight mass separator (MR-ToF MS) of ISOLTRAP (Au, At). These are summarized as part of an overview of the current status of the in-source resonance ionization spectroscopy setup at ISOLDE.

  11. Studies of Stable Octupole Deformations in the Radium Region

    CERN Multimedia

    2002-01-01

    The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

  12. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  13. Evaluating 99mTc Auger electrons for targeted tumor radiotherapy by computational methods.

    Science.gov (United States)

    Tavares, Adriana Alexandre S; Tavares, João Manuel R S

    2010-07-01

    Technetium-99m (99mTc) has been widely used as an imaging agent but only recently has been considered for therapeutic applications. This study aims to analyze the potential use of 99mTc Auger electrons for targeted tumor radiotherapy by evaluating the DNA damage and its probability of correct repair and by studying the cellular kinetics, following 99mTc Auger electron irradiation in comparison to iodine-131 (131I) beta minus particles and astatine-211 (211At) alpha particle irradiation. Computational models were used to estimate the yield of DNA damage (fast Monte Carlo damage algorithm), the probability of correct repair (Monte Carlo excision repair algorithm), and cell kinetic effects (virtual cell radiobiology algorithm) after irradiation with the selected particles. The results obtained with the algorithms used suggested that 99mTc CKMMX (all M-shell Coster-Kroning--CK--and super-CK transitions) electrons and Auger MXY (all M-shell Auger transitions) have a therapeutic potential comparable to high linear energy transfer 211At alpha particles and higher than 131I beta minus particles. All the other 99mTc electrons had a therapeutic potential similar to 131I beta minus particles. 99mTc CKMMX electrons and Auger MXY presented a higher probability to induce apoptosis than 131I beta minus particles and a probability similar to 211At alpha particles. Based on the results here, 99mTc CKMMX electrons and Auger MXY are useful electrons for targeted tumor radiotherapy.

  14. Radiobromination of humanized anti-HER2 monoclonal antibody trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate, a potential label for immunoPET

    Energy Technology Data Exchange (ETDEWEB)

    Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail: vladimir.tolmachev@bms.uu.se

    2005-08-01

    Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.

  15. Development and radiotherapeutic application of /sup 211/At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    Energy Technology Data Exchange (ETDEWEB)

    Adelstein, S.J.; Zalutsky, M.; Bloomer, W.

    1981-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.

  16. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  17. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  18. Modelling radon progeny concentration variations in thermal spas.

    Science.gov (United States)

    Nikolopoulos, Dimitrios; Vogiannis, Efstratios

    2007-02-01

    Radon and its short-lived progenies (218Po, 214Pb, 214Bi and 214Po) are well known radioactive indoor pollutants identified as the major radiation burden component of the thermal spa users. Monitoring of short-lived progeny concentration is of great importance for short-term dose estimations both for bathers and working personnel. A prediction model of the short-lived progeny concentration variations was developed and applied on published data of the thermal spas of Lesvos Island. The physical procedures involved were modeled in a set of differential equations describing radon progeny concentration variations on the basis of radon measurements. Published daughter data were fitted on model predictions adjusting non-measured parameters, e.g. attachment and deposition rate constants for attached and unattached progenies. Attachment rate constants were estimated between 50 and 200 h-1 while the deposition rate constants between 0.25 and 5 h-1 for attached progenies and 0.5 and 170 h-1 for the unattached ones. In addition, unattached 218Po, 214Pb and 214Bi progenies were found to be shifted forward in respect to radon approximately 0.001 h, 0.05 h and 0.40 h respectively, while attached 218Po, 214Pb and 214Bi progenies 0.05 h, 0.45 h and 0.65 h respectively.

  19. The Endophytic Symbiont—Pseudomonas aeruginosa Stimulates the Antioxidant Activity and Growth of Achyranthes aspera L.

    Directory of Open Access Journals (Sweden)

    Khaidem A. Devi

    2017-09-01

    Full Text Available A plant growth promoting bacterial endophyte designated as AL2-14B isolated from the leaves of Achyranthes aspera L. was identified as Pseudomonas aeruginosa based on its phenotypic and physiological features, and 16S rRNA gene sequence analysis. AL2-14B had plant growth stimulating attributes including siderophore and indole acetic acid release, inorganic phosphate solubilization, along with nitrogenase, ammonification, and protease activities. It also exhibited antifungal property against Rhizoctonia solani. The plantlets grown in germ-free condition were inoculated with AL2-14B and studied for the colonization of endophyte. Significant increase in population of AL2-14B between 3rd and 5th days after inoculation was recorded. The treatment of plants with endophytic P. aeruginosa AL2-14B increased nitrogen, phosphorus, potassium (NPK contents in plant by 3.8, 12.59, and 19.15%, respectively. Significant enhancement of shoot and root length, dry leaf, dry shoot and dry root weight, and leaf surface area as compared to control (P < 0.05 was recorded in AL2-14B inoculated plants. The antioxidant activities increased in plants grown in germ-free conditions and inoculated with AL2-14B. The present study emphasizes on the role of diazotrophic endophyte P. aeruginosa AL2-14B in stimulating growth of A. aspera L. and improvement of its medicinal properties. Significant increase in growth and antioxidant content of P. aeruginosa AL2-14B treated plants suggests the possibility of an economical and eco-friendly mean of achieving antioxidants rich, healthier A. aspera plants.

  20. المواضيع الإسلامية في الصحافة الحلية صحيفة الفيحاء انموذجاً للفترة من 20/ 4/ 2008 ــ 21/4/ 2009 Islamic topics in the Hilla City press (Al Fayhaa Newspaper as a model for the period from 20/4/2008 - 21/4/2009

    Directory of Open Access Journals (Sweden)

    Hatem Bidwee Obaid م.م .حاتم بديوي عبيد الشمري

    2011-12-01

    Full Text Available According to the Given features that the press enjoyed between the media through its functions and objectives, according to the theory of receiving and repulsion, concerning the nature of the receiving public and that are interested to know Preference conduct what receive of contents that incompatible with his beliefs or consistent with, and is subject content to process selection, so gave theoretical Islamic Media self-responsibility for who does calling focusing on the conscience and faith, So who does contact demands review of values ​​that are consistent with Islamic principles and moral, it is commentary and interpretations and essays and analyzes and news and information not in accordance with inclinations or tendencies media company in which it operates, but according to objective aimed that contribute to achieve stability, guidance and education, knowledge and achievement. All of this leads to highlighting the importance of the role of the media in building contemporary Islamic societies. So came the idea of ​​a researcher to identify the topics published in the Islamic press Ornament and the attention of those who made it. The research was divided into four sections, the first section is a methodological framework for the research, which included the importance of research and his problem and his goal method and procedures of the research and society. The second section was divided into two first: the history of the Islamic press in general in Iraq, and the second topic: the history of the Islamic press in Hilla. The third section has been allocated: the speech Media Islamic and dealt with three topics, the first: the Islamic discourse in general and the press in particular, the second topic: has been allocated for sources Islamic themes, and the third topic: was on the characteristics and attributes of media discourse Islamic. The fourth section: has been allocated for the analytical study of topics published in The Islamic Fayhaa within the period subject to search, and at the end of the researcher Find out some results in addition to the sources relied upon in the search.

  1. ASPECTOS LABORATORIAIS DA INTOXICAÇÃO EXPERIMENTAL DE BO-VINOS PELOS FRUTOS DE Stryphnodendron Fissuratum MART.(“ROSQUINHA”)

    National Research Council Canada - National Science Library

    Victor de Queiroz Ferreira; Anúzia Cristina Barini; Bruno Rodrigues Trindade; Adilson Donizeti Damasceno; Nilo Sérgio Troncoso Chaves; Ary da Silva Rodrigues; Carlos Eduardo de Moraes Souto Pantoja

    2006-01-01

    ... sangüínea de quinze bovinos, machos mestiços, com idade entre dez e quatorze meses, pesando entre 96 e 214 kg, intoxicados experimentalmente pelos frutos de Stryphnodendron fissuratum Mart. (“rosquinha”) em doses...

  2. Progression of hepatic fibrosis in patients with hepatitis C: a prospective repeat liver biopsy study

    National Research Council Canada - National Science Library

    Ryder, S D; Irving, W L; Jones, D A; Neal, K R; Underwood, J C

    2004-01-01

    .... We studied 214 HCV infected patients (126 male; median age 36 years (range 5-8)) with predominantly mild liver disease who were prospectively followed without treatment and assessed for risk factors for progression of liver disease...

  3. Disease: H01139 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available crobiol Infect Dis 72:214-8 (2012) PMID:17114714 Bakken JS, Dumler JS Clinical diagnosis and treatment of human granulocytotropic anaplasmosis. Ann N Y Acad Sci 1078:236-47 (2006) ...

  4. A Comparative Review of Three Microbiology Student Study Resources

    Directory of Open Access Journals (Sweden)

    JMBE Production Editor

    2012-03-01

    Full Text Available Correction for Wendy A. Dustman, “A Comparative Review of Three Microbiology Student Study Resources,” which appeared in the Journal of Microbiology & Biology Education, volume 12, number 2, December 2011, pages 214–216.

  5. Diabetes Prevention and Treatment Programs for Western PA - Pediatrics/Platelet Gel

    Science.gov (United States)

    2009-09-01

    another motivation to lose weight.)  BUN/Creatinine (Routine test of renal function)  Dipstick urinalysis (Routine screening for proteinuria and...20 214 $ 604 Expense (6) Diabetes Educator 150 $ 88 Dietitian 90 41

  6. EST Table: FS888238 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available tances) 10/09/28 49 %/214 aa ref|XP_623145.2| PREDICTED:...e mechanism)|GO:0016020(membrane)|GO:0016820(hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of subs

  7. About Military Sexual Trauma

    Medline Plus

    Full Text Available ... will automatically play next. Up next What is PTSD? (Whiteboard Video) - Duration: 3:38. Veterans Health Administration 334,841 views 3:38 Veterans and PTSD: Challenging the Misconceptions - Duration: 2:14. Veterans Health ...

  8. Disease: H01219 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available Acta Myol 26:153-8 (2007) PMID:15201162 (gene, description) Gomes AV, Potter JD Molecular and cellular aspects of troponin cardiomyopathies. Ann N Y Acad Sci 1015:214-24 (2004) ...

  9. 27 CFR 478.144 - Relief from disabilities under the Act.

    Science.gov (United States)

    2010-04-01

    ..., TOBACCO, FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE FIREARMS AND AMMUNITION COMMERCE IN FIREARMS AND... record (Department of Defense Form 214), charge sheet (Department of Defense Form 458), and final court...

  10. 75 FR 54215 - East Penn Railroad, LLC-Abandonment Exemption-in Montgomery County, PA

    Science.gov (United States)

    2010-09-03

    ... (Sub-No. 1X)] East Penn Railroad, LLC--Abandonment Exemption--in Montgomery County, PA East Penn... Bridgeport, and milepost 2.14 at Henderson Road in Upper Merion Township, in Montgomery County, Pa. The line...

  11. 78 FR 68047 - Combined Notice of Filings #2

    Science.gov (United States)

    2013-11-13

    ... Company. Description: KCP&L Greater Missouri Operations Company submits GMO Supplemental RS 135... Commission's Regulations (18 CFR 385.211 and 385.214) on or before 5:00 p.m. Eastern time on the specified...

  12. 77 FR 6103 - Combined Notice of Filings #1

    Science.gov (United States)

    2012-02-07

    ...-000. Applicants: Southwest Power Pool, Inc. Description: 1765R5 Kansas City Power and Light GMO NITSA... above proceedings must file in accordance with Rules 211 and 214 of the Commission's Regulations (18 CFR...

  13. ORF Alignment: NC_005126 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available otein BSU22460 [Bacillus subtilis subsp. subtilis ... str. 168] gb|AAB38445.1| 21.4% of identity to ... ... ... trans-acting transcription factor of Sacharomyces ... cerevisiae; 25% of identity to sucros

  14. ORF Alignment: NC_003228 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available otein BSU22460 [Bacillus subtilis subsp. subtilis ... str. 168] gb|AAB38445.1| 21.4% of identity to ... ... ... trans-acting transcription factor of Sacharomyces ... cerevisiae; 25% of identity to sucros

  15. ORF Alignment: NC_003901 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available otein BSU22460 [Bacillus subtilis subsp. subtilis ... str. 168] gb|AAB38445.1| 21.4% of identity to ... ... ... trans-acting transcription factor of Sacharomyces ... cerevisiae; 25% of identity to sucros

  16. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available otein BSU22460 [Bacillus subtilis subsp. subtilis ... str. 168] gb|AAB38445.1| 21.4% of identity to ... ... ... trans-acting transcription factor of Sacharomyces ... cerevisiae; 25% of identity to sucros

  17. ORF Alignment: NC_002977 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available otein BSU22460 [Bacillus subtilis subsp. subtilis ... str. 168] gb|AAB38445.1| 21.4% of identity to ... ... ... trans-acting transcription factor of Sacharomyces ... cerevisiae; 25% of identity to sucros

  18. Drug: D01667 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 489.0036 D01667.gif Antihypertensive; Enzyme inhibitor [angiotensin-converting] Therapeutic category: 2144 ...ic category of drugs in Japan [BR:br08301] 2 Agents affecting individual organs 21 Cardiovascular agents 214 Antihypertensive

  19. Drug: D10243 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available DR:D00523], Amlodipine besilate [DR:D00615] Antihypertensive Therapeutic category: 2149 ATC code: C09DB05 En...gans 21 Cardiovascular agents 214 Antihypertensives 2149 Others D10243 Irbesartan

  20. Drug: D00251 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 217.2853 D00251.gif Antihypertensive; Enzyme inhibitor [angiotensin-converting] Therapeutic category: 2144 ...category of drugs in Japan [BR:br08301] 2 Agents affecting individual organs 21 Cardiovascular agents 214 Antihypertensive

  1. Drug: D01369 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available . HCl 381.1707 381.8936 D01369.gif Anti-anginal; Antihypertensive; Cardiac depressant [anti-arrythmic] Thera...individual organs 21 Cardiovascular agents 214 Antihypertensives 2149 Others D013

  2. Drug: D00624 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 441.6046 D00624.gif Antihypertensive Same as: C07707 Therapeutic category: 2144 ATC code: C09AA04 prodrug, ...01] 2 Agents affecting individual organs 21 Cardiovascular agents 214 Antihypertensives 2144 Angiotensin con

  3. Drug: D01302 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 516 196.6369 D01302.gif Antihypertensive Therapeutic category: 2142 ATC code: C02DB02 Genomic biomarker: NAT...ffecting individual organs 21 Cardiovascular agents 214 Antihypertensives 2142 Hy

  4. Drug: D09196 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ); Ecard LD (TN) Candesartan cilexetil [DR:D00626], Hydrochlorothiazide [DR:D00340] Antihypertensive Therape... individual organs 21 Cardiovascular agents 214 Antihypertensives 2149 Others D09

  5. Drug: D09745 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available rtensives 2149 Others D09745 Valsartan - amlodipine besi...:1576] Therapeutic category of drugs in Japan [BR:br08301] 2 Agents affecting individual organs 21 Cardiovascular agents 214 Antihype

  6. Drug: D09219 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available A07 Therapeutic category of drugs in Japan [BR:br08301] 2 Agents affecting individual organs 21 Cardiovascular agents 214 Antihyperte...nsives 2149 Others D09219 Telmisartan - hydrochlorothiaz

  7. How fat works

    National Research Council Canada - National Science Library

    Wood, Philip A. (Philip Allen)

    2006-01-01

    ... for Making Good Decisions 192 IV. The Environment 17. Nutrient Labeling 203 18. 209 Alternative Medicine and Fad Diets 19. 214 Media Coverage of Health Research 225 Glossary 231 References Index 245 Ackn...

  8. About Military Sexual Trauma

    Medline Plus

    Full Text Available ... the types of incidents that constitute MST, the effects of MST on survivors and the services available ... Health Administration 2,673 views 2:14 Prolonged Exposure for PTSD - Duration: 2:45. Veterans Health Administration ...

  9. 75 FR 36449 - Yankee Atomic Electric Co.; Yankee Atomic Independent Spent Fuel Storage Installation; Issuance...

    Science.gov (United States)

    2010-06-25

    ... footprint of the existing ISFSI, and would have no other significant non-radiological impacts. In this...)(i)(A), 72.212(b)(7), and 72.214, will not significantly impact the quality of the ] human...

  10. Teater

    Index Scriptorium Estoniae

    2003-01-01

    KaTeater osaleb 2.-14. dets. A. Alegria draamaga "Niagaara" (lav. J. Urvet) Venetsueelas, Caracases VI rahvusvahelisel teatrifestivalil "Fiesta 2003". Eesti Teatriliidu volikogu koosolekul 17. nov. kinnitati R. Oja ettepanekul T. Tuisk ja A. Lumiste juhatuse uuteks liikmeteks

  11. About Military Sexual Trauma

    Medline Plus

    Full Text Available ... in to report inappropriate content. Sign in Transcript Statistics Add translations 13,730 views 37 Like this ... 50 Veterans and PTSD: Challenging the Misconceptions - Duration: 2:14. Veterans Health Administration 3,611 views 2: ...

  12. Drug: D09594 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D09594 Mixture, Drug Olmesartan medoxomil - azelnidipine mixt; Rezaltas (TN) Olmesa...nts 214 Antihypertensives 2149 Others D09594 Olmesartan medoxomil - azelnidipine mixt PubChem: 124490334 ...

  13. Drug: D00197 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 34 608.6787 D00197.gif Rauvolfia serpentina [TAX:4060] Antihypertensive Same as: C06539 Therapeutic category...gents affecting individual organs 21 Cardiovascular agents 214 Antihypertensives 2143 Rauwolfias D00197 Rese

  14. Drug: D00626 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 6597 D00626.gif Antagonist [angiotensin II receptor]; Antihypertensive Same as: C07709 Therapeutic category:...ardiovascular agents 214 Antihypertensives 2149 Others D00626 Candesartan cilexetil (JP16/USAN) Anatomical T

  15. Some Aspects of the Role of Intonation in English Versification

    Science.gov (United States)

    Pakosz, Maciej

    1973-01-01

    Non-segmental properties functioning in verse are discussed in an attempt to point to the possibility of a semantic analysis of the poem based entirely on accent. (Available from: See FL 508 214.) (Author/RM)

  16. Ultrastructural findings in progressive macular hypomelanosis indicate decreased melanin production

    NARCIS (Netherlands)

    Relyveld, G. N.; Dingemans, K. P.; Menke, H. E.; Bos, J. D.; Westerhof, W.

    2008-01-01

    BACKGROUND: The pathogenesis of progressive macular hypomelanosis (PMH) is unknown. Recently, Westerhof et al. (Arch Dermatol 2004; 140: 210-214) hypothesized that Propionibacterium acnes produces a depigmenting factor that interferes with melanogenesis in the skin, resulting in hypopigmented spots.

  17. Breeding ground survey, Alaska, May 18 to June 11, 1965

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This report summarizes the results of a breeding ground survey in Alaska during the 1965 breeding season. This year 206 of the 214, 16 mile transects laid out for...

  18. Biomass production and carbon storage of Populus ×canadensis ...

    African Journals Online (AJOL)

    euramericana (Dode) Guinier ex Piccarolo) clone I-214 have good potential for biomass production. The objective of the study was estimation of biomass using allometric equations and estimation of carbon allocation according to tree components.

  19. 78 FR 22820 - Revisions to Rules of Practice

    Science.gov (United States)

    2013-04-17

    ... (Order No. 214). The PAEA transformed the Postal Rate Commission into the Postal Regulatory Commission...) Disclosure of the number, identity and qualifications of witnesses, and the nature of their testimony...

  20. Modern trends of aircraft fly-by-wire systems

    National Research Council Canada - National Science Library

    Святослав Сергійович Юцкевич; Микола Максимович Юдін

    2013-01-01

    .... A comparison of the systems-level hardware and software, expressed through modes of guidance, provision of aircraft Airbus A-320, Boeing B-777, Tupolev Tu-214, Sukhoi Superjet SSJ-100 are carried...

  1. Gclust Server: 96271 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Cluster Sequences Related Sequences(214) 395 mel-26: Maternal Effect Lethal family member (mel-26) 1 1.00e-40...Sequence length 395 Representative annotation mel-26: Maternal Effect Lethal family member (mel-26) Number of

  2. 75 FR 38467 - Procurement List: Proposed Additions

    Science.gov (United States)

    2010-07-02

    ...: 7520-00-NIB-2084--Shoulder Rest, Telephone, Black, Softak II. NSN: 7520-00-NIB-2085--Shoulder Rest... Services Administration. NSN: 7520-01-253-1283--Shoulder Rest, Telephone, Beige, 2\\1/4\\ W x 7'' L. NSN...

  3. Gclust Server: 75483 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences Related Sequences(214) 955 ncam-1: NCAM (neural cell adhesion molecule) homolog family member (ncam-1)...length 955 Representative annotation ncam-1: NCAM (neural cell adhesion molecule) homolog family member (ncam-1)

  4. Association mapping for partial resistance to Phytophthora sojae in ...

    Indian Academy of Sciences (India)

    . The objective of this study was to identify QTLs for partial resistance to Phytophthora sojae. In this study, we evaluated a total of 214 soybean accessions by the hypocotyl inoculation method, and 175 were susceptible. The 175 susceptible ...

  5. Cloud amount/frequency, NITRATE and other data from ENDEAVOR in the NW Atlantic from 1990-06-24 to 1990-07-07 (NODC Accession 9300107)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Conductivity, Temperature and Depth (CTD) and other data were collected in NW Atlantic (limit-40 W). Data was collected from Ship ENDEAVOR cruise 214. The data...

  6. 20 CFR 655.50 - Enforcement process.

    Science.gov (United States)

    2010-04-01

    ... Temporary Employment in Occupations Other Than Agriculture or Registered Nursing in the United States (H-2B...(a)(6), and 214(c) of the INA, pursuant to the delegation of authority from the Secretary of Homeland...

  7. Evaluating Macro and Microscopic Rock Damage from Explosions and the Effects on Shear Wave Generation

    Science.gov (United States)

    2014-06-30

    Figure 2-14. Plywood and plastic tarp covering the drill holes to prevent mud and rain from entering the hole...AGM batteries in combination with solar panels powered the stations. The sensors were placed in shallow holes, oriented to truth north, leveled...Figure 2-14. Plywood and plastic tarp covering the drill holes to prevent mud and rain from entering the hole. GPS locations were made directly over the

  8. Gclust Server: 34445 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 34445 SCE_YKL214C=YRA2 Cluster Sequences Related Sequences(1) 203 Member of the REF (RNA and export factor...1.00e-25 0.0 0.0 0.0 0.0 0.0 37.5 Show 34445 Cluster ID 34445 Sequence ID SCE_YKL214C=YRA2 Link to cluster

  9. Functional promoter haplotypes of the human FAS gene are associated with the phenotype of SLE characterized by thrombocytopenia

    DEFF Research Database (Denmark)

    Nolsøe, R L; Kelly, J A; Pociot, F

    2005-01-01

    to SLE or subphenotypes in 126 multiplex American SLE pedigrees and found association of the FAS codon214 AC(C/T) as well as the FAS-670G>A'-codon214 AC(C/T)' haplotype to thrombocytopenia in SLE. Furthermore we have functionally characterized the FAS/FASL promoter polymorphisms associated with SLE...... variant, determines the promoter activity. We conclude that the FAS/FASL promoter haplotypes are functional and that polymorphisms in FAS may contribute to thrombocytopenia in SLE....

  10. Impaired pulmonary function after treatment for tuberculosis: the end of the disease?

    OpenAIRE

    Chushkin,Mikhail Ivanovich; Ots, Oleg Nikolayevich

    2017-01-01

    ABSTRACT Objective: To evaluate the prevalence of pulmonary function abnormalities and to investigate the factors affecting lung function in patients treated for pulmonary tuberculosis. Methods: A total of 214 consecutive patients (132 men and 82 women; 20-82 years of age), treated for pulmonary tuberculosis and followed at a local dispensary, underwent spirometry and plethysmography at least one year after treatment. Results: Pulmonary impairment was present in 102 (47.7%) of the 214 p...

  11. Study of Rn-222 exhalation in phosphogypsum through the adsorption technique in activated coal; Estudo da exalacao de Rn-222 em fosfogesso por meio da tecnica de adsorcao em carvao ativado

    Energy Technology Data Exchange (ETDEWEB)

    Nisti, Marcelo Bessa; Campos, Marcia Pires de, E-mail: mbnisti@ipen.b, E-mail: mpcampos@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-10-26

    The radon exhalation was estimated through the adsorption in activated carbon technique. Classified as TENORM, the radon exhalation determination on the phosphogypsum piles was performed through the adsorption ratio of radon in activated carbon, from the concentration of descendants of {sup 222}Rn, {sup 214}Pb and {sup 214}Bi obtained by gamma spectrometry. The results obtained in this work were compatibles with the values found in the literature

  12. 76 FR 76032 - Schedule of Fees for Consular Services, Department of State and Overseas Embassies and Consulates

    Science.gov (United States)

    2011-12-06

    ... States currently pay the Department of State a $330 application processing fee as well as a $74 immigrant....C. 1101 note, 1153 note, 1183a note, 1351, 1351 note, 1713, 1714, 1714 note; 10 U.S.C. 2602(c); 11 U.S.C. 1157 note; 22 U.S.C. 214, 214 note, 1475e, 2504(a), 4201, 4206, 4215, 4219, 6551; 31 U.S.C...

  13. Computed Tomography (CT) in civilian gunshot head injuries in ...

    African Journals Online (AJOL)

    Total 28 100.00. Table 3 Spectrum of CT findings and incidence in the 28 gunshot head injuries. CT findings Number %. Location of Bullet fragments. Intra parenchymal 20 66.6. Parietal lobe 9 32.1. Frontal lobe 6 21.4. Temporal lobe 3 10.7. Occipital lobe 2 7.1. Intraosseus 6 21.4. Both intraparenchymal and intraosseous 4 ...

  14. Optimizing MIBG therapy of neuroendocrine tumors: preclinical evidence of dose maximization and synergy

    Energy Technology Data Exchange (ETDEWEB)

    Mairs, Rob J. [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)], E-mail: r.mairs@beatson.gla.ac.uk; Boyd, Marie [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)

    2008-08-15

    [{sup 131}I]meta-Iodobenzylguanidine ([{sup 131}I]MIBG) has been used for the therapy of tumors of neuroectodermal origin since the 1980s. Its role in the management of these malignancies remains controversial because of the large variation in response rates. Appreciation of the mode of conveyance of [{sup 131}I]MIBG via the noradrenaline transporter into malignant cells and of factors that influence the activity of the uptake mechanism has indicated various ways in which the effectiveness of this type of targeted radiotherapy may be improved. Experimental observations indicate that radiolabeling of MIBG to high specific activity reduced the amount of cold competitor, thereby increasing tumor dose and minimizing pressor effects. We observed supra-additive tumor cell kill and inhibition of tumor growth following combined topotecan and [{sup 131}I]MIBG treatment. The improved efficacy is related to topotecan's increased disruption of DNA repair. Radiation damage to targeted tumors may also be enhanced by the use of the {alpha}-particle emitter [{sup 211}At]astatine rather than {sup 131}I as radiolabel. Furthermore, recent experimental findings indicate that [{sup 123}I]MIBG may have therapeutic potential over and above its utility as an imaging agent. It has recently been demonstrated that potent cytotoxic bystander effects were induced by the intracellular concentration of [{sup 131}I]MIBG, [{sup 123}I]MIBG or meta-[{sup 211}At]astatobenzylguanidine. Identification of the nature of bystander factors could be exploited to maximize the specificity and potency of MIBG-targeted radiotherapy. By employing a range of strategies, there are good prospects for the improvement of the [{sup 131}I]MIBG therapy of neuroectodermal tumors.

  15. Immuno-vectorization of radioelements emitters of alpha particles: a new therapy in cancerology; Immunovectorisation de radioelements emetteurs de particules alpha: une nouvelle voie therapeutique en cancerologie

    Energy Technology Data Exchange (ETDEWEB)

    Bourgeois, M

    2007-05-15

    The radio-immunotherapy is an anti cancerous therapy which consists in vectorising with immuno-specific agents very radio toxic radioelements on tumors or in their environment to destroy them. The first part of this report presents the different characteristics of antibodies as well as their means of production under monoclonal shapes specifically steered against a tumoral antigen of interest. The second part of this report replaces the importance of the immunological vectors in the context of the nuclear medicine. It is notably described that the different methods which allow to radio-label the vector, as well as the different ways of optimization which were envisaged to improve the targeting of radioelements on a tumor. These different developments allow to define the potential place of the alpha radio-immunotherapy in treatments and so re-place the interest of the experimental part. If the radio-immunotherapy, using beta emitters isotopes as the {sup 131}iodine or the{sup 90}yttrium, is today current in anti cancerous therapy, it finds limits because of the disintegration characteristics of the isotopes it uses. Indeed, compared with alpha particles, the beta particles deposit less energy by unit of length in the crossed material.The experimental part of this report aims at studying the feasibility of the coupling between an immunological vector and an alpha emitter isotope.The different tests led on the bismuth 213, the bismuth 212, the lead 212 and the astatine 211 demonstrated that the fixation of these radionuclides was possible. This research theme is strengthened by the construction in Nantes of a cyclotron with high energy ( A.R.R.O.N.A.X.) and the optimization of the obtained promising results should allow a therapeutic use in oncology of the alpha radio-immunotherapy. (N.C.)

  16. Locoregional therapy with α-emitting trastuzumab against peritoneal metastasis of human epidermal growth factor receptor 2-positive gastric cancer in mice.

    Science.gov (United States)

    Li, Huizi Keiko; Morokoshi, Yukie; Nagatsu, Kotaro; Kamada, Tadashi; Hasegawa, Sumitaka

    2017-08-01

    Peritoneal metastasis of gastric cancer (PMGC) is incurable and thus has an extremely poor prognosis. We have found, however, that locoregionally administered trastuzumab armed with astatine-211 ((211) At-trastuzumab) is effective against human epidermal growth factor receptor 2 (HER2)-positive PMGC in a xenograft mouse model. We first observed that (211) At-trastuzumab can specifically bind and effectively kill NCI-N87 (N87) cells, which are HER2-positive human metastatic GC cells, both in vitro and in s.c. tumors. We established a PMGC mouse model using N87 xenografts stably expressing luciferase to test α-particle radioimmunotherapy with (211) At-trastuzumab against PMGC. Biodistribution analysis in this PMGC mouse model revealed that the i.p. administration of (211) At-trastuzumab (1 MBq) was a more efficient means of delivery of (211) At into metastatic tumors than i.v. injection; the maximum tumor uptake with i.p. administration was over 60% injected dose per gram of tissue (%ID/g) compared to approximately 18%ID/g with i.v. injection. Surprisingly, a single i.p. injection of (211) At-trastuzumab (1 MBq) was sufficient to completely eradicate intraperitoneally disseminated HER2-positive GC xenografts in two of six treated mice by inducing DNA double-strand breaks, and to drastically reduce the tumor burden in another three mice. No bodyweight loss, leukocytopenia, or significant biochemical changes in liver or kidney function were observed in the treatment group. Accordingly, locoregionally administered (211) At-trastuzumab significantly prolonged the survival time of HER2-positive PMGC mice compared with control treatments. Our results provide a proof-of-concept demonstration that locoregional therapy with (211) At-trastuzumab may offer a new treatment option for HER2-positive PMGC. © 2017 The Authors. Cancer Science published by John Wiley & Sons Australia, Ltd on behalf of Japanese Cancer Association.

  17. Evaluation of cytotoxicity, morphological alterations and oxidative stress in Chinook salmon cells exposed to copper oxide nanoparticles.

    Science.gov (United States)

    Srikanth, Koigoora; Pereira, Eduarda; Duarte, Armando C; Rao, Janapala Venkateswara

    2016-05-01

    The current study is aimed to study cytotoxicity and oxidative stress mediated changes induced by copper oxide nanoparticles (CuO NPs) in Chinook salmon cells (CHSE-214). To this end, a number of biochemical responses are evaluated in CHSE-214 cells which are as follows [3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazoliumbromide] MTT, neutral red uptake (NRU), lactate dehydrogenase (LDH), protein carbonyl (PC), lipid peroxidation (LPO), oxidised glutathione (GSSG), reduced glutathione (GSH), glutathione peroxidase (GPx), glutathione sulfo-transferase (GST), superoxide dismutase (SOD), catalase (CAT), 8-Hydroxy-2'-deoxyguanosine (8-OHdG) and reactive oxygen species (ROS), respectively. The 50% inhibition concentration (IC50) of CuO NPs to CHSE-214 cells after 24 h exposure was found to be 19.026 μg ml(-1). Viability of cells was reduced by CuO NPs, and the decrease was dose dependent as revealed by the MTT and NRU assay. CHSE-214 cells exposed to CuO NPs induced morphological changes. Initially, cells started to detach from the surface (12 h), followed by polyhedric, fusiform appearance (19 h) and finally the cells started to shrink. Later, the cells started losing their cellular contents leading to their death only after 24 h. LDH, PC, LPO, GSH, GPx, GST, SOD, CAT, 8-OHdG and ROS responses were seen significantly increased with the increase in the concentration of CuO NPs when compared to their respective controls. However, significant decrease in GSSG was perceptible in CHSE-214 cells exposed to CuO NPs in a dose-dependent manner. Our data demonstrated that CuO NPs induced cytotoxicity in CHSE-214 cells through the mediation of oxidative stress. The current study provides a baseline for the CuO NPs-mediated cytotoxic assessment in CHSE-214 cells for the future studies.

  18. Comparative study on DOTA-derivatized bombesin analog labeled with {sup 90}Y and {sup 177}Lu: in vitro and in vivo evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Koumarianou, Eftychia [Institute R-RP, NCSR ' Demokritos' , Athens (Greece); IAE, Radioisotope Centre POLATOM, 05-400 Swierk-Otwock (Poland)], E-mail: eytyxiak@yahoo.com; Mikolajczak, Renata; Pawlak, Dariusz [IAE, Radioisotope Centre POLATOM, 05-400 Swierk-Otwock (Poland); Zikos, Xhristos; Bouziotis, Pinelopi [Institute R-RP, NCSR ' Demokritos' , Athens (Greece); Garnuszek, Piotr; Karczmarczyk, Urszula; Maurin, Michal [Department of Radiopharmaceuticals, National Medicines Institute, Chelmska 30/34, 00-725 Warsaw (Poland); Archimandritis, Spyridon C. [Institute R-RP, NCSR ' Demokritos' , Athens (Greece)

    2009-08-15

    Introduction: The aim of the study was to compare in vitro and in vivo a novel DOTA-chelated bombesin (BN) analog of the amino acid sequence, QRLGNQWAVGHLM-CONH{sub 2} (BN[2-14]NH{sub 2}), labeled with {sup 90}Y and {sup 177}Lu, for its potential use in targeted radiotherapy of tumors expressing gastrin releasing peptide (GRP) receptors. The same amino acid sequence, but with different chelator, referred as BN1.1 (Gly-Gly-Cys-Aca-QRLGNQWAVGHLM-CONH{sub 2}), has already been studied and reported; however, the DOTA-chelated one, suitable for labeling with M{sup +3} type radiometals, was not yet described. Methods: The conditions for labeling of DOTA-BN[2-14]NH{sub 2} with noncarrier added {sup 90}Y and with {sup 177}Lu [specific activity (SA), 15 Ci/mg Lu] were investigated and optimized to provide {sup 90}Y-DOTA-BN[2-14]NH{sub 2} and {sup 177}Lu-DOTA-BN[2-14]NH{sub 2} of high SA. The stability of the radiolabeled compounds in human serum was evaluated over a period of 24 h. The human prostate cancer cell line PC-3, known to express GRP receptors, was used for in vitro evaluation of radiolabeled peptide affinity to GRP receptors and for assessment of cytotoxicity of both nonlabeled and radiolabeled peptide. Biodistribution accompanied by receptor blocking was studied in normal Swiss mice. Results: {sup 90}Y-DOTA-BN[2-14]NH{sub 2} and {sup 177}Lu-DOTA-BN[2-14]NH{sub 2} were obtained with radiochemical yield >98% and high SA (67.3 GBq {sup 90}Y/{mu}mol and 33.6 GBq {sup 177}Lu/{mu}mol, respectively). They were stable when incubated in human serum for up to 24 h. The binding affinities of DOTA-BN[2-14]NH{sub 2} and both {sup nat}Y- and {sup nat}Lu-labeled analogs to GRP receptors were high (IC{sub 50}=1.78, 1.99, and 1.34 nM, respectively), especially for the {sup nat}Lu-DOTA-BN[2-14]NH{sub 2} complex. The cytotoxicity study of DOTA-BN[2-14]NH{sub 2} to PC-3 cells revealed an IC{sub 50}=6300 nM after 72 h of exposition, while the labeled derivatives showed no

  19. Behavior and environmental impacts of radionuclides during the hydrometallurgy of calcareous and argillaceous rocks, southwestern Sinai, Egypt.

    Science.gov (United States)

    El Aassy, Ibrahim E; Nada, Afaf A; El Galy, Mohamed M; El Feky, Mohamed G; Abd El Maksoud, Thanaa M; Talaat, Shadia M; Ibrahim, Eman M

    2012-06-01

    The hydrometallurgy of radionuclides means getting the radioelements from the rocks into solution by leaching, getting the radionuclides from the solution by extraction process, and then precipitation of the desired elements to obtain concentrate. The follow-up of the radionuclides during these processes is the main target of this work to identify the identity of the original samples, pregnant solutions (leachates), residuals and the concentrate. Six samples were chosen to achieve this work. The leaching process was carried out under the conditions; 20-30% acid (H(2)SO(4)) concentration, 1:3 solid/liquid ratios, 60 min stirring time at room temperature. The activity concentrations of (238)U, (235)U, (234)U, (226)Ra, (214)Pb, (214)Bi, (232)Th and (40)K were measured in the original samples, residuals and U-concentrate (Bq/kg), and leachates (Bq/ℓ). The results indicate that, the radionuclides before (226)Ra in the (238)U decay series are more leachable (released) than those from (226)Ra to (214)Bi in the order; (234)U>(238)U=(235)U > (226)Ra>(214)Pb>(214)Bi. (232)Th and (40)K are immobile under the present conditions. The radiological hazards of natural radioactivity in the original samples, leachates, residuals and U-concentrate were calculated and compared with the internationally recommended values and were found to be much higher than the world average values. Copyright © 2012 Elsevier Ltd. All rights reserved.

  20. In Situ Studies of the Temperature-Dependent Surface Structure and Chemistry of Single-Crystalline (001)-Oriented La 0.8 Sr 0.2 CoO 3−δ Perovskite Thin Films

    KAUST Repository

    Feng, Zhenxing

    2013-05-02

    Perovskites are used to promote the kinetics of oxygen electrocatalysis in solid oxide fuel cells and oxygen permeation membranes. Little is known about the surface structure and chemistry of perovskites at high temperatures and partial oxygen pressures. Combining in situ X-ray reflectivity (XRR) and in situ ambient pressure X-ray photoelectron spectroscopy (APXPS), we report, for the first time, the evolution of the surface structure and chemistry of (001)-oriented perovskite La0.8Sr0.2CoO 3-δ (LSC113) and (La0.5Sr 0.5)2CoO4+δ (LSC214)-decorated LSC113 (LSC113/214) thin films as a function of temperature. Heating the (001)-oriented LSC113 surface leads to the formation of surface LSC214-like particles, which is further confirmed by ex situ Auger electron spectroscopy (AES). In contrast, the LSC113/214 surface, with activities much higher than that of LSC 113, is stable upon heating. Combined in situ XRR and APXPS measurements support that Sr enrichment may occur at the LSC113 and LSC214 interface, which can be responsible for its markedly enhanced activities. © 2013 American Chemical Society.

  1. Functional roles of carboxylate residues comprising the DNA polymerase active site triad of Ty3 reverse transcriptase.

    Science.gov (United States)

    Bibillo, Arkadiusz; Lener, Daniela; Klarmann, George J; Le Grice, Stuart F J

    2005-01-01

    Aspartic acid residues comprising the -D-(aa) n -Y-L-D-D- DNA polymerase active site triad of reverse transcriptase from the Saccharomyces cerevisiae long terminal repeat-retrotransposon Ty3 (Asp151, Asp213 and Asp214) were evaluated via site-directed mutagenesis. An Asp151-->Glu substitution showed a dramatic decrease in catalytic efficiency and a severe translocation defect following initiation of DNA synthesis. In contrast, enzymes harboring the equivalent alteration at Asp213 and Asp214 retained DNA polymerase activity. Asp151-->Asn and Asp213-->Asn substitutions eliminated both polymerase activities. However, while Asp214 of the triad could be replaced by either Asn or Glu, introducing Gln seriously affected processivity. Mutants of the carboxylate triad at positions 151 and 213 also failed to catalyze pyrophosphorolysis. Finally, alterations to the DNA polymerase active site affected RNase H activity, suggesting a close spatial relationship between these N- and C-terminal catalytic centers. Taken together, our data reveal a critical role for Asp151 and Asp213 in catalysis. In contrast, the second carboxylate of the Y-L-D-D motif (Asp214) is not essential for catalysis, and possibly fulfills a structural role. Although Asp214 was most insensitive to substitution with respect to activity of the recombinant enzyme, all alterations at this position were lethal for Ty3 transposition.

  2. Investigation on the development of measurement techniques, the behavior in the environment and the estimation of internal radiation dose by inhalation for some typical atmospheric radionuclides

    Energy Technology Data Exchange (ETDEWEB)

    Amano, Hikaru [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1996-06-01

    Radionuclides in surface atmosphere on the earth are {sup 222}Rn, {sup 220}Rn and their short lived progeny, {sup 7}Be, {sup 85}Kr, {sup 3}H, {sup 14}C, {sup 137}Cs, {sup 90}Sr and so on. In this paper, among them, {sup 222}Rn, their short lived progeny ({sup 218}Po, {sup 214}Pb, {sup 214}Bi, {sup 214}Po), {sup 7}Be, {sup 3}H, and {sup 90}Sr are focused on as follows based on the experimental and observed results, 1. Development of their measurement techniques, 2. Analysis of their variation of atmospheric concentration with time and places, 3. Analysis of their interaction characteristics with surface environment including plants, 4. Estimation of internal radiation doses by inhalation of them. (author). 228 refs.

  3. The Impact of Radio Frequency Interference (RFI) on VLBI2010

    Science.gov (United States)

    Petrachenko, William

    2010-01-01

    A significant motivation for the development of a next generation system for geodetic VLBI was to address growing problems related to RFI. In this regard, the broadband 2-14 GHz frequency range proposed for VLBI2010 has advantages and disadvantages. It has the advantage of flexible allocation of band frequencies and hence the ability to avoid areas of the spectrum where RFI is worst. However, the receiver is at the same time vulnerable to saturation from RFI anywhere in the full 2-14 GHz range. The impacts of RFI on the VLBI2010 analog signal path, the sampler, and the digital signal processing are discussed. In addition, a number of specific RFI examples in the 2-14 GHz range are presented.

  4. Triterpenoid biosynthesis in tissue cultures of Glycyrrhiza glabra var. glandulifera.

    Science.gov (United States)

    Ayabe, S; Takano, H; Fujita, T; Furuya, T; Hirota, H; Takahashi, T

    1990-08-01

    The incorporation of [1-(14)C]acetate and [2(14) C]mevalonate into free and esterified triterpen-3-ols was examined in original plant organs and tissue cultures of Glycyrrhiza glabra var. glandulifera. Both substrates labeled β-amyrin, an oleanane-type triterpene, and cycloartenol and 24-methylenecycloartanol, both of which are intermediates of phytosterol biosynthesis. The label in esterified triterpenes was distributed mainly in phytosterol intermediates, but not in β-amyrin. The ratio of βamyrin formation among the three triterpenes from [2-(14)C]mevalonate was relatively high in stolon segments and in root cultures, but negligible in callus cultures. Administration of a specific inhibitor of squalene-2, 3-epoxide:cycloartenol (lanosterol) cyclase caused a marked increase of β-amyrin synthesis in root suspension cultures, and of 24-methylenecycloartanol synthesis in cell suspension cultures, from [2-(14)C]mevalonate.

  5. A 'delayed' counting method to determine indoor Rn-222 levels indirectly

    CERN Document Server

    Iannopollo, V; Trimarchi, M; Tripepi, M G; Vermiglio, G

    2001-01-01

    A new indirect and 'delayed' way is presented to determine indoor concentration of Rn-222 by best-fitting methods. If a rapid knowledge of Rn-222 levels is required and if a detection system is not available in situ, it is possible to obtain concentration of radioactive gas by determining of 'delayed' counts of Po-214. The 'delay' time consists of two or three hours. The method is based on the use of cellulose filters for particulate collection and on the analysis of samples by alpha spectroscopy. It is also possible to obtain concentrations of short-lived radon daughters Po-218, Pb-214, Bi-214, which are very important quantities in a medical framework.

  6. Daily variation of radon gas and its short-lived progeny concentration near ground level and estimation of aerosol residence time

    Science.gov (United States)

    M, Mohery; A, M. Abdallah; A, Ali; S, S. Baz

    2016-05-01

    Atmospheric concentrations of radon (222Rn) gas and its short-lived progenies 218Po, 214Pb, and 214Po were continuously monitored every four hours at the ground level in Jeddah city, Kingdom of Saudi Arabia. The measurements were performed three times every week, starting from November 2014 to October 2015. A method of electrostatic precipitation of positively charged 218Po and 214Po by a positive voltage was applied for determining 222Rn gas concentration. The short-lived 222Rn progeny concentration was determined by using a filter holder connected with the alpha-spectrometric technique. The meteorological parameters (relative air humidity, air temperature, and wind speed) were determined during the measurements of 222Rn and its progeny concentrations. 222Rn gas as well as its short-lived progeny concentration display a daily and seasonal variation with high values in the night and early morning hours as compared to low values at noon and in the afternoon. The observed monthly atmospheric concentrations showed a seasonal trend with the highest values in the autumn/winter season and the lowest values in the spring/summer season. Moreover, and in parallel with alpha-spectrometric measurements, a single filter-holder was used to collect air samples. The deposited activities of 214Pb and the long-lived 222Rn daughter 210Pb on the filter were measured with the gamma spectrometric technique. The measured activity concentrations of 214Pb by both techniques were found to be relatively equal largely. The highest mean seasonally activity concentrations of 210Pb were observed in the autumn/winter season while the lowest mean were observed in the spring/summer season. The mean residence time (MRT) of aerosol particles in the atmospheric air could be estimated from the activity ratios of 210Pb/214Pb. Project supported by the Deanship of Scientific Research (DSR), King Abdulaziz University, Jeddah (Grant No. 291/965/1434).

  7. Glasgow Coma Scores, Early Opioids, and Posttraumatic Stress Disorder Among Combat Amputees

    Science.gov (United States)

    2014-04-01

    associated with adjustment, anxiety, or substance abuse disorders. Among military service members, combat injury is signif- icantly associated with increased...psychological diagnoses were grouped as adjustment, anxiety, mood, substance abuse disorders, and other psychological diagnoses. Other psychological diagnoses...n % 15% 50% 85% Antibiotics 241 93.4 Cefazolin 214 82.9 185 of 214 86.4 1.00 g 1.00 g 2.00 g Paralytics 85 32.9 Succinylcholine 84 32.6 61 of 84 72.6

  8. Submicron E-Beam Lithography Utilizing A Positive Novolac-Based Resist

    Science.gov (United States)

    Tang, Patrick P.

    1988-06-01

    A positive novolac-based resist, WX-214, developed by Olin Hunt Chemical, has been investigated for use with the commercial electron beam lithography systems, AEBLE 150 and MEBES III. The WX-214 yielded a sensitivity of 16 pC/cm2, a high resolution of 0.25μm lines and spaces, and an excellent dry etching resistance for pattern transfer. The results on the characterization of the resist and the development of a process for thin and thick films are presented.

  9. Propionate Exchange Reactions in Methanogenic Ecosystems †

    Science.gov (United States)

    Boone, David R.

    1984-01-01

    Propionate degradation was measured with [1-14C]- and [2-14C]propionate in an anaerobic digestor. When [1-14C]propionate was used, label disappeared more rapidly from the propionate pool than when [2-14C]propionate was used. This indicated that an exchange reaction involving the carboxyl group of propionate occurred. Labeled propionate added to digestor samples which were equilibrated with H2 lost label from the carboxyl group but not from the methylene group. PMID:16346651

  10. Safety evaluation for packaging (onsite) SERF cask

    Energy Technology Data Exchange (ETDEWEB)

    Edwards, W.S.

    1997-10-24

    This safety evaluation for packaging (SEP) documents the ability of the Special Environmental Radiometallurgy Facility (SERF) Cask to meet the requirements of WHC-CM-2-14, Hazardous Material Packaging and Shipping, for transfer of Type B quantities (up to highway route controlled quantities) of radioactive material within the 300 Area of the Hanford Site. This document shall be used to ensure that loading, tie down, transport, and unloading of the SERF Cask are performed in accordance with WHC-CM-2-14. This SEP is valid until October 1, 1999. After this date, an update or upgrade to this document is required.

  11. Dicty_cDB: CHJ224 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Cri2_13_B20_SP6 Ceratopteris Spore Library Ceratopteris richardii cDNA clone Cri2_13_B20 5', mRNA sequence. 34...Cri2_11_F13_SP6 Ceratopteris Spore Library Ceratopteris richardii cDNA clone Cri2_11_F13 5', mRNA sequence. 34...Cri2_14_L15_SP6 Ceratopteris Spore Library Ceratopteris richardii cDNA clone Cri2_14_L15 5', mRNA sequence. 34

  12. Environmental Assessment for the Construction and Operation of a Shopping Center at Kirtland Air Force Base, Albuquerque, Bernalillo County, New Mexico

    Science.gov (United States)

    2010-09-01

    820 Shopping Center (Proposed Shopping Center) 95.4 6,586 93 59 152 291 316 607 850 Supermarket (Commissary) 107.7 11,011 214 137 350 574 551 1,125...Pharmacy/Drugstore with Drive-thru Window (Satellite Pharmacy) (a) 1.5 132 2 2 4 6 7 13 850 Supermarket (Commissary) 107.7 11,011 214 137 350...Center on the installation. The center will include retail shopping space, a merchandise processing area, and a Food/Concession Mall. The project

  13. Ramadan fasting does not adversely affect neuromuscular performances and reaction times in trained karate athletes.

    Science.gov (United States)

    Zarrouk, Nidhal; Hammouda, Omar; Latiri, Imed; Adala, Hela; Bouhlel, Ezzedine; Rebai, Haithem; Dogui, Mohamed

    2016-01-01

    The present study aimed to investigate the concomitant effects of Ramadan intermittent fast (RIF) and muscle fatigue on neuromuscular performances and reaction times in young trained athletes. Eight karate players (17.2 ± 0.5 years) were tested on three sessions: during a control period (S1: one week before Ramadan), and during the first (S2) and the fourth week of RIF (S3). Dietary intake and anthropometric measurements were assessed before each session. During each test session, participants performed maximal voluntary isometric contractions (MVC) and a submaximal contraction at 75 % MVC until exhaustion (T lim ) of the right elbow flexors. Surface electromyography was recorded from biceps brachii muscle during MVC and T lim . Simple (SRT) and choice (CRT) reaction times were evaluated at rest and just after T lim in a random order. The total daily energy (S2: +19.5 %, p < 0.05; S3: +27.4 %, p < 0.01) and water (S2: +26.8 %, p < 0.01; S3: +23.2 %, p < 0.05) intake were significantly increased during RIF. However, neither body mass nor body mass index was altered by RIF (F (2,14) = 0.80, p = 0.47 and F (2,14) = 0.78, p = 0.48, respectively). In addition, T lim (F (2,14) = 2.53, p = 0.12), MVC (F (2,14) = 0.51, p = 0.61) and associated electrical activity (F (2,14) = 0.13, p = 0.88) as well as neuromuscular efficiency (F (2,14) = 0.27, p = 0.76) were maintained during RIF. Moreover, neither SRT nor CRT was affected by RIF (F (2,14) = 1.82, p = 0.19 and F (2,14) = 0.26, p = 0.78, respectively) or neuromuscular fatigue (F (1,7) = 0.0002, p = 0.98 and F (1,7) = 3.78, p = 0.09, respectively). The present results showed that RIF did not adversely affect the neuromuscular performances and anthropometric parameters of elite karate athletes who were undertaking their usual training schedule. In addition, neither RIF nor neuromuscular fatigue poorly affects reaction

  14. AcEST: DK947833 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ike protein (Fragment) OS=Fritillaria liliacea PE=3 SV=1 Length = 214 Score = 89....3_FRILI Histone-like protein (Fragment) OS=Fritillaria liliacea PE=3 SV=1 Length = 214 Score = 89.4 bits (22...stone-like protein (Fragment) OS=Fritillaria liliacea PE=3 SV=1 Length = 211 Scor...Q94EU3_FRILI Histone-like protein (Fragment) OS=Fritillaria liliacea PE=3 SV=1 Length = 199 Score = 89.0 bit... Histone-like protein (Fragment) OS=Fritillaria liliacea PE=3 SV=1 Length = 211 S

  15. Functional roles of carboxylate residues comprising the DNA polymerase active site triad of Ty3 reverse transcriptase

    OpenAIRE

    Bibillo, Arkadiusz; Lener, Daniela; Klarmann, George J.; Le Grice, Stuart F. J.

    2005-01-01

    Aspartic acid residues comprising the -D-(aa) n -Y-L-D-D- DNA polymerase active site triad of reverse transcriptase from the Saccharomyces cerevisiae long terminal repeat-retrotransposon Ty3 (Asp151, Asp213 and Asp214) were evaluated via site-directed mutagenesis. An Asp151→Glu substitution showed a dramatic decrease in catalytic efficiency and a severe translocation defect following initiation of DNA synthesis. In contrast, enzymes harboring the equivalent alteration at Asp213 and Asp214 ret...

  16. Corrigendum: A miniature fiber-optic temperature sensor based on a Fabry-Perot interferometer Corrigendum: A miniature fiber-optic temperature sensor based on a Fabry-Perot interferometer

    Science.gov (United States)

    Rong, Qiangzhou; Sun, Hao; Qiao, Xueguang; Zhang, Jing; Hu, Manli; Feng, Zhongyao

    2012-05-01

    In the third line from the bottom of the right column on page 3, 'The solution is 1.151 x 10-4 °C' should be amended to 'The resolution is 1.153 x 10-1 °C'. In the eighth line from the bottom of the left column on page 4, '321.9 nm °C-1 (L = 19.49 μm), 214.66 nm °C-1' should be amended to '321.9 pm °C-1 (L = 19.49 μm), 214.66 pm °C-1'.

  17. Quantitative Single-Particle Digital Autoradiography with α-Particle Emitters for Targeted Radionuclide Therapy using the iQID Camera

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Brian W.; Frost, Sophia; Frayo, Shani; Kenoyer, Aimee L.; Santos, E. B.; Jones, Jon C.; Green, Damian J.; Hamlin, Donald K.; Wilbur, D. Scott; Fisher, Darrell R.; Orozco, Johnnie J.; Press, Oliver W.; Pagel, John M.; Sandmaier, B. M.

    2015-07-01

    Abstract Alpha emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50–80 μm) causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with alpha emitters may inactivate targeted cells with minimal radiation damage to surrounding tissues. For accurate dosimetry in alpha-RIT, tools are needed to visualize and quantify the radioactivity distribution and absorbed dose to targeted and non-targeted cells, especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, iQID (ionizing-radiation Quantum Imaging Detector), for use in alpha-RIT experiments. Methods: The iQID camera is a scintillator-based radiation detection technology that images and identifies charged-particle and gamma-ray/X-ray emissions spatially and temporally on an event-by-event basis. It employs recent advances in CCD/CMOS cameras and computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, we evaluated this system’s characteristics for alpha particle imaging including measurements of spatial resolution and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 (211At) activity distributions in cryosections of murine and canine tissue samples. Results: The highest spatial resolution was measured at ~20 μm full width at half maximum (FWHM) and the alpha particle background was measured at a rate of (2.6 ± 0.5) × 10–4 cpm/cm2 (40 mm diameter detector area). Simultaneous imaging of multiple tissue sections was performed using a large-area iQID configuration (ø 11.5 cm

  18. Quantitative single-particle digital autoradiography with α-particle emitters for targeted radionuclide therapy using the iQID camera

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Brian W., E-mail: brian.miller@pnnl.gov [Pacific Northwest National Laboratory, Richland, Washington 99354 and College of Optical Sciences, The University of Arizona, Tucson, Arizona 85719 (United States); Frost, Sofia H. L.; Frayo, Shani L.; Kenoyer, Aimee L.; Santos, Erlinda; Jones, Jon C.; Orozco, Johnnie J. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 (United States); Green, Damian J.; Press, Oliver W.; Pagel, John M.; Sandmaier, Brenda M. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 and Department of Medicine, University of Washington, Seattle, Washington 98195 (United States); Hamlin, Donald K.; Wilbur, D. Scott [Department of Radiation Oncology, University of Washington, Seattle, Washington 98195 (United States); Fisher, Darrell R. [Dade Moeller Health Group, Richland, Washington 99354 (United States)

    2015-07-15

    Purpose: Alpha-emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50–80 μm), causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with α emitters may thus inactivate targeted cells with minimal radiation damage to surrounding tissues. Tools are needed to visualize and quantify the radioactivity distribution and absorbed doses to targeted and nontargeted cells for accurate dosimetry of all treatment regimens utilizing α particles, including RIT and others (e.g., Ra-223), especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, the ionizing-radiation quantum imaging detector (iQID) camera, for use in α-RIT experiments. Methods: The iQID camera is a scintillator-based radiation detection system that images and identifies charged-particle and gamma-ray/x-ray emissions spatially and temporally on an event-by-event basis. It employs CCD-CMOS cameras and high-performance computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, the authors evaluated its characteristics for α-particle imaging, including measurements of intrinsic detector spatial resolutions and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 ({sup 211}At) activity distributions in cryosections of murine and canine tissue samples. Results: The highest spatial resolution was measured at ∼20 μm full width at half maximum and the α-particle background was measured at a rate as low as (2.6 ± 0.5) × 10{sup −4} cpm/cm{sup 2} (40 mm diameter detector area

  19. α-Imaging Confirmed Efficient Targeting of CD₄₅-Positive Cells After ²¹¹At-Radioimmunotherapy for Hematopoietic Cell Transplantation

    Energy Technology Data Exchange (ETDEWEB)

    Frost, Sophia; Miller, Brian W.; Back, Tom; Santos, E. B.; Hamlin, Donald K.; Knoblaugh, E.; Frayo, Shani; Kenoyer, Aimee L.; Storb, Rainer; Press, O. W.; Wilbur, D. Scott; Pagel, John M.; Sandmaier, B. M.

    2015-09-03

    Alpha-radioimmunotherapy (α-RIT) targeting CD45 may substitute for total body irradiation in hematopoietic cell transplantation (HCT) preparative regimens for lymphoma. Our goal was to optimize the anti-CD45 monoclonal antibody (MAb; CA12.10C12) protein dose for astatine-²¹¹(²¹¹At)-RIT, extending the analysis to include intra-organ ²¹¹At activity distribution and α-imaging-based small-scale dosimetry, along with imunohistochemical staining. Methods: Eight normal dogs were injected with either 0.75 (n=5) or 1.00 mg/kg (n=3) of ²¹¹At-B10-CA12.10C12 (11.5–27.6 MBq/kg). Two were euthanized and necropsied 19–22 hours postinjection (p.i.), and six received autologous HCT three days after ²¹¹At-RIT, following lymph node and bone marrow biopsies at 2–4 and/or 19 hours p.i. Blood was sampled to study toxicity and clearance; CD45 targeting was evaluated by flow cytometry. ²¹¹At localization and small scale dosimetry were assessed using two α-imaging : α-camera and iQID. Results: Uptake of ²¹¹At was highest in spleen (0.31–0.61 %IA/g), lymph nodes (0.02–0.16 %IA/g), liver (0.11–0.12 %IA/g), and marrow (0.06–0.08 %IA/g). Lymphocytes in blood and marrow were efficiently targeted using either MAb dose. Lymph nodes remained unsaturated, but displayed targeted ²¹¹At localization in T lymphocyte-rich areas. Absorbed doses to blood, marrow, and lymph nodes were estimated at 3.9, 3.0, and 4.2 Gy/210 MBq, respectively. All transplanted dogs experienced transient hepatic toxicity. Liver enzyme levels were temporarily elevated in 5 of 6 dogs; 1 treated with 1.00 mg MAb/kg developed ascites and was euthanized 136 days after HCT. Conclusion: ²¹¹At-anti-CD45 RIT with 0.75 mg MAb/kg efficiently targeted blood and marrow without severe toxicity. Dosimetry calculations and observed radiation-induced effects indicated that sufficient ²¹¹At-B10-CA12.10C12 localization was achieved for efficient conditioning for HCT.

  20. The role of alpha therapy for local and systemic treatment of cancer

    Energy Technology Data Exchange (ETDEWEB)

    Allen, B.J. [St George Hospital, Kogarah, NSW (Australia)

    1998-03-01

    Major problems in the management of cancer relate to the inability to control some primary lesions, e.g. glioblastoma multiforme (GBM), and the inability to deal with metastatic cancer arising from malignant cancers such as melanoma, breast and other cancers. Binary alpha therapy using neutron capture in boron-10 offers the potential for improved prognosis for high grade brain tumours such as GBM and melanoma metastases to the brain. Metastatic cancer proceeds through a number of quite separate stages in the development of lethal disease, i e. cells in transit, preangiogenic lesions, subclinical and clinical lesions. Early stages offer the potential for control if targeted alpha therapy is applied. However, the dose must be localised to the cancer cell and this requirement rules out beta-emitting radionuclides, which are more suited for clinical lesions. Alpha-emitting radionuclides are the most appropriate toxins, as their efficacy depends on the linear energy transfer (LET) and range of the alpha particles. After matching the cancer stage, radiolabel and carrier, we find that {sup 149}Tb is the radionuclide of choice for systemic therapy in all aspects except production. The production of {sup 149}Tb in {mu}Ci (kBq) quantities has been achieved using the heavy ion reaction at the ANU tandem accelerator at Canberra and in multi-mCi (MBq) quantities using the spallation reaction in combination with on-line isotope separation technology of ISOLDE at CERN. Terbium is ideally suited for chelation to monoclonal antibodies to produce stable radio-immunoconjugates (RIC). Astatine-211 is a halide and has potential for the elimination of early stage melanoma metastases as At-MTB. However, the availability of the alpha generators {sup 228}Th-{sup 212}Bi and {sup 225}Ac-{sup 213}Bi facilitates the use of Bi-RIC in clinical trials for acute myeloid leukaemia and cystic glioma. Alpha therapy has the potential to control refractory cancers when treated at the minimum residual