Energy Technology Data Exchange (ETDEWEB)
Ruth, T J; Dombsky, M; D' Auria, J M; Ward, T E
1988-01-01
This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs. (DLC)
Discovery of the astatine, radon, francium, and radium isotopes
Energy Technology Data Exchange (ETDEWEB)
Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu
2013-09-15
Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.
Discovery of the astatine, radon, francium, and radium isotopes
Fry, C
2012-01-01
Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.
Discovery of the astatine, radon, francium, and radium isotopes
Fry, C.; Thoennessen, M.
2013-09-01
Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.
Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line
Energy Technology Data Exchange (ETDEWEB)
Uusitalo, J.; Jakobsson, U. [Department of Physics, University of Jyvaeskylae (Finland); Collaboration: RITU-Gamma Gollaboration
2011-11-30
Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.
Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line
Uusitalo, J.; Jakobsson, U.
2011-11-01
Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.
Measurement of the first ionization potential of astatine by laser ionization spectroscopy
Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A
2013-01-01
The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.
Measurement of the first ionization potential of astatine by laser ionization spectroscopy.
Rothe, S; Andreyev, A N; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yuri; Köster, U; Lane, J F W; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt, K D A
2013-01-01
The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine.
Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei
Energy Technology Data Exchange (ETDEWEB)
Jakobsson, U., E-mail: ulrjak@kth.se; Cederwall, B. [KTH, The Division of Nuclear Physics, AlbaNova University Center, SE-10691 Stockholm (Sweden); Uusitalo, J.; Auranen, K.; Badran, H.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; Herzáň, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J. [University of Jyvaskyla, Department of Physics, P.O. Box 35, FI-40014 University of Jyvaskyla (Finland); and others
2015-10-15
Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2{sup +} state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2{sup +} state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2{sup +} state and the spherical 9/2{sup −} ground state in {sup 203}Fr and {sup 205}Fr.
Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei
Jakobsson, U.; Uusitalo, J.; Auranen, K.; Badran, H.; Cederwall, B.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; HerzáÅ, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J.; Scholey, C.; Sorri, J.; Stolze, S.
2015-10-01
Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2+ state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2+ state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2+ state and the spherical 9/2- ground state in 203Fr and 205Fr.
Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials
DEFF Research Database (Denmark)
Aneheim, Emma; Albertsson, Per; Bäck, Tom
2015-01-01
To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...
Measurement of the first ionization potential of astatine by laser ionization spectroscopy
Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Koester, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjoedin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.
The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical
An attempt to explore the production routes of Astatine radionuclides: Theoretical approach
Maiti, Moumita; Lahiri, Susanta
2008-01-01
In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...
DEFF Research Database (Denmark)
Aneheim, Emma; Gustafsson, Anna; Albertsson, Per
2016-01-01
Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even sing...... of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies....
Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag
2017-01-01
Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.
Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical
Energy Technology Data Exchange (ETDEWEB)
Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)
2008-12-15
No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.
Determination of the electron affinity of astatine and polonium by laser photodetachment
We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.
Adsorption of the astatine species on a gold surface: A relativistic density functional theory study
Demidov, Yuriy; Zaitsevskii, Andréi
2018-01-01
We report first-principle based studies of the adsorption interaction of astatine species on a gold surface. These studies are aimed primarily at the support and interpretation of gas chromatographic experiments with superheavy elements, tennessine (Ts, Z = 117), a heavier homologue of At, and possibly its pseudo-homologue nihonium (Nh, Z = 113). We use gold clusters with up to 69 atoms to simulate the adsorption sites and estimate the desorption energies of At & AtOH from a stable gold (1 1 1) surface. To describe the electronic structure of At -Aun and AtOH -Aun complexes, we combine accurate shape-consistent relativistic pseudopotentials and non-collinear two-component relativistic density functional theory. The predicted desorption energies of At and AtOH on gold are 130 ± 10 kJ/mol and 90 ± 10 kJ/mol, respectively. These results confirm the validity of the estimates derived from chromatographic data (147 ± 15 kJ/mol for At, and 100-10+20 kJ/mol for AtOH).
ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS
Energy Technology Data Exchange (ETDEWEB)
MICHAEL R. ZALUTSKY
2012-08-08
Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At
Energy Technology Data Exchange (ETDEWEB)
Rothe, Sebastian
2012-09-24
This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.
Rothe, Sebastian; Nörtershäuser, W
This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.
42 CFR 456.213 - Confidentiality.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Confidentiality. 456.213 Section 456.213 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED...: Informational Requirements § 456.213 Confidentiality. The UR plan must provide that the identities of individual...
7 CFR 3565.213 - Geographic distribution.
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Geographic distribution. 3565.213 Section 3565.213 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, DEPARTMENT OF AGRICULTURE GUARANTEED RURAL RENTAL HOUSING PROGRAM Loan Requirements § 3565.213 Geographic distribution. The...
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Aliens. 21.3 Section 21.3 Judicial Administration DEPARTMENT OF JUSTICE WITNESS FEES § 21.3 Aliens. (a) Aliens entitled to payment of $30 per day. The following aliens are entitled to witness fees and allowances provided in § 21.4: (1) Aliens...
7 CFR 1400.213 - Military personnel.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Military personnel. 1400.213 Section 1400.213... AND SUBSEQUENT CROP, PROGRAM, OR FISCAL YEARS Payment Eligibility § 1400.213 Military personnel. If a person is called to active duty in the military before a determination is made that the person is...
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Policies. 213.7 Section 213.7 Telecommunication OFFICE OF SCIENCE AND TECHNOLOGY POLICY AND NATIONAL SECURITY COUNCIL GOVERNMENT AND PUBLIC CORRESPONDENCE TELECOMMUNICATIONS PRECEDENCE SYSTEM § 213.7 Policies. (a) Calls and messages in each precedence...
25 CFR 2.13 - Filing documents.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Filing documents. 2.13 Section 2.13 Indians BUREAU OF... § 2.13 Filing documents. (a) An appeal document is properly filed with an official of the Bureau of... for receipt of mail addressed to the official; the document is considered filed by mail on the date...
47 CFR 80.213 - Modulation requirements.
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Modulation requirements. 80.213 Section 80.213... MARITIME SERVICES General Technical Standards § 80.213 Modulation requirements. (a) Transmitters must meet the following modulation requirements: (1) When double sideband emission is used the peak modulation...
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Compliance. 213.6 Section 213.6 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS TERMS, CONDITIONS AND LIMITATIONS OF FOREIGN AIR CARRIER PERMITS § 213.6 Compliance. Any violation...
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Reports. 171.213 Section 171.213... FACILITIES NON-FEDERAL NAVIGATION FACILITIES VHF Marker Beacons § 171.213 Reports. The owner of each facility to which this subpart applies shall make the following reports, at the times indicated, to the...
2010-10-01
... 49 Transportation 5 2010-10-01 2010-10-01 false Pueblo, CO. 372.213 Section 372.213 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL MOTOR CARRIER SAFETY ADMINISTRATION... TERMINAL AREAS Commercial Zones § 372.213 Pueblo, CO. The zone adjacent to, and commercially a part of...
7 CFR 920.213 - Assessment rate.
2010-01-01
... 7 Agriculture 8 2010-01-01 2010-01-01 false Assessment rate. 920.213 Section 920.213 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE KIWIFRUIT GROWN IN CALIFORNIA Miscellaneous Provisions § 920.213 Assessment...
25 CFR 213.48 - Effective date.
2010-04-01
... FIVE CIVILIZED TRIBES, OKLAHOMA, FOR MINING Removal of Restrictions § 213.48 Effective date. The regulations in this part shall become effective and in full force from and after the date of approval (Apr. 27... 25 Indians 1 2010-04-01 2010-04-01 false Effective date. 213.48 Section 213.48 Indians BUREAU OF...
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Rail joints. 213.121 Section 213.121..., DEPARTMENT OF TRANSPORTATION TRACK SAFETY STANDARDS Track Structure § 213.121 Rail joints. (a) Each rail joint, insulated joint, and compromise joint shall be of a structurally sound design and dimensions for...
29 CFR 780.213 - Produce business.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Produce business. 780.213 Section 780.213 Labor Regulations... Specific Situations Hatchery Operations § 780.213 Produce business. In some instances, hatcheries also engage in the produce business as such and commingle with the culled eggs and chickens other eggs and...
2010-10-01
... 47 Telecommunication 4 2010-10-01 2010-10-01 false Lotteries. 76.213 Section 76.213... CABLE TELEVISION SERVICE Cablecasting § 76.213 Lotteries. (a) No cable television system operator... any lottery, gift, enterprise, or similar scheme, offering prizes dependent in whole or in part upon...
32 CFR 213.5 - Responsibilities.
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 213.5 Section 213.5 National... SUPPORT FOR NON-FEDERAL ENTITIES AUTHORIZED TO OPERATE ON DOD INSTALLATIONS § 213.5 Responsibilities. (a... of non-Federal entities on DoD installations. (3) Assign responsibilities to the DoD Components to...
7 CFR 62.213 - Official identification.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Official identification. 62.213 Section 62.213... AGRICULTURAL COMMODITIES (QUALITY SYSTEMS VERIFICATION PROGRAMS) Quality Systems Verification Programs Definitions Service § 62.213 Official identification. The following, as shown in figure 1, constitutes...
47 CFR 101.213 - Station identification.
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Station identification. 101.213 Section 101.213 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES FIXED MICROWAVE SERVICES Operational Requirements § 101.213 Station identification. Stations in these services are exempt...
2010-01-01
... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Advertising. 213.7 Section 213.7 Banks and... (REGULATION M) § 213.7 Advertising. (a) General rule. An advertisement for a consumer lease may state that a... paragraph (d)(1) of this section shall also state the following items: (i) That the transaction advertised...
Energy Technology Data Exchange (ETDEWEB)
Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)
2011-12-14
The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLB213 (Link to dictyBase) - - - Contig-U15036-1 SLB213E (Link to Original site) SLB...213F 592 SLB213Z 585 SLB213P 1177 SLB213E 1112 Show SLB213 Library SL (Link to library) Clone ID SLB...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLB2-A/SLB213Q.Seq.d/ Representative seq. ID SLB...213E (Link to Original site) Representative DNA sequence >SLB213 (SLB213Q) /CSM/SL/SLB2-A/SLB...A Score E Sequences producing significant alignments: (bits) Value SLB213 (SLB213Q) /CSM/SL/SLB2-A/SLB
24 CFR 213.269 - Endorsement of supplementary loans.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Endorsement of supplementary loans. 213.269 Section 213.269 Housing and Urban Development Regulations Relating to Housing and Urban... Endorsement of supplementary loans. The provisions of §§ 213.266, 213.267, and 213.268 shall apply to...
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Institution. 93.213 Section 93.213 Public Health... STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH... or other research institutes, small research institutions, and independent researchers. ...
31 CFR 800.213 - Foreign government.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Foreign government. 800.213 Section 800.213 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF INVESTMENT SECURITY, DEPARTMENT OF THE TREASURY REGULATIONS PERTAINING TO MERGERS, ACQUISITIONS, AND...
Energy Technology Data Exchange (ETDEWEB)
Basunia, M. S.
2007-03-01
Evaluated spectroscopic data and level schemes from radioactive decay and nuclear reaction studies are presented for all nuclei with mass number A=213. This evaluation for A=213 supersedes the earlier one by Y. A. Akovali (1992Ak01), published in Nuclear Data Sheets 66, 237 (1992).
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Rail joints. 213.351 Section 213.351... Rail joints. (a) Each rail joint, insulated joint, and compromise joint shall be of a structurally sound design and dimensions for the rail on which it is applied. (b) If a joint bar is cracked, broken...
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLJ213 (Link to dictyBase) - - - Contig-U16382-1 SLJ213P (Link to Original site) SLJ...213F 169 SLJ213Z 101 SLJ213P 270 - - Show SLJ213 Library SL (Link to library) Clone ID SLJ... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLJ2-A/SLJ213Q.Seq.d/ Representative seq. ID SLJ...213P (Link to Original site) Representative DNA sequence >SLJ213 (SLJ213Q) /CSM/SL/SLJ2-A/SLJ2...X Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLJ213 (SLJ
2010-04-01
... Relations AGENCY FOR INTERNATIONAL DEVELOPMENT CLAIMS COLLECTION Compromise of Debts § 213.24 General. USAID... refers compromise offers for claims in excess of $100,000 to the Commercial Litigation Branch, Civil... delegations or procedures ...
Energy Technology Data Exchange (ETDEWEB)
O’Hara, Matthew J.; Krzysko, Anthony J.; Niver, Cynthia M.; Morrison, Samuel S.; Owsley, Stanley L.; Hamlin, Donald K.; Dorman, Eric F.; Scott Wilbur, D.
2017-04-01
Astatine-211 (211At) is a promising cyclotron-produced radionuclide being investigated for use in targeted alpha therapy of blood borne and metastatic cancers, as well as treatment of tumor remnants after surgical resections. The isolation of trace quantities of 211At, produced within several grams of a Bi metal cyclotron target, involves a complex, multi-step procedure: (1) Bi metal dissolution in strong HNO3, (2) distillation of the HNO3 to yield Bi salts containing 211At, (3) dissolution of the salts in strong HCl, (4) solvent extraction of 211At from bismuth salts with diisopropyl ether (DIPE), and (5) back-extraction of 211At from DIPE into NaOH, leading to a purified 211At product. Step (1) has been addressed first to begin the process of automating the onerous 211At isolation process. A computer-controlled Bi target dissolution system has been designed. The system performs in-line dissolution of Bi metal from the target assembly using an enclosed target dissolution block, routing the resulting solubilized 211At/Bi mixture to the subsequent process step. The primary parameters involved in Bi metal solubilization (HNO3 concentration and influent flow rate) were optimized prior to evaluation of the system performance on replicate cyclotron irradiated targets. The results indicate that the system performs reproducibly, having nearly quantitative release of 211At from irradiated targets, with cumulative 211At recoveries that follow a sigmoidal function. The predictable nature of the 211At release profile allows the user to tune the system to meet target processing requirements.
Wilbur, D Scott; Chyan, Ming-Kuan; Hamlin, Donald K; Vessella, Robert L; Wedge, Timothy J; Hawthorne, M Frederick
2007-01-01
Cancer-targeting biomolecules labeled with 211At must be stable to in vivo deastatination, as control of the 211At distribution is critical due to the highly toxic nature of alpha-particle emission. Unfortunately, no astatinated aryl conjugates have shown in vivo stability toward deastatination when (relatively) rapidly metabolized proteins, such as monoclonal antibody Fab' fragments, are labeled. As a means of increasing the in vivo stability of 211At-labeled proteins, we have been investigating antibody conjugates of boron cage moieties. In this investigation, protein-reactive derivatives containing a nido-carborane (2), a bis-nido-carborane derivative (Venus Flytrap Complex, 3), and four 2-nonahydro-closo-decaborate(2-) derivatives (4-7) were prepared and conjugated with an antibody Fab' fragment such that subsequent astatination and in vivo tissue distributions could be obtained. To aid in determination of stability toward in vivo deastatination, the Fab'-borane conjugates were also labeled with 125I, and that material was coinjected with the 211At-labeled Fab'. For comparison, direct labeling of the Fab' with 125I and 211At was conducted. Direct labeling with Na[125I]I and Chloramine-T gave an 89% radiochemical yield. However, direct labeling of the Fab' with Na[211At]At and Chloramine-T resulted in a yield of Studies to optimize the closo-decaborate(2-) conjugates for protein labeling are underway.
49 CFR 213.113 - Defective rails.
2010-10-01
... shelly spots, head checks, or flaking. (9) Engine burn fracture means a progressive fracture originating... allowable speed under § 213.9 for the class of track concerned, whichever is lower. When a search for..., whichever is lower. (b) As used in this section— (1) Transverse fissure means a progressive crosswise...
2010-10-01
..., such as slab track and track connected directly to bridge structural components, the track structure... TRANSPORTATION TRACK SAFETY STANDARDS Train Operations at Track Classes 6 and Higher § 213.335 Crossties. (a... track shall have— (1) A sufficient number of crossties which in combination provide effective support...
2010-10-01
... rail joint location shown above. (g) For track constructed without crossties, such as slab track, track... TRANSPORTATION TRACK SAFETY STANDARDS Track Structure § 213.109 Crossties. (a) Crossties shall be made of a material to which rail can be securely fastened. (b) Each 39 foot segment of track shall have— (1) A...
2010-07-01
... Installation of Aberdeen Proving Ground, Maryland § 552.213 Policy. (a) Aberdeen Proving Ground is a non-public forum and is open for expensive activity only under certain circumstances. Aberdeen Proving Ground is a..., and other official business. (b) On Aberdeen Proving Ground, except for activities authorized under 5...
42 CFR 2.13 - Confidentiality restrictions.
2010-10-01
... CONFIDENTIALITY OF ALCOHOL AND DRUG ABUSE PATIENT RECORDS General Provisions § 2.13 Confidentiality restrictions..., administrative, or legislative proceedings conducted by any Federal, State, or local authority. Any disclosure... place where only alcohol or drug abuse diagnosis, treatment, or referral is provided may be acknowledged...
7 CFR 1280.213 - Investment of funds.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Investment of funds. 1280.213 Section 1280.213... INFORMATION ORDER Lamb Promotion, Research, and Information Order Expenses § 1280.213 Investment of funds. The... the United States. Income from any such investment may be used for any purpose for which the invested...
49 CFR 213.237 - Inspection of rail.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Inspection of rail. 213.237 Section 213.237..., DEPARTMENT OF TRANSPORTATION TRACK SAFETY STANDARDS Inspection § 213.237 Inspection of rail. (a) In addition... made of all rail in Classes 4 through 5 track, and Class 3 track over which passenger trains operate...
49 CFR 213.139 - Spring rail frogs.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Spring rail frogs. 213.139 Section 213.139..., DEPARTMENT OF TRANSPORTATION TRACK SAFETY STANDARDS Track Structure § 213.139 Spring rail frogs. (a) The outer edge of a wheel tread shall not contact the gage side of a spring wing rail. (b) The toe of each...
49 CFR 213.122 - Torch cut rail.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Torch cut rail. 213.122 Section 213.122..., DEPARTMENT OF TRANSPORTATION TRACK SAFETY STANDARDS Track Structure § 213.122 Torch cut rail. (a) Except as a temporary repair in emergency situations no rail having a torch cut end shall be used in Classes 3 through 5...
47 CFR 97.213 - Telecommand of an amateur station.
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Telecommand of an amateur station. 97.213 Section 97.213 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES AMATEUR RADIO SERVICE Special Operations § 97.213 Telecommand of an amateur station. An amateur...
22 CFR 213.29 - Suspension-general.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Suspension-general. 213.29 Section 213.29 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT CLAIMS COLLECTION Suspension or Termination of Collection Action § 213.29 Suspension—general. The CFO may suspend or terminate the Agency's collection...
27 CFR 20.213 - Reuse of recovered spirits.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Reuse of recovered spirits. 20.213 Section 20.213 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Alcohol, Specially Denatured Rum, or Articles § 20.213 Reuse of recovered spirits. (a) If the denatured...
22 CFR 213.8 - Collection-general.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Collection-general. 213.8 Section 213.8 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT CLAIMS COLLECTION Collection § 213.8 Collection—general. (a... to reduce debt delinquencies. Collection actions may include sending written demands to the debtor's...
50 CFR 226.213 - Critical habitat for Johnson's seagrass.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Critical habitat for Johnson's seagrass. 226.213 Section 226.213 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS DESIGNATED CRITICAL HABITAT § 226.213 Critical habitat for Johnson's seagrass....
49 CFR 213.352 - Torch cut rail.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Torch cut rail. 213.352 Section 213.352... Torch cut rail. (a) Except as a temporary repair in emergency situations no rail having a torch cut end shall be used. When a rail end with a torch cut is used in emergency situations, train speed over that...
14 CFR 417.213 - Flight safety limits analysis.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Flight safety limits analysis. 417.213 Section 417.213 Aeronautics and Space COMMERCIAL SPACE TRANSPORTATION, FEDERAL AVIATION ADMINISTRATION... launch vehicle's flight to prevent the hazardous effects of the resulting debris impacts from reaching...
14 CFR 135.213 - Weather reports and forecasts.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Weather reports and forecasts. 135.213... Operating Limitations and Weather Requirements § 135.213 Weather reports and forecasts. (a) Whenever a person operating an aircraft under this part is required to use a weather report or forecast, that person...
40 CFR 96.213 - Certificate of representation.
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Certificate of representation. 96.213... CAIR Designated Representative for CAIR SO2 Sources § 96.213 Certificate of representation. (a) A complete certificate of representation for a CAIR designated representative or an alternate CAIR designated...
40 CFR 97.213 - Certificate of representation.
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Certificate of representation. 97.213... Representative for CAIR SO2 Sources § 97.213 Certificate of representation. (a) A complete certificate of representation for a CAIR designated representative or an alternate CAIR designated representative shall include...
24 CFR 213.266 - Initial insurance endorsement.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Initial insurance endorsement. 213.266 Section 213.266 Housing and Urban Development Regulations Relating to Housing and Urban... insurance endorsement. The Commissioner shall indicate his insurance of the mortgage or supplementary loan...
24 CFR 213.268 - Final insurance endorsement.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Final insurance endorsement. 213.268 Section 213.268 Housing and Urban Development Regulations Relating to Housing and Urban... insurance endorsement. When all advances of mortgage or loan proceeds have been made and all the terms and...
24 CFR 213.267 - Effect of insurance endorsement.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Effect of insurance endorsement. 213.267 Section 213.267 Housing and Urban Development Regulations Relating to Housing and Urban... of insurance endorsement. From the date of initial endorsement, the Commissioner and the mortgagee or...
20 CFR 410.213 - Duration of entitlement; child.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Duration of entitlement; child. 410.213...; Filing of Claims and Evidence § 410.213 Duration of entitlement; child. (a) An individual is entitled to benefits as a child for each month beginning with the first month in which all of the conditions of...
40 CFR 86.213-94 - Fuel specifications.
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Fuel specifications. 86.213-94 Section 86.213-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... 1994 and Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium...
40 CFR 86.213-04 - Fuel specifications.
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Fuel specifications. 86.213-04 Section 86.213-04 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... 1994 and Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium...
40 CFR 86.213-11 - Fuel specifications.
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Fuel specifications. 86.213-11 Section 86.213-11 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... 1994 and Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium...
49 CFR 213.110 - Gage restraint measurement systems.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Gage restraint measurement systems. 213.110... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION TRACK SAFETY STANDARDS Track Structure § 213.110 Gage restraint measurement systems. (a) A track owner may elect to implement a Gage Restraint Measurement System (GRMS...
Role of Ring Finger Protein 213 in Moyamoya Disease
Ma, Yong-Gang; Zhang, Qian; Yu, Le-Bao; Zhao, Ji-Zong
2016-01-01
Objective: The aim of this study was to help people comprehensively understand the research advances related to ring finger protein 213 (RNF213) in moyamoya disease (MMD) and to understand the disease at the molecular level to provide a new perspective of the diagnosis of the disease. Data Sources: This review was based on data in articles published between 2005 and 2015 that were retrieved from the PubMed database. The search terms included RNF213, MMD, intracranial major artery stenosis/occlusion (ICASO), genotype, phenotype, mutant and variants, and the combinations of these terms. Study Selection: Articles related to MMD and RNF213 were selected for review, and we also reviewed publications related to ICASO. Results: RNF213 is not only associated with MMD but also associated with intracranial major artery stenosis. In addition, RNF213 variants exhibit apparent ethnic diversity; specifically, the c.14576G>A variant is mainly detected in Korean, Chinese, and Japanese populations, particularly the latter population. The genotypes of RNF213 correlate with the phenotypes of MMD; for example, the homozygous c.14576G>A variant is associated with early-onset, severe symptoms, and an unfavorable prognosis. Furthermore, the RNF213 c.14576G>A variant should be considered during the diagnosis of MMD because no patients with quasi-MMD have been reported to carry the RNF213 c.14576G>A variant whereas 66 of 78 patients with definite MMD have been found to carry this variant. Conclusions: The growing literature demonstrates that MMD is primarily caused by the synergy of genetic and environmental factors, and unknown genetic modifiers might play roles in the etiology of MMD. Further research should be conducted to clarify the pathogenic mechanism of MMD. PMID:27748344
Phenotype abnormality: 213 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available 213 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u719i decreased sensitivity toward under influ...ence of brassinosteroid ... decreased sensitivity toward ... brassinosteroid ...
A process definition repository based on step AP 213
Energy Technology Data Exchange (ETDEWEB)
Butler, J.W.
1997-09-01
Over the years, in the context of numerically controlled machined part manufacturing, the loss, misinterpretation, and redundancy of re-inputting manufacturing instructions and data during the evolution of a product design into the finished product has been a resource depleting and costly endeavor. It is the intent of this project to utilize the emerging standards from the International Standards Organization, ISO 10303 Standard for the Exchange of Product Model Data, commonly referred to as STEP, to store and retrieve process planning information for a set of production work instructions. The project focuses on the utilization of the 1995 version of the Draft International Standard ISO/DIS 10303-213:1995 (E) Application protocol: Numerical control process plans for machined parts (AP213). This project illustrates the methodologies used to build an object-oriented Process Definition Repository (PDR), describes both the benefits and shortcomings experienced in implementing AP213, and recommends enhancements to AP213 for process planning information. The deliverable will be a Part 21 data file, based on the application-interpreted model for AP213 and integrated with product design data.
LabVIEW Data Acquisition for NE213 Neutron Detector
Energy Technology Data Exchange (ETDEWEB)
Gangadharan, Dhevan
2003-09-23
A neutron spectroscopy system based on a NE213 liquid scintillation detector at the Stanford Linear Accelerator Center measures neutron energies from a few MeV up to 800 MeV. The neutrons are produced from the electron beam and target interactions. The NE 213 scintillator, coupled with a Photomultiplier Tube (PMT), detects and converts radiation into electric pulses for signal processing. Signals are processed through Nuclear Instrument Modules (NIM) and Computer Automated Measurement and Control (CAMAC) modules. The processed pulses are then fed into a CAMAC analog to digital converter module (ADC). The ADC classifies the incoming analog pulses into one of 2048 digital channels. Data acquisition (DAQ) software based on LabVIEW version 7.0 acquires and organizes data from the CAMAC ADC. The DAQ system presents a spectrum showing a relationship between pulse events and respective charge (digital channel number). Various photon sources, such as Co-60, Y-88, and AmBe-241, are used to calibrate the NE213 detector. For each source, a Compton edge and reference energy in MeVee is obtained, resulting in a calibration curve. This project is focused on the development of a DAQ system and control setup to collect and process information from a NE213 liquid scintillation detector. A manual is also created to document the process of the development and interpretation of the LabVIEW-based DAQ system.
49 CFR 213.57 - Curves; elevation and speed limitations.
2010-10-01
... speed limitations. (a) The maximum crosslevel on the outside rail of a curve may not be more than 8...) and (d) on curves in Class 1 through 5 track which are contiguous to the high speed track provided... 49 Transportation 4 2010-10-01 2010-10-01 false Curves; elevation and speed limitations. 213.57...
45 CFR 213.33 - Effective date of Administrator's decision.
2010-10-01
... Section 213.33 Public Welfare Regulations Relating to Public Welfare OFFICE OF FAMILY ASSISTANCE (ASSISTANCE PROGRAMS), ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES... State, or payments will be limited to categories under or parts of the State plan not affected, shall...
47 CFR 73.213 - Grandfathered short-spaced stations.
2010-10-01
... Section 73.213 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES... application for authority to operate a Class A station with no more than 3000 watts ERP and 100 meters antenna HAAT (or equivalent lower ERP and higher antenna HAAT based on a class contour distance of 24 km) must...
27 CFR 21.3 - Stocks of discontinued formulas.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Stocks of discontinued..., DEPARTMENT OF THE TREASURY LIQUORS FORMULAS FOR DENATURED ALCOHOL AND RUM General Provisions § 21.3 Stocks of discontinued formulas. Denaturers, or specially denatured spirits dealers or users, having on hand stocks of...
14 CFR 67.213 - General medical condition.
2010-01-01
...) AIRMEN MEDICAL STANDARDS AND CERTIFICATION Second-Class Airman Medical Certificate § 67.213 General medical condition. The general medical standards for a second-class airman medical certificate are: (a) No... hypoglycemic drug for control. (b) No other organic, functional, or structural disease, defect, or limitation...
40 CFR 262.213 - Laboratory clean-outs.
2010-07-01
... when it is transported off-site; and (4) An eligible academic entity must document the activities of... Determination and Accumulation of Unwanted Material for Laboratories Owned by Eligible Academic Entities § 262.213 Laboratory clean-outs. (a) One time per 12 month period for each laboratory, an eligible academic...
19 CFR 10.213 - Articles eligible for preferential treatment.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles eligible for preferential treatment. 10...; DEPARTMENT OF THE TREASURY ARTICLES CONDITIONALLY FREE, SUBJECT TO A REDUCED RATE, ETC. Textile and Apparel Articles Under the African Growth and Opportunity Act § 10.213 Articles eligible for preferential treatment...
27 CFR 24.213 - Heavy bodied blending wine.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Heavy bodied blending wine..., DEPARTMENT OF THE TREASURY LIQUORS WINE Production of Other Than Standard Wine § 24.213 Heavy bodied blending wine. Heavy bodied blending wine is wine made for blending purposes from grapes or other fruit without...
The synthesis of [2-13C]2-nitropropane at room temperature and at atmospheric pressure
Jacquemijns M; Zomer G
1990-01-01
In this report the synthesis of [2-13C]2-nitropropane at room temperature is described. [2-13C]Acetone was converted into the oxime with hydroxy hydrochloridelamine and sodium carbonate. Treatment with hypobromic acid resulted in 2-13C]2-bromo-2-nitropropane. Hydrogenation with sodium borohydride gave [2-13C]2-nitropropane in 14,3% overall yield.
The synthesis of [2-13C]2-nitropropane at room temperature and at atmospheric pressure
Jacquemijns M; Zomer G
1990-01-01
In this report the synthesis of [2-13C]2-nitropropane at room temperature is described. [2-13C]Acetone was converted into the oxime with hydroxy hydrochloridelamine and sodium carbonate. Treatment with hypobromic acid resulted in 2-13C]2-bromo-2-nitropropane. Hydrogenation with sodium borohydride
9 CFR 93.213 - Appearance of disease among poultry in quarantine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Appearance of disease among poultry in quarantine. 93.213 Section 93.213 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE...; REQUIREMENTS FOR MEANS OF CONVEYANCE AND SHIPPING CONTAINERS Poultry § 93.213 Appearance of disease among...
49 CFR 213.347 - Automotive or railroad crossings at grade.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Automotive or railroad crossings at grade. 213.347 Section 213.347 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD... Higher § 213.347 Automotive or railroad crossings at grade. (a) There shall be no at-grade (level...
48 CFR 213.106-1-70 - Soliciting competition-tiered evaluation of offers.
2010-10-01
... SIMPLIFIED ACQUISITION PROCEDURES Procedures 213.106-1-70 Soliciting competition—tiered evaluation of offers... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Soliciting competition-tiered evaluation of offers. 213.106-1-70 Section 213.106-1-70 Federal Acquisition Regulations System...
40 CFR 2.213 - Designation by business of addressee for notices and inquiries.
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Designation by business of addressee for notices and inquiries. 2.213 Section 2.213 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL PUBLIC INFORMATION Confidentiality of Business Information § 2.213 Designation by business...
22 CFR 213.33 - Permitted actions after termination of collection activity.
2010-04-01
... collection activity. 213.33 Section 213.33 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT CLAIMS COLLECTION Suspension or Termination of Collection Action § 213.33 Permitted actions after termination of collection activity. Termination of collection activity ceases active collection of the debt. Termination...
Inorganic resins for clinical use of .sup.213Bi generators
DePaoli, David W [Knoxville, TN; Hu, Michael Z [Knoxville, TN; Mirzadeh, Saed [Knoxville, TN; Clavier, John W [Elizabethton, TN
2011-03-29
Applicant's invention is a radionuclide generator resin material for radiochemical separation of daughter radionuclides, particularly .sup.213Bi, from a solution of parental radionuclides, the resin material capable of providing clinical quantities of .sup.213Bi of at least 20-mCi, wherein the resin material comprises a silica-based structure having at least one bifunctional ligand covalently attached to the surface of the silica-based structure. The bifunctional ligand comprises a chemical group having desirable surface functionality to enable the covalent attachment of the bifunctional ligand thereon the surface of the structure and the bifunctional ligand further comprises a second chemical group capable of binding and holding the parental radionuclides on the resin material while allowing the daughter radionuclides to elute off the resin material. The bifunctional ligand has a carbon chain with a limited number of carbons to maintain radiation stability of the resin material.
LabVIEW DAQ for NE213 Neutron Detector
Energy Technology Data Exchange (ETDEWEB)
Al-Adeeb, Mohammed
2003-09-23
A neutron spectroscopy system, based on a NE213 liquid scintillation detector, to be placed at the Stanford Linear Accelerator Center to measure neutron spectra from a few MeV up to 800 MeV, beyond shielding. The NE213 scintillator, coupled with a Photomultiplier Tube (PMT), detects and converts radiation into current for signal processing. Signals are processed through Nuclear Instrument Modules (NIM) and Computer Automated Measurement and Control (CAMAC) modules. CAMAC is a computer automated data acquisition and handling system. Pulses are properly prepared and fed into an analog to digital converter (ADC), a standard CAMAC module. The ADC classifies the incoming analog pulses into 1 of 2048 digital channels. Data acquisition (DAQ) software based on LabVIEW, version 7.0, acquires and organizes data from the CAMAC ADC. The DAQ system presents a spectrum showing a relationship between pulse events and respective charge (digital channel number). Various photon sources, such as Co-60, Y-88, and AmBe-241, are used to calibrate the NE213 detector. For each source, a Compton edge and reference energy [units of MeVee] is obtained. A complete calibration curve results (at a given applied voltage to the PMT and pre-amplification gain) when the Compton edge and reference energy for each source is plotted. This project is focused to development of a DAQ system and control setup to collect and process information from a NE213 liquid scintillation detector. A manual is created to document the process of the development and interpretation of the LabVIEW-based DAQ system. Future high-energy neutron measurements can be referenced and normalized according to this calibration curve.
Energy Technology Data Exchange (ETDEWEB)
Blazquez Martinez, J.; Butragueno Casado, J. L.
1974-07-01
This work describes the experimental way followed for getting the calibration of a NE213 detector with a beam of neutrons from the J.E.N. 2 MeV Van de Graaff and using at once pulse shape discrimination. Detector has been used for measuring the spectrum of the fast reactor CORAL-1. There is also included an experimental method in order to get with precision where the Compton edge is placed on the electron spectrum. (Author) 9 refs.
2-(1,3-Benzoxazol-2-yl-1-phenylethenyl benzoate
Directory of Open Access Journals (Sweden)
Mohammad Hassan Ghorbani
2011-10-01
Full Text Available In the title molecule, C22H15NO3, the configuration about the ethylenic double bond is Z configuration and it is approximately coplanar with the adjacent phenyl ring and benzoxazole ring system as indicated by the C(H=C(O—Cphenyl—Cphenyl and Obenzoxazole—C—C(H=C(O torsion angles of 179.88 (15 and 5.7 (2°, respectively. The dihedral angle between the essentially planar (r.m.s. deviation = 0.080 Å 2-(1,3-benzoxazol-2-yl-1-phenylethenyl group and the benzoate phenyl ring is 61.51 (6°. A short intramolecular O...O non-bonded interaction of 2.651 (2 Å is present.
9 CFR 205.213 - Obligations subject-“person indebted”-“debtor.”
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Obligations subject-âperson indebtedâ-âdebtor.â 205.213 Section 205.213 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS... to a security interest for another's debt. However the terms “person indebted” and “debtor” in the...
27 CFR 44.213 - Destruction of tobacco products, and cigarette papers and tubes.
2010-04-01
... products, and cigarette papers and tubes. 44.213 Section 44.213 Alcohol, Tobacco Products and Firearms... TOBACCO PRODUCTS AND CIGARETTE PAPERS AND TUBES, WITHOUT PAYMENT OF TAX, OR WITH DRAWBACK OF TAX Removal of Shipments of Tobacco Products and Cigarette Papers and Tubes by Manufacturers and Export Warehouse...
22 CFR 213.23 - Salary offset when USAID is not the creditor agency.
2010-04-01
... to the Chief Financial Officer, Office of Financial Management (M/FM), United States Agency for International Development, Ronald Reagan Building , 1300 Pennsylvania Avenue NW., Washington, DC 20523-4601. (c... agency. 213.23 Section 213.23 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT CLAIMS COLLECTION...
49 CFR 213.355 - Frog guard rails and guard faces; gage.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Frog guard rails and guard faces; gage. 213.355... Higher § 213.355 Frog guard rails and guard faces; gage. The guard check and guard face gages in frogs... distance between the gage line of a frog to the guard line 1 of its guard rail or guarding face, measured...
5 CFR 213.3301 - Positions of a confidential or policy-determining nature.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Positions of a confidential or policy-determining nature. 213.3301 Section 213.3301 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL... or policy-determining nature. (a) Upon specific authorization by OPM, agencies may make appointments...
24 CFR 213.275 - Nature of the Cooperative Management Housing Insurance Fund.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Nature of the Cooperative Management Housing Insurance Fund. 213.275 Section 213.275 Housing and Urban Development Regulations Relating... Nature of the Cooperative Management Housing Insurance Fund. The Cooperative Management Housing Insurance...
49 CFR 240.213 - Procedures for making the determination on completion of training program.
2010-10-01
... completion of training program. 240.213 Section 240.213 Transportation Other Regulations Relating to... making the determination on completion of training program. (a) Each railroad, prior to the initial... documentation showing that: (1) The person completed a training program that complies with § 240.123 of this...
22 CFR 213.20 - Administrative offset of non-employee debts.
2010-04-01
.... 213.20 Section 213.20 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT CLAIMS COLLECTION... only after: (i) The debtor has been provided due process as set forth in paragraph (a) of this section... offset a debtor's anticipated or future benefit payments under the Civil Service Retirement and...
48 CFR 253.213-70 - Completion of DD Form 1155, Order for Supplies or Services.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Completion of DD Form 1155... Forms 253.213-70 Completion of DD Form 1155, Order for Supplies or Services. Follow the procedures at PGI 253.213-70 for completion of DD Form 1155. ...
31 CFR 585.213 - Exemption of activities related to certain international organizations.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Exemption of activities related to certain international organizations. 585.213 Section 585.213 Money and Finance: Treasury Regulations... related to certain international organizations. Any activities related to the United Nations Protection...
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Simplified acquisition procedures (SF's 18, 30, 44, 1165, 1449, and OF's 336, 347, and 348). 853.213 Section 853.213 Federal... 853.213 Simplified acquisition procedures (SF's 18, 30, 44, 1165, 1449, and OF's 336, 347, and 348...
2010-10-01
... procedures (SF's 18, 30, 44, 1165, 1449, and OF's 336, 347, and 348). 253.213 Section 253.213 Federal... OF's 336, 347, and 348). (f) DoD uses the DD Form 1155, Order for Supplies or Services, instead of OF 347; and OF 336, Continuation Sheet, instead of OF 348. Follow the procedures at PGI 253.213(f) for...
Response matrices of NE213 scintillation detectors for neutrons
Energy Technology Data Exchange (ETDEWEB)
Guldbakke, S.; Klein, H. [Physikalisch-Technische Bundesanstalt, Braunschweig (Germany); Meister, A.; Scheler, U.; Unholzer, S. [Technical Univ., Dresden (Germany); Pulpan, J.; Tichy, M. [Inst. of Radiation Dosimetry, Prague (Czech Republic)
1994-12-31
Four NE213 detectors of different size have been calibrated at the accelerator facility of the PTB. The response functions were experimentally determined for 33 neutron energies between 1 MeV and 16 MeV and compared with Monte Carlo simulations using the NRESP7 code. The light output functions for recoil protons were found to be significantly different for all detectors even if they were of the same size. The neutron fluence determined on the basis of the response functions calculated with the corresponding light output functions agreed to better than {+-}2% with reference values if energy independent adjustment factors between 0.98 and 1.03 were applied. The response matrices required for the unfolding of neutron induced pulse height spectra were therefore calculated with the NRESP7 code taking into account the adjustment factors. Similarly, the response matrices for photons were calculated with the EGS4 code, but without any adjustment. Finally, the DIFBAS code was applied for the unfolding of pure neutron- and photon-induced pulse height spectra. The resulting spectral fluences are in reasonable agreement with the results obtained by time-of-flight measurements and by spectrometry with a Ge detector.
Paediatric lymphoma in China: a clinicopathological study of 213 cases.
Wang, Jia; Wu, Xv; Shen, Yuetian; Xi, Zhengjun
2012-12-01
This retrospective study was conducted to evaluate information on paediatric lymphoma in China. We reviewed the pathological files of patients less than 12 years of age with lymphoma in Shanghai Xinhua Hospital from January 1982 to June 2009. SPSS version 11.0 was used to analyse the results. Of the 213 subjects, 176 (82.6%) had non-Hodgkin's lymphoma (NHL) and 37 (17.4%) had Hodgkin's lymphoma (HL). All NHL cases had diffuse and high grade tumours, and 33.5% of these tumours primarily involved extra-nodal sites. Of the NHL cases, 56.6%, 43.3%, and 1.7% were derived from T, B, and null cells, respectively. Lymphoblastic lymphoma (LL, 50.6%), Burkitt's lymphoma (BL, 28.4%), and anaplastic large cell lymphoma (ALCL, 12.5%) comprised the majority of the NHL cases. A significant difference was found in the frequency of stage I/II cases between LL and ALCL. Paediatric HL resembled the disease in adults. Paediatric lymphoma in China is different from that in Western countries with respect to the incidence rate of HL and BL. The distribution pattern of NHL histological subtypes is more similar to that in Japan than that in Pakistan. These features suggest ethnic or geographic variations.
Multiple product pathways in photodissociation of nitromethane at 213 nm
Energy Technology Data Exchange (ETDEWEB)
Sumida, Masataka; Kohge, Yasunori; Yamasaki, Katsuyoshi; Kohguchi, Hiroshi, E-mail: kohguchi@hiroshima-u.ac.jp [Department of Chemistry, Graduate School of Science, Hiroshima University, Kagamiyama 1-3-1, Higashi-Hiroshima, Hiroshima 739-8526 (Japan)
2016-02-14
In this paper, we present a photodissociation dynamics study of nitromethane at 213 nm in the π → π{sup *} transition. Resonantly enhanced multiphoton ionization spectroscopy and ion-imaging were applied to measure the internal state distributions and state-resolved scattering distributions of the CH{sub 3}, NO(X {sup 2}Π, A {sup 2}Σ{sup +}), and O({sup 3}P{sub J}) photofragments. The rotationally state-resolved scattering distribution of the CH{sub 3} fragment showed two velocity components, of which the slower one decreased the relative intensity as the rotational and vibrational excitations. The translational energy distribution of the faster CH{sub 3} fragment indicated the production of the NO{sub 2} counter-product in the electronic excited state, wherein 1 {sup 2}B{sub 2} was the most probable. The NO(v = 0) fragment exhibited a bimodal translational energy distribution, whereas the NO(v = 1 and 2) fragment exhibited a single translational energy component with a relatively larger internal energy. The translational energy of a portion of the O({sup 3}P{sub J}) photofragment was found to be higher than the one-photon dissociation threshold, indicating the two-photon process involved. The NO(A {sup 2}Σ{sup +}) fragment, which was detected by ionization spectroscopy via the Rydberg ←A {sup 2}Σ{sup +} transition, also required two-photon energy. These experimental data corroborate the existence of competing photodissociation product pathways, CH{sub 3} + NO{sub 2},CH{sub 3} + NO + O,CH{sub 3}O + NO, and CH{sub 3}NO + O, following the π → π{sup *} transition. The origins of the observed photofragments are discussed in this report along with recent theoretical studies and previous dynamics experiments performed at 193 nm.
Antimicrobial activity and mechanism of PDC213, an endogenous peptide from human milk.
Sun, Yazhou; Zhou, Yahui; Liu, Xiao; Zhang, Fan; Yan, Linping; Chen, Ling; Wang, Xing; Ruan, Hongjie; Ji, Chenbo; Cui, Xianwei; Wang, Jiaqin
2017-02-26
Human milk has always been considered an ideal source of elemental nutrients to both preterm and full term infants in order to optimally develop the infant's tissues and organs. Recently, hundreds of endogenous milk peptides were identified in human milk. These peptides exhibited angiotensin-converting enzyme inhibition, immunomodulation, or antimicrobial activity. Here, we report the antimicrobial activity and mechanism of a novel type of human antimicrobial peptide (AMP), termed PDC213 (peptide derived from β-Casein 213-226 aa). PDC213 is an endogenous peptide and is present at higher levels in preterm milk than in full term milk. The inhibitory concentration curve and disk diffusion tests showed that PDC213 had obvious antimicrobial against S. aureus and Y. enterocolitica, the common nosocomial pathogens in neonatal intensive care units (NICUs). Fluorescent dye methods, electron microscopy experiments and DNA-binding activity assays further indicated that PDC213 can permeabilize bacterial membranes and cell walls rather than bind intracellular DNA to kill bacteria. Together, our results suggest that PDC213 is a novel type of AMP that warrants further investigation. Copyright © 2017 Elsevier Inc. All rights reserved.
In Vitro comparison of 213Bi- and 177Lu-radiation for peptide receptor radionuclide therapy.
Chan, Ho Sze; de Blois, Erik; Morgenstern, Alfred; Bruchertseifer, Frank; de Jong, Marion; Breeman, Wouter; Konijnenberg, Mark
2017-01-01
Absorbed doses for α-emitters are different from those for β-emitters, as the high linear energy transfer (LET) nature of α-particles results in a very dense energy deposition over a relatively short path length near the point of emission. This highly localized and therefore high energy deposition can lead to enhanced cell-killing effects at absorbed doses that are non-lethal in low-LET type of exposure. Affinities of DOTA-DPhe1-Tyr3-octreotate (DOTATATE), 115In-DOTATATE, 175Lu-DOTATATE and 209Bi-DOTATATE were determined in the K562-SST2 cell line. Two other cell lines were used for radiation response assessment; BON and CA20948, with a low and high expression of somatostatin receptors, respectively. Cellular uptake kinetics of 111In-DOTATATE were determined in CA20948 cells. CA20948 and BON were irradiated with 137Cs, 177Lu-DTPA, 177Lu-DOTATATE, 213Bi-DTPA and 213Bi-DOTATATE. Absorbed doses were calculated using the MIRDcell dosimetry method for the specific binding and a Monte Carlo model of a cylindrical 6-well plate geometry for the exposure by the radioactive incubation medium. Absorbed doses were compared to conventional irradiation of cells with 137Cs and the relative biological effect (RBE) at 10% survival was calculated. IC50 of (labelled) DOTATATE was in the nM range. Absorbed doses up to 7 Gy were obtained by 5.2 MBq 213Bi-DOTATATE, in majority the dose was caused by α-particle radiation. Cellular internalization determined with 111In-DOTATATE showed a linear relation with incubation time. Cell survival after exposure of 213Bi-DTPA and 213Bi-DOTATATE to BON or CA20948 cells showed a linear-exponential relation with the absorbed dose, confirming the high LET character of 213Bi. The survival of CA20948 after exposure to 177Lu-DOTATATE and the reference 137Cs irradiation showed the typical curvature of the linear-quadratic model. 10% Cell survival of CA20948 was reached at 3 Gy with 213Bi-DOTATATE, a factor 6 lower than the 18 Gy found for 177Lu
A Polymorphism in RNF213 Is a Susceptibility Gene for Intracranial Atherosclerosis.
Directory of Open Access Journals (Sweden)
Oh Young Bang
Full Text Available Both intracranial atherosclerotic stenosis (ICAS and moyamoya disease (MMD are prevalent in Asians. We hypothesized that the Ring Finger protein 213 gene polymorphism (RNF213, a susceptibility locus for MMD in East Asians, is also a susceptibility gene for ICAS in patients whose diagnosis had been confirmed by conventional angiography (absence of basal collaterals and high-resolution MRI (HR-MRI, presence of plaque.We analyzed 532 consecutive patients with ischemic events in the middle cerebral artery (MCA distribution and relevant stenotic lesion on the distal internal carotid artery or proximal MCA, but no demonstrable carotid or cardiac embolism sources. Additional angiography was performed on 370 (69.5% patients and HR-MRI on 283 (53.2% patients.Based on angiographic and HR-MRI findings, 234 patients were diagnosed with ICAS and 288 with MMD. The RNF213 variant was observed in 50 (21.4% ICAS patients and in 119 (69.1% MMD patients. The variant was observed in 25.2% of patients with HR-MRI-confirmed ICAS. Similarly, 15.8% of ICAS patients in whom MMD was excluded by angiography had this variant. Among the ICAS patients, RNF213 variant carriers were younger and more likely to have a family history of MMD than non-carriers were. Multivariate testing showed that only the age of ICAS onset was independently associated with the RNF213 variant (odds ratio, 0.97; 95% CI, 0.944-0.99.RNF213 is a susceptibility gene not only for MMD but also for ICAS in East Asians. Further studies are needed on RNF213 variants in ICAS patients outside East Asian populations.
RNF213 Rare Variants in Slovakian and Czech Moyamoya Disease Patients.
Kobayashi, Hatasu; Brozman, Miroslav; Kyselová, Kateřina; Viszlayová, Daša; Morimoto, Takaaki; Roubec, Martin; Školoudík, David; Petrovičová, Andrea; Juskanič, Dominik; Strauss, Jozef; Halaj, Marián; Kurray, Peter; Hranai, Marián; Harada, Kouji H; Inoue, Sumiko; Yoshida, Yukako; Habu, Toshiyuki; Herzig, Roman; Youssefian, Shohab; Koizumi, Akio
2016-01-01
RNF213/Mysterin has been identified as a susceptibility gene for moyamoya disease, a cerebrovascular disease characterized by occlusive lesions in the circle of Willis. The p.R4810K (rs112735431) variant is a founder polymorphism that is strongly associated with moyamoya disease in East Asia. Many non-p.R4810K rare variants of RNF213 have been identified in white moyamoya disease patients, although the ethnic mutations have not been investigated in this population. In the present study, we screened for RNF213 variants in 19 Slovakian and Czech moyamoya disease patients. A total of 69 RNF213 coding exons were directly sequenced in 18 probands and one relative who suffered from moyamoya disease in Slovakia and the Czech Republic. We previously reported one proband harboring RNF213 p.D4013N. Results from the present study identified four rare variants other than p.D4013N (p.R4019C, p.E4042K, p.V4146A, and p.W4677L) in four of the patients. P.V4146A was determined to be a novel de novo mutation, and p.R4019C and p.E4042K were identified as double mutations inherited on the same allele. P.W4677L, found in two moyamoya disease patients and an unaffected subject in the same pedigree, was a rare single nucleotide polymorphism. Functional analysis showed that RNF213 p.D4013N, p.R4019C and p.V4146A-transfected human umbilical vein endothelial cells displayed significant lowered migration, and RNF213 p.V4146A significantly reduced tube formation, indicating that these are disease-causing mutations. Results from the present study identified RNF213 rare variants in 22.2% (4/18 probands) of Slovakian and Czech moyamoya disease patients, confirming that RNF213 may also be a major causative gene in a relative large population of white patients.
RNF213 Rare Variants in Slovakian and Czech Moyamoya Disease Patients.
Directory of Open Access Journals (Sweden)
Hatasu Kobayashi
Full Text Available RNF213/Mysterin has been identified as a susceptibility gene for moyamoya disease, a cerebrovascular disease characterized by occlusive lesions in the circle of Willis. The p.R4810K (rs112735431 variant is a founder polymorphism that is strongly associated with moyamoya disease in East Asia. Many non-p.R4810K rare variants of RNF213 have been identified in white moyamoya disease patients, although the ethnic mutations have not been investigated in this population. In the present study, we screened for RNF213 variants in 19 Slovakian and Czech moyamoya disease patients. A total of 69 RNF213 coding exons were directly sequenced in 18 probands and one relative who suffered from moyamoya disease in Slovakia and the Czech Republic. We previously reported one proband harboring RNF213 p.D4013N. Results from the present study identified four rare variants other than p.D4013N (p.R4019C, p.E4042K, p.V4146A, and p.W4677L in four of the patients. P.V4146A was determined to be a novel de novo mutation, and p.R4019C and p.E4042K were identified as double mutations inherited on the same allele. P.W4677L, found in two moyamoya disease patients and an unaffected subject in the same pedigree, was a rare single nucleotide polymorphism. Functional analysis showed that RNF213 p.D4013N, p.R4019C and p.V4146A-transfected human umbilical vein endothelial cells displayed significant lowered migration, and RNF213 p.V4146A significantly reduced tube formation, indicating that these are disease-causing mutations. Results from the present study identified RNF213 rare variants in 22.2% (4/18 probands of Slovakian and Czech moyamoya disease patients, confirming that RNF213 may also be a major causative gene in a relative large population of white patients.
Corneal refractive surgery using an ultraviolet (213 nm) solid state laser
Ren, Qiushi; Gailitis, Raymond P.; Thompson, Keith P.; Penney, Carl M.; Lin, Jui T.; Waring, George O., III
1991-06-01
The authors demonstrate the use of a frequency multiplied Q-switched Nd:YAG laser to generate the fifth (213 nm) and the fourth (266 nm) harmonic frequencies to ablate porcine corneas and synthetic collagen materials. This new strategy is discussed for corneal refractive surgery using a solid state laser. The potential for spatially resolved refractive correction based on a 213 nm solid state laser is reviewed in light of new corneal imaging technology that can detect localized refractive errors of the eye. Finally, the authors discuss remaining problems that need to be addressed before this technology can be applied to clinical investigation.
The R213G polymorphism in SOD3 protects against allergic airway inflammation
DEFF Research Database (Denmark)
Gaurav, Rohit; Varasteh, Jason T; Weaver, Michael R
2017-01-01
nucleotide polymorphism (SNP) in SOD3 (R213G; rs1799895) changes lung distribution of EC-SOD, and decreases likelihood of asthma-related symptoms. Knockin mice analogous to the human R213G SNP had lower airway hyperresponsiveness, inflammation, and mucus hypersecretion with decreased interleukin-33 (IL-33...... by resulting in high EC-SOD in airway-lining fluid, which ameliorates allergic airway inflammation by dampening the innate immune response, including IL-33/ST2-mediated changes in ILC2s....
2010-07-01
... requirements apply to transmix processors and transmix blenders? 80.213 Section 80.213 Protection of... requirements apply to transmix processors and transmix blenders? Transmix processors and transmix blenders, as... standards otherwise applicable to a refiner under subpart H of this part. (a) Any transmix processor who...
2010-04-01
... social insurance systems that base benefits on earnings but not on residence or citizenship, and those... pension based on your noncovered employment. 404.213 Section 404.213 Employees' Benefits SOCIAL SECURITY ADMINISTRATION FEDERAL OLD-AGE, SURVIVORS AND DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts...
2010-01-01
... applications for approval of schedules; procedure thereon. 213.5 Section 213.5 Aeronautics and Space OFFICE OF... applications for approval of schedules; procedure thereon. (a) Number of copies and certificate of service. An original and three copies of each schedule, and an original and seven (7) copies of application for...
Excitation of He(2(1,3)S) by electron impact
DeHeer, FJ; Bray, [No Value; Fursa, DV; Bliek, FW; Hoekstra, R; Summers, HP
1995-01-01
Theoretical data for electron impact excitation of neutral helium in the He (2(1,3)S) states are reviewed and a preferred data set is established for excitation to the He (n(1,3)L) states with n=2-4. Such a set of data was presented in a FOM report. The present work is an improvement made possible
49 CFR 213.119 - Continuous welded rail (CWR); plan contents.
2010-10-01
... repairs, in-track welding, and in conjunction with adjustments made in the area of tight track, a track... cracks and other indications of potential failures in CWR joints. In formulating the procedures under... otherwise detectable cracks and conduct remedial action pursuant to § 213.121; (3) Specify the conditions of...
22 CFR 213.37 - Referrals to the Department of Justice.
2010-04-01
... Section 213.37 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT CLAIMS COLLECTION Referrals to the... procedures, USAID refers for litigation debts of more than $2,500 but less than $1,000,000 to the Department... Report (CCLR) instructions. Debts of over $1,000,000 shall be referred to the Civil Division at the...
Fission dynamics of the compound nucleus 213 Fr formed in heavy ...
Indian Academy of Sciences (India)
A stochastic approach based on one-dimensional Langevin equations was used to calculate the average pre-fission multiplicities of neutrons, light charged particles and the fission probabilities for the compound nucleus 213Fr and the results are compared with the experimental data. In these calculations, a modified wall ...
14 CFR 145.213 - Inspection of maintenance, preventive maintenance, or alterations.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Inspection of maintenance, preventive... Rules § 145.213 Inspection of maintenance, preventive maintenance, or alterations. (a) A certificated repair station must inspect each article upon which it has performed maintenance, preventive maintenance...
49 CFR 213.143 - Frog guard rails and guard faces; gage.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Frog guard rails and guard faces; gage. 213.143... and guard faces; gage. The guard check and guard face gages in frogs shall be within the limits... frog to the guard line 1 of its guard rail or guarding face, measured across the track at right angles...
27 CFR 25.213 - Beer returned to brewery other than that from which removed.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Beer returned to brewery... AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS BEER Beer Returned to Brewery § 25.213 Beer returned to brewery other than that from which removed. (a) Refund or adjustment of tax...
25 CFR 213.5 - Term of oil and gas leases.
2010-04-01
... MEMBERS OF FIVE CIVILIZED TRIBES, OKLAHOMA, FOR MINING How to Acquire Leases § 213.5 Term of oil and gas leases. Oil and gas mining leases which require the approval of the Secretary of the Interior may be made for periods of 10 years from the date of approval of lease by the Secretary of the Interior and as...
25 CFR 213.34 - Inspection of premises; books and accounts.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Inspection of premises; books and accounts. 213.34... premises; books and accounts. Lessees shall agree to allow the lessors and their agents or any authorized... books and records, showing manner of operations and persons interested, shall be open at all times for...
Direct measurements of secondary water inventory of steam generator PGV-213 in operation
Energy Technology Data Exchange (ETDEWEB)
Tarankov, G.A.; Trunov, N.B.; Dranchenko, B.N.; Kamiagin, W.W. [OKB Gidropress (Russian Federation)
1997-12-31
Results of weight measurement of PGV-213 steam generator during filling in, heating-up and power increase are described. Special measurement system based on stress gauges has been developed. Method of derivation of secondary water inventory is described. Comparison of the data for two steam generators prove accuracy of the measurements. (orig.). 1 refs.
Draft Genome Sequence of Serratia marcescens Strain LCT-SM213
Wang, Yajuan; Yuan, Yanting; Zhou, Lisha; Su, Qingqing; Fang, Xiangqun; Li, Tianzhi; Wang, Junfeng; Chang, De; Su, Longxiang; Xu, Guogang; Guo, Yinghua; Yang, Ruifu; Liu, Changting
2012-01-01
Serratia marcescens is a species of Gram-negative, rod-shaped bacterium of the family Enterobacteriaceae. S. marcescens can cause nosocomial infections, particularly catheter-associated bacteremia, urinary tract infections, and wound infections. Here, we present the draft genome sequence of Serratia marcescens strain LCT-SM213, which was isolated from CGMCC 1.1857.
BILATERAL SPLIT HAND FOOT MALFORMATION AND INV(7)(P22Q21.3)
COBBEN, JM; VERHEIJ, JBGM; EISMA, WH; ROBINSON, PH; ZWIERSTRA, RP; LEEGTE, B; CASTEDO, S
A boy with typical tetramelic split hands and feet is described. In addition, there was a large arteriovenous malformation of the right arm. Chromosome studies showed a pericentric inversion of chromosome 7: 46,XY,inv(7) (p22q21.3). Inspection of the extremities and chromosome studies in the parents
Caveolin-1, Ring finger protein 213, and endothelial function in Moyamoya disease.
Bang, Oh Young; Chung, Jong-Won; Kim, Suk Jae; Oh, Mi Jeong; Kim, Soo Yoon; Cho, Yeon Hee; Cha, Jihoon; Yeon, Je Young; Kim, Keon Ha; Kim, Gyeong-Moon; Chung, Chin-Sang; Lee, Kwang Ho; Ki, Chang-Seok; Jeon, Pyoung; Kim, Jong-Soo; Hong, Seung Chyul; Moon, Gyeong Joon
2016-12-01
Moyamoya disease is a unique cerebrovascular occlusive disease of unknown etiology. Ring finger protein 213 (RNF213) was identified as a susceptibility gene for Moyamoya disease in East Asian countries. However, the pathogenesis of Moyamoya disease remains unclear. We prospectively analyzed clinical data for 139 patients with Moyamoya disease (108 bilateral Moyamoya disease, 31 unilateral Moyamoya disease), 61 patients with intracranial atherosclerotic stroke, and 68 healthy subjects. We compared the genetic (RNF213 variant) and protein biomarkers for caveolae (caveolin-1), angiogenesis (vascular endothelial growth factor (VEGF) and receptor (VEGFR2), and antagonizing cytokine (endostatin)) and endothelial dysfunction (asymmetric dimethylarginine (ADMA), and nitric oxide and its metabolites (nitrite and nitrate)) between patients with Moyamoya disease and intracranial atherosclerotic stroke. We then performed path analysis to evaluate whether a certain protein biomarker mediates the association between genes and Moyamoya disease. Caveolin-1 level was decreased in patients with Moyamoya disease and markedly decreased in RNF213 variant carriers. Circulating factors such as VEGF and VEGFR2 did not differ among the groups. Markers for endothelial dysfunction were significantly higher in patients with intracranial atherosclerotic stroke but normal in those with Moyamoya disease. Path analysis showed that the presence of the RNF213 variant was associated with caveolin-1 levels that could lead to Moyamoya disease. The level of combined marker of Moyamoya disease (caveolin-1) and intracranial atherosclerotic stroke (ADMA, an endothelial dysfunction marker) predicted Moyamoya disease with good sensitivity and specificity. Our results suggest that Moyamoya disease is a caveolae disorder but is not related to endothelial dysfunction or dysregulation of circulating cytokines. © 2016 World Stroke Organization.
Energy Technology Data Exchange (ETDEWEB)
Seidl, Christof; Zoeckler, Christine; Beck, Roswitha; Senekowitsch-Schmidtke, Reingard [Technische Universitaet Muenchen, Department of Nuclear Medicine, Munich (Germany); Quintanilla-Martinez, Leticia [Universitaetsklinikum Tuebingen, Institute for Pathology, Tuebingen (Germany); Bruchertseifer, Frank [Institute for Transuranium Elements, European Commission, Joint Research Centre, Karlsruhe (Germany)
2011-02-15
{sup 213}Bi-d9MAb-immunoconjugates targeting gastric cancer cells have effectively cured peritoneal carcinomatosis in a nude mouse model following intraperitoneal injection. Because the {beta}-emitter {sup 177}Lu has proven to be beneficial in targeted therapy, {sup 177}Lu-d9MAb was investigated in this study in order to compare its therapeutic efficacy and toxicity with those of {sup 213}Bi-d9MAb. Nude mice were inoculated intraperitoneally with HSC45-M2 gastric cancer cells expressing d9-E-cadherin and were treated intraperitoneally 1 or 8 days later with different activities of specific {sup 177}Lu-d9MAb immunoconjugates targeting d9-E-cadherin or with nonspecific {sup 177}Lu-d8MAb. Therapeutic efficacy was evaluated by monitoring survival for up to 250 days. For evaluation of toxicity, both biodistribution of {sup 177}Lu-d9MAb and blood cell counts were determined at different time points and organs were examined histopathologically. Treatment with {sup 177}Lu-immunoconjugates (1.85, 7.4, 14.8 MBq) significantly prolonged survival. As expected, treatment on day 1 after tumour cell inoculation was more effective than treatment on day 8, and specific {sup 177}Lu-d9MAb conjugates were superior to nonspecific {sup 177}Lu-d8MAb. Treatment with 7.4 MBq of {sup 177}Lu-d9MAb was most successful, with 90% of the animals surviving longer than 250 days. However, treatment with therapeutically effective activities of {sup 177}Lu-d9MAb was not free of toxic side effects. In some animals lymphoblastic lymphoma, proliferative glomerulonephritis and hepatocarcinoma were seen but were not observed after treatment with {sup 213}Bi-d9MAb at comparable therapeutic efficacy. The therapeutic efficacy of {sup 177}Lu-d9MAb conjugates in peritoneal carcinomatosis is impaired by toxic side effects. Because previous therapy with {sup 213}Bi-d9MAb revealed comparable therapeutic efficacy without toxicity it should be preferred for the treatment of peritoneal carcinomatosis. (orig.)
2010-10-01
... procedures (SF's 18, 30, 44, 1165, and 1449, and OF's 336, 347, and 348). 53.213 Section 53.213 Federal... of Forms 53.213 Simplified acquisition procedures (SF's 18, 30, 44, 1165, and 1449, and OF's 336, 347...(e). (e) OF 336 (4/86 Ed.), Continuation Sheet. OF 336, prescribed in 53.214(h), may be used as a...
DEFF Research Database (Denmark)
Kobylecki, Camilla J; Afzal, Shoaib; Nordestgaard, Børge G
2016-01-01
City Heart Study. The hazard ratio for homozygotes versus noncarriers (NC) (213RR) was 2.8 (95% confidence interval: 1.2-6.8, p = 0.02) for IHD, 1.8 (0.7-4.8, p = 0.25) for any form of cancer, and 2.3 (0.9-6.2, p = 0.10) for all-cause mortality. R213G heterozygosity was not associated with morbidity......The extracellular superoxide dismutase (SOD3, EC-SOD) enzyme is a major extracellular scavenger of the superoxide anion, a free radical with the potential to cause oxidative damage. Previously, R213G heterozygosity has been associated with a decreased risk of chronic obstructive pulmonary disease...... (COPD) and an increased risk of ischemic heart disease (IHD). We questioned whether SOD3 R213G homozygosity (213GG) influences morbidity, mortality, and lung function. We found 14 R213G homozygotes (213GG) among 95,871 individuals (1/7000) from the Copenhagen General Population Study and the Copenhagen...
Molecular analysis of RNF213 gene for moyamoya disease in the Chinese Han population.
Directory of Open Access Journals (Sweden)
Zhiyuan Wu
Full Text Available BACKGROUND: Moyamoya disease (MMD is an uncommon cerebrovascular disorder characterized by progressive occlusion of the internal carotid artery causing cerebral ischemia and hemorrhage. Genetic factors in the etiology and pathogenesis of MMD are being increasingly recognized. Previous studies have shown that the RNF213 gene was related to MMD susceptibility in the Japanese population. However, there is no large scale study of the association between this gene and MMD in the Chinese Han population. Thus we designed this case-control study to validate the R4810K mutation and to define the further spectrum of RNF213 mutations in Han Chinese. METHODOLOGY/PRINCIPAL FINDINGS: Genotyping of the R4810K mutation in the RNF213 gene was performed in 170 MMD cases and 507 controls from a Chinese Han population. The R4810K mutation was identified in 22 of 170 MMD cases (13%, including 21 heterozygotes and a single familial homozygote. Two of the 507 controls (0.4% were heterozygous R4810K carriers. The R4810K mutation greatly increased the risk for MMD (OR = 36.7, 95% CI: 8.6~156.6, P = 6.1 E-15. The allele frequency of R4810K was significantly different between patients with ischemia and hemorrhage (OR = 5.4, 95% CI: 1.8~16.1, P = 0.001. Genomic sequencing covering RNF213 exon 40 to exon 68 also identified eight other non-R4810K variants; P4007R, Q4367L, A4399T, T4586P, L4631V, E4950D, A5021V and M5136I. Among them A4399T polymorphism was found in 28/170 cases (16.5% and 45/507 controls (8.9% and was associated with MMD (OR = 2.0, 95% CI: 1.2~3.3, P = 0.004, especially with hemorrhage (OR = 2.8, 95% CI: 1.2~6.5, P = 0.014. CONCLUSIONS: RNF213 mutations are associated with MMD susceptibility in Han Chinese. The ischemic type MMD is particularly related to the R4810K mutation. However, A4399T is also a susceptible variant for MMD, primarily associated with hemorrhage. Identification of novel variants in the RNF213 gene further highlights the genetic
Determination of the half-life of 213Fr with high precision
Fisichella, M.; Musumarra, A.; Farinon, F.; Nociforo, C.; Del Zoppo, A.; Figuera, P.; La Cognata, M.; Pellegriti, M. G.; Scuderi, V.; Torresi, D.; Strano, E.
2013-07-01
High-precision measurement of half-life and Qα value of neutral and highly charged α emitters is a major subject of investigation currently. In this framework, we recently pushed half-life measurements of neutral emitters to a precision of a few per mil. This result was achieved by using different techniques and apparatuses at Istituto Nazionale di Fisica Nucleare Laboratori Nazionali del Sud (INFN-LNS) and GSI Darmstadt. Here we report on 213Fr half-life determination [T1/2(213Fr) = 34.14±0.06 s] at INFN-LNS, detailing the measurement protocol used. Direct comparison with the accepted value in the literature shows a discrepancy of more than three sigma. We propose this new value as a reference, discussing previous experiments.
Digital karyotyping reveals probable target genes at 7q21.3 locus in hepatocellular carcinoma
Directory of Open Access Journals (Sweden)
Wang Shengyue
2011-07-01
Full Text Available Abstract Background Hepatocellular carcinoma (HCC is a worldwide malignant liver tumor with high incidence in China. Subchromosomal amplifications and deletions accounted for major genomic alterations occurred in HCC. Digital karyotyping was an effective method for analyzing genome-wide chromosomal aberrations at high resolution. Methods A digital karyotyping library of HCC was constructed and 454 Genome Sequencer FLX System (Roche was applied in large scale sequencing of the library. Digital Karyotyping Data Viewer software was used to analyze genomic amplifications and deletions. Genomic amplifications of genes detected by digital karyotyping were examined by real-time quantitative PCR. The mRNA expression level of these genes in tumorous and paired nontumorous tissues was also detected by real-time quantitative RT-PCR. Results A total of 821,252 genomic tags were obtained from the digital karyotyping library of HCC, with 529,162 tags (64% mapped to unique loci of human genome. Multiple subchromosomal amplifications and deletions were detected through analyzing the digital karyotyping data, among which the amplification of 7q21.3 drew our special attention. Validation of genes harbored within amplicons at 7q21.3 locus revealed that genomic amplification of SGCE, PEG10, DYNC1I1 and SLC25A13 occurred in 11 (21%, 11 (21%, 11 (21% and 23 (44% of the 52 HCC samples respectively. Furthermore, the mRNA expression level of SGCE, PEG10 and DYNC1I1 were significantly up-regulated in tumorous liver tissues compared with corresponding nontumorous counterparts. Conclusions Our results indicated that subchromosomal region of 7q21.3 was amplified in HCC, and SGCE, PEG10 and DYNC1I1 were probable protooncogenes located within the 7q21.3 locus.
Digital karyotyping reveals probable target genes at 7q21.3 locus in hepatocellular carcinoma.
Dong, Hui; Zhang, Hongyi; Liang, Jianping; Yan, Huadong; Chen, Yangyi; Shen, Yan; Kong, Yalin; Wang, Shengyue; Zhao, Guoping; Jin, Weirong
2011-07-19
Hepatocellular carcinoma (HCC) is a worldwide malignant liver tumor with high incidence in China. Subchromosomal amplifications and deletions accounted for major genomic alterations occurred in HCC. Digital karyotyping was an effective method for analyzing genome-wide chromosomal aberrations at high resolution. A digital karyotyping library of HCC was constructed and 454 Genome Sequencer FLX System (Roche) was applied in large scale sequencing of the library. Digital Karyotyping Data Viewer software was used to analyze genomic amplifications and deletions. Genomic amplifications of genes detected by digital karyotyping were examined by real-time quantitative PCR. The mRNA expression level of these genes in tumorous and paired nontumorous tissues was also detected by real-time quantitative RT-PCR. A total of 821,252 genomic tags were obtained from the digital karyotyping library of HCC, with 529,162 tags (64%) mapped to unique loci of human genome. Multiple subchromosomal amplifications and deletions were detected through analyzing the digital karyotyping data, among which the amplification of 7q21.3 drew our special attention. Validation of genes harbored within amplicons at 7q21.3 locus revealed that genomic amplification of SGCE, PEG10, DYNC1I1 and SLC25A13 occurred in 11 (21%), 11 (21%), 11 (21%) and 23 (44%) of the 52 HCC samples respectively. Furthermore, the mRNA expression level of SGCE, PEG10 and DYNC1I1 were significantly up-regulated in tumorous liver tissues compared with corresponding nontumorous counterparts. Our results indicated that subchromosomal region of 7q21.3 was amplified in HCC, and SGCE, PEG10 and DYNC1I1 were probable protooncogenes located within the 7q21.3 locus.
Energy Technology Data Exchange (ETDEWEB)
Hitomi, Toshiaki [Department of Health and Environmental Sciences, Graduate School of Medicine, Kyoto University, Kyoto (Japan); Habu, Toshiyuki [Radiation Biology Center, Kyoto University, Kyoto (Japan); Kobayashi, Hatasu; Okuda, Hiroko; Harada, Kouji H. [Department of Health and Environmental Sciences, Graduate School of Medicine, Kyoto University, Kyoto (Japan); Osafune, Kenji [Center for iPS Cell Research and Application (CiRA), Kyoto University, Kyoto (Japan); Taura, Daisuke; Sone, Masakatsu [Department of Medicine and Clinical Science, Graduate School of Medicine, Kyoto University, Kyoto (Japan); Asaka, Isao; Ameku, Tomonaga; Watanabe, Akira; Kasahara, Tomoko; Sudo, Tomomi; Shiota, Fumihiko [Center for iPS Cell Research and Application (CiRA), Kyoto University, Kyoto (Japan); Hashikata, Hirokuni; Takagi, Yasushi [Department of Neurosurgery, Graduate School of Medicine, Kyoto University, Kyoto (Japan); Morito, Daisuke [Faculty of Life Sciences, Kyoto Sangyo University, Kyoto (Japan); Miyamoto, Susumu [Department of Neurosurgery, Graduate School of Medicine, Kyoto University, Kyoto (Japan); Nakao, Kazuwa [Department of Medicine and Clinical Science, Graduate School of Medicine, Kyoto University, Kyoto (Japan); Koizumi, Akio, E-mail: koizumi.akio.5v@kyoto-u.ac.jp [Department of Health and Environmental Sciences, Graduate School of Medicine, Kyoto University, Kyoto (Japan)
2013-10-04
Highlights: •Overexpression of RNF213 R4810K inhibited cell proliferation. •Overexpression of RNF213 R4810K had the time of mitosis 4-fold and mitotic failure. •R4810K formed a complex with MAD2 more readily than wild-type. •iPSECs from the MMD patients had elevated mitotic failure compared from the control. •RNF213 R4810K induced mitotic abnormality and increased risk of aneuploidy. -- Abstract: Moyamoya disease (MMD) is a cerebrovascular disease characterized by occlusive lesions in the Circle of Willis. The RNF213 R4810K polymorphism increases susceptibility to MMD. In the present study, we characterized phenotypes caused by overexpression of RNF213 wild type and R4810K variant in the cell cycle to investigate the mechanism of proliferation inhibition. Overexpression of RNF213 R4810K in HeLa cells inhibited cell proliferation and extended the time of mitosis 4-fold. Ablation of spindle checkpoint by depletion of mitotic arrest deficiency 2 (MAD2) did not shorten the time of mitosis. Mitotic morphology in HeLa cells revealed that MAD2 colocalized with RNF213 R4810K. Immunoprecipitation revealed an RNF213/MAD2 complex: R4810K formed a complex with MAD2 more readily than RNF213 wild-type. Desynchronized localization of MAD2 was observed more frequently during mitosis in fibroblasts from patients (n = 3, 61.0 ± 8.2%) compared with wild-type subjects (n = 6, 13.1 ± 7.7%; p < 0.01). Aneuploidy was observed more frequently in fibroblasts (p < 0.01) and induced pluripotent stem cells (iPSCs) (p < 0.03) from patients than from wild-type subjects. Vascular endothelial cells differentiated from iPSCs (iPSECs) of patients and an unaffected carrier had a longer time from prometaphase to metaphase than those from controls (p < 0.05). iPSECs from the patients and unaffected carrier had significantly increased mitotic failure rates compared with controls (p < 0.05). Thus, RNF213 R4810K induced mitotic abnormalities and increased risk of genomic instability.
The 9p21.3 locus and cardiovascular risk in familial hypercholesterolemia.
Paquette, Martine; Chong, Michael; Saavedra, Yascara Grisel Luna; Paré, Guillaume; Dufour, Robert; Baass, Alexis
Carrying a risk variant in the 9p21.3 locus represents one of the strongest genetic risk factors for atherosclerotic cardiovascular disease (ASCVD) in the general population. However, the effect of these polymorphisms in patients with familial hypercholesterolemia (FH) has never been studied. The objective of this study was to investigate the association between the sentinel 9p21.3 single nucleotide polymorphisms (SNP) rs1333047 and ASCVD susceptibility in FH subjects. A total of 20,434 Caucasian patients with dyslipidemia were screened, of which 725 FH were included in this study. The risk allele (T) of the rs1333047 SNP has previously been shown to confer increased ASCVD risk compared with the control allele (A). In a model adjusted for traditional cardiovascular risk factors, carrying the risk allele was associated with a 42% increased ASCVD susceptibility per allele, according to an additive model (odds ratio = 1.42; 95% confidence interval, 1.05-1.91; P = .02). On average, 0.53 cardiovascular event was observed in AA carriers, compared with 0.83 in the TT group (P = .02). The mean age of first ASCVD event was similar among the 3 variants. The 9p21.3 SNP rs1333047 SNP was associated with increased ASCVD in FH subjects. Genetic screening for this SNP could allow to identify very high risk FH patients, which could benefit from more aggressive ASCVD prevention. Copyright © 2017 National Lipid Association. Published by Elsevier Inc. All rights reserved.
On the Effect of Fluorination of 2,1,3-Benzothiadiazole
Nielsen, Christian B.
2015-04-22
The 4,7-dithieno-2,1,3-benzothiadiazole (DTBT) moiety and its fluorinated counterpart are important pi-conjugated building blocks in the field of organic electronics. Here we present a combined experimental and theoretical investigation into fundamental properties relating to these two molecular entities and discuss the potential impact on extended π-conjugated materials and their electronic properties. While the fluorinated derivative, in the solid state, packs with a smaller co-facial overlap than DTBT, we report experimental evidence for stronger optical absorption as well as stronger intra- and intermolecular contacts upon fluorination.
A comparison of neutron spectrum unfolding codes used with a miniature NE213 detector
Koohi-Fayegh, R; Scott, M C
2001-01-01
The effects of unfolding technique on neutron spectra measured with a miniature NE-213 spectrometer are investigated. The codes used were FORIST, FERDOR and RADAK, a differential code FLYSPEC and one developed by the authors based on Neural Networks. The characteristics required of experimental test spectra were that they be structured, well known and have a significant component above 10 MeV. Four different test spectra were employed. It is found that all the codes performed well with the test spectra used, producing generally consistent results.
On the Use of an ER-213 Detonator to Establish a Baseline for the ER-486
Energy Technology Data Exchange (ETDEWEB)
Thomas, Keith A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Liechty, Gary H. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Jaramillo, Dennis C. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Munger, Alan C. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); McHugh, Douglas C. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Kennedy, James E. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2014-08-19
This report documents a series of tests using a TSD-115 fireset coupled with an ER-213, a gold exploding bridgewire (EBW) detonator. These tests were designed to fire this EBW with a smaller fireset to obtain current and voltage data as well as timing information at voltage levels below, above, and throughout the threshold firing region. This study could then create a database for comparison to our current ER-486 EBW development, which is designed to be a lower voltage (<500V) device.
A Case with 46,XX,dup(X(q21.3q24 karyotype
Directory of Open Access Journals (Sweden)
Selda Şimşek
2010-03-01
Full Text Available The relationship between phenotype and Xq duplicationsin females remains unclear. Some females are normal;some have short stature; and others have features suchas microcephaly, developmental delay/mental retardation,body asymmetries, and gonadal dysgenesis. Somefeatures in these females resemble those in Turner syndrome.We, herein, presented a 15 years-old girl withshort stature and primary amenorrhea, who was referredto cytogenetic laboratory. Through karyotipe analysis performedby Giemsa banding technique, the patient wasdetermined to have positive Barr body and 46,XX,dup(X(q21.3q24 chromosomal constitution. Case was discussedaccording to information of present literatures.
Kanoke, Atsushi; Fujimura, Miki; Niizuma, Kuniyasu; Fujimura, Taku; Kakizaki, Aya; Ito, Akira; Sakata, Hiroyuki; Sato-Maeda, Mika; Kure, Shigeo; Tominaga, Teiji
2016-07-01
Moyamoya disease (MMD) is a chronic, occlusive cerebrovascular disease with an unknown etiology and is characterized by an abnormal vascular network at the base of the brain. Recent studies identified the RNF213 gene (RNF213) as an important susceptibility gene for MMD; however, the mechanisms underlying the RNF213 abnormality related to MMD have not yet been elucidated. We previously reported that Rnf213-deficient mice and Rnf213 p. R4828K knock-in mice did not spontaneously develop MMD, indicating the importance of secondary insults in addition to genetic factors in the pathogenesis of MMD. The most influential secondary insult is considered to be an immunological reaction because RNF213 is predominantly expressed in immunological tissues. Therefore, we herein attempted to evaluate the role of an immunological stimulation as a supplementary insult to the target disruption of RNF213 in the pathophysiology of MMD. Rnf213-deficient mice were treated with strong immunological adjuvants including muramyl dipeptide (MDP)-Lys (L18), and then underwent time-sequential magnetic resonance angiography (MRA) up to 40 weeks of age. The results obtained did not reveal any characteristic finding of MMD, and no significant difference was observed in MRA findings or the anatomy of the circle of Willis between Rnf213-deficient mice and wild-type mice after the administration of MDP-Lys (L18). The ratio of regulatory T cells after the administration of MDP-Lys (L18) was significantly decreased in Rnf213-deficient mice (p<0.01), suggesting the potential role of the RNF213 abnormality in the differentiation of regulatory T cells. Although the mechanisms underlying the development of MMD currently remain unclear, the RNF213 abnormality may compromise immunological self-tolerance, thereby contributing to the development of MMD. Copyright © 2016 Elsevier B.V. All rights reserved.
Chains of Dense Cores in the Taurus L1495/B213 Complex
Tafalla, Mario; Hacar, Alvaro
2014-07-01
We study the formation of dense cores in the filamentary L1495/B213 region of Taurus. Observations of its C18O emission show that what appears as a single 10pc-long filament in optical and continuum images is in fact a complex web of smaller filamentary structures that we call fibers. These fibers are typically 0.5~pc long and velocity coherent, and seem to have decoupled from the turbulent velocity field of the large-scale cloud. Fibers appear as the true parent structures of the cores, but only a small subset of them seem able to form cores ("fertile fibers") while the rest remain sterile. The fertile-sterile dychotomy of fibers is striking, since sterile fibers do not form cores but fertile fibers form three cores on average. As a result, most cores in the L1495/B213 region are part of linear groups or chains that have a typical core spacing of 0.1pc. Our observations and analysis suggest that core formation out of a large-scale filament is a two-step process that involves first the dissipation of turbulence via shock interaction and then the fragmentation of those disspated structures that exceed the mass per unit length limit of gravitational instability.
Generation of the neutron response function of an NE213 scintillator for fusion applications
Binda, F.; Eriksson, J.; Ericsson, G.; Hellesen, C.; Conroy, S.; Nocente, M.; Sundén, E. Andersson; JET Contributors
2017-09-01
In this work we present a method to evaluate the neutron response function of an NE213 liquid scintillator. This method is particularly useful when the proton light yield function of the detector has not been measured, since it is based on a proton light yield function taken from literature, MCNPX simulations, measurements of gamma-rays from a calibration source and measurements of neutrons from fusion experiments with ohmic plasmas. The inclusion of the latter improves the description of the proton light yield function in the energy range of interest (around 2.46 MeV). We apply this method to an NE213 detector installed at JET, inside the radiation shielding of the magnetic proton recoil (MPRu) spectrometer, and present the results from the calibration along with some examples of application of the response function to perform neutron emission spectroscopy (NES) of fusion plasmas. We also investigate how the choice of the proton light yield function affects the NES analysis, finding that the result does not change significantly. This points to the fact that the method for the evaluation of the neutron response function is robust and gives reliable results.
Cao, Yang; Kobayashi, Hatasu; Morimoto, Takaaki; Kabata, Risako; Harada, Kouji H; Koizumi, Akio
2016-09-01
RNF213 p.R4810K is a founder polymorphism that confers genetic susceptibility to moyamoya disease in East Asia. Only a few studies have investigated the symptoms and disease histories of RNF213 p.R4810K carriers in Japan. This study investigated the frequency of RNF213 p.R4810K in the general Japanese population and the health characteristics of the carriers. Through a health-promotion campaign in the city of Uji, Japan, 519 subjects (120 males and 399 females) of the general Japanese population were genotyped for RNF213 p.R4810K and interviewed to determine health characteristics. Nine RNF213 p.R4810K heterozygous carriers (GA genotype) and no RNF213 p.R4810K homozygous carriers (AA genotype) were found among the 519 individuals. The estimates of the genotypes and allele frequencies for RNF213 p.R4810K were 1.73 and 0.87 %, respectively. There were no obvious differences in age, gender ratio, body mass index, hypertension, dyslipidemia, diabetes, kidney disease, liver disease, heart disease, or drinking or smoking habits between carriers and non-carriers. Interestingly, one patient with moyamoya disease was found among the nine RNF213 p.R4810K carriers. This study showed the genotypes and allele frequencies of RNF213 p.R4810K in the general Japanese population to be similar to results of previous reports.
Energy Technology Data Exchange (ETDEWEB)
Davis, I.A.; Kennel, S.J.
1998-10-14
A monoclonal antibody (201B) specific to murine thrombomodulin, covalently linked to CHX-b-DTPA, successfully delivers chelated 213Bi, an {alpha}-particle emitter, (213Bi-201B) rapidly to lungvascular endothelium. When injected at doses of l MBq/mouse, 213Bi-201B destroyed most of the 100 colonies of EMT-6 mammary carcinomas growing as lung tumors of up to 2000 cells/colony. Some mice were cured of lung tumors and others had extended life-spans compared to untreated control animals but eventually succumbed to tumor recurrence. At injected doses of 4-6 MBq/mouse, 100% of lung tumor colonies were eliminated; however, 3-4 months later these mice developed pulmonary fibrosis and died. The mechanisms leading to the fibrotic response in other pulmonary irradiation models strongly implicate tumor necrosis factor-alpha (TNF-{alpha}), released from damaged tissues, as the pivotal inflammatory cytokine in a cascade of events which culminate in fibrosis. Attempts to prevent the development of pulmonary fibrosis, by using antibodies or soluble receptor (Enbrel{trademark}) as inhibitors of TNF-{alpha}, were unsuccessful. Additionally, mice genetically deficient for TNF-{alpha} production developed pulmonary fibrosis following 213Bi-201B treatment. Interestingly, non-tumor bearing BALB/c mice receiving Enbrel{trademark} or mice genetically deficient in TNF-{alpha} production and treated with 213Bi-201B, had significantly reduced life spans compared to mice receiving no treatment or 213Bi-201B alone. We speculate that, in normal mice, while TNF-{alpha} may induce an inflammatory response following {alpha}-particle radiation mediated tumor clearance and pulmonary damage, its effects in the post-tumor clearance time period may actually retard the development of fibrosis.
Khochamit, Nalisa; Siripornadulsil, Surasak; Sukon, Peerapol; Siripornadulsil, Wilailak
2015-01-01
The antimicrobial activity and probiotic properties of Bacillus subtilis strain KKU213, isolated from local soil, were investigated. The cell-free supernatant (CFS) of a KKU213 culture containing crude bacteriocins exhibited inhibitory effects on Gram-positive bacteria, including Bacillus cereus, Listeria monocytogenes, Micrococcus luteus, and Staphylococcus aureus. The antibacterial activity of the CFS precipitated with 40% ammonium sulfate (AS) remained even after treatment at 60 and 100 °C, at pH 4 and 10 and with proteolytic enzymes, detergents and heavy metals. When analyzed by SDS-PAGE and overlaid with the indicator strains B. cereus and S. aureus, the 40% AS precipitate exhibited inhibitory activity on proteins smaller than 10 kDa. However, proteins larger than 25 kDa and smaller than 10 kDa were still observed on a native protein gel. Purified subtilosin A was prepared by Amberlite XAD-16 bead extraction and HPLC and analyzed by Nano-LC-QTOF-MS. Its molecular mass was found to be 3.4 kDa, and it retained its antibacterial activity. These results are consistent with the detection of the anti-listerial subtilosin A gene of the sbo/alb cluster in the KKU213 strain, which is 100% identical to that of B. subtilis subsp. subtilis 168. In addition to stable and cyclic subtilosin A, a mixture of many extracellular antibacterial peptides was also detected in the KKU213 culture. The KKU213 strain produced extracellular amylase, cellulase, lipase and protease, is highly acid-resistant (pH 2) when cultured in inulin and promotes health and reduces infection of intestinally colonized broiler chickens. Therefore, we propose that bacteriocin-producing B. subtilis KKU213 could be used as a potential probiotic strain or protective culture. Copyright © 2014 Elsevier GmbH. All rights reserved.
High-precision mass measurements of {sup 203-207}Rn and {sup 213}Ra with SHIPTRAP
Energy Technology Data Exchange (ETDEWEB)
Droese, C.; Marx, G.; Schweikhard, L. [Ernst-Moritz-Arndt-Universitaet, Greifswald (Germany); Ackermann, D.; Block, M.; Dworschak, M.; Herfurth, F.; Hofmann, S. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Andersson, L.L. [University of Liverpool, Liverpool (United Kingdom); Johannes Gutenberg-Universitaet, Helmholtz-Institut Mainz, Mainz (Germany); Blaum, K. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Ruprecht-Karls-Universitaet Heidelberg, Heidelberg (Germany); Eibach, M. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Johannes Gutenberg-Universitaet Mainz, Mainz (Germany); Eliseev, S.; Ketelaer, J. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Forsberg, U.; Rudolph, D. [Lund University, Lund (Sweden); Haettner, E.; Plass, W.R.; Scheidenberger, C. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Justus-Liebig-Universitaet Giessen, Giessen (Germany); Hessberger, F.P. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Johannes Gutenberg-Universitaet, Helmholtz-Institut Mainz, Mainz (Germany); Minaya Ramirez, E. [Johannes Gutenberg-Universitaet, Helmholtz-Institut Mainz, Mainz (Germany); Nesterenko, D.; Novikov, Yu.N. [NRC Kurchatov Institute, PNPI, Gatchina (Russian Federation); Rodriguez, D. [Universidad de Granada, Campus de Fuentenueva, Granada (Spain); Stolze, S. [University of Jyvaeskylae, Jyvaeskylae (Finland); Thirolf, P.G.; Weber, C. [Ludwig Maximilians-Universitaet Muenchen, Garching (Germany)
2013-01-15
The masses of the nuclides {sup 203-207}Rn and {sup 213}Ra were measured directly for the first time with the Penning-trap mass spectrometer SHIPTRAP at GSI Darmstadt. The results confirm the previously determined mass values. The mass uncertainties for {sup 205}Rn and {sup 213}Ra were significantly reduced. The results are relevant for the investigation of the nuclear shell structure between N=82 and N=126. As an indicator of structural changes the two-neutron separation energies S{sub 2n}(Z,N) have been studied. (orig.)
Directory of Open Access Journals (Sweden)
Ana Carolina Campi-Azevedo
Full Text Available BACKGROUND: This study aimed to compare the cytokine-mediated immune response in children submitted to primary vaccination with the YF-17D-213/77 or YF-17DD yellow fever (YF substrains. METHODS: A non-probabilistic sample of eighty healthy primary vaccinated (PV children was selected on the basis of their previously known humoral immune response to the YF vaccines. The selected children were categorized according to their YF-neutralizing antibody titers (PRNT and referred to as seroconverters (PV-PRNT(+ or nonseroconverters (PV-PRNT(-. Following revaccination with the YF-17DD, the PV-PRNT(- children (YF-17D-213/77 and YF-17DD groups seroconverted and were referred as RV-PRNT(+. The cytokine-mediated immune response was investigated after short-term in vitro cultures of whole blood samples. The results are expressed as frequency of high cytokine producers, taking the global median of the cytokine index (YF-Ag/control as the cut-off. RESULTS: The YF-17D-213/77 and the YF-17DD substrains triggered a balanced overall inflammatory/regulatory cytokine pattern in PV-PRNT(+, with a slight predominance of IL-12 in YF-17DD vaccinees and a modest prevalence of IL-10 in YF-17D-213/77. Prominent frequency of neutrophil-derived TNF-α and neutrophils and monocyte-producing IL-12 were the major features of PV-PRNT(+ in the YF-17DD, whereas relevant inflammatory response, mediated by IL-12(+CD8(+ T cells, was the hallmark of the YF-17D-213/77 vaccinees. Both substrains were able to elicit particular but relevant inflammatory events, regardless of the anti-YF PRNT antibody levels. PV-PRNT(- children belonging to the YF-17DD arm presented gaps in the inflammatory cytokine signature, especially in terms of the innate immunity, whereas in the YF-17D-213/77 arm the most relevant gap was the deficiency of IL-12-producing CD8(+T cells. Revaccination with YF-17DD prompted a balanced cytokine profile in YF-17DD nonresponders and a robust inflammatory profile in YF-17D
Carbon Dioxide Clusters: (CO_2)_6 to (CO_2)13
McKellar, A. R. W.; Oliaee, J. Norooz; Dehghany, M.; Moazzen-Ahmadi, N.
2011-06-01
We recenty reported assignments of specific infrared bands in the CO_2 νb{3} region (˜2350 wn) to (CO_2)_6, (CO_2)_7, (CO_2)_9, (CO_2)10, (CO_2)11, (CO_2)12, and (CO_2)13. Spectra are obtained by direct absorption using a rapid-scan tuneable diode laser spectrometer to probe a pulsed supersonic slit-jet expansion and assignments are facilitated by recent calculations of Takeuchi based on the Murthy potential. (CO_2)_6 is a symmetric top with S_6 point group symmetry which can be thought of as a stack of two planar cyclic trimers. (CO_2)13 is also an S_6 symmetric top, and consists of a single CO_2 monomer surrounded by an slightly distorted icosahedral cage. The remaining clusters are asymmetric tops without symmetry. Here we report additional CO_2 cluster results. Calculations based on the SAPT-s potential indicate that the structure of (CO_2)10 may be slightly different from that given by Takeuchi/Murthy. An additional band is observed for each of (CO_2)13 and (CO_2)10. A feature observed at 2378.2 wn is assigned as a (CO_2)_6 parallel combination band involving the sum of a fundamental and a low-lying intermolecular vibration. Most significantly, two bands are assigned to a second isomer of (CO_2)_6. This is also a symmetric top, but now with S_4 symmetry. The two symmetric hexamer isomers observed spectroscopically correspond well with the lowest energy structures given by both the SAPT-s and Murthy intermolecular potentials. [1] J. Norooz Oliaee, M. Dehgany, N. Moazzen-Ahmadi, and A.R.W. McKellar, Phys. Chem. Chem. Phys. 13, 1297 (2011). [2] H. Takeuchi, J. Phys. Chem. A 107, 5703 (2008); C.S. Murthy, S.F. O'Shea, and I.R. McDonald, Mol. Phys. 50, 531 (1983). [3] R. Bukowski, J. Sadlej, B. Jeziorski, P. Jankowski, K. Szalewicz, S.A. Kucharski, H.L. Williams, and B.M. Rice, J. Chem. Phys. 110, 3785 (1999)
The Role of RNF213 4810G>A and 4950G>A Variants in Patients with Moyamoya Disease in Korea
Directory of Open Access Journals (Sweden)
Young Seok Park
2017-11-01
Full Text Available Although a founder variant of RNF213 4810G>A is a major genetic risk factor for moyamoya disease (MMD in East Asians, the frequency and disease susceptibility of RNF213 variants remain largely unknown. This study investigated the mutation analysis of RNF213 (4448, 4810, 4863, and 4950 between Korean MMD and healthy controls. We performed a polymerase chain reaction-restriction fragment length polymorphism analysis. To identify the association between RNF213 gene polymorphisms and MMD disease, we performed statistical analyses such as multivariable logistic regression and Fisher’s exact test. Genetic data from 117 MMD patients were analyzed and compared with 253 healthy controls. We assessed and compared single nucleotide polymorphisms of RNF213 (4448, 4810, 4863, and 4950 between MMD and control groups. We performed genome-wide association studies to investigate the genetic pathophysiology of MMD. Among the RNF213 variants (4448G>A, 4810G>A, 4863G>A, and 4950G>A, RNF213 4810G>A and 4950G>A variants were more frequent in MMD patients. In a subgroup analysis, the RNF213 4810G>A was more frequent in moyamoya disease, and the comparison with GG+AA genotype was also significantly different in moyamoya patients. These results confirm that RNF213 4810G>A and RNF213 4950G>A were more frequent in MMD patients. We have confirmed that RNF213 4810G>A and 4950G>A are strongly associated with Korean MMD in children and adults as well as for the ischemic and hemorrhagic types.
The Role of RNF213 4810G>A and 4950G>A Variants in Patients with Moyamoya Disease in Korea
Park, Young Seok; An, Hui Jeong; Kim, Jung Oh; Kim, Won Seop; Han, In Bo; Kim, Ok Joon; Kim, Dong-Seok
2017-01-01
Although a founder variant of RNF213 4810G>A is a major genetic risk factor for moyamoya disease (MMD) in East Asians, the frequency and disease susceptibility of RNF213 variants remain largely unknown. This study investigated the mutation analysis of RNF213 (4448, 4810, 4863, and 4950) between Korean MMD and healthy controls. We performed a polymerase chain reaction-restriction fragment length polymorphism analysis. To identify the association between RNF213 gene polymorphisms and MMD disease, we performed statistical analyses such as multivariable logistic regression and Fisher’s exact test. Genetic data from 117 MMD patients were analyzed and compared with 253 healthy controls. We assessed and compared single nucleotide polymorphisms of RNF213 (4448, 4810, 4863, and 4950) between MMD and control groups. We performed genome-wide association studies to investigate the genetic pathophysiology of MMD. Among the RNF213 variants (4448G>A, 4810G>A, 4863G>A, and 4950G>A), RNF213 4810G>A and 4950G>A variants were more frequent in MMD patients. In a subgroup analysis, the RNF213 4810G>A was more frequent in moyamoya disease, and the comparison with GG+AA genotype was also significantly different in moyamoya patients. These results confirm that RNF213 4810G>A and RNF213 4950G>A were more frequent in MMD patients. We have confirmed that RNF213 4810G>A and 4950G>A are strongly associated with Korean MMD in children and adults as well as for the ischemic and hemorrhagic types. PMID:29160859
Neuropathic pain in patients with spinal cord injury: report of 213 patients
Directory of Open Access Journals (Sweden)
Manoel Jacobsen Teixeira
2013-09-01
Full Text Available Objective Management of neuropathic pain following spinal cord injury (SCI can be a frustrating experience for patients since it poses a therapeutic challenge. In this article the authors describe the clinical characteristics of a group of patients with pain after spinal cord injury. Methods In this retrospective study, 213 patients with SCI and neuropathic pain were assessed. We analyzed clinical characteristics, treatment options, and pain intensity for these patients. Results The main cause of SCI was spine trauma, which occurred in 169 patients, followed by tumors and infection. Complete lesions were verified in 144 patients. In our study, patients with traumatic SCI and partial lesions seem to be presented with more intense pain; however, this was not statistically significant. Conclusions Neuropathic pain is a common complaint in patients with SCI and presents a treatment challenge. Knowledge of the clinical characteristics of this group of patients may help determine the best approach to intervention.
DEFF Research Database (Denmark)
Olesen, Inge Ahlmann; Andersson, Anna-Maria; Aksglaede, Lise
2017-01-01
OBJECTIVE: To study the pathologic findings among men evaluated for infertility. DESIGN: A retrospective, single-center, cross-sectional study. SETTING: University hospital-based research center. PARTICIPANT(S): We included data from 1,213 medical records from infertile men referred for diagnostic...... work-up from 2005 to 2009. INTERVENTIONS(S): None. MAIN OUTCOME MEASURE(S): Health history, clinical findings, chromosome/genetic aberrations, semen quality, reproductive hormones. RESULT(S): In total, 64.4% of the infertile men had one or more reproductive disorders or factors influencing fertility......, leaving 35.6% diagnosed as idiopathic infertile. In 244 patients (20%), including seven cases of testicular cancer and/or germ cell neoplasia in situ, a pathologic finding was first detected during diagnostic work-up. Two hundred four patients (16.8%) had a history of cryptorchidism and 154 (12...
Sun, Zhihong; Harris, Hugh M. B.; McCann, Angela; Guo, Chenyi; Argimón, Silvia; Zhang, Wenyi; Yang, Xianwei; Jeffery, Ian B; Cooney, Jakki C.; Kagawa, Todd F.; Liu, Wenjun; Song, Yuqin; Salvetti, Elisa; Wrobel, Agnieszka; Rasinkangas, Pia; Parkhill, Julian; Rea, Mary C.; O'Sullivan, Orla; Ritari, Jarmo; Douillard, François P.; Paul Ross, R.; Yang, Ruifu; Briner, Alexandra E.; Felis, Giovanna E.; de Vos, Willem M.; Barrangou, Rodolphe; Klaenhammer, Todd R.; Caufield, Page W.; Cui, Yujun; Zhang, Heping; O'Toole, Paul W.
2015-01-01
Lactobacilli are a diverse group of species that occupy diverse nutrient-rich niches associated with humans, animals, plants and food. They are used widely in biotechnology and food preservation, and are being explored as therapeutics. Exploiting lactobacilli has been complicated by metabolic diversity, unclear species identity and uncertain relationships between them and other commercially important lactic acid bacteria. The capacity for biotransformations catalysed by lactobacilli is an untapped biotechnology resource. Here we report the genome sequences of 213 Lactobacillus strains and associated genera, and their encoded genetic catalogue for modifying carbohydrates and proteins. In addition, we describe broad and diverse presence of novel CRISPR-Cas immune systems in lactobacilli that may be exploited for genome editing. We rationalize the phylogenomic distribution of host interaction factors and bacteriocins that affect their natural and industrial environments, and mechanisms to withstand stress during technological processes. We present a robust phylogenomic framework of existing species and for classifying new species. PMID:26415554
Vasorelaxant effects of novel Kv7.4 channel enhancers ML213 and NS15370
DEFF Research Database (Denmark)
Jepps, Thomas Andrew; Bentzen, B H; Stott, J B
2014-01-01
BACKGROUND AND PURPOSE: The KCNQ encoded voltage-gated potassium channel family (Kv7.1-Kv7.5) are established regulators of smooth muscle contractility, where Kv7.4 and Kv7.5 predominate. Various Kv7.2-Kv7.5 channel enhancers have been developed that have been shown to cause a vasorelaxation...... in both rodent and human blood vessels. Recently, two novel Kv7 channel enhancers have been identified, ML213 and NS15370, that show increased potency, particularly on Kv7.4 channels. The aim of this study was to characterise the effects of these novel enhancers in different rat blood vessels and compare...
2,1,3-Benzothiadiazine derivatives: synthesis and screening versus PDE4 enzyme.
Tait, Annalisa; Luppi, Amedeo; Avallone, Rossella; Baraldi, Mario
2005-08-01
A series of N-1,3 disubstituted 2,1,3-benzothiadiazine derivatives (BTDs) were synthesized and evaluated for their inhibitory activity versus enzymatic isoform PDE4 extracted from U937 cell line. Some of the tested compounds showed a high PDE4 inhibitory activity at 100 microM and the IC(50) value of the most interesting terms were evaluated. The structure-activity relationships of these compounds showed that the 3,5-di-tert-butyl-4-hydroxybenzyl moiety at N-1 position is important to obtain activity at micromolar level as previously reported. For the same compounds the antioxidant activity were evaluated highlighting 14 as the most significative one. The introduction of other bulky substituents in N-1 position is detrimental.
Active shimming method for a 21.3 MHz small-animal MRI magnet
Chen, Shanshan; Xia, Tian; Miao, Zhiying; Xu, Luoyuan; Wang, Hongzhi; Dai, Shuguang
2017-04-01
In a 21.3 MHz animal nuclear magnetic resonance (NMR) analyzer and imaging system, high uniformity of the static field B 0 is a crucial prerequisite for obtaining high-quality images and detecting weak signals with short relaxation time. Using only passive shimming and gradient shimming, it is impossible to achieve perfect B 0 uniformity. This paper presents an approach involving high-order active shimming for an NMR analyzer and an imaging magnet. The diameter spherical volume (DSV) of the magnet is only 60 mm. The spherical harmonic function is introduced to analyze the magnetic field and provide a foundation for active shimming. Eleven pairs of bi-planar active shim coils (X, Y, Z, XZ, YZ, Z 2, X 2 + Y 2, X 2 - Y 2, Z 3, Z 4, Z 5) were designed using the target field-and stream-function methods, and coils were manufactured with printed circuit board technology in this research. The magnetic field created by these electrified shim coils compensates effectively and accurately for the static magnetic field B 0. The full width at half maximum of the resonance spectrum was used to measure the shimming effect. The results of practical shimming experiments in a 21.3 MHz animal NMR analyzer and imaging device showed that this new approach helps to reduce inhomogeneity from 24 ppm (24 × 10-6) to 0.39 ppm (0.39 × 10-6) over a 60 mm DSV, which meets the requirements of imaging and analytical practice.
2010-01-01
... if I withdrew all or part of my TSP account after I was corrected to FERS? 839.213 Section 839.213... of my TSP account after I was corrected to FERS? (a) You may not make a retirement coverage election... one of the following TSP withdrawals: (1) A TSP annuity after separation from service, but before...
2010-10-01
... Relating to Transportation (Continued) TRANSPORTATION SECURITY ADMINISTRATION, DEPARTMENT OF HOMELAND SECURITY CIVIL AVIATION SECURITY FOREIGN AIR CARRIER SECURITY Operations § 1546.213 Access to cargo... 49 Transportation 9 2010-10-01 2010-10-01 false Access to cargo: Security threat assessments for...
Yamazaki, Satoru; Toyoda, Atsushi; Kikuta, Ken-ichiro; Takagi, Yasushi; Harada, Kouji H.; Fujiyama, Asao; Herzig, Roman; Krischek, Boris; Zou, Liping; Kim, Jeong Eun; Kitakaze, Masafumi; Miyamoto, Susumu; Nagata, Kazuhiro; Hashimoto, Nobuo; Koizumi, Akio
2011-01-01
Background Moyamoya disease is an idiopathic vascular disorder of intracranial arteries. Its susceptibility locus has been mapped to 17q25.3 in Japanese families, but the susceptibility gene is unknown. Methodology/Principal Findings Genome-wide linkage analysis in eight three-generation families with moyamoya disease revealed linkage to 17q25.3 (Pmoyamoya disease in East Asian populations (251 cases and 707 controls) with an odds ratio of 111.8 (P = 10−119). Sequencing of RNF213 in East Asian cases revealed additional novel variants: p.D4863N, p.E4950D, p.A5021V, p.D5160E, and p.E5176G. Among Caucasian cases, variants p.N3962D, p.D4013N, p.R4062Q and p.P4608S were identified. RNF213 encodes a 591-kDa cytosolic protein that possesses two functional domains: a Walker motif and a RING finger domain. These exhibit ATPase and ubiquitin ligase activities. Although the mutant alleles (p.R4810K or p.D4013N in the RING domain) did not affect transcription levels or ubiquitination activity, knockdown of RNF213 in zebrafish caused irregular wall formation in trunk arteries and abnormal sprouting vessels. Conclusions/Significance We provide evidence suggesting, for the first time, the involvement of RNF213 in genetic susceptibility to moyamoya disease. PMID:21799892
Synthesis of New 2-(1,3-Dithianylphenols and Hexakis-[p-(1,3-dithian-2-ylphenoxy]cyclotriphosphazene
Directory of Open Access Journals (Sweden)
Prónayová Nadezda
1997-01-01
Full Text Available 2-Chloro-1,3-dithiane was obtained by the chlorination of 1,3-dithiane with N-chlorosuccinimide. Reactions of 2-chloro-1,3-dithiane with various substituted phenols lead to 2-(1,3-dithianylphenols (3. Hexakis-[p-(1,3-dithian-2-ylphenoxy]cyclotriphosphazene (6 was obtained by reaction with hexachlorotriazacyclotriphosphazene (5.
Directory of Open Access Journals (Sweden)
Wanyang Liu
Full Text Available Moyamoya disease is an idiopathic vascular disorder of intracranial arteries. Its susceptibility locus has been mapped to 17q25.3 in Japanese families, but the susceptibility gene is unknown.Genome-wide linkage analysis in eight three-generation families with moyamoya disease revealed linkage to 17q25.3 (P<10(-4. Fine mapping demonstrated a 1.5-Mb disease locus bounded by D17S1806 and rs2280147. We conducted exome analysis of the eight index cases in these families, with results filtered through Ng criteria. There was a variant of p.N321S in PCMTD1 and p.R4810K in RNF213 in the 1.5-Mb locus of the eight index cases. The p.N321S variant in PCMTD1 could not be confirmed by the Sanger method. Sequencing RNF213 in 42 index cases confirmed p.R4810K and revealed it to be the only unregistered variant. Genotyping 39 SNPs around RNF213 revealed a founder haplotype transmitted in 42 families. Sequencing the 260-kb region covering the founder haplotype in one index case did not show any coding variants except p.R4810K. A case-control study demonstrated strong association of p.R4810K with moyamoya disease in East Asian populations (251 cases and 707 controls with an odds ratio of 111.8 (P = 10(-119. Sequencing of RNF213 in East Asian cases revealed additional novel variants: p.D4863N, p.E4950D, p.A5021V, p.D5160E, and p.E5176G. Among Caucasian cases, variants p.N3962D, p.D4013N, p.R4062Q and p.P4608S were identified. RNF213 encodes a 591-kDa cytosolic protein that possesses two functional domains: a Walker motif and a RING finger domain. These exhibit ATPase and ubiquitin ligase activities. Although the mutant alleles (p.R4810K or p.D4013N in the RING domain did not affect transcription levels or ubiquitination activity, knockdown of RNF213 in zebrafish caused irregular wall formation in trunk arteries and abnormal sprouting vessels.We provide evidence suggesting, for the first time, the involvement of RNF213 in genetic susceptibility to moyamoya
Ma, D; McDevitt, M R; Finn, R D; Scheinberg, D A
2001-11-01
Bisumth-213, a short-lived alpha particle emitting radionuclide, is generated from the decay of 225Ac, which has a half-life of 10 days. The development of a clinical 225Ac/213Bi generator and the preparation of a 213Bi radiolabeled antibody for radioimmunotherapy of leukemia have been reported. The 225Ac decay scheme is complex; therefore a thorough understanding of the impact of both the parent 225Ac and its daughters on radiolabeling, purification, and quantification is necessary for optimal use of the generator system. This paper reports: (i) unique new methods to measure 221Fr, 213Bi, and 209Pb, the prominent daughters of 225Ac; and (ii) a quantitative evaluation of 225Ac/213Bi generator breakthrough and the radionuclidic purity of 213Bi labeled radiopharmaceutical dose formulations. A quantitative multi-dimensional proportional scanning method was employed to distinguish and measure specific daughter radionuclides. This method combines thin layer chromatography in two perpendicular directions with attenuated collimation as a function of time for data collection and analysis. Francium-221 and 213Bi eluted differentially from the generator, and 221Fr contributed minimally to unchelated 213Bi in the reaction and final products. Lead-209 was present in the reaction solution, but not strongly bound by the chelating moiety either (i) under the 213Bi labeling reaction conditions or (ii) following chelated 213Bi decay. As a consequence of incorporating several new procedures to the operation of the generator, 225Ac breakthrough in the final product was further reduced and represented a trivial contaminant in the final drug formulations.
Poster - Thurs Eve-11: Quantitative imaging of 213Bi alpha-emitter with a beta-imager.
Hobbs, R; Song, H; Sgouros, G
2008-07-01
Targeted alpha-particle emitter therapy is emerging as a promising approach for treating metastatic cancer. An understanding of the biodistribution of targeted alpha-emitters at the cell level is important in evaluating potential efficacy and toxicity. This is best accomplished by autoradiography of tissue samples, ex vivo. We have investigated the feasibility of using a high resolution, quantitative beta-imager (Biospace Mesures β-Imager) to detect the short-lived alpha-particle emitter, Bismuth-213 (213Bi). The advantages of this detector include: shorter acquisition time than film-based autoradiography, which is critical for an isotope with such a short half-life; high resolution; and data acquisition in list mode. While our interest in 213Bi lies in the α, the decay chain includes high energy β- particles, enabling this study. Published studies using the β-Imager show predominantly qualitative results, with the quantitative depending on long exposure time or direct comparisons. At low count rate the detector auto-regulates by varying the HV, directly affecting the results. We imaged a phantom prepared from 213Bi in 5% gelatin. We plot only the results in a narrow HV range and fit an exponential decay function to obtain a half-life close to the expected value. We plot the ratio of the exponential fit to the measured count rate value against HV for all count rates and find a functional correlation between HV and count rate. A similar correction for gas flow ratio variations is also applied. As the remaining fluctuations conform to Gaussian statistics, this suggests that we have successfully calibrated 213Bi for future studies. © 2008 American Association of Physicists in Medicine.
Cores, filaments, and bundles: hierarchical core formation in the L1495/B213 Taurus region
Hacar, A.; Tafalla, M.; Kauffmann, J.; Kovács, A.
2013-06-01
Context. Core condensation is a critical step in the star-formation process, but it is still poorly characterized observationally. Aims: We have studied the 10 pc-long L1495/B213 complex in Taurus to investigate how dense cores have condensed out of the lower density cloud material. Methods: We observed L1495/B213 in C18O(1-0), N2H+(1-0), and SO(JN = 32-21) with the 14 m FCRAO telescope, and complemented the data with dust continuum observations using APEX (870 μm) and IRAM 30 m (1200 μm). Results: From the N2H+ emission, we identify 19 dense cores, some starless and some protostellar. They are not distributed uniformly, but tend to cluster with relative separations on the order of 0.25 pc. From the C18O emission, we identify multiple velocity components in the gas. We have characterized them by fitting Gaussians to the spectra and by studying the distribution of the fits in position-position-velocity space. In this space, the C18O components appear as velocity-coherent structures, and we identify them automatically using a dedicated algorithm (FIVE: Friends In VElocity). Using this algorithm, we identify 35 filamentary components with typical lengths of 0.5 pc, sonic internal velocity dispersions, and mass-per-unit length close to the stability threshold of isothermal cylinders at 10 K. Core formation seems to have occurred inside the filamentary components via fragmentation, with few fertile components with higher mass-per-unit length being responsible for most cores in the cloud. On large scales, the filamentary components appear grouped into families, which we refer to as bundles. Conclusions: Core formation in L1495/B213 has proceeded by hierarchical fragmentation. The cloud fragmented first into several pc-scale regions. Each of these regions later fragmented into velocity-coherent filaments of about 0.5 pc in length. Finally, a small number of these filaments fragmented quasi-statically and produced the individual dense cores we see today. Based on
High resolution infrared spectroscopy of carbon dioxide clusters up to (CO2)13.
Norooz Oliaee, J; Dehghany, M; McKellar, A R W; Moazzen-Ahmadi, N
2011-07-28
Thirteen specific infrared bands in the 2350 cm(-1) region are assigned to carbon dioxide clusters, (CO(2))(N), with N = 6, 7, 9, 10, 11, 12 and 13. The spectra are observed in direct absorption using a tuneable infrared laser to probe a pulsed supersonic jet expansion of a dilute mixture of CO(2) in He carrier gas. Assignments are aided by cluster structure calculations made using two reliable CO(2) intermolecular potential functions. For (CO(2))(6), two highly symmetric isomers are observed, one with S(6) symmetry (probably the more stable form), and the other with S(4) symmetry. (CO(2))(13) is also symmetric (S(6)), but the remaining clusters are asymmetric tops with no symmetry elements. The observed rotational constants tend to be slightly (≈2%) smaller than those from the predicted structures. The bands have increasing vibrational blueshifts with increasing cluster size, similar to those predicted by the resonant dipole-dipole interaction model but significantly larger in magnitude. © 2011 American Institute of Physics
Hyperpolarized [2-13C]-fructose: a hemiketal DNP substrate for in vivo metabolic imaging.
Keshari, Kayvan R; Wilson, David M; Chen, Albert P; Bok, Robert; Larson, Peder E Z; Hu, Simon; Van Criekinge, Mark; Macdonald, Jeffrey M; Vigneron, Daniel B; Kurhanewicz, John
2009-12-09
Hyperpolarized (13)C labeled molecular probes have been used to investigate metabolic pathways of interest as well as facilitate in vivo spectroscopic imaging by taking advantage of the dramatic signal enhancement provided by DNP. Due to the limited lifetime of the hyperpolarized nucleus, with signal decay dependent on T(1) relaxation, carboxylate carbons have been the primary targets for development of hyperpolarized metabolic probes. The use of these carbon nuclei makes it difficult to investigate upstream glycolytic processes, which have been related to both cancer metabolism as well as other metabolic abnormalities, such as fatty liver disease and diabetes. Glucose carbons have very short T(1)s (glycolysis. However, the pentose analogue fructose can also enter glycolysis through its phosphorylation by hexokinase and yield complementary information. The C(2) of fructose is a hemiketal that has a relatively longer relaxation time (approximately 16 s at 37 degrees C) and high solution state polarization (approximately 12%). Hyperpolarized [2-(13)C]-fructose was also injected into a transgenic model of prostate cancer (TRAMP) and demonstrated difference in uptake and metabolism in regions of tumor relative to surrounding tissue. Thus, this study demonstrates the first hyperpolarization of a carbohydrate carbon with a sufficient T(1) and solution state polarization for ex vivo spectroscopy and in vivo spectroscopic imaging studies.
7P1/2 hyperfine splitting in 206 , 207 , 209 , 213Fr and the hyperfine anomaly
Zhang, J.; Orozco, L. A.; Collister, R.; Gwinner, G.; Tandecki, M.; Behr, J. A.; Pearson, M. R.; Gomez, E.; Aubin, S.
2013-05-01
We perform precision measurements on francium, the heaviest alkali with no stable isotopes, at the recently commissioned Francium Trapping Facility at TRIUMF. A combination of RF and optical spectroscopy allows better than 10 ppm (statistical) measurements of the 7P1 / 2 state hyperfine splitting for the isotopes 206 , 207 , 209 , 213Fr, in preparation for weak interaction studies. Together with previous measurements of the ground state hyperfine structure, it is possible to extract the hyperfine anomaly. This is a correction to the point interaction of the nuclear magnetic moment and the electron wavefunction, known as the Bohr Weisskopf effect. Our measurements extend previous measurements to the neutron closed shell isotope (213) as well as further in the neutron deficient isotopes (206, 207). Work supported by NSERC and NRC from Canada, NSF and DOE from USA, CONYACT from Mexico.
DEFF Research Database (Denmark)
Goh, Jian Yuan; Feng, Min; Wang, Wenyu
2017-01-01
Tumor recurrence remains the main reason for breast cancer-associated mortality, and there are unmet clinical demands for the discovery of new biomarkers and development of treatment solutions to benefit patients with breast cancer at high risk of recurrence. Here we report the identification...... of chromosomal copy-number amplification at 1q21.3 that is enriched in subpopulations of breast cancer cells bearing characteristics of tumor-initiating cells (TICs) and that strongly associates with breast cancer recurrence. Amplification is present in ∼10-30% of primary tumors but in more than 70% of recurrent...... tumors, regardless of breast cancer subtype. Detection of amplification in cell-free DNA (cfDNA) from blood is strongly associated with early relapse in patients with breast cancer and could also be used to track the emergence of tumor resistance to chemotherapy. We further show that 1q21.3-encoded S100...
De novo inv(17)(p11.2q21.3) in an intellectually disabled girl ...
Indian Academy of Sciences (India)
2012-08-09
Aug 9, 2012 ... 3Present address: Departamento de Ciencias Médicas, CUCOSTA,. Universidad de Guadalajara, Puerto Vallarta, Mexico. [Partida-Pérez M., Domínguez M. G., Neira V. A., Figuera L. E. and Rivera H. 2012 De novo inv(17)(p11.2q21.3) in an intellectually disabled girl: appraisal of 21 inv(17) constitutional ...
Goh, Jian Yuan; Feng, Min; Wang, Wenyu; Oguz, Gokce; Yatim, Siti Maryam J M; Lee, Puay Leng; Bao, Yi; Lim, Tse Hui; Wang, Panpan; Tam, Wai Leong; Kodahl, Annette R; Lyng, Maria B; Sarma, Suman; Lin, Selena Y; Lezhava, Alexander; Yap, Yoon Sim; Lim, Alvin S T; Hoon, Dave S B; Ditzel, Henrik J; Lee, Soo Chin; Tan, Ern Yu; Yu, Qiang
2017-11-01
Tumor recurrence remains the main reason for breast cancer-associated mortality, and there are unmet clinical demands for the discovery of new biomarkers and development of treatment solutions to benefit patients with breast cancer at high risk of recurrence. Here we report the identification of chromosomal copy-number amplification at 1q21.3 that is enriched in subpopulations of breast cancer cells bearing characteristics of tumor-initiating cells (TICs) and that strongly associates with breast cancer recurrence. Amplification is present in ∼10-30% of primary tumors but in more than 70% of recurrent tumors, regardless of breast cancer subtype. Detection of amplification in cell-free DNA (cfDNA) from blood is strongly associated with early relapse in patients with breast cancer and could also be used to track the emergence of tumor resistance to chemotherapy. We further show that 1q21.3-encoded S100 calcium-binding protein (S100A) family members, mainly S100A7, S100A8, and S100A9 (S100A7/8/9), and IL-1 receptor-associated kinase 1 (IRAK1) establish a reciprocal feedback loop driving tumorsphere growth. Notably, this functional circuitry can be disrupted by the small-molecule kinase inhibitor pacritinib, leading to preferential impairment of the growth of 1q21.3-amplified breast tumors. Our study uncovers the 1q21.3-directed S100A7/8/9-IRAK1 feedback loop as a crucial component of breast cancer recurrence, serving as both a trackable biomarker and an actionable therapeutic target for breast cancer.
Kui Young Park; Ji Young Kim; Moo Yeol Hyun; Won Jong Oh; Se Yeong Jeong; Tae Young Han; Ji Young Ahn; Beom Joon Kim; Myeung Nam Kim
2015-01-01
Background. Photodynamic therapy (PDT) has been used for acne, with various combinations of photosensitizers and light sources. Objective. We evaluated the effectiveness and safety of indocyanine green (ICG) and intense pulsed light (IPL) in the treatment of acne. Materials and Methods. A total of 1,213 patients with facial acne were retrospectively reviewed. Patients received three or five treatments of ICG and IPL at two-week intervals. Clinical response to treatment was assessed by compar...
Slimene, Imen Ben; Tabbene, Olfa; Gharbi, Dorra; Mnasri, Bacem; Schmitter, Jean Marie; Urdaci, Maria-Camino; Limam, Ferid
2015-04-01
Among nine chitinase-producing strains isolated from Tunisian soil, one isolate called S213 exhibited a potent chitinolytic activity. S213 strain was identified as Bacillus licheniformis by API 50CH system and sequence analysis of its partial 16S ribosomal DNA. Chitinolytic activity was induced either by colloidal chitin or fungal cell walls, and the highest chitinase activity reached at the late stationary phase exhibiting optimal temperature and pH of 50-60 °C and pH 6.0, respectively. SDS-PAGE analysis of the secreted colloidal chitin-induced proteins showed a major protein of about 65 kDa. This protein was identified as chitinase on the basis of its peptide sequences which displayed high homology with chitinase sequence of B. licheniformis ATCC 14580. Moreover, chitinolytic activity containing supernatant inhibited the growth of several phytopathogenic fungi including Phoma medicaginis. Interestingly, S213 strain reduced efficiently the damping-off disease caused by P. medicaginis in Medicago truncatula and should be envisaged in enzyme-based biopesticides against phytopathogen application.
Park, Kui Young; Kim, Ji Young; Hyun, Moo Yeol; Oh, Won Jong; Jeong, Se Yeong; Han, Tae Young; Ahn, Ji Young; Kim, Beom Joon; Kim, Myeung Nam
2015-01-01
Photodynamic therapy (PDT) has been used for acne, with various combinations of photosensitizers and light sources. We evaluated the effectiveness and safety of indocyanine green (ICG) and intense pulsed light (IPL) in the treatment of acne. A total of 1,213 patients with facial acne were retrospectively reviewed. Patients received three or five treatments of ICG and IPL at two-week intervals. Clinical response to treatment was assessed by comparing pre- and posttreatment clinical photographs and patient satisfaction scores. Marked to excellent improvement was noted in 483 of 1,213 (39.8%) patients, while minimal to moderate improvement was achieved in the remaining 730 (60.2%) patients. Patient satisfaction scores revealed that 197 (16.3%) of 1,213 patients were highly satisfied, 887 (73.1%) were somewhat satisfied, and 129 (10.6%) were unsatisfied. There were no significant side effects. These results suggest that PDT with ICG and IPL can be effectively and safely used in the treatment of acne.
Bayram, Ayşe Kaçar; Yilmaz, Ebru; Per, Huseyin; Ito, Masaki; Uchino, Haruto; Doganay, Selim; Houkin, Kiyohiro; Unal, Ekrem
2016-03-01
Moyamoya disease is an uncommon, progressive, and occlusive cerebrovascular disorder, predominantly affecting the terminal segment of the internal carotid arteries and its main branches. This occlusion results at the formation of a compensatory collateral arterial network (moyamoya vessels) developing at the base of the brain. The c.14576G>A variant in ring finger protein 213 (RNF213) was recently reported as a susceptibility gene for moyamoya disease. We describe two Turkish pediatric siblings with moyamoya disease born to consanguineous, unaffected Turkish parents. The first patient (proband) is a 2-year-old boy who presented with afebrile focal seizures, moderate psychomotor retardation, paresis in the left upper and lower extremity, multiple infarctions of the brain, stenosis of the bilateral internal carotid artery and the middle cerebral artery, and stenosis of the right posterior cerebral artery. The second patient is a 10-year-old girl who is an elder sister of proband. She showed normal psychomotor development, millimetric signal enhancement without diffusion limitation of the brain, and stenosis of the bilateral internal carotid artery. We herein report pediatric sibling patients of moyamoya disease who have homozygous wild-type c.14576G>A variant in RNF213, showing different clinical course and disease severity. This is the first report of pediatric siblings with moyamoya disease from Turkey validating the genetic background of most frequent variant in East Asian patients with moyamoya disease.
Directory of Open Access Journals (Sweden)
Kui Young Park
2015-01-01
Full Text Available Background. Photodynamic therapy (PDT has been used for acne, with various combinations of photosensitizers and light sources. Objective. We evaluated the effectiveness and safety of indocyanine green (ICG and intense pulsed light (IPL in the treatment of acne. Materials and Methods. A total of 1,213 patients with facial acne were retrospectively reviewed. Patients received three or five treatments of ICG and IPL at two-week intervals. Clinical response to treatment was assessed by comparing pre- and posttreatment clinical photographs and patient satisfaction scores. Results. Marked to excellent improvement was noted in 483 of 1,213 (39.8% patients, while minimal to moderate improvement was achieved in the remaining 730 (60.2% patients. Patient satisfaction scores revealed that 197 (16.3% of 1,213 patients were highly satisfied, 887 (73.1% were somewhat satisfied, and 129 (10.6% were unsatisfied. There were no significant side effects. Conclusion. These results suggest that PDT with ICG and IPL can be effectively and safely used in the treatment of acne.
On the Wegener granulomatosis associated region on chromosome 6p21.3
Directory of Open Access Journals (Sweden)
Csernok Elena
2006-03-01
Full Text Available Abstract Background Wegener granulomatosis (WG belongs to the heterogeneous group of systemic vasculitides. The multifactorial pathophysiology of WG is supposedly caused by yet unknown environmental influence(s on the basis of genetic predisposition. The presence of anti-neutrophil cytoplasmic antibodies (ANCA in the plasma of patients and genetic involvement of the human leukocyte antigen system reflect an autoimmune background of the disease. Strong associations were revealed with WG by markers located in the major histocompatibility complex class II (MHC II region in the vicinity of human leukocyte antigen (HLA-DPB1 and the retinoid X receptor B (RXRB loci. In order to define the involvement of the 6p21.3 region in WG in more detail this previous population-based association study was expanded here to the respective 3.6 megabase encompassing this region on chromosome 6. The RXRB gene was analysed as well as a splice-site variation of the butyrophilin-like (BTNL2 gene which is also located within the respective region. The latter polymorphism has been evaluated here as it appears as a HLA independent susceptibility factor in another granulomatous disorder, sarcoidosis. Methods 150–180 German WG patients and a corresponding cohort of healthy controls (n = 100–261 were used in a two-step study. A panel of 94 microsatellites was designed for the initial step using a DNA pooling approach. Markers with significantly differing allele frequencies between patient and control pools were individually genotyped. The RXRB gene was analysed for single strand conformation polymorphisms (SSCP and restriction fragment length polymorphisms (RFLP. The splice-site polymorphism in the BTNL2 gene was also investigated by RFLP analysis. Results A previously investigated microsatellite (#1.0.3.7, Santa Cruz genome browser (UCSC May 2004 Freeze localisation: chr6:31257596-34999883, which was used as a positive control, remained associated throughout the whole two
On the Wegener granulomatosis associated region on chromosome 6p21.3
Szyld, Paweł; Jagiello, Peter; Csernok, Elena; Gross, Wolfgang L; Epplen, Joerg T
2006-01-01
Background Wegener granulomatosis (WG) belongs to the heterogeneous group of systemic vasculitides. The multifactorial pathophysiology of WG is supposedly caused by yet unknown environmental influence(s) on the basis of genetic predisposition. The presence of anti-neutrophil cytoplasmic antibodies (ANCA) in the plasma of patients and genetic involvement of the human leukocyte antigen system reflect an autoimmune background of the disease. Strong associations were revealed with WG by markers located in the major histocompatibility complex class II (MHC II) region in the vicinity of human leukocyte antigen (HLA)-DPB1 and the retinoid X receptor B (RXRB) loci. In order to define the involvement of the 6p21.3 region in WG in more detail this previous population-based association study was expanded here to the respective 3.6 megabase encompassing this region on chromosome 6. The RXRB gene was analysed as well as a splice-site variation of the butyrophilin-like (BTNL2) gene which is also located within the respective region. The latter polymorphism has been evaluated here as it appears as a HLA independent susceptibility factor in another granulomatous disorder, sarcoidosis. Methods 150–180 German WG patients and a corresponding cohort of healthy controls (n = 100–261) were used in a two-step study. A panel of 94 microsatellites was designed for the initial step using a DNA pooling approach. Markers with significantly differing allele frequencies between patient and control pools were individually genotyped. The RXRB gene was analysed for single strand conformation polymorphisms (SSCP) and restriction fragment length polymorphisms (RFLP). The splice-site polymorphism in the BTNL2 gene was also investigated by RFLP analysis. Results A previously investigated microsatellite (#1.0.3.7, Santa Cruz genome browser (UCSC) May 2004 Freeze localisation: chr6:31257596-34999883), which was used as a positive control, remained associated throughout the whole two-step approach
Cores, Filaments, and Bundles: Hierarchical core formation in the B213 filament in Taurus
Hacar, Alvaro; Tafalla, Mario; Kauffmann, Jens; Kovacs, Attila
2013-07-01
Characterizing the dense core formation in filaments is a critical step for our understanding of the star formation process within molecular clouds. Using different molecular tracers to study the gas kinematics at different scales and density regimes, we have investigated the dense core formation in the B213/L1495 filament in Taurus, one of the most prominent structures identified in nearby clouds (see Hacar et al 2013, A&A, 554, A55). Our analysis of its internal kinematics demonstrates that this filament is actually a bundle of 35 velocity-coherent filaments, typically with lengths of ˜ 0.5 pc and oscillatory-like and sonic velocity field, each of them exhibiting linear masses close to the expected mass for a filament in hydrostatic equilibrium. Among them, only a small fraction of these filaments (˜1/4) are "fertile" and efficiently fragment forming all the cores identified within this region, while most of them (˜3/4) do not form cores and remain "sterile". Our observations then suggest that core formation in Taurus occurs in two steps. First, 0.5 pc-long velocity-coherent filaments condense out of the cloud gas, probably as a result of the turbulent cascade. After that, the dense cores condense quasi-statically in only those "fertile" filaments that have accumulated enough mass to became gravitational unstable, inheriting their kinematic properties. The formation of these velocity-coherent filaments appears therefore as a critical step on the star formation process being the first subsonic structures formed out of the turbulent regime that dominates the cloud dynamics at large scales.
Olesen, Inge Ahlmann; Andersson, Anna-Maria; Aksglaede, Lise; Skakkebaek, Niels Erik; Rajpert-de Meyts, Ewa; Joergensen, Niels; Juul, Anders
2017-01-01
To study the pathologic findings among men evaluated for infertility. A retrospective, single-center, cross-sectional study. University hospital-based research center. We included data from 1,213 medical records from infertile men referred for diagnostic work-up from 2005 to 2009. None. Health history, clinical findings, chromosome/genetic aberrations, semen quality, reproductive hormones. In total, 64.4% of the infertile men had one or more reproductive disorders or factors influencing fertility, leaving 35.6% diagnosed as idiopathic infertile. In 244 patients (20%), including seven cases of testicular cancer and/or germ cell neoplasia in situ, a pathologic finding was first detected during diagnostic work-up. Two hundred four patients (16.8%) had a history of cryptorchidism and 154 (12.7%) of varicocele (grade 2 and 3). Thirty-three patients had chromosomal abnormalities, including 16 with sex chromosome abnormalities (11 with 47,XXY). Y-chromosome microdeletions were detected in 65 patients (5.4%). One hundred thirty-three had azoospermia, of which 58 had testicular biopsy findings (Sertoli cell-only syndrome: n = 23; spermatogenic arrest: n = 7; impaired spermatogenesis and atrophy: n = 28). Additionally, in idiopathic infertile men and infertile men with additional symptoms of testicular dysgenesis syndrome, 22.5% presented with a degree of Leydig cell insufficiency, with the highest frequency (33.1%) among patients with sperm concentration men referred to our center. Thus, male infertility may be a sign of an underlying disease that warrants attention. Copyright © 2016. Published by Elsevier Inc.
Energy Technology Data Exchange (ETDEWEB)
Keijzer, W.
1993-08-01
The Service Unit Engineering of the Netherlands Energy Research Foundation (ECN) designed a permanent accommodation for the Business Unit Renewable Energy, also of ECN. Energy efficient materials must be used in the design. The project consists of two phases. In phase 1 an energy efficient office building has to be designed, and in phase 2 experiments, aimed at energy conservation, have to be carried out. In this report attention is paid to the activities for phase 1. The study on energetic aspects is based on the guidelines in the ISSO/SBR-publication 213: 'Design of energy efficient office buildings'. 2 figs., 1 tab., 1 annex
Directory of Open Access Journals (Sweden)
Jinlong Guo
2013-01-01
Full Text Available Plant metallothioneins (MTs, which are cysteine-rich, low-molecular-weight, and metal-binding proteins, play important roles in detoxification, metal ion homeostasis, and metal transport adjustment. In this study, a novel metallothionein gene, designated as ScMT2-1-3 (GenBank Accession number JQ627644, was identified from sugarcane. ScMT2-1-3 was 700 bp long, including a 240 bp open reading frame (ORF encoding 79 amino acid residues. A His-tagged ScMT2-1-3 protein was successfully expressed in Escherichia coli system which had increased the host cell’s tolerance to Cd2+, Cu2+, PEG, and NaCl. The expression of ScMT2-1-3 was upregulated under Cu2+ stress but downregulated under Cd2+ stress. Real-time qPCR demonstrated that the expression levels of ScMT2-1-3 in bud and root were over 14 times higher than those in stem and leaf, respectively. Thus, both the E. coli assay and sugarcane plantlets assay suggested that ScMT2-1-3 is significantly involved in the copper detoxification and storage in the cell, but its functional mechanism in cadmium detoxification and storage in sugarcane cells needs more testification though its expressed protein could obviously increase the host E. coli cell’s tolerance to Cd2+. ScMT2-1-3 constitutes thus a new interesting candidate for elucidating the molecular mechanisms of MTs-implied plant heavy metal tolerance/accumulation and for developing sugarcane phytoremediator varieties.
Guo, Jinlong; Xu, Liping; Su, Yachun; Wang, Hengbo; Gao, Shiwu; Xu, Jingsheng; Que, Youxiong
2013-01-01
Plant metallothioneins (MTs), which are cysteine-rich, low-molecular-weight, and metal-binding proteins, play important roles in detoxification, metal ion homeostasis, and metal transport adjustment. In this study, a novel metallothionein gene, designated as ScMT2-1-3 (GenBank Accession number JQ627644), was identified from sugarcane. ScMT2-1-3 was 700 bp long, including a 240 bp open reading frame (ORF) encoding 79 amino acid residues. A His-tagged ScMT2-1-3 protein was successfully expressed in Escherichia coli system which had increased the host cell's tolerance to Cd(2+), Cu(2+), PEG, and NaCl. The expression of ScMT2-1-3 was upregulated under Cu(2+) stress but downregulated under Cd(2+) stress. Real-time qPCR demonstrated that the expression levels of ScMT2-1-3 in bud and root were over 14 times higher than those in stem and leaf, respectively. Thus, both the E. coli assay and sugarcane plantlets assay suggested that ScMT2-1-3 is significantly involved in the copper detoxification and storage in the cell, but its functional mechanism in cadmium detoxification and storage in sugarcane cells needs more testification though its expressed protein could obviously increase the host E. coli cell's tolerance to Cd(2+). ScMT2-1-3 constitutes thus a new interesting candidate for elucidating the molecular mechanisms of MTs-implied plant heavy metal tolerance/accumulation and for developing sugarcane phytoremediator varieties.
Search for the decay K→πγγ in the π momentum region P>213 MeV/c
E949 Collaboration; Artamonov, A. V.; Bassalleck, B.; Bhuyan, B.; Blackmore, E. W.; Bryman, D. A.; Chen, S.; Chiang, I.-H.; Christidi, I.-A.; Cooper, P. S.; Diwan, M. V.; Frank, J. S.; Fujiwara, T.; Hu, J.; Jaffe, D. E.; Kabe, S.; Kettell, S. H.; Khabibullin, M. M.; Khotjantsev, A. N.; Kitching, P.; Kobayashi, M.; Komatsubara, T. K.; Konaka, A.; Kozhevnikov, A. P.; Kudenko, Yu. G.; Kushnirenko, A.; Landsberg, L. G.; Lewis, B.; Li, K. K.; Littenberg, L. S.; MacDonald, J. A.; Mildenberger, J.; Mineev, O. V.; Miyajima, M.; Mizouchi, K.; Mukhin, V. A.; Muramatsu, N.; Nakano, T.; Nomachi, M.; Nomura, T.; Numao, T.; Obraztsov, V. F.; Omata, K.; Patalakha, D. I.; Petrenko, S. V.; Poutissou, R.; Ramberg, E. J.; Redlinger, G.; Sato, T.; Sekiguchi, T.; Shinkawa, T.; Strand, R. C.; Sugimoto, S.; Tamagawa, Y.; Tschirhart, R.; Tsunemi, T.; Vavilov, D. V.; Viren, B.; Yershov, N. V.; Yoshimura, Y.; Yoshioka, T.
2005-09-01
We have searched for the K→πγγ decay in the kinematic region with π momentum close to the end point. No events were observed, and the 90% confidence-level upper limit on the partial branching ratio was obtained, B(K→πγγ,P>213 MeV/c)<8.3×10 under the assumption of chiral perturbation theory including next-to-leading order “unitarity” corrections. The same data were used to determine an upper limit on the K→πγ branching ratio of 2.3×10 at the 90% confidence level.
Energy Technology Data Exchange (ETDEWEB)
Essler, Markus; Gaertner, Florian C.; Blechert, Birgit; Senekowitsch-Schmidtke, Reingard; Seidl, Christof [Technische Universitaet Muenchen, Department of Nuclear Medicine, Munich (Germany); Neff, Frauke [Helmholtz Zentrum Muenchen, Institute of Pathology, Neuherberg (Germany); Bruchertseifer, Frank; Morgenstern, Alfred [Institute for Transuranium Elements, European Commission, Joint Research Centre, Karlsruhe (Germany)
2012-04-15
Targeted delivery of alpha-particle-emitting radionuclides is a promising novel option in cancer therapy. We generated stable conjugates of the vascular tumour-homing peptide F3 both with {sup 225}Ac and {sup 213}Bi that specifically bind to nucleolin on the surface of proliferating tumour cells. The aim of our study was to determine the therapeutic efficacy of {sup 225}Ac-DOTA-F3 in comparison with that of {sup 213}Bi-DTPA-F3. ID{sub 50} values of {sup 213}Bi-DTPA-F3 and {sup 225}Ac-DOTA-F3 were determined via clonogenic assays. The therapeutic efficacy of both constructs was assayed by repeated treatment of mice bearing intraperitoneal MDA-MB-435 xenograft tumours. Therapy was monitored by bioluminescence imaging. Nephrotoxic effects were analysed by histology. ID{sub 50} values of {sup 213}Bi-DTPA-F3 and {sup 225}Ac-DOTA-F3 were 53 kBq/ml and 67 Bq/ml, respectively. The median survival of control mice treated with phosphate-buffered saline was 60 days after intraperitoneal inoculation of 1 x 10{sup 7} MDA-MB-435 cells. Therapy with 6 x 1.85 kBq of {sup 225}Ac-DOTA-F3 or 6 x 1.85 MBq of {sup 213}Bi-DTPA-F3 prolonged median survival to 95 days and 97 days, respectively. While F3 labelled with short-lived {sup 213}Bi (t{sub 1/2} 46 min) reduced the tumour mass at early time-points up to 30 days after treatment, the antitumour effect of {sup 225}Ac-DOTA-F3 (t{sub 1/2} 10 days) increased at later time-points. The difference in the fraction of necrotic cells after treatment with {sup 225}Ac-DOTA-F3 (43%) and with {sup 213}Bi-DTPA-F3 (36%) was not significant. Though histological analysis of kidney samples revealed acute tubular necrosis and tubular oedema in 10-30% of animals after treatment with {sup 225}Ac-DOTA-F3 or {sup 213}Bi-DTPA-F3, protein casts were negligible (2%), indicating only minor damage to the kidney. Therapy with both {sup 225}Ac-DOTA-F3 and {sup 213}Bi-DTPA-F3 increased survival of mice with peritoneal carcinomatosis. Mild renal toxicity of both
Directory of Open Access Journals (Sweden)
S. Pandia Rajan
2016-03-01
Full Text Available The present study investigates the effect of thermal and friction produced in the tube to tube plate during the friction welding process by using a Tungsten carbide external tool. In this process, the fictional welding of SA 213 tube and SA 387 tube plate was done by using an external tool. Modeling of tool and wok piece is done by using Solid works and to study the thermal and frictional effect by using Ansys. In this research work, joining of SA 213 tube to SA 387 tube plate was done by using two different techniques such as with hole [WH] and without hole [WOH]. The stress value of with hole and without hole such as 18,782 MPa and 10,486 MPa respectively and the ultimate heat flux generated with hole and without hole such as 0.80475 W/mm2 and 1.1344 W/mm2 respectively were observed.
Allan, Bruce D; Hassan, Hala
2013-01-01
To explore the use of the Pulsar Z1 solid-state 213 nm photorefractive laser platform in topography-guided transepithelial photorefractive keratectomy (PRK) for irregular astigmatism. Moorfields Eye Hospital, London, United Kingdom. Prospective clinical case series. Patients with irregular astigmatism after previous refractive surgery or corneal transplantation were treated with topography-guided transepithelial PRK. Preoperatively and 1-year postoperatively, corrected distance visual acuity (CDVA) and secondary outcome measures (including manifest refraction, contrast sensitivity, haze score, index of surface variation, root-mean-square higher-order aberrations, and subjective visual change) were compared between groups. Adjunctive mitomycin-C was not used. Seven patients had previous refractive surgery, and 7 had previous corneal transplantation. All but 2 patients with a marked haze response had subjective gains in vision and improved CDVA. Gains in CDVA for patients with irregular astigmatism after previous refractive surgery (median 2 lines gain; range 0 to 2 lines gained) were higher than for patients with irregular astigmatism after keratoplasty (median 0 lines; range 5 lines lost to 4 lines gained). Trends in secondary outcome measures were similar, with greater variation in post-keratoplasty patients. Haze scores were higher in post-keratoplasty patients. 213 nm topography-guided transepithelial PRK was easy to perform and well tolerated by patients with irregular astigmatism. Most patients gained CDVA; however, increased haze responses were observed in post-keratoplasty cases. Copyright © 2012 ASCRS and ESCRS. Published by Elsevier Inc. All rights reserved.
Significant Association of the RNF213 p.R4810K Polymorphism with Quasi-Moyamoya Disease.
Morimoto, Takaaki; Mineharu, Yohei; Kobayashi, Hatasu; Harada, Kouji H; Funaki, Takeshi; Takagi, Yasushi; Sakai, Nobuyuki; Miyamoto, Susumu; Koizumi, Akio
2016-11-01
Quasi-moyamoya disease is an angiographical moyamoya disease equivalent accompanied by known underlying diseases. Mysterin/RNF213 is a major susceptibility gene for moyamoya disease, of which the p.R4810K variant is a founder polymorphism. The genetics of quasi-moyamoya disease is poorly understood, therefore, this study investigated a potential association between the p.R4810K polymorphism and quasi-moyamoya disease. Genotyping of the p.R4810K variant was performed on 18 quasi-moyamoya disease cases and 91 controls, who visited Kyoto University Hospital or Kobe City Medical Center, Japan, between 2006 and 2015. The p.R4810K variant was found in 12 of 18 quasi-moyamoya disease patients. The frequency of p.R4810K carriers was significantly higher in quasi-moyamoya disease cases than in controls (66.7% versus 2.2%, odds ratio 89.0, 95% confidence interval: 19.2-669.4). Our data showed that the RNF213 p.R4810K polymorphism was significantly associated with quasi-moyamoya disease. Copyright © 2016 National Stroke Association. Published by Elsevier Inc. All rights reserved.
Arakawa, Kensuke; Yoshida, Saki; Aikawa, Hiroki; Hano, Chihiro; Bolormaa, Tsognemekh; Burenjargal, Sedkhuu; Miyamoto, Taku
2016-03-01
Strain 213M0 was selected with productivity of a bacteriocin-like inhibitory substance (BLIS) among 235 strains of lactic acid bacteria (LAB) isolated from Mongolian fermented milk 'airag'. Strain 213M0 was species-identified as Leuconostoc mesenteroides subsp. dextranicum by morphological observation, carbohydrate fermentation profiling and sequencing the 16S rRNA gene. Incubation temperature proper to produce the BLIS was 25°C rather than 30 and 37°C, and the production actively proceeded during the exponential growth phase of the producer cells. Antibacterial effect of BLIS 213M0 was limited to all nine strains of Listeria sp. bacteria and seven strains of LAB cocci among 53 tested strains, which corresponds to a typical feature of the class IIa pediocin-like bacteriocins. BLIS 213M0 was not inactivated in every broad pH range solution (pH 2.0-11.0), and was stable against storage at 25°C for 1 week and heating at 121°C for 15 min under pH 4.5. Peptide frame of BLIS 213M0 was confirmed by inactivation with some peptidases, and then its molecular weight was estimated to be 2.6-3.0 kDa using an in situ activity assay following sodium dodecyl sulfate polyacrylamide gel electrophoresis. The estimated size was different from the other Leuconostoc bacteriocins already reported. These results suggest that BLIS 213M0 would be a novel listericidal bacteriocin. © 2015 Japanese Society of Animal Science.
Liao, Can; Fu, Fang; Li, Ru; Yang, Xin; Xu, Qing; Li, Dong-Zhi
2012-01-01
We present three foetuses with Dandy-Walker malformation, intra-uterine growth restriction and multiple congenital abnormalities, who were studied by array-based comparative genomic hybridization and revealed a novel locus on chromosome 7p21.3. The association of pure chromosome 7p aberrations with Dandy-Walker malformation has rarely been reported. The present study suggests that the critical region associated with Dandy-Walker malformation is restricted to 7p21.3, including the cerebellar disease associated genes NDUFA4 and PHF14. Copyright © 2012 Elsevier Masson SAS. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Keijzer, W.
1994-03-01
A new office building has been designed by the Service Unit Engineering for the Business Unit Renewable Energy, both of the Netherlands Energy Research Foundation ECN, Petten, Netherlands. The aim has been to apply materials that will contribute to the energy efficiency of the building. In phase 1 attention is paid to the design of an energy efficient building according to regulations for such a design process, which can be found in publication 213 of two Dutch building research institutes ISSO and SBR. The construction of the office started in January 1993 and is already accomplished. In 1994-1995 the energy consumption target values will be evaluated. In this report (phase 2) the results of experiments regarding means to reduce the energy consumption are presented. 21 appendices, 10 refs.
Energy Technology Data Exchange (ETDEWEB)
Keijzer, W.
1994-03-01
A new office building has been designed by the Service Unit Engineering for the Business Unit Renewable Energy, both of the Netherlands Energy Research Foundation ECN, Petten, Netherlands. The aim has been to apply materials that will contribute to the energy efficiency of the building. In this report attention is paid to the design of an energy efficient building according to regulations for such a design process, which can be found in publication 213 of two Dutch building research institutes ISSO and SBR. The construction of the office started in January 1993 and is already accomplished. In 1994-1995 the energy consumption target values will be evaluated. In phase 2 of the title study, for which a separate abstract is prepared, the results of experiments regarding means to reduce the energy cosnumption are presented. 2 figs., 1 tab., 5 appendices
Adoption of in-vessel retention concept for VVER-440/V213 reactors in Central European Countries
Energy Technology Data Exchange (ETDEWEB)
Matejovic, Peter, E-mail: peter.matejovic@ivstt.sk [Inzinierska Vypoctova Spolocnost (IVS), Jana Holleho 5, 91701 Trnava (Slovakia); Barnak, Miroslav; Bachraty, Milan; Vranka, Lubomir [Inzinierska Vypoctova Spolocnost (IVS), Jana Holleho 5, 91701 Trnava (Slovakia); Berky, Robert [Integrita a Bezpecnost Ocelovych Konstrukcii, Rybnicna 40, 831 07 Bratislava (Slovakia)
2017-04-01
Highlights: • Design of in-vessel retention concept for VVER-440/V213 reactors. • Thermal loads acting on the inner reactor surface. • Structural response of reactor pressure vessel. • External reactor vessel cooling. - Abstract: An in-vessel retention (IVR) concept was proposed for standard VVER-440/V213 reactors equipped with confinement made of reinforced concrete and bubbler condenser pressure suppression system. This IVR concept is based on simple modifications of existing plant technology and thus it was attractive for plant operators in Central European Countries. Contrary to the solution that was adopted before at Loviisa NPP in Finland (two units of VVER-440/V213 reactor with steel confinement equipped with ice condenser), the coolant access to the reactor pressure vessel from flooded cavity is enabled via closable hole installed in the centre of thermal shield of the reactor lower head instead of lowering this massive structure in the case of severe accident. As a consequence, the crucial point of this IVR concept is narrow gap between torispherical lower head and thermal and biological shield. Here the highest thermal flux is expected in the case of severe accident. Thus, realistic estimation of thermal load and corresponding deformations of reactor wall and their impact on gap width for coolant flow are of primarily importance. In this contribution the attention is paid especially to the analytical support with emphasis to the following points: 1) {sup ∗}Estimation of thermal loads acting on the inner reactor surface; 2) {sup ∗}Estimation of structural response of reactor pressure vessel (RPV) with emphasis on the deformation of outer reactor surface and its impact on the annular gap between RPV wall and thermal/biological shield; 3) {sup ∗}Analysis of external reactor vessel cooling. For this purpose the ASTEC code was used for performing analysis of core degradation scenarios, the ANSYS code for structural analysis of reactor vessel
Halogen Bonding and Chalcogen Bonding in 4,7-Dibromo-5,6-dinitro-2,1,3-benzothiadiazole.
Pavan, Mysore S; Jana, Ajay Kumar; Natarajan, S; Guru Row, Tayur N
2015-08-27
An organic solid, 4,7-dibromo-5,6-dinitro-2,1,3-benzothiadiazole, has been designed to serve as an illustrative example to quantitatively evaluate the relative merits of halogen and chalcogen bonding in terms of charge density features. The compound displays two polymorphic modifications, one crystallizing in a non-centrosymmetric space group (Z' = 1) and the other in a centrosymmetric space group with two molecules in the asymmetric unit (Z' = 2). Topological analysis based on QTAIM clearly brings out the dominance of the chalcogen bond over the halogen bond along with an indication that halogen bonds are more directional compared to chalcogen bonds. The cohesive energies calculated with the absence of both strong and weak hydrogen bonds as well as stacking interaction are indicative of the stabilities associated with the polymorphic forms.
Relap5/Mod3.1 analysis of main steam header rupture in VVER- 440/213 NPP
Energy Technology Data Exchange (ETDEWEB)
Kral, P. [Nuclear Research Inst. Rez (Switzerland)
1995-12-31
The presentation is focused on two main topics. First the applied modelling of PGV-4 steam generator for RELAP5 code are described. The results of steady-state calculation under reference conditions are compared against measured data. The problem of longitudinal subdivision of SG tubes is analysed and evaluated. Secondly, a best-estimate analysis of main steam header (MSH) rupture accident in WWER-440/213 NPP is presented. The low reliability of initiation of ESFAS signal `MSH Rupture` leads in this accident to big loss of secondary coolant, full depressurization of main steam system, extremely fast cool-down of both secondary and primary system, opening of PRZ SV-bypass valve with later liquid outflow, potential reaching of secondary criticality by failure of HPIS. 7 refs.
Repensando la libertad de expresión desde el abordaje al art. 213 del Código Penal argentino
Directory of Open Access Journals (Sweden)
Matalone, Noelia
2013-12-01
Full Text Available Este ensayo intenta presentar abordajes críticos sobre el delito tipificado en el art. 213 del Código Penal. En tal temperamento, se contrapone el tipo penal de apología del delito con los derechos individuales de las personas, en particular, la libertad de expresión. En este sentido, la autora formula una propuesta de derogación de la norma, como consecuencia de los fundamentos y efectos de esta norma, todo ello en orden a preservar, por sobre los intereses que puedan sostener este tipo de prohibición, la pluralidad de voces en la sociedad. Para ello, apela al sentido de la tolerancia social y a los principios de razonalibidad y de necesidad del sistema penal al momento de investigar y perseguir este tipo de casos.
Search for the decay K+ to pi+ gamma gamma in the pi+ momentum region P > 213 MeV/c
Energy Technology Data Exchange (ETDEWEB)
Artamonov, A.V.; Bassalleck, B.; Bhuyan, B.; Blackmore, E.W.; Bryman, D.A.; Chen, S.; Chiang, I.-H.; Christidi, I.-A.; Cooper, P.S.; Diwan, M.V.; Frank, J.S.; Fujiwara,; Hu, J.; Jaffe, D.E.; Kabe, S.; Kettell, S.H.; Khabibullin, M.M.; Khotjantsev, A.N.; Kitching, P.; Kobayashi, M.; Komatsubara, T.K.; /Serpukhov, IHEP /New Mexico U. /Brookhaven
2005-05-01
We have searched for the K{sup +} {yields} {pi}{sup +}{gamma}{gamma} decay in the kinematic region with {pi}{sup +} momentum close to the end point. No events were observed, and the 90% confidence-level upper limit on the partial branching ratio was obtained, B(K{sup +} {yields} {pi}{sup +}{gamma}{gamma}, P > 213 MeV/c) < 8.3 x 10{sup -9} under the assumption of chiral perturbation theory including next-to-leading order ''unitarity'' corrections. The same data were used to determine an upper limit on the K{sup +} {yields} {pi}{sup +}{gamma} branching ratio of 2.3 x 10{sup -9} at the 90% confidence level.
Morito, Daisuke; Nishikawa, Kouki; Hoseki, Jun; Kitamura, Akira; Kotani, Yuri; Kiso, Kazumi; Kinjo, Masataka; Fujiyoshi, Yoshinori; Nagata, Kazuhiro
2014-03-01
Moyamoya disease is an idiopathic human cerebrovascular disorder that is characterized by progressive stenosis and abnormal collateral vessels. We recently identified mysterin/RNF213 as its first susceptibility gene, which encodes a 591-kDa protein containing enzymatically active P-loop ATPase and ubiquitin ligase domains and is involved in proper vascular development in zebrafish. Here we demonstrate that mysterin further contains two tandem AAA+ ATPase modules and forms huge ring-shaped oligomeric complex. AAA+ ATPases are known to generally mediate various biophysical and mechanical processes with the characteristic ring-shaped structure. Fluorescence correlation spectroscopy and biochemical evaluation suggested that mysterin dynamically changes its oligomeric forms through ATP/ADP binding and hydrolysis cycles. Thus, the moyamoya disease-associated gene product is a unique protein that functions as ubiquitin ligase and AAA+ ATPase, which possibly contributes to vascular development through mechanical processes in the cell.
Murphy, K; Oaklander, A L; Elias, G; Kathuria, S; Long, D M
2016-02-01
There has been a steady progression of case reports and a small surgical series that report successful surgical treatment of Tarlov cysts with concomitant relief of patients' symptoms and improvement in their neurological dysfunction, yet patients are still told that these lesions are asymptomatic by physicians. The purpose of this study was to analyze the efficacy and safety of intervention in 213 consecutive patients with symptomatic Tarlov cysts treated by CT-guided 2-needle cyst aspiration and fibrin sealing. This study was designed to assess outcomes in patients who underwent CT-guided aspiration and injection of ≥1 sacral Tarlov cyst at Johns Hopkins Hospital between 2003 and 2013. In all, 289 cysts were treated in 213 consecutive patients. All these patients were followed for at least 6 months, 90% were followed for 1 year, and 83% were followed for 3-6 years. The aspiration-injection procedure used 2 needles and was performed with the patients under local anesthesia and intravenous anesthesia. In the fibrin-injection stage of the procedure, a commercially available fibrin sealant was injected into the cyst through the deep needle (Tisseel VH). One year postprocedure, excellent results were obtained in 104 patients (54.2% of patients followed), and good or satisfactory results were obtained in 53 patients (27.6%). Thus, 157 patients (81.8%) in all were initially satisfied with the outcome of treatment. At 3-6 years postprocedure, 74.0% of patients followed were satisfied with treatment. There were no clinically significant complications. The aspiration-injection technique described herein constitutes a safe and efficacious treatment option that holds promise for relieving cyst-related symptoms in many patients with very little risk. © 2016 by American Journal of Neuroradiology.
DEFF Research Database (Denmark)
Balic-Zunic, Tonci; Topa, Dan; Makovicky, Emil
2002-01-01
geology, emilite, Cu10.7Pb10.7Bi21.3S48, aikinite-bismuthinite derivative, crystal structure, Felbertal, scheelite deposit, Austria......geology, emilite, Cu10.7Pb10.7Bi21.3S48, aikinite-bismuthinite derivative, crystal structure, Felbertal, scheelite deposit, Austria...
DEFF Research Database (Denmark)
Durkin, M E; Naylor, S L; Albrechtsen, R
1997-01-01
Tetranectin is a plasminogen-binding protein that is induced during the mineralization phase of osteogenesis. By screening a human chromosome 3 somatic cell hybrid mapping panel, we have localized the human tetranectin gene (TNA) to 3p22-->p21.3, which is distinct from the loci of two human...
Hongo, Hiroki; Miyawaki, Satoru; Imai, Hideaki; Shinya, Yuki; Ono, Hideaki; Mori, Harushi; Nakatomi, Hirofumi; Kunimatsu, Akira; Saito, Nobuhito
2017-01-01
Intracranial atherosclerosis (ICAS) involves diverse histologies and several remodeling patterns. Ring finger protein 213 (RNF213) c.14576G>A variant (rs112735431), recently reported to be associated with ICAS, may be linked with negative remodeling (outer diameter - reducing morphological alteration) of intracranial arteries. This study investigated the outer diameter of atherosclerotic middle cerebral artery (MCA). Patients with unilateral atherosclerotic MCA stenosis/occlusion were enrolled in this single-hospital-based case-control study at The University of Tokyo Hospital. The patients were divided into two groups by the presence of RNF213 c.14576G>A (variant group and wild-type group) and the outer diameter of the MCA was measured with high-resolution magnetic resonance imaging. Twenty-eight patients with the wild type and 19 patients with the variant type were included. The outer diameter of the stenotic side MCA was smaller in the variant group than in the wild-type group ( P = 8.3 × 10 -6 ). The outer diameter of the normal side MCA was also smaller in the variant group than in the wild-type group ( P = 5.2 × 10 -3 ). The ratio of stenotic side to normal side was also smaller in the variant group than in the wild-type group ( P = 1.5 × 10 -5 ). This study indicates that RNF213 c.14576G>A is associated with negative remodeling of ICAS.
Energy Technology Data Exchange (ETDEWEB)
Kratochwil, C.; Giesel, F.L.; Mier, W.; Haberkorn, U. [University Hospital Heidelberg, Department of Nuclear Medicine, Heidelberg (Germany); Bruchertseifer, F.; Apostolidis, C.; Morgenstern, A. [European Commission, Institute for Transuranium Elements, Karlsruhe (Germany); Boll, R.; Murphy, K. [Oak Ridge National Laboratory, Oak Ridge, TN (United States)
2014-11-15
Radiopeptide therapy using a somatostatin analogue labelled with a beta emitter such as {sup 90}Y/{sup 177}Lu-DOTATOC is a new therapeutic option in neuroendocrine cancer. Alternative treatments for patients with refractory disease are rare. Here we report the first-in-human experience with {sup 213}Bi-DOTATOC targeted alpha therapy (TAT) in patients pretreated with beta emitters. Seven patients with progressive advanced neuroendocrine liver metastases refractory to treatment with {sup 90}Y/{sup 177}Lu-DOTATOC were treated with an intraarterial infusion of {sup 213}Bi-DOTATOC, and one patient with bone marrow carcinosis was treated with a systemic infusion of {sup 213}Bi-DOTATOC. Haematological, kidney and endocrine toxicities were assessed according to CTCAE criteria. Radiological response was assessed with contrast-enhanced MRI and {sup 68}Ga-DOTATOC-PET/CT. More than 2 years of follow-up were available in seven patients. The biodistribution of {sup 213}Bi-DOTATOC was evaluable with 440 keV gamma emission scans, and demonstrated specific tumour binding. Enduring responses were observed in all treated patients. Chronic kidney toxicity was moderate. Acute haematotoxicity was even less pronounced than with the preceding beta therapies. TAT can induce remission of tumours refractory to beta radiation with favourable acute and mid-term toxicity at therapeutic effective doses. (orig.)
Guey, Stéphanie; Kraemer, Markus; Hervé, Dominique; Ludwig, Thomas; Kossorotoff, Manoëlle; Bergametti, Françoise; Schwitalla, Jan Claudius; Choi, Simone; Broseus, Lucile; Callebaut, Isabelle; Genin, Emmanuelle; Tournier-Lasserve, Elisabeth
2017-08-01
Moyamoya angiopathy (MMA) is a cerebral angiopathy affecting the terminal part of internal carotid arteries. Its prevalence is 10 times higher in Japan and Korea than in Europe. In East Asian countries, moyamoya is strongly associated to the R4810K variant in the RNF213 gene that encodes for a protein containing a RING-finger and two AAA+ domains. This variant has never been detected in Caucasian MMA patients, but several rare RNF213 variants have been reported in Caucasian cases. Using a collapsing test based on exome data from 68 European MMA probands and 573 ethnically matched controls, we showed a significant association between rare missense RNF213 variants and MMA in European patients (odds ratio (OR)=2.24, 95% confidence interval (CI)=(1.19-4.11), P=0.01). Variants specific to cases had higher pathogenicity predictive scores (median of 24.2 in cases versus 9.4 in controls, P=0.029) and preferentially clustered in a C-terminal hotspot encompassing the RING-finger domain of RNF213 (P<10(-3)). This association was even stronger when restricting the analysis to childhood-onset and familial cases (OR=4.54, 95% CI=(1.80-11.34), P=1.1 × 10(-3)). All clinically affected relatives who were genotyped were carriers. However, the need for additional factors to develop MMA is strongly suggested by the fact that only 25% of mutation carrier relatives were clinically affected.
F.D.J. Ernst (Florian); K. Uhr (Katharina); A. Teumer (Alexander); J. Fanghänel (Jutta); S. Schulz (Susanne); B. Noack (Barbara); J. Gonzales (Jose); S. Reichert (Stefan); P. Eickholz (Peter); B. Holtfreter (Birte); P. Meisel (Peter); G.J. Linden (Gerard); G. Homuth (Georg); T. Kocher (Thomas)
2010-01-01
textabstractBackground: The human chromosomal region 9p21.3 has been shown to be strongly associated with Coronary Heart Disease (CHD) in several Genome-wide Association Studies (GWAS). Recently, this region has also been shown to be associated with Aggressive Periodontitis (AgP), strengthening the
DEFF Research Database (Denmark)
Butler, Graham
2015-01-01
of Copenhagen, Denmark. In this interview, carried out in June 2015 for the Utrecht Journal of International and European Law, David Thór Björgvinsson outlined his views to Graham Butler on Opinion 2/13 from the Court of Justice of the European Union on the Union’s accession to the European Convention on Human...
Energy Technology Data Exchange (ETDEWEB)
Duan, Wentao; Huang, Jinhua; Kowalski, Jeffrey A.; Shkrob, Ilya A.; Vijayakumar, M.; Walter, Eric; Pan, Baofei; Yang, Zheng; Milshtein, Jarrod D.; Li, Bin; Liao, Chen; Zhang, Zhengcheng; Wang, Wei; Liu, Jun; Moore, Jeffery S.; Brushett, Fikile R.; Zhang, Lu; Wei, Xiaoliang
2017-04-19
A highly soluble, readily accessible, redox-active organic material, 2,1,3-benzothiadiazole, is demonstrated as a novel anolyte material to enable exceptional cyclability in a full-cell organic redox flow battery. This material discovery represents a significant progress toward promising next-generation energy storage.
Dubielecka, Patrycja M; Machida, Kazuya; Xiong, Xiaoling; Hossain, Sajjad; Ogiue-Ikeda, Mari; Carrera, Ana C; Mayer, Bruce J; Kotula, Leszek
2010-08-04
Macropinocytosis is regulated by Abl kinase via an unknown mechanism. We previously demonstrated that Abl kinase activity is, itself, regulated by Abi1 subsequent to Abl kinase phosphorylation of Abi1 tyrosine 213 (pY213) [1]. Here we show that blocking phosphorylation of Y213 abrogated the ability of Abl to regulate macropinocytosis, implicating Abi1 pY213 as a key regulator of macropinocytosis. Results from screening the human SH2 domain library and mapping the interaction site between Abi1 and the p85 regulatory domain of PI-3 kinase, coupled with data from cells transfected with loss-of-function p85 mutants, support the hypothesis that macropinocytosis is regulated by interactions between Abi1 pY213 and the C-terminal SH2 domain of p85-thereby linking Abl kinase signaling to p85-dependent regulation of macropinocytosis. Copyright (c) 2010 Federation of European Biochemical Societies. All rights reserved.
Brueggemann, Lyubov I; Haick, Jennifer M; Cribbs, Leanne L; Byron, Kenneth L
2014-09-01
Recent research suggests that smooth muscle cells express Kv7.4 and Kv7.5 voltage-activated potassium channels, which contribute to maintenance of their resting membrane voltage. New pharmacologic activators of Kv7 channels, ML213 (N-mesitybicyclo[2.2.1]heptane-2-carboxamide) and ICA-069673 N-(6-chloropyridin-3-yl)-3,4-difluorobenzamide), have been reported to discriminate among channels formed from different Kv7 subtypes. We compared the effects of ML213 and ICA-069673 on homomeric human Kv7.4, Kv7.5, and heteromeric Kv7.4/7.5 channels exogenously expressed in A7r5 vascular smooth muscle cells. We found that, despite its previous description as a selective activator of Kv7.2 and Kv7.4, ML213 significantly increased the maximum conductance of homomeric Kv7.4 and Kv7.5, as well as heteromeric Kv7.4/7.5 channels, and induced a negative shift of their activation curves. Current deactivation rates decreased in the presence of the ML213 (10 μM) for all three channel combinations. Mutants of Kv7.4 (W242L) and Kv7.5 (W235L), previously found to be insensitive to another Kv7 channel activator, retigabine, were also insensitive to ML213 (10 μM). In contrast to ML213, ICA-069673 robustly activated Kv7.4 channels but was significantly less effective on homomeric Kv7.5 channels. Heteromeric Kv7.4/7.5 channels displayed intermediate responses to ICA-069673. In each case, ICA-069673 induced a negative shift of the activation curves without significantly increasing maximal conductance. Current deactivation rates decreased in the presence of ICA-069673 in a subunit-specific manner. Kv7.4 W242L responded to ICA-069673-like wild-type Kv7.4, but a Kv7.4 F143A mutant was much less sensitive to ICA-069673. Based on these results, ML213 and ICA-069673 likely bind to different sites and are differentially selective among Kv7.4, Kv7.5, and Kv7.4/7.5 channel subtypes. Copyright © 2014 by The American Society for Pharmacology and Experimental Therapeutics.
Vallon, Mario; Seidl, Christof; Blechert, Birgit; Li, Zhoulei; Gilbertz, Klaus-Peter; Baumgart, Anja; Aichler, Michaela; Feuchtinger, Annette; Gaertner, Florian C; Bruchertseifer, Frank; Morgenstern, Alfred; Walch, Axel K; Senekowitsch-Schmidtke, Reingard; Essler, Markus
2012-12-01
Targeted therapy with α-particle emitting radionuclides is a promising new option in cancer therapy. Stable conjugates of the vascular tumour-homing peptide F3 with the α-emitter (213)Bi specifically target tumour cells. The aim of our study was to determine efficacy of combined (213)Bi-diethylenetriaminepentaacetic acid (DTPA)-F3 and paclitaxel treatment compared to treatment with either (213)Bi-DTPA-F3 or paclitaxel both in vitro and in vivo. Cytotoxicity of treatment with (213)Bi-DTPA-F3 and paclitaxel, alone or in combination, was assayed towards OVCAR-3 cells using the alamarBlue assay, the clonogenic assay and flow cytometric analyses of the mode of cell death and cell cycle arrest. Therapeutic efficacy of the different treatment options was assayed after repeated treatment of mice bearing intraperitoneal OVCAR-3 xenograft tumours. Therapy monitoring was performed by bioluminescence imaging and histopathologic analysis. Treatment of OVCAR-3 cells in vitro with combined (213)Bi-DTPA-F3 and paclitaxel resulted in enhanced cytotoxicity, induction of apoptosis and G2/M phase arrest compared to treatment with either (213)Bi-DTPA-F3 or paclitaxel. Accordingly, i.p. xenograft OVCAR-3 tumours showed the best response following repeated (six times) combined therapy with (213)Bi-DTPA-F3 (1.85 MBq) and paclitaxel (120 μg) as demonstrated by bioluminescence imaging and histopathologic investigation of tumour spread on the mesentery of the small and large intestine. Moreover, mean survival of xenograft mice that received combined therapy with (213)Bi-DTPA-F3 and paclitaxel was significantly superior to mice treated with either (213)Bi-DTPA-F3 or paclitaxel alone. Combined treatment with (213)Bi-DTPA-F3 and paclitaxel significantly increased mean survival of mice with peritoneal carcinomatosis of ovarian origin, thus favouring future therapeutic application.
Energy Technology Data Exchange (ETDEWEB)
Vallon, Mario; Seidl, Christof; Blechert, Birgit; Li, Zhoulei; Gaertner, Florian C.; Senekowitsch-Schmidtke, Reingard; Essler, Markus [Technische Universitaet Muenchen, Department of Nuclear Medicine, Munich (Germany); Gilbertz, Klaus-Peter [German Armed Forces, Institute of Radiobiology, Munich (Germany); Baumgart, Anja [Technische Universitaet Muenchen, III. Medical Department, Munich (Germany); Aichler, Michaela; Feuchtinger, Annette; Walch, Axel K. [Helmholtz Zentrum Muenchen, Institute of Pathology, Neuherberg (Germany); Bruchertseifer, Frank; Morgenstern, Alfred [Institute for Transuranium Elements, European Commission, Joint Research Centre, Karlsruhe (Germany)
2012-12-15
Targeted therapy with {alpha}-particle emitting radionuclides is a promising new option in cancer therapy. Stable conjugates of the vascular tumour-homing peptide F3 with the {alpha}-emitter {sup 213}Bi specifically target tumour cells. The aim of our study was to determine efficacy of combined {sup 213}Bi-diethylenetriaminepentaacetic acid (DTPA)-F3 and paclitaxel treatment compared to treatment with either {sup 213}Bi-DTPA-F3 or paclitaxel both in vitro and in vivo. Cytotoxicity of treatment with {sup 213}Bi-DTPA-F3 and paclitaxel, alone or in combination, was assayed towards OVCAR-3 cells using the alamarBlue assay, the clonogenic assay and flow cytometric analyses of the mode of cell death and cell cycle arrest. Therapeutic efficacy of the different treatment options was assayed after repeated treatment of mice bearing intraperitoneal OVCAR-3 xenograft tumours. Therapy monitoring was performed by bioluminescence imaging and histopathologic analysis. Treatment of OVCAR-3 cells in vitro with combined {sup 213}Bi-DTPA-F3 and paclitaxel resulted in enhanced cytotoxicity, induction of apoptosis and G2/M phase arrest compared to treatment with either {sup 213}Bi-DTPA-F3 or paclitaxel. Accordingly, i.p. xenograft OVCAR-3 tumours showed the best response following repeated (six times) combined therapy with {sup 213}Bi-DTPA-F3 (1.85 MBq) and paclitaxel (120 {mu}g) as demonstrated by bioluminescence imaging and histopathologic investigation of tumour spread on the mesentery of the small and large intestine. Moreover, mean survival of xenograft mice that received combined therapy with {sup 213}Bi-DTPA-F3 and paclitaxel was significantly superior to mice treated with either {sup 213}Bi-DTPA-F3 or paclitaxel alone. Combined treatment with {sup 213}Bi-DTPA-F3 and paclitaxel significantly increased mean survival of mice with peritoneal carcinomatosis of ovarian origin, thus favouring future therapeutic application. (orig.)
Khan, Muhammad A
2017-02-01
This publication updates an earlier review on the ever increasing knowledge about genetic polymorphism of HLA-B*27 and discusses its clinical relevance. As of January 1, 2017, there are 213 known alleles of HLA-B*27 at nucleotide sequence level, while at the translated protein level, there are 160 known subtypes based on one or more amino acid sequence differences. Some of these subtypes exhibit differential association with ankylosing spondylitis, and there may even be some level of hierarchy in this regard. On the other hand, HLA-B*27 has a protective effect against HCV, and this effect is also influenced by some of the subtypes of HLA-B*27. This may have important implications for designing anti-viral vaccines for global population and also for developing individualized treatments and vaccines. Disease association and disease protective roles of HLA-B*27 suggest a common ground, i.e., promoting a more pronounced immune/inflammatory response for effective clearance of some pathogens, but that might, on the other hand, lead to autoimmunity and tissue injury in some circumstances.
Energy Technology Data Exchange (ETDEWEB)
Duan, Wentao [Joint Center for Energy Storage Research, Argonne, IL (United States); Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Huang, Jinhua [Joint Center for Energy Storage Research, Argonne, IL (United States); Argonne National Lab. (ANL), Argonne, IL (United States); Kowalski, Jeffrey A. [Joint Center for Energy Storage Research, Argonne, IL (United States); Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States); Shkrob, Ilya A. [Joint Center for Energy Storage Research, Argonne, IL (United States); Argonne National Lab. (ANL), Argonne, IL (United States); Vijayakumar, M. [Joint Center for Energy Storage Research, Argonne, IL (United States); Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Walter, Eric [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Pan, Baofei [Joint Center for Energy Storage Research, Argonne, IL (United States); Argonne National Lab. (ANL), Argonne, IL (United States); Yang, Zheng [Joint Center for Energy Storage Research, Argonne, IL (United States); Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Milshtein, Jarrod D. [Joint Center for Energy Storage Research, Argonne, IL (United States); Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States); Li, Bin [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Liao, Chen [Joint Center for Energy Storage Research, Argonne, IL (United States); Argonne National Lab. (ANL), Argonne, IL (United States); Zhang, Zhengcheng [Joint Center for Energy Storage Research, Argonne, IL (United States); Argonne National Lab. (ANL), Argonne, IL (United States); Wang, Wei [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Liu, Jun [Joint Center for Energy Storage Research, Argonne, IL (United States); Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Moore, Jeffery S. [Joint Center for Energy Storage Research, Argonne, IL (United States); Univ. of Illinois Urbana-Champaign, Urbana, IL (United States); Brushett, Fikile R. [Joint Center for Energy Storage Research, Argonne, IL (United States); Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States); Zhang, Lu [Joint Center for Energy Storage Research, Argonne, IL (United States); Argonne National Lab. (ANL), Argonne, IL (United States); Wei, Xiaoliang [Joint Center for Energy Storage Research, Argonne, IL (United States); Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2017-04-24
Redox-active organic materials (ROMs) have shown great promise for redox flow battery applications but generally encounter limited cycling efficiency and stability at relevant redox material concentrations in nonaqueous systems. Here we report a new heterocyclic organic anolyte molecule, 2,1,3-benzothiadiazole, that has high solubility, a low redox potential, and fast electrochemical kinetics. Coupling it with a benchmark catholyte ROM, the nonaqueous organic flow battery demonstrated significant improvement in cyclable redox material concentrations and cell efficiencies compared to the state-of-the-art nonaqueous systems. Especially, this system produced exceeding cyclability with relatively stable efficiencies and capacities at high ROM concentrations (>0.5 M), which is ascribed to the highly delocalized charge densities in the radical anions of 2,1,3-benzothiadiazole, leading to good chemical stability. As a result, this material development represents significant progress toward promising next-generation energy storage.
Buchhorn, H Matthias; Seidl, Christof; Beck, Roswitha; Saur, Dieter; Apostolidis, Christos; Morgenstern, Alfred; Schwaiger, Markus; Senekowitsch-Schmidtke, Reingard
2007-06-01
Non-invasive imaging of tumour development remains a challenge, especially for tumours in the intraperitoneal cavity. Therefore, the aim of this study was the visualisation of both the development of peritoneal carcinomatosis and tumour regression after radioimmunotherapy with tumour-specific 213Bi-Immunoconjugates, via in vivo bioluminescence imaging of firefly luciferase-transfected cells. Human diffuse-type gastric cancer cells expressing mutant d9-E-cadherin were stably transfected with firefly luciferase (HSC45-M2-luc). For bioluminescence imaging, nude mice were inoculated intraperitoneally with 1x10(7) HSC45-M2-luc cells. On days 4 and 8 after tumour cell inoculation, imaging was performed following D-luciferin injection using a cooled CCD camera with an image intensifier unit. For therapy, mice were injected with 2.7 MBq 213Bi-d9MAb targeting d9-E-cadherin on day 8 after tumour cell inoculation. Bioluminescence images were taken every 4 days to monitor tumour development. After i.p. inoculation of HSC45-M2-luc cells into nude mice, development as well as localisation of peritoneal carcinomatosis could be visualised using bioluminescence imaging. Following 213Bi-d9MAb therapy on day 8 after intraperitoneal inoculation of HSC45-M2-luc cells, small tumour nodules were totally eliminated and larger nodules showed a clear reduction in size on day 12 after tumour cell inoculation. Subsequently a recurrence of tumour mass was observed, starting from the remaining tumour spots. By measuring the mean grey level intensity, tumour development over time could be demonstrated. Non-invasive bioluminescence imaging permits visualisation of the development of peritoneal carcinomatosis, localisation of tumour in the intraperitoneal cavity and evaluation of therapeutic success after 213Bi-d9MAb treatment.
Energy Technology Data Exchange (ETDEWEB)
Hwang, J.K.; Hamilton, J.H.; Ramayya, A.V. [Vanderbilt University, Physics Department, Nashville, TN (United States)
2013-12-15
Excited high spin states in {sup 211}At, {sup 212}Rn, {sup 213}Fr and {sup 214}Ra with N = 126 are reorganized and interpreted in terms of the stretched weak coupling of an octupole 3{sup -} phonon. Nearly identical sequences of levels with {Delta}I = 3 and the parity change are found, for the first time, up to 25{sup -} for 20 states of {sup 214}Ra, up to 35{sup -} for 36 states of {sup 212}Rn and up to 53/2{sup +} for 16 states of {sup 213}Fr. The stretched weak coupling of an octupole phonon is extended up to the highest excitation energy of 11355 keV for {sup 212}Rn which has the largest experimental B(E3) value of 44.1(88) W.u. for the 11{sup -} {yields} 8{sub 2}{sup +} transition. The stretched weak coupling of an octupole 3{sup -} phonon needs to be considered when single particle configurations are assigned to high spin states. Average octupole excitation energies of 657(51) keV for {sup 211}At, 1101(28) keV for {sup 212}Rn, 667(25) keV for {sup 213}Fr, and 709(25) keV for {sup 214}Ra are obtained. The calculated level energies are in a good agreement with the experimental level energies within the error limit of 4.3%. (orig.)
Directory of Open Access Journals (Sweden)
Kaouthar Abid
2015-01-01
Full Text Available Multiple association studies found that the human 9p21.3 chromosome locus is a risk factor for atherosclerosis. The purpose of this study was to investigate the association of the severity and early-onset of coronary artery disease with variant rs1333049 on chromosome 9p21.3 polymorphism and the impact of this variant on cardiovascular risk factors in type 2 diabetic patients. The study population consisted of a control CAD group (101 patients and 273 consecutive type 2 diabetic patients. Severity and extent of coronary atherosclerosis were scored numerically using the Gensini scoring system. The diabetic population was divided into three groups according to Gensini score: Group 1: no stenosis; Group 2: moderate CAD; Group 3, severe CAD. The homozygous CC genotype of rs1333049 was significantly associated with CAD in Group 2 (OR: 1.36; p=0.02 and Group 3 (OR: 5.77, p<0.001 compared to Group 1 (OR: 0.18; p=0.2 and control group (OR: 0.22; p=0.21. Among diabetic patients with early-onset CAD, CC genotype carriers had significantly higher Gensini scores than non-CC genotype carriers (49±21.3 versus 14.87±25.22; p<0.001. The homozygous CC genotype of rs1333049 confers a magnified risk of early-onset and severe CAD in type 2 diabetic Tunisian population.
Niemiec, Pawel; Balcerzyk, Anna; Iwanicki, Tomasz; Emich-Widera, Ewa; Kopyta, Ilona; Nowak, Tomasz; Pilarska, Ewa; Pienczk-Ręcławowicz, Karolina; Kaciński, Marek; Wendorff, Janusz; Gorczynska-Kosiorz, Sylwia; Trautsolt, Wanda; Grzeszczak, Władysław; Zak, Iwona
2017-12-01
The association of 9p21.3 locus single nucleotide polymorphisms with arterial ischemic stroke in adults was demonstrated in many studies, but there are no studies in pediatric arterial ischemic stroke patients. We investigated whether the 9p21.3 locus polymorphism, namely rs10757278, is associated with the arterial ischemic stroke risk in children. The study group consisted of 335 individuals: 80 children with arterial ischemic stroke, their biological parents (n = 122), and 133 children (age and sex matched) without any symptoms of arterial ischemic stroke as a control group. The rs10757278 polymorphism was genotyped using the TaqMan® Pre-designed SNP Genotyping Assay (Applied Biosystems). Two different study design models were used: family-based association test (transmission-disequilibrium test) and case-control model. There were no statistically significant differences in the distribution of genotypes and alleles of the rs10757278 polymorphism between groups of children with arterial ischemic stroke and controls. The frequency of both transmitted alleles in transmission-disequilibrium test analysis was identical (50%). The A allele carrier state (AA+AG genotype) was more frequent in arterial ischemic stroke children with hemiparesis than in patients without this symptom (94.5% versus 68.0%, P = .004). There is no evidence to consider the 9p21.3 locus polymorphism as a risk factor for childhood arterial ischemic stroke. Copyright © 2017 National Stroke Association. Published by Elsevier Inc. All rights reserved.
Gruen, Dieter M.
2000-01-01
A 213 nm laser beam is capable of single photon ablative photodecomposition for the removal of a polymer or biological material substrate. Breaking the molecular bonds and displacing the molecules away from the substrate in a very short time period results in most of the laser photon energy being carried away by the displaced molecules, thus minimizing thermal damage to the substrate. The incident laser beam may be unfocussed and is preferably produced by quintupling the 1064 nm radiation from a Nd:YAG solid state laser, i.e., at 213 nm. In one application, the 213 nm laser beam is expanded in cross section and directed through a plurality of small beta barium borate (BBO) crystals for increasing the energy per photon of the laser radiation directed onto the substrate. The BBO crystals are arranged in a crystal matrix array to provide a large laser beam transmission area capable of accommodating high energy laser radiation without damaging the BBO crystals. The BBO crystal matrix array may also be used with 266 nm laser radiation for carrying out single or multi photon ablative photodecomposition. The BBO crystal matrix array may also be used in an optical parametric oscillator mode to generate high power tunable laser radiation in the range of 210-400 nm.
Tashiro, Ryosuke; Fujimura, Miki; Niizuma, Kuniyasu; Endo, Hidenori; Sakata, Hiroyuki; Sato-Maeda, Mika; Tominaga, Teiji
2017-01-01
The de novo development of moyamoya disease (MMD) in adults is extremely rare, with only 2 cases being previously reported. Furthermore, the mechanisms underlying the progression of adult MMD have not been elucidated yet. A transient ischemic attack occurred in a 46-year-old woman, owing to progressive MMD. Magnetic resonance (MR) angiography performed 7 years before the diagnosis of MMD did not detect any steno-occlusive changes in the major intracranial vessels, including the internal carotid artery (ICA) and the middle cerebral artery (MCA). However, during the last 2 years, serial MR angiography revealed the gradual progression of left MCA stenosis and ultimately showed apparent stenosis of the bilateral terminal ICA to proximal MCA. Catheter angiography confirmed the definitive diagnosis of MMD. A genetic analysis of RING-finger protein (RNF)-213, an MMD susceptibility gene, revealed that not only the patient, but also her sister, brother, and daughter had the heterozygous variant of the RNF-213 gene. Because of hemodynamic compromise with ischemic symptoms, the patient underwent revascularization surgery on the affected hemisphere, without complications. She had no cerebrovascular event in the postoperative follow-up period of 8 months, and there was no evidence of the further progression of MMD. We herein present the entire clinical course of the de novo development of MMD in a female adult. Newly developed MMD in an adult patient with a characteristic variant of the RNF-213 gene appears to be unique. Copyright © 2017 National Stroke Association. Published by Elsevier Inc. All rights reserved.
Bykov, Sergei V; Mao, Michael; Gares, Katie L; Asher, Sanford A
2015-08-01
We describe a new compact acousto-optically Q-switched diode-pumped solid-state (DPSS) intracavity frequency-tripled neodymium-doped yttrium vanadate laser capable of producing ~100 mW of 213 nm power quasi-continuous wave as 15 ns pulses at a 30 kHz repetition rate. We use this new laser in a prototype of a deep ultraviolet (UV) Raman standoff spectrometer. We use a novel high-throughput, high-resolution Echelle Raman spectrograph. We measure the deep UV resonance Raman (UVRR) spectra of solid and solution sodium nitrate (NaNO3) and ammonium nitrate (NH4NO3) at a standoff distance of ~2.2 m. For this 2.2 m standoff distance and a 1 min spectral accumulation time, where we only monitor the symmetric stretching band, we find a solid state NaNO3 detection limit of ~100 μg/cm(2). We easily detect ~20 μM nitrate water solutions in 1 cm path length cells. As expected, the aqueous solutions UVRR spectra of NaNO3 and NH4NO3 are similar, showing selective resonance enhancement of the nitrate (NO3(-)) vibrations. The aqueous solution photochemistry is also similar, showing facile conversion of NO3(-) to nitrite (NO2(-)). In contrast, the observed UVRR spectra of NaNO3 and NH4NO3 powders significantly differ, because their solid-state photochemistries differ. Whereas solid NaNO3 photoconverts with a very low quantum yield to NaNO2, the NH4NO3 degrades with an apparent quantum yield of ~0.2 to gaseous species.
F, Lu; Y, Tu; X, Peng; L, Wang; H, Wang; Z, Sun; H, Zheng; Z, Hu
2008-07-01
Mycophenolate mofetil (MMF) with prednisolone has been associated with high remission rates when used as induction treatment for lupus nephritis. This prospective, multicentre, cohort study investigates the efficacy and safety of this regimen over 24 weeks in 213 Chinese patients with active lupus nephritis (Classes III, IV, V or combination). Baseline activity index (AI) was 6.91+/-3.33 and chronicity index (CI) was 1.9+/-1.2. The remission rate was 82.6% at 24 weeks (complete remission, 34.3%; partial remission, 48.4%). There were significant (Pfactors influencing remission were pathological classification (including Class V and III or Class V and IV nephritis) and elevated serum creatinine at baseline (OR 2.967, 95% CI: 1.479-6.332, P=0.001 and OR 1.007, 95% CI: 1.002-1.011, P=0.001, respectively). Patients with concomitant membranous features on biopsy had a lower remission rate than those with Class III and IV nephritis (66.7% vs 87.3%, P=0.002). Renal biopsy was repeated in 25 patients following treatment. There was a transition to less severe pathological morphologies in majority of subjects. Infections were monitored throughout treatment: eight patients (3.8%) experienced bacterial infections, whereas herpes zoster occurred in seven patients. Nine patients (4.2%) suffered from gastrointestinal upset, which resolved without discontinuation of MMF. One patient became leucopenic, whereas another died from active disease unrelated to kidney symptoms. MMF combined with prednisolone is an effective and well-tolerated induction treatment for patients with active lupus nephritis and for controlling SLE systemic activity.
Energy Technology Data Exchange (ETDEWEB)
Zhu Xunlin; Shaw, P. Nicholas; Barrett, David A
2003-02-22
4-Fluoro-7-nitro-2,1,3-benzoxadiazole (NBD-F) was evaluated as a fluorogenic derivatization reagent for the analysis of the catecholamines, dopamine, epinephrine, norepinephrine, and their naturally occurring metabolites, metanephrine and normetanephrine, homovanillic acid, 3,4-dihydroxyphenyl acetic acid. These compounds reacted rapidly with NBD-F under mild conditions to form stable derivatives. The optimal reaction conditions were found to be 12.5 mM borate buffer pH 8.0 in water:acetonitrile (1:1) at 50 deg. C for 5 min. New NBD derivatives of all the catecholamines and metabolites were prepared and purified and were shown by electrospray mass spectrometry to be fully reacted at all available catechol and amine sites, resulting in di- or tri-substituted derivatives. Homovanillic acid and 3,4-dihydroxyphenyl acetic acid reacted with NBD-F but gave non-fluorescent derivatives. The fluorescence excitation wavelength maximum demonstrated a red shift for the derivatives with increasing polarity of the solvent and the fluorescence intensity increased linearly with increasing organic ratio in the solvent-aqueous buffer complex. The presence of electrolyte in the solvent and the electrolyte concentration in the solvent-electrolyte complex had little effect on the fluorescent intensity. The fluorescence quantum yields in acetonitrile were also obtained. The separation behavior of the NBD-catecholamines was determined by high-performance liquid chromatography (HPLC). The studies demonstrated good potential for the application of NBD-F derivatization to the quantitative analysis of catecholamines and related compounds in biological matrices.
Energy Technology Data Exchange (ETDEWEB)
Gray, J; Lukose, R; Bronson, J; Chandler, B; Merchant, T; Farr, J [St. Jude Children’s Research Hospital, Memphis, TN (United States)
2015-06-15
Purpose: To conduct a failure mode and effects analysis (FMEA) as per AAPM Task Group 100 on clinical processes associated with teletherapy, and the development of mitigations for processes with identified high risk. Methods: A FMEA was conducted on clinical processes relating to teletherapy treatment plan development and delivery. Nine major processes were identified for analysis. These steps included CT simulation, data transfer, image registration and segmentation, treatment planning, plan approval and preparation, and initial and subsequent treatments. Process tree mapping was utilized to identify the steps contained within each process. Failure modes (FM) were identified and evaluated with a scale of 1–10 based upon three metrics: the severity of the effect, the probability of occurrence, and the detectability of the cause. The analyzed metrics were scored as follows: severity – no harm = 1, lethal = 10; probability – not likely = 1, certainty = 10; detectability – always detected = 1, undetectable = 10. The three metrics were combined multiplicatively to determine the risk priority number (RPN) which defined the overall score for each FM and the order in which process modifications should be deployed. Results: Eighty-nine procedural steps were identified with 186 FM accompanied by 193 failure effects with 213 potential causes. Eighty-one of the FM were scored with a RPN > 10, and mitigations were developed for FM with RPN values exceeding ten. The initial treatment had the most FM (16) requiring mitigation development followed closely by treatment planning, segmentation, and plan preparation with fourteen each. The maximum RPN was 400 and involved target delineation. Conclusion: The FMEA process proved extremely useful in identifying previously unforeseen risks. New methods were developed and implemented for risk mitigation and error prevention. Similar to findings reported for adult patients, the process leading to the initial treatment has an
African Journals Online (AJOL)
boaz
enseignement universitaire d'université d'Ilorin, Ilorin, Nigeria;. ²Département de Microbiologie ... Médecine communautaire, Centre Médicale, Fédérale, Ido – Ekiti, Nigeria. Correspondance ... there is no national surveillance on rubella in the country (14).
Attarbaschi, Andishe; Carraro, Elisa; Abla, Oussama; Barzilai-Birenboim, Shlomit; Bomken, Simon; Brugieres, Laurence; Bubanska, Eva; Burkhardt, Birgit; Chiang, Alan K S; Csoka, Monika; Fedorova, Alina; Jazbec, Janez; Kabickova, Edita; Krenova, Zdenka; Lazic, Jelena; Loeffen, Jan; Mann, Georg; Niggli, Felix; Miakova, Natalia; Osumi, Tomoo; Ronceray, Leila; Uyttebroeck, Anne; Williams, Denise; Woessmann, Wilhelm; Wrobel, Grazyna; Pillon, Marta
2016-12-01
Children and adolescents with pre-existing conditions such as DNA repair defects or other primary immunodeficiencies have an increased risk of non-Hodgkin lymphoma. However, large-scale data on patients with non-Hodgkin lymphoma and their entire spectrum of pre-existing conditions are scarce. A retrospective multinational study was conducted by means of questionnaires sent out to the national study groups or centers, by the two largest consortia in childhood non-Hodgkin lymphoma, the European Intergroup for Childhood non-Hodgkin Lymphoma, and the international Berlin-Frankfurt-Münster Study Group. The study identified 213 patients with non-Hodgkin lymphoma and a pre-existing condition. Four subcategories were established: a) cancer predisposition syndromes (n=124, 58%); b) primary immunodeficiencies not further specified (n=27, 13%); c) genetic diseases with no increased cancer risk (n=40, 19%); and d) non-classifiable conditions (n=22, 10%). Seventy-nine of 124 (64%) cancer predispositions were reported in groups with more than 20 patients: ataxia telangiectasia (n=32), Nijmegen breakage syndrome (n=26), constitutional mismatch repair deficiency (n=21). For the 151 patients with a known cancer risk, 5-year event-free survival and overall survival rates were 40%±4% and 51%±4%, respectively. Five-year cumulative incidences of progression/relapse and treatment-related death as a first event were 22%±4% and 24%±4%, respectively. Ten-year incidence of second malignancy was 24%±5% and 7-year overall survival of the 21 patients with a second malignancy was 41%±11%. Patients with non-Hodgkin lymphoma and pre-existing conditions have an inferior survival rate with a large proportion of therapy-related deaths compared to patients with non-Hodgkin lymphoma and no pre-existing conditions. They may require special vigilance when receiving standard or modified/reduced-intensity chemotherapy or when undergoing allogeneic stem cell transplantation. Copyright© Ferrata
Directory of Open Access Journals (Sweden)
Ji-Hyeon Choi
Full Text Available Compound K (C-K is a crucial pharmaceutical and cosmetic component because of disease prevention and skin anti-aging effects. For industrial application of this active compound, the protopanaxadiol (PPD-type ginsenosides should be transformed to C-K. β-Glycosidase from Sulfolobus solfataricus has been reported as an efficient C-K-producing enzyme, using glycosylated PPD-type ginsenosides as substrates. β-Glycosidase from S. solfataricus can hydrolyze β-d-glucopyranoside in ginsenosides Rc, C-Mc1, and C-Mc, but not α-l-arabinofuranoside in these ginsenosides. To determine candidate residues involved in α-l-arabinofuranosidase activity, compound Mc (C-Mc was docking to β-glycosidase from S. solfataricus in homology model and sequence was aligned with β-glycosidase from Pyrococcus furiosus that has α-l-arabinofuranosidase activity. A L213A variant β-glycosidase with increased α-l-arabinofuranosidase activity was selected by substitution of other amino acids for candidate residues. The increased α-l-arabinofuranosidase activity of the L213A variant was confirmed through the determination of substrate specificity, change in binding energy, transformation pathway, and C-K production from ginsenosides Rc and C-Mc. The L213A variant β-glycosidase catalyzed the conversion of Rc to Rd by hydrolyzing α-l-arabinofuranoside linked to Rc, whereas the wild-type β-glycosidase did not. The variant enzyme converted ginsenosides Rc and C-Mc into C-K with molar conversions of 97%, which were 1.5- and 2-fold higher, respectively, than those of the wild-type enzyme. Therefore, protein engineering is a useful tool for enhancing the hydrolytic activity on specific glycoside linked to ginsenosides.
Energy Technology Data Exchange (ETDEWEB)
Hitomi, Toshiaki [Department of Health and Environmental Sciences, Kyoto University, Kyoto (Japan); Habu, Toshiyuki [Radiation Biology Center, Kyoto University, Kyoto (Japan); Kobayashi, Hatasu; Okuda, Hiroko; Harada, Kouji H. [Department of Health and Environmental Sciences, Kyoto University, Kyoto (Japan); Osafune, Kenji [Center for iPS Cell Research and Application (CiRA), Kyoto University, Kyoto (Japan); Taura, Daisuke; Sone, Masakatsu [Department of Medicine and Clinical Science, Kyoto University, Kyoto (Japan); Asaka, Isao; Ameku, Tomonaga; Watanabe, Akira; Kasahara, Tomoko; Sudo, Tomomi; Shiota, Fumihiko [Center for iPS Cell Research and Application (CiRA), Kyoto University, Kyoto (Japan); Hashikata, Hirokuni; Takagi, Yasushi [Department of Neurosurgery, Kyoto University,Kyoto (Japan); Morito, Daisuke [Faculty of Life Sciences, Kyoto Sangyo University, Kyoto (Japan); Miyamoto, Susumu [Department of Neurosurgery, Kyoto University,Kyoto (Japan); Nakao, Kazuwa [Department of Medicine and Clinical Science, Kyoto University, Kyoto (Japan); Koizumi, Akio, E-mail: koizumi.akio.5v@kyoto-u.ac.jp [Department of Health and Environmental Sciences, Kyoto University, Kyoto (Japan)
2013-08-16
Highlights: •Angiogenic activities were reduced in iPSECs from MMD patients. •Many mitosis-regulated genes were downregulated in iPSECs from MMD patients. •RNF213 R4810K downregulated Securin and inhibited angiogenic activity. •Securin suppression by siRNA reduced angiogenic activities of iPSECs and HUVECs. -- Abstract: Moyamoya disease (MMD) is a cerebrovascular disease characterized by occlusive lesions in the circle of Willis. The RNF213 R4810K polymorphism increases susceptibility to MMD. Induced pluripotent stem cells (iPSCs) were established from unaffected fibroblast donors with wild-type RNF213 alleles, and from carriers/patients with one or two RNF213 R4810K alleles. Angiogenic activities of iPSC-derived vascular endothelial cells (iPSECs) from patients and carriers were lower (49.0 ± 19.4%) than from wild-type subjects (p < 0.01). Gene expression profiles in iPSECs showed that Securin was down-regulated (p < 0.01) in carriers and patients. Overexpression of RNF213 R4810K downregulated Securin, inhibited angiogenic activity (36.0 ± 16.9%) and proliferation of humanumbilical vein endothelial cells (HUVECs) while overexpression of RNF213 wild type did not. Securin expression was downregulated using RNA interference techniques, which reduced the level of tube formation in iPSECs and HUVECs without inhibition of proliferation. RNF213 R4810K reduced angiogenic activities of iPSECs from patients with MMD, suggesting that it is a promising in vitro model for MMD.
Directory of Open Access Journals (Sweden)
Cora Cravero
2017-01-01
Full Text Available We report the case of a young boy with nonverbal autism and intellectual disability, with a rare de novo 1q21.3 microdeletion. The patient had early and extreme self-injurious behaviours that led to blindness, complicated by severe developmental regression. A significant reduction in the self-injurious behaviours and the recovery of developmental dynamics were attained in a multidisciplinary neurodevelopmental inpatient unit. Improvement was obtained after managing all causes of somatic pains, using opiate blockers and stabilizing the patient’s mood. We offered both sensorimotor developmental approach with therapeutic body wrap and specific psychoeducation adapted to his blindness condition for improving his communication abilities.
Claperon, Cédric; Rozenfeld, Raphael; Iturrioz, Xavier; Inguimbert, Nicolas; Okada, Mayumi; Roques, Bernard; Maigret, Bernard; Llorens-Cortes, Catherine
2008-11-15
APA (aminopeptidase A; EC 3.4.11.7) is a membrane-bound zinc metallopeptidase, also activated by Ca(2+), involved in the formation of brain angiotensin III, which exerts a tonic stimulatory action on the central control of blood pressure in hypertensive animals. In the present study, in the three-dimensional model of the ectodomain of mouse APA, we docked the specific APA inhibitor glutamate phosphonate, in the presence of Ca(2+). The model showed the presence of one Ca(2+) atom in an hydrophilic pocket corresponding to the S1 subsite in which the lateral chain of the inhibitor is pointing. In this pocket, the Ca(2+) atom was hexaco-ordinated with the acidic side chains of Asp(213) and Asp(218), the carbonyl group of Glu(215) and three water molecules, one of them being engaged in a hydrogen bond with the negatively charged carboxylate side chain of the inhibitor. Mutagenic replacement of Asp(213) and Asp(218) with a conservative residue maintained the ability of mutated APAs to be activated by Ca(2+). However, the replacement by a non-conservative residue abolished this property, demonstrating the crucial role of these residues in Ca(2+) binding. We also showed the involvement of these residues in the strict specificity of APA in the presence of Ca(2+) for N-terminal acidic residues from substrates or inhibitors, since mutagenic replacement of Asp(213) and Asp(218) induced a decrease of the inhibitory potencies of inhibitors homologous with acidic residues. Finally, this led to the rational design of a new potent APA inhibitor, NI926 (K(i)=70 nM), which allowed us to precisely localize Asp(213) at the entrance and Asp(218) at the bottom of the S1 subsite. Taken together, these data provide new insight into the organization and functional role of the APA S1 subsite and will allow the design of pharmacophore of the inhibitor, helpful for the development of a new generation of APA inhibitors as central-acting antihypertensive agents.
Diazidobis[4,4,5,5-tetramethyl-2-(1,3-thiazol-2-yl-2-imidazoline-1-oxyl-3-oxide-κ2O,N]manganese(II
Directory of Open Access Journals (Sweden)
Kai Jiang
2009-02-01
Full Text Available In the crystal structure of the title compound, [Mn(N32(C10H14N3O2S2], the Mn(II atom exhibits a roughly octahedral coordination geometry. The Mn(II atom lies on an inversion centre, thus the asymmetric unit comprises one half-molecule. The metal center is six-coordinated by two azide anions and by two chelating 4,4,5,5-tetramethyl-2-(1,3-thiazol-2-yl-2-imidazoline-1-oxyl-3-oxide nitronyl nitroxide radical ligands, leading to two six-membered chelate rings.
Directory of Open Access Journals (Sweden)
Aprilia Kusumastuti
2015-10-01
Full Text Available The aim of the study was to know avian influenza (AI infection in field by using serology test in threemarketing area of AI vaccines. Haemagglutination inhibition methode was used in this test. There werefour antigen strains of AI subtype H5N1 clade 2.1.3 (AIstrainA/Chicken/West Java/PWT-WIJ/2006, AIstrain A/Chicken/Garut/BBVW-223/2007, AI strain A/Chicken/West Java-Nagrak/30/2007, and AI strainA/Chicken/Pekalongan/BBVW-208/2007 and 2 antigen strains of AI subtype H5N1 clade 2.3.2 (AI strainA/duck/Sukoharjo/BBVW-1428-9/2012 and AI strain A/duck/Sleman/BBVW-1463-10/2012 was used inthis study for HI test. The result presents that 93,33% chicken farms in three marketing area of PT. SanbioLaboratories have positive antibody titre to AI subtype H5N1 clade 2.1.3. This titre may be obtained fromAI clade 2.1.3 vaccination. From 15 samples, 92,86% are positive to AI subtype H5N1 clade 2.3.2A/duck/Sukoharjo/BBVW-1428-9/2012 and 92,31% are positive to A/duck/Sleman/BBVW-1463-10/2012 evenwithout AI clade 2.3.2 vaccination. This antibody titre may be obtained from AI clade 2.1.3 vaccine crossprotection or field infection.
Van Esch, Hilde; Zanni, Ginevra; Holvoet, Maureen; Borghgraef, Martine; Chelly, Jamel; Fryns, Jean-Pierre; Devriendt, Koenraad
2005-01-01
X-linked mental retardation (XLMR) is a heterogeneous disorder that can be classified as either non-specific (MRX), when mental retardation is the only feature, or as syndromic mental retardation (MRXS). Genetic defects underlying XLMR are being identified at a rapid pace, often starting from X-chromosomal aberrations and XLMR families with a well-defined linkage interval. Here, we present a new family with a syndromic form of XLMR, including mild mental retardation, short stature, microcephaly and hypogonadism. Two-point linkage analysis with 24 polymorphic markers spanning the entire X chromosome was carried out. We could assign the causative gene to a 6 cM interval in Xp22.1-p21.3, with a maximum LOD score of 2.61 for markers DXS989 and DXS1061 at theta = 0.00. No mutations were found in the presented family for two known MRX genes mapping to this interval, ARX and IL1RAPL-1. These data indicate that the interval Xp22.1-p21.3 contains at least one additional MRXS gene.
Becher, Simon; Spengler, Bernhard; Heiles, Sven
2017-01-01
Ultraviolet photodissociation tandem mass spectrometry is a powerful tool to investigate the structure of biomolecules, due to its ability to generate rich fragmentation patterns or bond selective cleavage, as a function of used laser wavelength, laser fluence, dose (number of accumulated laser pulses), and available chromophores. Herein, we report first results obtained with a newly developed two-wavelength (266 nm and 213 nm) ultraviolet photodissociation setup coupled to a Fourier-transform ion cyclotron resonance mass spectrometer. Photoproduct yields for protonated 3-iodo-l-tyrosine were up to ∼75%. Dose and fluence dependent measurements for protonated 3-iodo-l-tyrosine, doubly charged protonated bradykinin and Fe(II) attached to 1,2-dioleoyl-sn-glycero-3-phosphocholine reveal that the ultraviolet photodissociation mechanism for photoproduct formation qualitatively differs between these model systems. Three derived photodissociation models were used to interpret the experimental results and show that while protonated 3-iodo-l-tyrosine and Fe(II) attached to 1,2-dioleoyl-sn-glycero-3-phosphocholine most likely dissociates via a single-photon process, fragmentation of doubly charged bradykinin ions was found to be most consistent with sequential two-photon dissociation (213 nm). The introduced dissociation models present an easy means to study the mechanism of ultraviolet photodissociation processes for a variety of analytes without prior knowledge of their photochemistry or to optimize experimental conditions by adjusting laser fluence or number of laser pulses.
Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"
Energy Technology Data Exchange (ETDEWEB)
Wilbur, Daniel Scott
2012-12-12
Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.
Production of Astatine-211 at the Duke University Medical Center for its regional distribution
Energy Technology Data Exchange (ETDEWEB)
Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)
2016-01-01
Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.
Directory of Open Access Journals (Sweden)
Indriani R
2015-03-01
Full Text Available Highly Pathogenic Avian Influenza (HPAI subtype H5N1 clade 2.3.2 has infected chickens in farms, causing mortality and a decrease in egg production. Vaccination is one of the strategies to control disease of AI subtype H5N1. AI H5N1 clade 2.1.3 vaccine is available commercially. The effectiveness of two vaccines of AI H5N1 clade 2.1.3 (product A and B, and AI H5N1 clade 2.3.2 (Sukoharjo against AI H5N1 clade 2.3.2 (Sukoharjo virus SPF chickens was tested in laboratory. Four groups of SPF chickens were used in this study, there were (1 vaccinated with H5N1 clade 2.1.3 (product A, (2 vaccinated with H5N1 clade 2.1.3 (product B, (3 vaccinated with AI H5N1 clade 2.3.2 and (4 unvaccinated (as a control. Each vaccinated group consisted of 10 chicken except 8 chicken for control group. SPF chicken were vaccinated with 1 dose of vaccine at 3 weeks olds, and then after 3 weeks post vaccination (at 6 weeks olds. All group of chicken were challenged with 106 EID50 per 0.1 ml via intranasal. The results showed, chicken vaccinated with H5N1 clade 2.1.3 product A and B gave 100 and 80% protection respectively, but showed challenged virus shedding, whereas vaccine of H5N1 clade 2.3.2 gave 100% protection from mortality and without virus shedding. Vaccines of AI H5N1 clade 2.1.3 product A was better than vaccine product B, and when chicken vaccinated against H5N1 clade 2.3.2, H5N1 clade 2.3.2 vaccine was the best to be used. In order to protect chicken from AI subtype H5N1 clade 2.1.3 and 2.3.2 in the field, a bivalent vaccine of H5N1 clade 2.1.3 and 2.3.2 subtypes should be developed.
Directory of Open Access Journals (Sweden)
Nolwenn eFichou
2015-11-01
Full Text Available Objectives: Radioimmunotherapy (RIT has emerged as a potential treatment option for multiple myeloma (MM. In humans, a dosimetry study recently showed the relevance of RIT using an antibody targeting the CD138 antigen. The therapeutic efficacy of RIT using an anti-CD138 antibody coupled to 213Bi, an α-emitter, was also demonstrated in a preclinical MM model. Since then, RIT with β-emitters has shown efficacy in treating hematologic cancer. In this paper, we investigate the therapeutic efficacy of RIT in the 5T33 murine MM model using a new anti-CD138 monoclonal antibody labeled either with 213Bi for α-RIT or 177Lu for β-RIT.Methods: A new monoclonal anti-CD138 antibody, 9E7.4, was generated by immunizing a rat with a murine CD138-derived peptide. Antibody specificity was validated by flow cytometry, biodistribution and α-RIT studies. Then, a β-RIT dose-escalation assay with the 177Lu-radiolabeled 9E7.4 mAb was performed in KalwRij C57/BL6 mice 10 days after i.v. engraftment with 5T33 MM cells. Animal survival and toxicological parameters were assessed to define the optimal activity.Results: α-RIT performed with 3.7 MBq of 213Bi-labeled 9E7.4 anti-CD138 mAb increased median survival to 80 days compared to 37 days for the untreated control and effected cure in 45% of animals. β-RIT performed with 18.5 MBq of 177Lu-labeled 9E7.4 mAb was well tolerated and significantly increased mouse survival (54 versus 37 days in the control group; however, no mice were cured with this treatment.Conclusion: This study revealed the advantages of α-RIT in the treatment of MM in a preclinical model where β-RIT shows almost no efficacy.
Chloridobis[2-(1,3-thiazol-4-yl-κN-1H-benzimidazole-κN3]cobalt(II chloride dihydrate
Directory of Open Access Journals (Sweden)
Zhan-Wang Shi
2012-08-01
Full Text Available In the title compound, [CoCl(C10H7N3S2]Cl·2H2O, the CoII atom is five-coordinated by four N atoms from two chelating 2-(1,3-thiazol-4-yl-1H-benzimidazole ligands and one Cl atom in a distorted trigonal–bipyramidal geometry. In the crystal, N—H...O and O—H...Cl hydrogen bonds and π–π interactions between the thiazole, imidazole and benzene rings [centroid-to-centroid distances 3.546 (2, 3.683 (2 and 3.714 (2 Å] link the complex cations, chloride anions and uncoordinating water molecules into a three-dimensional network.
Schmidt, D
2001-01-01
Neutron detection efficiencies of NE213 scintillation detectors were determined by comparison of the measured neutron time-of-flight spectrum of a sup 2 sup 5 sup 2 Cf source deposited in a parallel-plate, low-mass ionization chamber with its reference neutron energy distribution. Measurement conditions and parameters were systematically varied to study their influence on the efficiencies obtained. The efficiencies derived from the measurement were compared with well-established efficiencies of the detectors used. These efficiencies were calculated with a Monte Carlo code and corrected after comparison with a proton recoil telescope in neutron fluence measurements. Details of the measurement and the data analysis including the corrections needed are discussed.
Directory of Open Access Journals (Sweden)
George D. Kymionis
2010-01-01
Full Text Available Purpose. To present a case of a keratoconic patient who underwent epithelial removal with transepithelial phototherapeutic keratectomy (t-PTK using a 213-nm solid-state laser system followed by corneal collagen cross-linking (CXL with riboflavin and ultraviolet-A (UVA irradiation. Methods. Case report. Results. A twenty-four-year-old male with keratoconus underwent CXL treatment after epithelial removal with t-PTK using a solid-state laser system. No intra- or early postoperative complications were found. One month postoperatively, uncorrected visual acuity (UCVA improved from 20/63 to 20/32 while best spectacle- corrected visual acuity (BSCVA improved from 20/40 to 20/25. Corneal topography revealed a significant improvement which remained stable during the six-month followup period. Conclusions. Epithelial removal with t-PTK before CXL could improve patient's visual outcome.
Zhang, Li-Yao; Tang, Xing-Chun; Sun, Meng-Xiang
2005-06-25
Capillary zone electrophoresis (CZE) with fluorescence detection was applied to the simultaneous determination of histamine and polyamines including spermine, spermidine, diaminopropane, putrescine, cadaverine, diaminohexane with 4-fluor-7-nitro-2,1,3-benzoxadiazole (NBD-F) as the fluorescent derivatization reagent. The seven NBD-F labeled amines was separated within 200 s using 85 mM phosphate running buffer at pH 3.0. The concentration limits of these amines ranged from 5.1 x 10(-8) M for spermine to 2.1 x 10(-8) M for histamine. The relative standard deviations for migration time and peak height were less than 1.5% and 6.0%, respectively. The method was successfully applied to the analysis of biogenic amines in the lysate of tobacco mesophyll protoplasts, and spermidine and putrescine were detected in the lysate with satisfying recovery.
Energy Technology Data Exchange (ETDEWEB)
Scherzinger, J. [Division of Nuclear Physics, Lund University, SE-221 00 Lund (Sweden); Detector Group, European Spallation Source ERIC, SE-221 00 Lund (Sweden); Al Jebali, R.; Annand, J.R.M. [SUPA School of Physics and Astronomy, University of Glasgow, Glasgow G12 8QQ, Scotland (United Kingdom); Fissum, K.G., E-mail: kevin.fissum@nuclear.lu.se [Division of Nuclear Physics, Lund University, SE-221 00 Lund (Sweden); Detector Group, European Spallation Source ERIC, SE-221 00 Lund (Sweden); Hall-Wilton, R. [Detector Group, European Spallation Source ERIC, SE-221 00 Lund (Sweden); Mid-Sweden University, SE-851 70 Sundsvall (Sweden); Kanaki, K. [Detector Group, European Spallation Source ERIC, SE-221 00 Lund (Sweden); Lundin, M. [MAX IV Laboratory, Lund University, SE-221 00 Lund (Sweden); Nilsson, B. [Detector Group, European Spallation Source ERIC, SE-221 00 Lund (Sweden); MAX IV Laboratory, Lund University, SE-221 00 Lund (Sweden); Perrey, H. [Division of Nuclear Physics, Lund University, SE-221 00 Lund (Sweden); Detector Group, European Spallation Source ERIC, SE-221 00 Lund (Sweden); Rosborg, A. [MAX IV Laboratory, Lund University, SE-221 00 Lund (Sweden); Svensson, H. [MAX IV Laboratory, Lund University, SE-221 00 Lund (Sweden); Sweflo Engineering, SE-275 63 Blentarp (Sweden)
2016-12-21
The response of a NE-213 liquid-scintillator detector has been measured using tagged neutrons from 2 to 6 MeV originating from an Am/Be neutron source. The neutron energies were determined using the time-of-flight technique. Pulse-shape discrimination was employed to discern between gamma-rays and neutrons. The behavior of both the fast (35 ns) and the combined fast and slow (475 ns) components of the neutron scintillation-light pulses were studied. Three different prescriptions were used to relate the neutron maximum energy-transfer edges to the corresponding recoil-proton scintillation-light yields, and the results were compared to simulations. The overall normalizations of parametrizations which predict the fast or total light yield of the scintillation pulses were also tested. Our results agree with both existing data and existing parametrizations. We observe a clear sensitivity to the portion and length of the neutron scintillation-light pulse considered.
Energy Technology Data Exchange (ETDEWEB)
Ono, Yoshiaki; Shimasaku, Kazuhiro; Nakajima, Kimihiko, E-mail: ono@astron.s.u-tokyo.ac.jp [Department of Astronomy, Graduate School of Science, University of Tokyo, Tokyo 113-0033 (Japan); Ouchi, Masami [Institute for Cosmic Ray Research, University of Tokyo, Kashiwa 277-8582 (Japan); Mobasher, Bahram; Nayyeri, Hooshang [Department of Physics and Astronomy, University of California, Riverside, CA 92521 (United States); Dickinson, Mark; Kartaltepe, Jeyhan S. [National Optical Astronomical Observatories, Tucson, AZ 85719 (United States); Penner, Kyle [Department of Astronomy, University of Arizona, Tucson, AZ 85721 (United States); Weiner, Benjamin J. [Steward Observatory, University of Arizona, Tucson, AZ 85721 (United States); Stern, Daniel [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Kashikawa, Nobunari [Optical and Infrared Astronomy Division, National Astronomical Observatory of Japan, Tokyo 181-8588 (Japan); Spinrad, Hyron [Department of Astronomy, University of California, Berkeley, CA 94720 (United States)
2012-01-10
We present the results of our ultra-deep Keck/DEIMOS spectroscopy of z-dropout galaxies in the Subaru Deep Field and Great Observatories Origins Deep Survey's northern field. For 3 out of 11 objects, we detect an emission line at {approx}1 {mu}m with a signal-to-noise ratio of {approx}10. The lines show asymmetric profiles with high weighted skewness values, consistent with being Ly{alpha}, yielding redshifts of z = 7.213, 6.965, and 6.844. Specifically, we confirm the z = 7.213 object in two independent DEIMOS runs with different spectroscopic configurations. The z = 6.965 object is a known Ly{alpha} emitter, IOK-1, for which our improved spectrum at a higher resolution yields a robust skewness measurement. The three z-dropouts have Ly{alpha} fluxes of 3 Multiplication-Sign 10{sup -17} erg s{sup -1} cm{sup -2} and rest-frame equivalent widths EW{sup Ly{alpha}}{sub 0} = 33-43 A. Based on the largest spectroscopic sample of 43 z-dropouts, which is the combination of our and previous data, we find that the fraction of Ly{alpha}-emitting galaxies (EW{sup Ly{alpha}}{sub 0} > 25 A) is low at z {approx} 7; 17% {+-} 10% and 24% {+-} 12% for bright (M{sub UV} {approx_equal} -21) and faint (M{sub UV} {approx_equal} -19.5) galaxies, respectively. The fractions of Ly{alpha}-emitting galaxies drop from z {approx} 6 to 7 and the amplitude of the drop is larger for faint galaxies than for bright galaxies. These two pieces of evidence would indicate that the neutral hydrogen fraction of the intergalactic medium increases from z {approx} 6 to 7 and that the reionization proceeds from high- to low-density environments, as suggested by an inside-out reionization model.
Matsuda, Yoshiko; Mineharu, Yohei; Kimura, Mitsuru; Takagi, Yasushi; Kobayashi, Hatasu; Hitomi, Toshiaki; Harada, Kouji H; Uchihashi, Yoshito; Funaki, Takeshi; Miyamoto, Susumu; Koizumi, Akio
2017-08-01
This study aimed to determine the effectiveness of genetic testing for the p.R4810K variant (rs112735431) of the Mysterin/RNF213 gene, which is associated with moyamoya disease and other intracranial vascular diseases, in the family members of patients with moyamoya disease. We performed genotyping of the RNF213 p.R4810K polymorphism and magnetic resonance angiography on 59 relatives of 18 index patients with moyamoya disease. Nineteen individuals had follow-up magnetic resonance angiography with a mean follow-up period of 7.2 years. Six of the 34 individuals with the GA genotype (heterozygotes for p.R4810K) showed intracranial steno-occlusive lesions in the magnetic resonance angiography, whereas none of the 25 individuals with the GG genotype (wild type) showed any abnormalities. Follow-up magnetic resonance angiography revealed de novo lesions in 2 and disease progression in 1 of the 11 individuals with the GA genotype, despite none of the 8 individuals with the GG genotype showing any changes. Accordingly, 8 individuals had steno-occlusive lesions at the last follow-up, and all had the p.R4810K risk variant. The prevalence of steno-occlusive intracranial arterial diseases in family members with the p.R4810K variant was 23.5% (95% confidence interval: 9.27%-37.78%), which was significantly higher than in those without the variant (0%, P = .0160). Genotyping of the p.R4810K missense variant is useful for identifying individuals with an elevated risk for steno-occlusive intracranial arterial diseases in the family members of patients with moyamoya disease. Copyright © 2017 National Stroke Association. Published by Elsevier Inc. All rights reserved.
DEFF Research Database (Denmark)
Brekke, Eva Marie; Walls, Anne Byriel; Schousboe, Arne
2012-01-01
is known about the PPP in neurons. The activity of the PPP was quantified in cultured cerebral cortical and cerebellar neurons after incubation in the presence of [2-(13)C]glucose or [3-(13)C]glucose. The activity of the PPP was several fold lower than glycolysis in both types of neurons. While metabolism...
Directory of Open Access Journals (Sweden)
Moneeb A. K. Othman
2014-01-01
Full Text Available Acute leukemia often presents with pure chromosomal resolution; thus, aberrations may not be detected by banding cytogenetics. Here, a case of 26-year-old male diagnosed with T-cell acute lymphoblastic leukemia (T-ALL and a normal karyotype after standard GTG-banding was studied retrospectively in detail by molecular cytogenetic and molecular approaches. Besides fluorescence in situ hybridization (FISH, multiplex ligation-dependent probe amplification (MLPA and high resolution array-comparative genomic hybridization (aCGH were applied. Thus, cryptic chromosomal aberrations not observed before were detected: three chromosomes were involved in a cytogenetically balanced occurring translocation t(2;9;18(p23.2;p21.3;q21.33. Besides a translocation t(10;14(q24;q11 was identified, an aberration known to be common in T-ALL. Due to the three-way translocation deletion of tumor suppressor genes CDKN2A/INK4A/p16, CDKN2B/INK4B/p15, and MTAP/ARF/p14 in 9p21.3 took place. Additionally RB1 in 13q14 was deleted. This patient, considered to have a normal karyotype after low resolution banding cytogenetics, was treated according to general protocol of anticancer therapy (ALL-BFM 95.
Yu, Jianwei; Ornelas, Joshua Loroña; Tang, Yumin; Uddin, Mohammad Afsar; Guo, Han; Yu, Simiao; Wang, Yulun; Woo, Han Young; Zhang, Shiming; Xing, Guichuan; Guo, Xugang; Huang, Wei
2017-12-06
A series of polymer semiconductors incorporating 2,1,3-benzothiadiazole-5,6-dicarboxylicimide (BTZI) as strong electron-withdrawing unit and an alkoxy-functionalized head-to-head linkage containing bithiophene or bithiazole as highly electron-rich co-unit are designed and synthesized. Because of the strong intramolecular charge transfer characteristics, all three polymers BTZI-TRTOR (P1), BTZI-BTOR (P2), and BTZI-BTzOR (P3) exhibit narrow bandgaps of 1.13, 1.05, and 0.92 eV, respectively, resulting in a very broad absorption ranging from 350 to 1400 nm. The highly electron-deficient 2,1,3-benzothiadiazole-5,6-dicarboxylicimide and alkoxy-functionalized bithiophene (or thiazole) lead to polymers with low-lying lowest unoccupied molecular orbitals (-3.96 to -4.28 eV) and high-lying highest occupied molecular orbitals (-5.01 to -5.20 eV). Hence, P1 and P3 show substantial and balanced ambipolar transport with electron mobilities/hole mobilities of up to 0.86/0.51 and 0.95/0.50 cm2 V-1 s-1, respectively, and polymer P2 containing the strongest donor unit exhibited unipolar p-type performance with an average hole mobility of 0.40 cm2 V-1 s-1 in top-gate/bottom-contact thin-film transistors with gold as the source and drain electrodes. When incorporated into bulk heterojunction polymer solar cells, the narrow bandgap (1.13 eV) polymer P1 shows an encouraging power conversion efficiency of 4.15% with a relatively large open-circuit voltage of 0.69 V, which corresponds to a remarkably small energy loss of 0.44 eV. The power conversion efficiency of P1 is among the highest reported to date with such a small energy loss in polymer:fullerene solar cells.
Directory of Open Access Journals (Sweden)
Xiao-Chun Wang
2017-10-01
Full Text Available Objectives: Objectives: Cigarette smoking is the major risk factor of bladder cancer via exposure to chemical carcinogens. Nicotinamide adenine dinucleotide phosphate (NADP+: quinine oxidoreductase 1 (NQO1 and sulfotransferase 1A1 (SULT1A1 have been reported to involve in the metabolism of polycyclic aromatic hydrocarbons (PAHs and aromatic amines. Therefore, the risk of bladder cancer (BC may be influenced by polymorphisms in the genes that modulate metabolic detoxification in particular by interacting with cigarette smoking. Considering the limited power by the individual studies with a relatively small sample size, especially when analyzing the combined effect of polymorphisms in NQO1 and SULT1A1 genes and smoking, these 2 meta-analyses have aimed to clarify the combined effects of them on BC risk by integrating related studies. Material and Methods: Two meta-analyses included 1341 cases and 1346 controls concerning NQO1 Pro187Ser and smoking, and 1921 cases and 1882 controls on SULT1A1 Arg213His and smoking were performed. Odds ratios (OR and 95% confidence intervals (CI were used for assessing the strength of the association. Results: The result has demonstrated that smokers with NQO1 Pro/Ser or Ser/Ser genotypes have a prominent association with the risk of BC as compared with non-smokers with NQO1 Pro/Pro genotype, with OR equal to 3.71 (95% CI: 2.87–4.78, pheterogeneity = 0.376. Besides, smokers carrying SULT1A1 Arg/Arg genotypes were observed to confer 2.38 fold increased risk of BC (95% CI: 1.44–3.93, pheterogeneity = 0.001 when compared with non-smokers with SULT1A1 Arg/Arg or His/His genotypes. Conclusions: These findings have suggested that the NQO1 Pro187Ser or SULT1A1 Arg213His polymorphism combination with smoking significantly confer susceptibility to BC. Int J Occup Med Environ Health 2017;30(5:791–802
First High Resolution IR Study of the νb{14} (a') A-Type Band Near 421.847 \\wn of 2-^{13}C-PROPENE
Daunt, S. J.; Grzywacz, Robert; Billinghurst, Brant E.
2017-06-01
This is is the first high resolution IR study of any band of the 2-^{13}C-propene species. There have been only two previous high resolution studies of vibration-rotation bands of the normal species. The band examined here is the νb{14} (A') CCC skeletal bending near 421.847 \\wn which has an A-Type asymmetric rotor structure. The spectra were recorded on the FTS at the Far-IR beamline of the Canadian Light Source with a resolution of Δν = 0.0009 \\wn. We have assigned and fitted around 2200 transitions and determined ground and upper state rotational constants. Lines with J up to 49 and K up to 12 were included. The subbands with K greater than 12 were perturbed and show torsional splittings that vary from small to extremely large. The fitting was done with the PGOPHER program of Colin Western. The GS constants are in good agreement with the MW constants reported recently by Craig, Groner and co-workers. Ainetschian, Fraser, Ortigoso & Pate, J. Chem. Phys. 100, 729 ff. (1994); Lafferty, Flaud & Herman, J. Mol. Struct. 780-781, 65 ff. (2006). Western, J. Quant. Spectrosc. Rad. Transf. 186, 221 ff. (2017). Paper M109, 71st ISMS Symposium (2016); J. Mol. Spectrosc. 328, 1-6 (2016).
Ptushenko, Vasily V; Cherepanov, Dmitry A; Krishtalik, Lev I
2015-12-01
Continuum electrostatic calculation of the transfer energies of anions from water into aprotic solvents gives the figures erroneous by order of magnitude. This is due to the hydrogen bond disruption that suggests the necessity to reconsider the traditional approach of the purely electrostatic calculation of the transfer energy from water into protein. In this paper, the method combining the experimental estimates of the transfer energies from water into aprotic solvent and the electrostatic calculation of the transfer energies from aprotic solvent into protein is proposed. Hydrogen bonds between aprotic solvent and solute are taken into account by introducing an imaginary aprotic medium incapable to form hydrogen bonds with the solute. Besides, a new treatment of the heterogeneous intraprotein dielectric permittivity based on the microscopic protein structure and electrometric measurements is elaborated. The method accounts semi-quantitatively for the electrostatic effect of diverse charged amino acid substitutions in the donor and acceptor parts of the photosynthetic bacterial reaction center from Rhodobacter sphaeroides. Analysis of the volatile secondary acceptor site QB revealed that in the conformation with a minimal distance between quinone QB and Glu L 212 the proton uptake upon the reduction of QB is prompted by Glu L 212 in alkaline and by Asp L 213 in slightly acidic regions. This agrees with the pH dependences of protonation degrees and the proton uptake. The method of pK calculation was applied successfully also for dissociation of Asp 26 in bacterial thioredoxin. Copyright © 2015 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Wilbur, D. Scott
2011-12-23
This grant was a one-year extension of another grant with the same title (DE-FG03-98ER62572). The objective of the studies was to continue in vivo evaluation of reagents to determine which changes in structure were most favorable for in vivo use. The focus of our studies was development and optimization of reagents for pretargeting alpha-emitting radionuclides At-211 or Bi-213 to cancer cells. Testing of the reagents was conducted in vitro and in animal model systems. During the funding period, all three specific aims set out in the proposed studies were worked on, and some additional studies directed at development of a method for direct labeling of proteins with At-211 were investigated. We evaluated reagents in two different approaches in 'two step' pretargeting protocols. These approaches are: (1) delivery of the radionuclide on recombinant streptavidin to bind with pretargeted biotinylated monoclonal antibody (mAb), and alternatively, (2) delivery of the radionuclide on a biotin derivative to bind with pretargeted antibody-streptavidin conjugates. The two approaches were investigated as it was unclear which will be superior for the short half-lived alpha-emitting radionuclides.
Energy Technology Data Exchange (ETDEWEB)
Perneczky, L. [KFKI Atomic Energy Research Inst., Budabest (Hungary)
1997-12-31
Nuclear power plants of WWER-440/213-type have several special features. Consequently, the transient behaviour of such a reactor system should be different from the behaviour of the PWRs of western design. The opening of the steam generator (SG) collector cover, as a specific primary to secondary circuit leakage (PRISE) occurring in WWER-type reactors happened first time in Rovno NPP Unit I on January 22, 1982. Similar accident was studied in the framework of IAEA project RER/9/004 in 1987-88 using the RELAP4/mod6 code. The Hungarian AGNES (Advanced General and New Evaluation of Safety) project was performed in the period 1991-94 with the aim to reassess the safety of the Paks NPP using state-of-the-art techniques. The project comprised three type of analyses for the primary to secondary circuit leakages: Design Basis Accident (DBA) analyses, Pressurized Thermal Shock (PTS) study and deterministic analyses for Probabilistic Safety Analysis (PSA). Major part of the thermohydraulic analyses has been performed by the RELAP5/mod2.5/V251 code version with two input models. 32 refs.
Xiao, Guo-Yong; Lei, Peng; Chi, Hai-Jun; Hu, Zhi-Zhi; Li, Xiao
2009-03-25
In the title compound, [Ir(C(15)H(9)FNS)(2)(C(5)H(7)O(2))], the Ir atom is hexa-coordinated by three chelating ligands, with two cyclo-metalated 2-(1,3-benzothia-zol-2-yl)-1-(4-fluoro-phen-yl)ethenyl ligands showing N,C-bidentate coordination and an O,O'-bidenate pentane-2,4-dionate anion, thereby forming a distorted octa-hedral enviroment.
Directory of Open Access Journals (Sweden)
Masaki Ohata
2017-01-01
Full Text Available The laser-induced breakdown spectroscopy (LIBS with a frequency quintupled 213 nm Nd:YAG laser was examined to the analysis of trace level of carbon (C in high-purity metals and its detection and analytical capabilities were evaluated. Though C signal in a wavelength of 247.9 nm, which showed the highest sensitivity of C, could be obtained from Cd, Ti, and Zn ca. 7000 mg kg−1 C in Fe could not be detected due to the interferences from a lot of Fe spectra. Alternative C signal in a wavelength of 193.1 nm could not be also detected from Fe due to the insufficient laser output energy of the frequency quintupled 213 nm Nd:YAG laser. The depth analysis of C by LIBS was also demonstrated and the C in Cd and Zn was found to be contaminated in only surface area whereas the C in Ti was distributed in bulk. From these results, the frequency quintupled 213 nm Nd:YAG laser, which was adopted widely as a commercial laser ablation (LA system coupled with inductively coupled plasma mass spectrometry (ICPMS for trace element analysis in solid materials, could be used for C analysis to achieve simultaneous measurements for both C and trace elements in metals by LIBS and LA-ICPMS, respectively.
Directory of Open Access Journals (Sweden)
Qiande Hu
Full Text Available Alveolar rhabdomyosarcoma (ARMS is an aggressive pediatric cancer of skeletal muscle. More than 70% of ARMS tumors carry balanced t(2;13 chromosomal translocation that leads to the production of two novel fusion genes, PAX3-FKHR and FKHR-PAX3. While the PAX3-FKHR gene has been intensely studied, the reciprocal FKHR-PAX3 gene has rarely been described. We report here the cloning and functional characterization of the FKHR-PAX3 gene as the first step towards a better understanding of its potential impact on ARMS biology. From RH30 ARMS cells, we detected and isolated three versions of FKHR-PAX3 cDNAs whose C-terminal sequences corresponded to PAX3c, PAX3d, and PAX3e isoforms. Unlike the nuclear-specific localization of PAX3-FKHR, the reciprocal FKHR-PAX3 proteins stayed predominantly in the cytoplasm. FKHR-PAX3 potently inhibited myogenesis in both non-transformed myoblast cells and ARMS cells. We showed that FKHR-PAX3 was not a classic oncogene but could act as a facilitator in oncogenic pathways by stabilizing PAX3-FKHR expression, enhancing cell proliferation, clonogenicity, anchorage-independent growth, and matrix adhesion in vitro, and accelerating the onset of tumor formation in xenograft mouse model in vivo. In addition to these pro-oncogenic behaviors, FKHR-PAX3 also negatively affected cell migration and invasion in vitro and lung metastasis in vivo. Taken together, these functional characteristics suggested that FKHR-PAX3 might have a critical role in the early stage of ARMS development.
Directory of Open Access Journals (Sweden)
Shengping Li
Full Text Available Genome-wide association studies (GWAS have recently identified KIF1B as susceptibility locus for hepatitis B virus (HBV-related hepatocellular carcinoma (HCC. To further identify novel susceptibility loci associated with HBV-related HCC and replicate the previously reported association, we performed a large three-stage GWAS in the Han Chinese population. 523,663 autosomal SNPs in 1,538 HBV-positive HCC patients and 1,465 chronic HBV carriers were genotyped for the discovery stage. Top candidate SNPs were genotyped in the initial validation samples of 2,112 HBV-positive HCC cases and 2,208 HBV carriers and then in the second validation samples of 1,021 cases and 1,491 HBV carriers. We discovered two novel associations at rs9272105 (HLA-DQA1/DRB1 on 6p21.32 (OR = 1.30, P = 1.13×10⁻¹⁹ and rs455804 (GRIK1 on 21q21.3 (OR = 0.84, P = 1.86×10⁻⁸, which were further replicated in the fourth independent sample of 1,298 cases and 1,026 controls (rs9272105: OR = 1.25, P = 1.71×10⁻⁴; rs455804: OR = 0.84, P = 6.92×10⁻³. We also revealed the associations of HLA-DRB1*0405 and 0901*0602, which could partially account for the association at rs9272105. The association at rs455804 implicates GRIK1 as a novel susceptibility gene for HBV-related HCC, suggesting the involvement of glutamate signaling in the development of HBV-related HCC.
Mansour, Nahla M; Heine, Holger; Abdou, Sania M; Shenana, Mohamed E; Zakaria, Mohamed K; El-Diwany, Ahmed
2014-10-01
Probiotics, defined as living bacteria that are beneficial for human health, mainly function through their immunomodulatory abilities. Hence, these microorganisms have proven successful for treating diseases resulting from immune deregulation. The aim of this study was to find novel candidates to improve on and complement current probiotic treatment strategies. Of 60 lactic acid bacterial strains that were isolated from fecal samples of healthy, full-term, breast-fed infants, three were chosen because of their ability to activate human immune cells. These candidates were then tested with regard to immunomodulatory properties, antimicrobial effects on pathogens, required pharmacological properties and their safety profiles. To identify the immunomodulatory structures of the selected isolates, activation of specific innate immune receptors was studied. The three candidates for probiotic treatment were assigned Enterococcus faecium NM113, Enterococcus faecium NM213 and Lactobacillus casei NM512. Compared with the established allergy-protective strain Lactococcus lactis G121, these isolates induced release of similar amounts of IL-12, a potent inducer of T helper 1 cells. In addition, all three neonatal isolates had antimicrobial activity against pathogens. Analysis of pharmacological suitability showed high tolerance of low pH, bile salts and pancreatic enzymes. In terms of safe application in humans, the isolates were sensitive to three antibiotics (chloramphenicol, tetracycline and erythromycin). In addition, the Enterococcus isolates were free from the four major virulence genes (cylA, agg, efaAfs and ccf). Moreover, the isolates strongly activated Toll-like receptor 2, which suggests lipopeptides as their active immunomodulatory structure. Thus, three novel bacterial strains with great potential as probiotic candidates and promising immunomodulatory properties have here been identified and characterized. © 2014 The Societies and Wiley Publishing Asia Pty Ltd.
Energy Technology Data Exchange (ETDEWEB)
Chen, Mingyang; Dixon, David A.
2013-07-09
The initial structures for the search for the global minimum of TiO₂ nanoclusters were generated by combining a tree growth (TG) algorithm with a hybrid genetic algorithm (HGA). In the TG algorithm, the clusters grow from a small seed to the size of interest stepwise. New atoms are added to the smaller cluster from the previous step, by analogy to new leaves grown by a tree. The addition of the new atoms is controlled by predefined geometry parameters to reduce the computational cost and to provide physically meaningful structures. In each step, the energies for the various generated structures are evaluated, and those with the lowest energies are carried into the next step. The structures that match the formulas of interest are collected as HGA candidates during the various steps. Low energy candidates are fed to the HGA component to search for the global minimum for each formula of interest. The lowest energy structures from the HGA are then optimized by using density functional theory to study the dissociation energies of the clusters and the evolution in the structure as the size of the cluster increases. The optimized geometries of the (TiO₂)n nanoclusters for n = 2-13, do not show the character of a TiO₂ bulk crystal with a hexacoordinate Ti. The average clustering energy (ΔEn) converges slowly to the bulk value for rutile. The TiO₂ dissociation energies for (TiO₂)n clusters approach the bulk value for rutile more quickly but show larger variations. The (TiO₂)12 cluster appears to be quite stable, and the (TiO₂)13 cluster is quite unstable on a relative scale.
Miller, Joe; Yu, Xiao-Bo; Yu, Paula K; Cringle, Stephen J; Yu, Dao-Yi
2011-02-20
Ultraviolet (UV) lasers have the capability to precisely remove tissue via ablation; however, due to strong absorption of the applicable portion the UV spectrum, their surgical use is currently limited to extraocular applications at the air/tissue boundary. Here we report the development and characterization of a fiber-optic laser delivery system capable of outputting high-fluence UV laser pulses to internal tissue surfaces. The system has been developed with a view to intraocular surgical applications and has been demonstrated to ablate ocular tissue at the fluid/tissue boundary. The fifth (213 nm) and fourth(266 nm) harmonics of a Nd:YAG laser were launched into optical fibers using a hollow glass taper to concentrate the beam. Standard and modified silica/silica optical fibers were used, all commercially available. The available energy and fluence as a function of optical fiber length was evaluated and maximized. The maximum fluence available to ablate tissue was affected by the wavelength dependence of the fiber transmission; this maximum fluence was greater for 266 nm pulses (8.4 J/cm2) than for 213 nm pulses (1.4 J/cm2). The type of silica/silica optical fiber used did not affect the transmission efficiency of 266 nm pulses, but transmission of 213 nm pulses was significantly greater through modified silica/silica optical fiber. The optical fiber transmission efficiency of 213 nm pulses decreased as a function of number of pulses transmitted, whereas the transmission efficiency of 266 nm radiation was unchanged. Single pulses have been used to ablate fresh porcine ocular tissue. In summary, we report a method for delivering the fifth (213 nm) and fourth (266 nm) harmonics of a Nd:YAG laser to the surface of immersed tissue, the reliability and stability of the system has been characterized, and proof of concept via tissue ablation of porcine ocular tissue demonstrates the potential for the intraocular surgical application of this
African Journals Online (AJOL)
Prof. Adipala Ekwamu
(Spiegel et al., 1993). Thus, research and development efforts to test and clean up propagule-borne viruses from germplasm resources have concentrated on these groups ... The symptoms included stunting, yellowing, mottling, leaf distortion and deformation. The number of sweetpotato genotypes evaluated, the presence.
Energy Technology Data Exchange (ETDEWEB)
Hola, Marketa, E-mail: mhola@sci.muni.c [Department of Chemistry, Faculty of Science, Masaryk University, Kotlarska 2, 611 37 Brno (Czech Republic); Konecna, Veronika [Department of Chemistry, Faculty of Science, Masaryk University, Kotlarska 2, 611 37 Brno (Czech Republic); Mikuska, Pavel [Institute of Analytical Chemistry, Academy of Sciences of the Czech Republic v.v.i., Veveri 97, 602 00 Brno (Czech Republic); Kaiser, Jozef [Institute of Physical Engineering, Faculty of Mechanical Engineering, Brno University of Technology, Technicka 2896/2, 616 69 Brno (Czech Republic); Kanicky, Viktor [Department of Chemistry, Faculty of Science, Masaryk University, Kotlarska 2, 611 37 Brno (Czech Republic)
2010-01-15
The influence of sample properties and composition on the size and concentration of aerosol particles generated by nanosecond Nd:YAG laser ablation at 213 nm was investigated for three sets of different materials, each containing five specimens with a similar matrix (Co-cemented carbides with a variable content of W and Co, steel samples with minor differences in elemental content and silica glasses with various colors). The concentration of ablated particles (particle number concentration, PNC) was measured in two size ranges (10-250 nm and 0.25-17 mum) using an optical aerosol spectrometer. The shapes and volumes of the ablation craters were obtained by Scanning Electron Microscopy (SEM) and by an optical profilometer, respectively. Additionally, the structure of the laser-generated particles was studied after their collection on a filter using SEM. The results of particle concentration measurements showed a significant dominance of particles smaller than 250 nm in comparison with larger particles, irrespective of the kind of material. Even if the number of particles larger than 0.25 mum is negligible (up to 0.1%), the volume of large particles that left the ablation cell can reach 50% of the whole particle volume depending on the material. Study of the ablation craters and the laser-generated particles showed a various number of particles produced by different ablation mechanisms (particle splashing or condensation), but the similar character of released particles for all materials was observed by SEM after particle collection on the membrane filter. The created aerosol always consisted of two main structures - spherical particles with diameters from tenths to units of micrometers originally ejected from the molten surface layer and mum-sized 'fibres' composed of primary agglomerates with diameters in the range between tens and hundreds of nanometers. The shape and structure of ablation craters were in good agreement with particle concentration
Directory of Open Access Journals (Sweden)
P. A. Shesternya
2013-01-01
Full Text Available Aim. To investigate association between 9p21.3 locus single nucleotide polymorphisms (SNPs and coronary atherosclerosis severity and long-term outcomes after percutaneous coronary intervention (PCI in patients with myocardial infarction (MI.Material and methods. A total of 255 Caucasian patients (211 male, 44 female; aged up to 65 years, on the average 52.56±7.98 years with MI were recruited into the study from 01.01.2009 to 30.06.2010. All participants were included into the study after written informed consent. Genome DNA was extracted from leukocytes of venous blood by the phenol-chloroform extraction method. Two SNPs rs10757278 and rs1333049 (locus 9p21.3 were tested by real-time polymerase chain reaction (PCR according to protocol (probes TaqMan, Applied Biosystems, 7900HT. The coronary angiograms were reviewed by independent angiographers who were blinded to the results of the genotyp- ing (Philips Allura Xper FD10. The total number of lesions, Gensini score and SYNTAX score were derived. Follow-up lasted two years.Results. Locus 9р21.3 genotypes CC rs1333049 and GG rs10757278 demonstrated a direct strong association with severity of coronary atheromatous burden (left main coro- nary artery stenosis, total number of lesions, Gensini score. There are not influence of locus 9p21.3 on mortality, recurrent MI, hospitalization due to unstable angina, repeated PCI, stroke during follow-up period (6, 12, 24 months. Frequency of the genotype СС rs1333049 among patients with recurrent MI was 20% (without recurrent MI — 27.4%; р=0.54; with hospitalization due to unstable angina — 27.5% (without hospitalization — 26.4%; р=0.82; with repeated PCI — 24.0% (without repeated PCI — 27.2%; р=0.97; among died patients — 29.8% (among survived ones — 26.4%; р=0.76. Frequencies of the genotype GG rs10757278 were similar: recurrent MI (yes — 18.8%; no — 26.4%; р=0.49; hospitalization due to unstable angina (yes — 28%; no — 25
Mans, D. R.; Ret?l, J.; van Maanen, J M; Lafleur, M. V.; van Schaik, M. A.; Pinedo, H M; Lankelma, J.
1990-01-01
The mechanism of action of the anti-tumour agent etoposide (VP-16-213) could involve its bioactivation to metabolites which can damage DNA. Active metabolites of etoposide, generated in vitro, are the 3',4'-dihydroxy-derivative (catechol) and its oxidation product, the ortho-quinone. The conversion of the catechol into the ortho-quinone (and vice versa) proceeds via formation of a semi-quinone free radical. We investigated the role of this radical species in the inactivation of biologically a...
Verolet, Quentin; Soleimanpour, Saeideh; Fujisawa, Kaori; Dal Molin, Marta; Sakai, Naomi; Matile, Stefan
2015-06-01
Monomers with large surface area and high quantum yield, that is fluorescent flippers, have been engineered into twisted push-pull oligomers to create membrane probes with high mechanosensitivity and long fluorescence lifetime. Here, the synthesis and characterization of thieno[3,4]pyrazines and 2,1,3-benzothiadiazoles are described in comparison with the original dithienothiophene S,S-dioxides. Dithienothiophene S,S-dioxide flippers are confirmed as the best reported so far, and poor results with single flipper probes support that two flippers are needed for the probe to really "swim", that is, for high mechanosensitivity.
Nielsen, Christian Bergenstof
2014-12-15
A new photoactive polymer comprising benzo[1,2-b:3,4-b′:5,6-d′]trithiophene and 2,1,3-benzothiadiazole-5,6-dicarboxylic imide is reported. The synthetic design allows for alkyl chains to be introduced on both electron-rich and electron-deficient components, which in turn allows for rapid optimization of the alkyl chain substitution pattern. Consequently, the optimized polymer shows a maximum efficiency of 8.3% in organic photovoltaic devices processed in commercially viable fashion without solvent additives, annealing, or device engineering.
Energy Technology Data Exchange (ETDEWEB)
Benesch, W.A. [STEAG encotec GmbH, Essen (Germany); Mueller, L.; Schirmer, U. [VGB Power Tech e.V., Essen (Germany)
2007-07-01
The codes are being revised. However, technology is consistent. The consistency between new and old codes and power plant engineering - in particular concerning furnace and mill - is to be re-established. It is more and more important to present the corresponding relationships closely according to their development. The paper will demonstrate how to achieve these targets with the VGB Guideline R 200 and the VGB Instruction Sheet M 213H. VGB guidelines mainly are to observe special operating conditions and are commonly drafted by the VGB working panels, i.e. a wealth of experience is made available to the entire community of power generation. (orig.)
2015-09-01
This randomised, double-blind, multicentre study with children nine-23 months old evaluated the immunogenicity of yellow fever (YF) vaccines prepared with substrains 17DD and 17D-213/77. YF antibodies were titered before and 30 or more days after vaccination. Seropositivity and seroconversion were analysed according to the maternal serological status and the collaborating centre. A total of 1,966 children were randomised in the municipalities of the states of Mato Grosso do Sul, Minas Gerais and São Paulo and blood samples were collected from 1,714 mothers. Seropositivity was observed in 78.6% of mothers and 8.9% of children before vaccination. After vaccination, seropositivity rates of 81.9% and 83.2%, seroconversion rates of 84.8% and 85.8% and rates of a four-fold increase over the pre-vaccination titre of 77.6% and 81.8% were observed in the 17D-213/77 and 17DD subgroups, respectively. There was no association with maternal immunity. Among children aged 12 months or older, the seroconversion rates of 69% were associated with concomitant vaccination against measles, mumps and rubella. The data were not conclusive regarding the interference of maternal immunity in the immune response to the YF vaccine, but they suggest interference from other vaccines. The failures in seroconversion after vaccination support the recommendation of a booster dose in children within 10 years of the first dose.
Energy Technology Data Exchange (ETDEWEB)
Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)
2016-07-19
This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-year project with 1 year no-cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.
Neubert, Gerda; von Au, Katja; Drossel, Katrin; Tzschach, Andreas; Horn, Denise; Nickel, Renate; Kaindl, Angela M
2013-01-10
Angelman syndrome is a neurodevelopmental disorder characterized by mental retardation, severe speech disorder, facial dysmorphism, secondary microcephaly, ataxia, seizures, and abnormal behaviors such as easily provoked laughter. It is most frequently caused by a de novo maternal deletion of chromosome 15q11-q13 (about 70-90%), but can also be caused by paternal uniparental disomy of chromosome 15q11-q13 (3-7%), an imprinting defect (2-4%) or in mutations in the ubiquitin protein ligase E3A gene UBE3A mostly leading to frame shift mutation. In addition, for patients with overlapping clinical features (Angelman-like syndrome), mutations in methyl-CpG binding protein 2 gene MECP2 and cyclin-dependent kinase-like 5 gene CDKL5 as well as a microdeletion of 2q23.1 including the methyl-CpG binding domain protein 5 gene MBD5 have been described. Here, we describe a patient who carries a de novo 5Mb-deletion of chromosome 15q11.2-q13.1 known to be associated with Angelman syndrome and a further, maternally inherited deletion 2q21.3 (~364kb) of unknown significance. In addition to classic features of Angelman syndrome, she presented with severe infections in the first year of life, a symptom that has not been described in patients with Angelman syndrome. The 15q11.2-q13.1 deletion contains genes critical for Prader-Willi syndrome, the Angelman syndrome causing genes UBE3A and ATP10A/C, and several non-imprinted genes: GABRB3 and GABRA5 (both encoding subunits of GABA A receptor), GOLGA6L2, HERC2 and OCA2 (associated with oculocutaneous albinism II). The deletion 2q21.3 includes exons of the genes RAB3GAP1 (associated with Warburg Micro syndrome) and ZRANB3 (not disease-associated). Despite the normal phenotype of the mother, the relevance of the 2q21.3 microdeletion for the phenotype of the patient cannot be excluded, and further case reports will need to address this point. Copyright © 2012 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Fuzi, Siti Aishah Ahmad, E-mail: aishah-fuzi@yahoo.com; Jumali, Mohammad Hafizuddin Hj, E-mail: hafizhj@ukm.edu.my; Al-Asbahi, Bandar Ali Abdulqader, E-mail: alasbahibandar@gmail.com [School of Applied Physics, Faculty of Science and Technology, Universiti Kebangsaan Malaysia, 43600 UKM Bangi, Selangor. Malaysia (Malaysia)
2015-09-25
This work investigated the effect on 5 wt% addition of TiO{sub 2} nanoparticles (NPs) on the optical absorption characteristics of Poly[(9,9-di-n-octylfluorenyl-2,7-diyl)-alt-(benzo[2,1,3] thiadiazol-4,8-diyl)] (F8BT). Both materials were mixed using solution blending method and then spin coated onto ITO-coated glass substrate at 1000 rpm for 30s. The optical properties of the nanocomposite were determined using UV-Vis spectroscopy. Compares to pristine film, the absorption peak of the nanocomposite film improved and shifted to longer wavelength indicating reduction in the direct and indirect band gaps. Better optophysical properties of F8BT/TiO{sub 2} nanocomposites is believed due to compatible band structures and efficient charge trapping effect displayed by the NPs.
Energy Technology Data Exchange (ETDEWEB)
Kowalska, M.; Herlert, A. [CERN, Physics Department, Geneva 23 (Switzerland); Naimi, S.; Audi, G.; Lunney, D.; Minaya-Ramirez, E. [Universite de Paris Sud, CSNSM-IN2P3-CNRS, Orsay (France); Agramunt, J.; Estevez, E.; Rubio, B. [CSIC-Universidad de Valencia, IFIC, Valencia (Spain); Algora, A. [CSIC-Universidad de Valencia, IFIC, Valencia (Spain); Institute of Nuclear Research of the Hungarian Academy of Sciences, Debrecen (Hungary); Beck, D.; Herfurth, F. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Blank, B. [Universite Bordeaux 1/CNRS/IN2P3, CENBG, Gradignan Cedex (France); Blaum, K.; Boehm, C.; Kellerbauer, A.; Neidherr, D.; Warring, U. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Breitenfeldt, M.; Rosenbusch, M.; Schweikhard, L. [Ernst-Moritz-Arndt-Universitaet, Institut fuer Physik, Greifswald (Germany); Fraile, L.M.; Olaizola, B. [Universidad Complutense, Departamento de Fisica Atomica, Molecular y Nuclear, Madrid (Spain); George, S. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Johannes Gutenberg-Universitaet, Institut fuer Physik, Mainz (Germany); Riisager, K. [University of Aarhus, Department of Physics and Astronomy, Aarhus (Denmark); Schwarz, S. [Michigan State University, NSCL, East Lansing, MI (United States)
2009-12-15
With the Penning trap mass spectrometer ISOLTRAP, located at ISOLDE/CERN, preparatory work has been performed towards mass and decay studies on neutron-rich Hg and Tl isotopes beyond N=126. The properties of these isotopes are not well known because of large isobaric contamination coming mainly from surface-ionised Fr. Within the studies, production tests using several target-ion source combinations were performed. It was furthermore demonstrated around mass number A=209 that the resolving power required to purify Fr is achievable with ISOLTRAP. In addition, masses of several isobaric contaminants, {sup 211-213}Fr and {sup 211}Ra, were determined with a three-fold improved precision. The results influence masses of more than 20 other nuclides in the {sup 208}Pb region. (orig.)
Common variants at 2q37.3, 8q24.21, 15q21.3, and 16q24.1 influence chronic lymphocytic leukemia risk
Crowther-Swanepoel, Dalemari; Broderick, Peter; Di Bernardo, Maria Chiara; Dobbins, Sara E.; Torres, Mar?a; Mansouri, Mahmoud; Ruiz-Ponte, Clara; Enjuanes, Anna; Rosenquist, Richard; Carracedo, Angel; Jurlander, Jesper; Campo, Elias; Juliusson, Gunnar; Montserrat, Emilio; Smedby, Karin E
2010-01-01
To identify novel risk variants for chronic lymphocytic leukemia (CLL) we conducted a genome-wide association study of 299,983 tagging SNPs, with validation in four additional series totaling 2,503 cases and 5,789 controls. We identified four risk loci for CLL at 2q37.3 (rs757978, FARP2; odds ratio [OR] = 1.39; P = 2.11 x 10-9), 8q24.21 (rs2456449; OR = 1.26; P = 7.84 x 10-10), 15q21.3 (rs7169431; OR = 1.36; P = 4.74 x 10-7) and 16q24.1 (rs305061; OR = 1.22; P = 3.60 x 10-7). There was also e...
Directory of Open Access Journals (Sweden)
Tracy Russell P
2011-03-01
Full Text Available Abstract Background Genetic risk factors might improve prediction of coronary events. Several variants at chromosome 9p21.3 have been widely reported to be associated with coronary heart disease (CHD in prospective and case-control studies. A variant of KIF6 (719Arg has also been reported to be associated with increased risk of CHD in large prospective studies, but not in case-control studies. We asked whether the addition of genetic information (the 9p21.3 or KIF6 variants or a well-established non-genetic risk factor (C-reactive protein [CRP] can improve risk prediction by the Framingham Risk Score (FRS in the Cardiovascular Health Study (CHS--a prospective observational study of risk factors for cardiovascular disease among > 5,000 participants aged 65 or older. Methods Improvement of risk prediction was assessed by change in the area under the receiver-operator characteristic curve (AUC and by net reclassification improvement (NRI. Results Among white participants the FRS was improved by addition of KIF6 719Arg carrier status among men as assessed by the AUC (from 0.581 to 0.596, P = 0.03 but not by NRI (NRI = 0.027, P = 0.32. Adding both CRP and 719Arg carrier status to the FRS improved risk prediction by the AUC (0.608, P = 0.02 and NRI (0.093, P = 0.008 in men, but not women (P ≥ 0.24. Conclusions While none of these risk markers individually or in combination improved risk prediction among women, a combination of KIF6 719Arg carrier status and CRP levels modestly improved risk prediction among white men; although this improvement is not significant after multiple-testing correction. These observations should be investigated in other prospective studies.
Gao, Xike; Di, Chong-an; Hu, Yunbin; Yang, Xiaodi; Fan, Hongyu; Zhang, Feng; Liu, Yunqi; Li, Hongxiang; Zhu, Daoben
2010-03-24
A new class of n-type semiconductors for organic thin film transistors (OTFTs), based on core-expanded naphthalene diimides fused with 2-(1,3-dithiol-2-ylidene)malonitrile groups, is reported. The first two representatives of these species, derived from long branched N-alkyl chains, have been successfully used as active layers for high-performance, ambient-stable, solution-processed n-channel OTFTs. Their bottom-gate top-contact devices fabricated by spin-coating methods exhibit high electron mobilities of up to 0.51 cm(2) V(-1) s(-1) with current on/off ratios of 10(5)-10(7), and small threshold voltages below 10 V under ambient conditions. As this class of n-type organic semiconductors has relatively low-lying LUMO levels and good film-formation ability, they also displayed good environmental stability even with prolonged exposure to ambient air. Both the device performance and the ambient stability are among the best for n-channel OTFTs reported to date.
Directory of Open Access Journals (Sweden)
Taito Kobayashi
2017-11-01
Full Text Available 2-thioxo-3-pyrrolidinecarbaldehyde (TPC is an important intermediate in the yellowing of Japanese pickles “takuan-zuke”. TPC has been reported to have antibacterial activity against bacteria causing food poisoning and microorganisms associated with the development of caries, as well as various physiological functions such as antimutagenicity. However, since TPC has high reactivity, robust quantitative analysis is difficult with the extraction method or pre-column derivatization method using 2,4-dinitrophenylhydrazine. In this study, a high-performance liquid chromatography (HPLC method involving labeling with 4-(N,N-dimethylaminosulfonyl-7-hydrazino-2,1,3-benzoxadiazole (DBD-H was developed for the determination of the level of TPC in takuan-zuke. DBD-TPC was successfully stabilized by adding a buffer solution to the reaction solution, which established continuous analysis by HPLC using an autosampler. The DBD-TPC calibration curve was linear in the range of 0.25–250 nmol/mL (final concentration and showed a wide dynamic range. The lower limit of detection was 0.205 nmol/mL in TPC standard. The proposed method was successfully applied to the measurement of TPC in daikon-oroshi. The results reveal the possibility of determining the variation of TPC level in processed foods containing radish. We concluded that the proposed method is useful for evaluating the quality of processed radish products.
Energy Technology Data Exchange (ETDEWEB)
Forbes, S.A.; Brennan, L.; Richardson, M. [Queen Charlotte`s Hospital, London (United Kingdom)] [and others
1996-01-01
The gene for X-linked cleft palate (CPX) has previously been mapped in an Icelandic kindred between the unordered proximal markers DXS1002/DXS349/DXS95 and the distal marker DXYS1X, which maps to the proximal end of the X-Y homology region in Xq21.3. Using six sequence-tagged sites (STSs) within the region, a total of 91 yeast artificial chromosome (YAC) clones were isolated and overlapped in a single contig that spans approximately 3.1 Mb between DXS1002 and DXYS1X. The order of microsatellite and STS markers in this was established as DXS1002-DXS1168-DXS349-DXS95-DXS364-DXS1196-DXS472-DXS1217-DXYS1X. A long-range restriction map of this region was created using eight nonchimeric, overlapping YAC clones. Analysis of newly positioned polymorphic markers in recombinant individuals from the Icelandic family has enabled us to identify DXS1196 and DXS1217 as the flanking markers for CPX. The maximum physical distance containing the CPX gene has been estimated to be 2.0 Mb, which is spanned by a minimum set of five nonchimeric YAC clones. In addition, YAC end clone and STS analyses have pinpointed the location of the proximal boundary of the X-Y homology region within the map. 40 refs., 2 figs., 2 tabs.
Xiao, Xiao; Liang, Jingwen; Xie, Jingyi; Liu, Xin; Zhu, Dongsheng; Dong, Yuan
2017-10-01
Organotin carboxylates based on an amide carboxylic acid 2-(1,3-dioxo-1H-benzo[de]isoquinolin-2(3H)-yl)acetic acid (HL): [(Bn2Sn)2O2L]2·2C6H6 (1) (Bn = benzyl group) and (Ph2Sn)(L)2 (2) were synthesized and characterized by elemental analysis, IR, 1H, 13C, 119Sn NMR spectroscopy and X-ray crystallography diffraction analysis. Complex 1 is dimeric carboxylate tetraorganodistannoxane and show a ;ladder-like; molecular structure. Complex 2 is a dialkyltin carboxylate monomer possessing crystallographically imposed two-fold symmetry. Ligand in 1 and 2 adopts unidentate and bidentate coordination respectively. Both 1 and 2 form 1D, 2D and 3D supramolecular organizations in the solid state mediated through Csbnd H⋯O and π⋯π interactions which are discussed in detail. The luminescent properties and preliminary antitumor activities about this series of complexes were also studied.
Champion, Duane E.; Herman, Theodore C.
2003-01-01
A paleomagnetic study was conducted on basalt from 41 lava flows represented in about 2,300 ft of core from coreholes ICPP-213, ICPP-214, ICPP-215, and USGS 128. These wells are in the area of the Idaho Nuclear Technology and Engineering Center (INTEC) Vadose Zone Research Park within the Idaho National Engineering and Environmental Laboratory (INEEL). Paleomagnetic measurements were made on 508 samples from the four coreholes, which are compared to each other, and to surface outcrop paleomagnetic data. In general, subhorizontal lines of correlation exist between sediment layers and between basalt layers in the area of the new percolation ponds. Some of the basalt flows and flow sequences are strongly correlative at different depth intervals and represent important stratigraphic unifying elements. Some units pinch out, or thicken or thin even over short separation distances of about 1,500 ft. A more distant correlation of more than 1 mile to corehole USGS 128 is possible for several of the basalt flows, but at greater depth. This is probably due to the broad subsidence of the eastern Snake River Plain centered along its topographic axis located to the south of INEEL. This study shows this most clearly in the oldest portions of the cored sections that have differentially subsided the greatest amount.
Directory of Open Access Journals (Sweden)
Arnold N. Onyango
2008-08-01
Full Text Available Phosphatidylcholines (PCs bearing various kinds of aldehydic acyl chains at the sn-2 position have been detected in atherosclerotic tissues. However, 1-acyl-2-(13'-oxo-9',11'-tridecadienoyl- sn-glycero-3-phosphocholine and other alpha;beta;&gama;σ-unsaturated aldehyde PCs have not. To determine whether this might be due to their high chemical reactivity with biomolecules, we investigated the reactions of 1-stearoyl-2-(13'-oxo-9',11'-tridecadienoyl- sn-glycero-3-phosphocholine (OTDA-PC, where OTDA refers to the oxo-tridecadienoyl moiety with nucleophilic amino acids and peptides by means of electrospray mass spectroscopy. OTDA-PC formed Michael adducts with lysine, arginine, histidine, hippuryl lysine and hippuryl arginine, but was surprisingly unreactive with cysteine or glutathione. When 1-stearoyl-2-(13'-hydroperoxy-9'Z,11'E,15'Z-octadecatrienoyl- sn-glycero-3-phosphocholine (PC-LNA-OOH, where LNA-OOH denotes the linolenic acid hydroperoxide moiety was decomposed in the presence of the reactive lysine, OTDA-PC was still detected as a major product. However, OTDA-PC could not be detected when 1-stearoyl-2-(13'-hydroperoxy-9'Z,11'E-octadecadienoyl- sn-glycero-3-phosphocholine (PC-LA-OOH, where LA-OOH refers to linoleic acid hydroperoxide was decomposed in the presence or absence of lysine. Since linoleic acid is the major polyunsaturated fatty acid in atherosclerotic tissues, these results indicate that formation of OTDA-PC in only minor amounts in such tissues may explain its not having been detected in them. Surprisingly, 1-stearoyl-2-(9'-oxononanoyl- sn-glycero-3-phosphocholine was the major aldehydic product of the decomposition of PC-LA-OOH under anaerobic conditions.
Li, Xutian; Zhang, Min; Liang, Haipeng; Huang, Zhaowei; Tang, Jiang; Chen, Zhi; Yang, Liting; Ma, Li-Jun; Wang, Yuhai; Xu, Baiping
2016-01-01
Fluorescent and colorimetric pH probe possess many advantages including rapid response time, nondestructive testing, and excellent pH sensitivity. However, they usually cannot be utilized simultaneously in both acidic and basic pH ranges. In this study, a new selective and sensitive fluorescent and colorimetric pH probe, 4-(8- quinolyl)amino-7-nitro-2,1,3-benzoxadiazole (1), was designated and synthesized. The optical probe exhibited dual-responsive pH ranges to both acidic and basic aqueous solutions. When the solution pH was gradually increased from 8.5 to 13.3, the absorption spectra of 1 showed an obvious hyperchromicity, accompanied with a red shift of the absorption band at 340 nm, a blue shift of the absorption band at 482 nm, and a distinct color change from orange to violet pink to yellow. Within the pH range from 2.2 to 0.2, the fluorescent spectra of 1 showed a "turn-on" response signal to solution pH. In order to understand the response mechanism of the probe to solution pH, the probe molecule was split into two parts, 8-aminoquinoline (2) and 4-amino-7- nitro-benzofurazan (3). UV-vis absorption and fluorescent experiments of 2 and 3 indicated that both are sensitive optical pH probes. Furthermore, the NMR experiment of 1 was explored in basic and acidic conditions. The results indicated that the colorimetric responses of 1 to pH under basic condition should be attributed to the deprotonation of the imino group on the quinolyl ring, and the fluorescent recognition of 1 to pH under acidic condition was probably due to the protonation of the nitrogen atoms from the benzofurazan and quinolyl rings.
Energy Technology Data Exchange (ETDEWEB)
Xu, Caixia [Shandong Key Laboratory of Chemical Energy-storage and Novel Cell Technology, Liaocheng University, Liaocheng 252059 (China); Zhao, Jinsheng, E-mail: j.s.zhao@163.com [Shandong Key Laboratory of Chemical Energy-storage and Novel Cell Technology, Liaocheng University, Liaocheng 252059 (China); State Key Laboratory of Electronic Thin Films and Integrated Devices, University of Electronic Science and Technology of China, Chengdu 610054 (China); Wang, Min; Cui, Chuansheng; Liu, Renmin [Shandong Key Laboratory of Chemical Energy-storage and Novel Cell Technology, Liaocheng University, Liaocheng 252059 (China)
2013-01-01
A donor–acceptor type monomer 4,7-dicarbazol-9-yl-2,1,3-benzothiadiazole (CBTD) was synthesized by modified Ullmann coupling reaction and its corresponding polymer (PCBTD) was obtained via electrochemical polymerization. Characterizations of the resulting polymer PCBTD were performed by cyclic voltammetry, UV–vis spectroscopy, Fourier transform infrared spectroscopy and scanning electron microscopy. The polymer displayed multiple colors changed from yellow to yellowish green, green, and turquoise blue with the applied potential. The UV–vis spectra depicted that polymer film have two absorption bands as expected for this type of donor–acceptor polymer, at 320 and 467 nm, which attributed to the π–π* transition and intrachain charge transfer transition, respectively. Further, electrochemical and optical band gaps were obtained by using their oxidation and reduction onset potentials and absorption edges, respectively. The optical contrasts of the PCBTD film were found to be 28.1% at 420 nm and 49.9% at 800 nm in the visible region. The dual type electrochromic device constructed utilizing PCBTD and poly(3,4-ethylenedioxythiophene) showed a maximum contrast (ΔT %) of 49.4% at 620 nm with response time of 0.6 s and exhibited high coloration efficiency (1728 cm{sup 2} C{sup −1}) and good stability. These properties make the polymer a suitable material for electrochromic applications. - Highlights: ► A donor–acceptor carbazole based monomer and its polymer were synthesized. ► The polymer film showed good electrochromic properties and high optical contrast. ► An electrochromic device based on the polymer was also constructed and characterized.
Directory of Open Access Journals (Sweden)
Joyce Siew Yong Low
Full Text Available Nasopharyngeal carcinoma (NPC is a neoplasm of the epithelial lining of the nasopharynx. Despite various reports linking genomic variants to NPC predisposition, very few reports were done on copy number variations (CNV. CNV is an inherent structural variation that has been found to be involved in cancer predisposition.A discovery cohort of Malaysian Chinese descent (NPC patients, n = 140; Healthy controls, n = 256 were genotyped using Illumina® HumanOmniExpress BeadChip. PennCNV and cnvPartition calling algorithms were applied for CNV calling. Taqman CNV assays and digital PCR were used to validate CNV calls and replicate candidate copy number variant region (CNVR associations in a follow-up Malaysian Chinese (NPC cases, n = 465; and Healthy controls, n = 677 and Malay cohort (NPC cases, n = 114; Healthy controls, n = 124.Six putative CNVRs overlapping GRM5, MICA/HCP5/HCG26, LILRB3/LILRA6, DPY19L2, RNase3/RNase2 and GOLPH3 genes were jointly identified by PennCNV and cnvPartition. CNVs overlapping GRM5 and MICA/HCP5/HCG26 were subjected to further validation by Taqman CNV assays and digital PCR. Combined analysis in Malaysian Chinese cohort revealed a strong association at CNVR on chromosome 11q14.3 (Pcombined = 1.54x10-5; odds ratio (OR = 7.27; 95% CI = 2.96-17.88 overlapping GRM5 and a suggestive association at CNVR on chromosome 6p21.3 (Pcombined = 1.29x10-3; OR = 4.21; 95% CI = 1.75-10.11 overlapping MICA/HCP5/HCG26 genes.Our results demonstrated the association of CNVs towards NPC susceptibility, implicating a possible role of CNVs in NPC development.
Low, Joyce Siew Yong; Chin, Yoon Ming; Mushiroda, Taisei; Kubo, Michiaki; Govindasamy, Gopala Krishnan; Pua, Kin Choo; Yap, Yoke Yeow; Yap, Lee Fah; Subramaniam, Selva Kumar; Ong, Cheng Ai; Tan, Tee Yong; Khoo, Alan Soo Beng; Ng, Ching Ching
2016-01-01
Nasopharyngeal carcinoma (NPC) is a neoplasm of the epithelial lining of the nasopharynx. Despite various reports linking genomic variants to NPC predisposition, very few reports were done on copy number variations (CNV). CNV is an inherent structural variation that has been found to be involved in cancer predisposition. A discovery cohort of Malaysian Chinese descent (NPC patients, n = 140; Healthy controls, n = 256) were genotyped using Illumina® HumanOmniExpress BeadChip. PennCNV and cnvPartition calling algorithms were applied for CNV calling. Taqman CNV assays and digital PCR were used to validate CNV calls and replicate candidate copy number variant region (CNVR) associations in a follow-up Malaysian Chinese (NPC cases, n = 465; and Healthy controls, n = 677) and Malay cohort (NPC cases, n = 114; Healthy controls, n = 124). Six putative CNVRs overlapping GRM5, MICA/HCP5/HCG26, LILRB3/LILRA6, DPY19L2, RNase3/RNase2 and GOLPH3 genes were jointly identified by PennCNV and cnvPartition. CNVs overlapping GRM5 and MICA/HCP5/HCG26 were subjected to further validation by Taqman CNV assays and digital PCR. Combined analysis in Malaysian Chinese cohort revealed a strong association at CNVR on chromosome 11q14.3 (Pcombined = 1.54x10-5; odds ratio (OR) = 7.27; 95% CI = 2.96-17.88) overlapping GRM5 and a suggestive association at CNVR on chromosome 6p21.3 (Pcombined = 1.29x10-3; OR = 4.21; 95% CI = 1.75-10.11) overlapping MICA/HCP5/HCG26 genes. Our results demonstrated the association of CNVs towards NPC susceptibility, implicating a possible role of CNVs in NPC development.
49 CFR 213.337 - Defective rails.
2010-10-01
.... (9) Engine burn fracture means a progressive fracture originating in spots where driving wheels have... rail to 30 m.p.h. until joint bars are applied; thereafter, limit speed to 50 m.p.h. When a search for... used in this section— (1) Transverse fissure means a progressive crosswise fracture starting from a...
22 CFR 213.4 - Other remedies.
2010-04-01
... inexcusable, prolonged or repeated failure to pay a debt. For example, the Agency may stop doing business with... from an advance payment to a reimbursement method; or revoke a grantee's or contractor's letter-of...
2010-04-01
... Record Systems, including, but not limited to education, financial transactions, medical history, criminal history, or employment history, that contain names or personal identifiers. (c) Privacy Act Record...
African Journals Online (AJOL)
RHUMSIKI
colony forming cells (Rhodes et al., 1986). Chemically induced neurodegeneration is usually characterised by different patterns of neuronal cell death, gliosis, swollen or destroyed axons, or destruction of the myelin sheath which is usually preceded by biochemical changes (Cavanagh, 1984). Due to this report and some ...
Fungal Planet 213 – 26 November 2013
Crous, P.W.; Wingfield, M.J.; Guarro, J.; Cheewangkoon, R.; van der Bank, M.; Swart, W.J.; Stchigel, A.M.; Cano-Lira, J.F.; Roux, J.; Madrid, H.; Damm, U.; Wood, A.R.; Shuttleworth, L.A.; Hodges, C.S.; Munster, M.
2013-01-01
Novel species of microfungi described in the present study include the following from South Africa: Camarosporium aloes, Phaeococcomyces aloes and Phoma aloes from Aloe, C. psoraleae, Diaporthe psoraleae and D. psoraleae-pinnatae from Psoralea, Colletotrichum euphorbiae from Euphorbia, Coniothyrium prosopidis and Peyronellaea prosopidis from Prosopis, Diaporthe cassines from Cassine, D. diospyricola from Diospyros, Diaporthe maytenicola from Maytenus, Harknessia proteae from Protea, Neofusico...
49 CFR 213.365 - Visual inspections.
2010-10-01
... track in a vehicle, the inspection will be subject to the following conditions— (1) One inspector in a... track centers are 15 foot or less, the requirements of this paragraph (b)(3) will not apply; and (4... 22, 1998; 63 FR 45959, Aug. 28, 1998] ...
Publications | Page 213 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Clean energy and water : an assessment for services for adaptation to climate change; final assessment report (open access). The report assesses challenges facing the wider uses of renewable energy technologies in water services. Promotion of pro-poor renewable-based water pumping options in East Africa such as ...
2010-10-01
... lifetime. Livestock depredation area means a specific geographic location in which depredation by golden eagles has been recognized. The boundaries and duration of a livestock depredation area are declared by U..., weapons, and sensors for proper operation and suitability for combat use. It does not include (a) routine...
2010-10-01
...) Distributing essential food and supplies critical to health. (12) Accomplishing tasks necessary to insure... OFFICE OF SCIENCE AND TECHNOLOGY POLICY AND NATIONAL SECURITY COUNCIL GOVERNMENT AND PUBLIC... on: (i) Command and control of military forces essential to defense and retaliation. (ii) Critical...
7 CFR 989.213 - Maturity dockage.
2010-01-01
... and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE RAISINS PRODUCED FROM GRAPES GROWN IN... factor from the dockage table prescribed in paragraphs (b), (c), and (d) of this section. (b) Maturity...: Dockage factor 50.0 or more (1) 49.9 0.9995 49.8 .9990 49.7 .9985 49.6 .9980 49.5 .9975 1 No dockage. Note...
14 CFR 61.213 - Eligibility requirements.
2010-01-01
...) Be at least 18 years of age; (2) Be able to read, write, speak, and understand the English language... fundamentals of instructing to include— (i) The learning process; (ii) Elements of effective teaching; (iii... to teach at an educational level of the 7th grade or higher; or (3) Is employed as a teacher at an...
GPCR Interaction: 213 [GRIPDB[Archive
Lifescience Database Archive (English)
Full Text Available s controlled by RTP4, which governs their membrane targeting and functional activity. 18836069 ELISA, immunoblotting, coimmunoprecipi...tation, western blotting, SEAP assay NP_000905.3 ...
Fungal Planet description sheets: 154–213
Crous, P.W.; Wingfield, M.J.; Guarro, J.; Cheewangkoon, R.; Bank, van der M.; Swart, W.J.; Stchigel, A.M.; Cano-Lira, J.F.; Roux, J.; Madrid, H.; Damm, U.; Wood, A.R.; Shuttleworth, L.A.; Hodges, C.S.; Munster, M.; Jesús Yáñez-Morales, de M.; Zúñiga-Estrada, L.; Cruywagen, E.M.; Hoog, de G.S.; Silvera, C.; Najafzadeh, J.; Davison, E.M.; Davison, P.J.N.; Barrett, M.D.; Barrett, R.L.; Manamgoda, D.S.; Minnis, A.M.; Kleczewski, N.M.; Flory, S.L.; Castlebury, L.A.; Clay, K.; Hyde, K.D.; Maússe-Sitoe, S.N.D.; Chen, S.; Lechat, C.; Hairaud, M.; Lesage-Meessen, L.; Pawlowska, J.; Wilk, M.; Sliwinska-Wyrzychowska, A.; Metrak, M.; Wrzosek, M.; Pavlic-Zupanc, D.; Maleme, H.M.; Slippers, B.; Mac Cormack, W.P.; Archuby, D.I.; Grünwald, N.J.; Tellería, M.T.; Dueñas, M.; Martín, M.P.; Marincowitz, S.; Beer, de Z.W.; Perez, C.A.; Gené, J.; Marin-Felix, Y.; Groenewald, J.Z.
2013-01-01
Novel species of microfungi described in the present study include the following from South Africa: Camarosporium aloes, Phaeococcomyces aloes and Phoma aloes from Aloe, C. psoraleae, Diaporthe psoraleae and D. psoraleae-pinnatae from Psoralea, Colletotrichum euphorbiae from Euphorbia, Coniothyrium
Publications | Page 213 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Clean energy and water : an assessment for services for adaptation to climate change; final assessment report (open access). The report ... Background: Hospitals are generally moving towards a system of management based on business concepts that lead to market mechanisms and principles of efficiency. The concern ...
Publications | Page 213 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...
2010-10-01
... area or SIDA, except as provided in § 1542.5, unless that individual has successfully completed... access to the SIDA on November 14, 2001, training on responsibility under § 1540.105 can be provided by...
Reference: 213 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available esponses. We showed that loss-of-function atmdr1 and atpgp1 mutants display hypersensitivity to far-red, red...1-NAA or NPA. The atmdr1-100 and atmdr1-100/atpgp1-100 mutants also displayed enhanced root gravitropism. Ge
Energy Technology Data Exchange (ETDEWEB)
Aguilera-Granja, F [Instituto de Fisica, Universidad Autonoma de San Luis PotosI, SLP 78000 (Mexico); Vega, A [Departamento de Fisica Teorica, Atomica, y Optica, Universidad de Valladolid, E-47011 Valladolid (Spain); Gallego, L J [Departamento de Fisica de la Materia Condensada, Facultad de Fisica, Universidad de Santiago de Compostela, E-15782 Santiago de Compostela (Spain)
2008-04-09
We report the results of density-functional calculations of the structures, binding energies and magnetic moments of the clusters Mo{sub N} (N = 2-13), Mo{sub 12}Fe, Mo{sub 12}Co and Mo{sub 12}Ni that were performed using the SIESTA method within the generalized gradient approximation for exchange and correlation. For pure Mo{sub N} clusters, we obtain collinear magnetic structures in all cases, even when the self-consistent calculations were started from non-collinear inputs. Our results for these clusters show that both linear, planar and three-dimensional clusters have a strong tendency to form dimers. In general, even-numbered clusters are more stable than their neighbouring odd-numbered clusters because they can accommodate an integer number of tightly bound dimers. As a consequence, the binding energies of pure Mo{sub N} clusters, in their lowest-energy states, exhibit an odd-even effect in all dimensionalities. Odd-even effects are less noticeable in the magnetic moments than in the binding energies. When comparing our results for pure Mo clusters with those obtained recently by other authors, we observe similarities in some cases, but striking differences in others. In particular, the odd-even effect in three-dimensional Mo clusters was not observed before, and our results for some clusters (e.g. for planar Mo{sub 3} and Mo{sub 7} and for three-dimensional Mo{sub 7} and Mo{sub 13}) differ from those reported by other authors. For Mo{sub 12}Fe and Mo{sub 12}Ni, we obtain that the icosahedral configuration with the impurity atom at the cluster surface is more stable than the configuration with the impurity at the central site, while the opposite occurs in the case of Mo{sub 12}Co. In Mo{sub 12}Co and Mo{sub 12}Ni, the impurities exhibit a weak magnetic moment parallely coupled to the total magnetic moment of the Mo atoms, whereas in Mo{sub 12}Fe the impurity shows a high moment with antiparallel coupling.
Energy Technology Data Exchange (ETDEWEB)
Woodruff, Dana L.; Schultz, Irvin R.; Marshall, Kathryn E.; Ward, Jeffrey A.; Cullinan, Valerie I.
2012-05-01
This fiscal year (FY) 2011 progress report (Task 2.1.3 Effects on Aquatic Organisms, Subtask 2.3.1.1 Electromagnetic Fields) describes studies conducted by PNNL as part of the DOE Wind and Water Power Program to examine the potential effects of electromagnetic fields (EMF) from marine and hydrokinetic devices on aquatic organisms, including freshwater and marine fish and marine invertebrates. In this report, we provide a description of the methods and results of experiments conducted in FY 2010-FY 2011 to evaluate potential responses of selected aquatic organisms. Preliminary EMF laboratory experiments during FY 2010 and 2011 entailed exposures with representative fish and invertebrate species including juvenile coho salmon (Oncorhynchus kisutch), Atlantic halibut (Hippoglossus hippoglossus), California halibut (Paralicthys californicus), rainbow trout (Oncorhynchus mykiss), and Dungeness crab (Metacarcinus magister). These species were selected for their ecological, commercial, and/or recreational importance, as well as their potential to encounter an MHK device or transmission cable during part or all of their life cycle. Based on previous studies, acute effects such as mortality were not expected to occur from EMF exposures. Therefore, our measurement endpoints focused on behavioral responses (e.g., detection of EMF, interference with feeding behavior, avoidance or attraction to EMF), developmental changes (i.e., growth and survival from egg or larval stage to juvenile), and exposure markers indicative of physiological responses to stress. EMF intensities during the various tests ranged from 0.1 to 3 millitesla, representing a range of upper bounding conditions reported in the literature. Experiments to date have shown there is little evidence to indicate distinct or extreme behavioral responses in the presence of elevated EMF for the species tested. Several developmental and physiological responses were observed in the fish exposures, although most were not
Energy Technology Data Exchange (ETDEWEB)
NONE
1994-07-15
The Riskaudit 7 report has been made by a group of independent experts from Western European countries representing technical organizations specialized in the support of regulatory bodies of those countries. It represents a preliminary estimation of the Ukrainian WWER B 213 and B 320 reactors, based on the example of Rovno NPP, analysed with a Western practice. The second part of the document covers the following aspects of the report: accident analysis; systems analysis; plant operation; operating experience feedback; radio protection and health; probabilistic safety assessment; summary and future plans.
Energy Technology Data Exchange (ETDEWEB)
NONE
1994-07-15
The Riskaudit 7 report has been made by a group of independent experts from Western European countries representing technical organizations specialized in the support of regulatory bodies of those countries. It represents a preliminary estimation of the Ukrainian WWER B 213 and B 320 reactors, based on the example of Rovno NPP, analysed with a Western practice. The first part of the document covers the following aspects of the report: core design and fuel management; pressurized components; electrical supply; instrumentation and control; containment; internal events; site conditions and external events.
Energy Technology Data Exchange (ETDEWEB)
Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.
2015-03-26
Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.
49 CFR 571.213 - Standard No. 213; Child restraint systems.
2010-10-01
... 572 Subpart S dummy need not meet S5.1.2 and S5.1.3. S5.1 Dynamic performance. S5.1.1Child restraint... restraint system, neither knee pivot point shall, at any time during the dynamic test, pass through a... not less than 24 square inches for systems recommended for children weighing 20 pounds or more, or 48...
Wang, Wenjing; Zhao, Ming; Wang, Yuji; Liu, Jiawang; Wu, Jianhui; Kang, Guifeng; Peng, Shiqi
2011-03-01
{2-[1-(3-Methoxycarbonylmethyl-1H-indol-2-yl)-1-methyl-ethyl]-1H-indol-3-yl}-acetic acid methyl ester (MIAM) was provided as a DNA-intercalator. For the comprehensive evaluation of this new intercalator, an assay system consisting of cell, S180 mouse, healthy mouse, spectrum, non-spectrum, and gel electrophoresis models was constructed. On the cell (S180, K562, MCF-7, HeLa and HepG2) models, MIAM selectively inhibited the viability of HeLa. On the S180 mouse model, 0.89, 8.9, 89 and 890 μmol kg(-1) of MIAM dose-dependently inhibited the tumor growth. Even at a dose of 890 μmol kg(-1), MIAM did not damage the treated S180 mice. The safety of MIAM was supported by a high spleen index and an obvious increase of body weight of the treated S180 mice. On the healthy mouse model the LD(50) value of MIAM is higher than 890 μmol kg(-1). The ultraviolet (UV), fluorescence, circular dichroism (CD), relative viscosity, melting curve, and gel electrophoresis assays of DNA with or without MIAM consistently supported an intercalation mechanism for MIAM.
Directory of Open Access Journals (Sweden)
Ye Li
2015-01-01
Full Text Available {2-[1-(3-Methoxycarbonylmethyl-1H-indol-2-yl-1-methyl-ethyl]-1H-indol-3-yl}-acetic acid methyl ester (MIAM is a novel indole compound, which possessed high efficacy against many cancers xenografted in mice without obvious toxicity. In this study, we aimed to investigate the effects of MIAM on human hepatocellular carcinoma (HCC Bel-7402 cells and its resistant variants Bel-7402/5FU. MIAM inhibited the growth of HCC more potent in Bel-7402/5FU cells than its parent cells. MIAM increased cellular reactive oxygen species (ROS levels, induced cell apoptosis, and arrested cell cycle in G0/G1 phase. MIAM might exert its action on Bel-7402/5FU cells through activation of NADPH oxidase 4 (NOX4/p22, Sirtuin3 (SIRT3/SOD2, and SIRT3/p53/p21 pathways. MIAM might inhibit HCC growth through the modulation of SIRT3. When SIRT3 was silenced, the inhibitory effect of MIAM on Bel-7402/5FU was lowered, showing the characteristic of resistance against MIAM, whereas Bel-7402/5FU cells with high expression of SIRT3 by SIRT3 adenovirus infection demonstrated the high sensitivity to MIAM. These results suggested that MIAM might exert its action against Bel-7402/5FU growth through upregulation of SIRT3. We suggested that MIAM might be a promising candidate compound which could develop as a potent anticancer agent targeting NOX4 and SIRT3 activation.
MO-FG-213-04: Managing the Relationship
Energy Technology Data Exchange (ETDEWEB)
Wong, J. [Johns Hopkins University: Managing the Relationship (United States)
2015-06-15
Academic-industrial collaborations are playing an increasingly prominent role in medical physics research. Successful partnerships have enabled truly translational, benchtop-to-bedside research that has significantly and positively impacted our field. Given the current flat or depleting trends in federal funding, and the increasing emphasis in the medical physics community on demonstrating translatability, efficacy, and safety prior to widespread clinical use, it is anticipated that such partnerships will become ever more important in advancing our field. In the future, it is likely that neither academia alone, nor industry alone, will be able to bring significant innovation to successfully impact patient care in radiotherapy. Such innovation will require partnership and symbiosis through the lifetime of the project. This symposium is aimed at professionals from academia and the industry who are interested in either initiating new collaborations or maintaining and improving existing partnerships. We will hear from four thought leaders from industry and academia on critical aspects of building and maintaining successful academic-industrial research partnerships. The following topics will be addressed: 1. Motivations: The industry perspective [Kevin Brown, Elekta] What goes into the development of a company’s R&D roadmap What are the motivations and expectations of the industry from academic partners How can academics make a successful pitch by identifying projects aligned with a company’s roadmap Why are some relationships successful and some not Milestones and progress reports - Why do we need them 2. Motivations: The academic perspective [T. Rock Mackie, Univ. of Madison, WI; Tomotherapy] What are the motivations and expectations of academic partners from the industry What are the cultural differences in academia vs industry on sharing information, exchanging ideas Partnership or entrepreneurship? When does each option make sense 3. Industrial Grants and Research Contracts – a Primer [Norbert Pelc; Stanford University] What topics are suited to industrial grants vs. academic grants How do resources (personnel effort, tuition) get allocated and charged in academia What are reasonable resource and timeline requests for small and big projects; from small and big companies “Fair market value” considerations Sections of a research agreement (IP including software confidential information, publications, data, exclusivity, support) 4. Managing the relationship [John Wong, Johns Hopkins University] How to effectively collaborate with each other How to adapt to changes in the relationship How to renew funding with the industry Moderated Panel Discussion [All speakers + moderators] Learning Objectives: 1. Understand the motivations of each partner 2. Elements that contribute to a successful partnership 3. Avoiding pitfalls - Challenges on either side that may derail a project 4. How to frame a research grant and agreement 5. How to sustain the collaborative relationship Amit Sawant: Funding from: NIH. Varian, Elekta and VisionRT; Michelle Svatos: Employee and shareholder: Varian, Board Member, TopasMC; Kevin Brown: Employee, Elekta; T. Rock Mackie: Consultant, Accuray; Norbert Pelc: Research support: Philips Healthcare, GE Healthcare; John Wong: Funding from NIH, Xstrahl and Elekta. Co-founder and advisor for JPLC Associates, LLC.
5 CFR 213.3202 - Entire executive civil service.
2010-01-01
.... Classification of students is based on the occupational series for which they are hired. Grade level is to be set... Government but must be to an occupation related to the student's academic training and work-study experience... relating to recruitment needs in geographical areas, specific occupational series, and grades, pay bands or...
9 CFR 113.213 - Pseudorabies Vaccine, Killed Virus.
2010-01-01
... established as pure, safe, and immunogenic shall be used for preparing seeds for vaccine production. All... immunogenicity of vaccine prepared from the Master Seed in accordance with the Outline of Production shall be... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pseudorabies Vaccine, Killed Virus...
40 CFR 98.213 - Calculating GHG emissions.
2010-07-01
... ton carbonate consumed. Fi = Fraction calcination achieved for each particular carbonate type i (decimal fraction). As an alternative to measuring the calcination fraction, a value of 1.0 can be used. n...
Lifescience Database Archive (English)
Full Text Available 9292.1 As_L3_32G02_SKPL Ascaris suum (parasitic nematode) L3 stage Ascaris suum cDNA clone As_L3_32G02 5' si...AC145413.2 Sus scrofa clone RP44-386P23, WORKING DRAFT SEQUENCE, 4 ordered pieces. 34 0.039 6 CB039292 |CB03
Session 21.3 - Radio and Optical Site Protection
Sefako, Ramotholo
2016-10-01
Advancement in radio technology means that radio astronomy has to share the radio spectrum with many other non-astronomical activities, majority of which increase radio frequency interference (RFI), and therefore detrimentally affecting the radio observations at the observatory sites. Major radio facilities such as the SKA, in both South Africa and Australia, and the Five-hundred-meter Aperture Spherical radio Telescope (FAST) in China will be very sensitive, and therefore require protection against RFI. In the case of optical astronomy, the growing urbanisation and industrialisation led to optical astronomy becoming impossible near major cities due to light and dust pollution. Major optical and IR observatories are forced to be far away in remote areas, where light pollution is not yet extreme. The same is true for radio observatories, which have to be sited away from highly RFI affected areas near populated regions and major cities. In this review, based on the Focus Meeting 21 (FM21) oral presentations at the IAU General Assembly on 11 August 2015, we give an overview of the mechanisms that have evolved to provide statutory protection for radio astronomy observing, successes (e.g at 21 cm HI line), defeats and challenges at other parts of the spectrum. We discuss the available legislative initiatives to protect the radio astronomy sites for large projects like SKA (in Australia and South Africa), and FAST against the RFI. For optical protection, we look at light pollution with examples of its effect at Xinglong observing station of the National Astronomical Observatories of China (NAOC), Ali Observatory in Tibet, and Asiago Observatory in Italy, as well as the effect of conversion from low pressure sodium lighting to LEDs in the County of Hawaii.
12 CFR 213.9 - Relation to state laws.
2010-01-01
... act and this part. No exemption will extend to the civil liability provisions of sections 130, 131...) Enforcement and liability. After an exemption has been granted, the requirements of the applicable state law...
Lifescience Database Archive (English)
Full Text Available SLVVEAFIKMMDLGKIANSNTGGYSGGNKRKVSLSIAMLG NPSVVLIDEASSGCDPIIRYRQCQVISELGKNKVIILTSHSMSEIQALCSRMTIMRDGQF...SLVVEAFIKMMDLGKIANSNTGGYSGGNKRKVSLSIAMLG NPSVVLIDEASSGCDPIIRYRQCQVISELGKNKVIILTSHSMSEIQALCSRMTIMRDGQF
Lifescience Database Archive (English)
Full Text Available AAAAAAAAAAAAAAAC CCAAGTTAATCAGAAAAAT sequence update 2000. 3.29 Translated Amino Acid sequence ---pets...xtiixsvlfink kkkkkkkkkkkkkkkkkkkpklirk Frame B: ---petskgrlkftpn*TIKGNTIRIGVWNVQG
Energy Technology Data Exchange (ETDEWEB)
NONE
2015-06-15
The purpose of this session is to introduce attendees to the healthcare reimbursement system and how it applies to the clinical work of a Medical Physicist. This will include general information about the different categories of payers and payees, how work is described by CPT© codes, and how various payers set values for this work in different clinical settings. 2015 is a year of significant changes to the payment system. Many CPT© codes have been deleted and replaced with new CPT© codes. These codes define some of the most common work performed in our clinics including treatment planning and delivery. This presentation will describe what work is encompassed in these codes and will give attendees an overview of the changes for 2015 as they apply to radiation oncology. Finally, some insight into what can be expected during 2016 will be presented. This includes what information is typically released by the Centers for Medicaid & Medicare Services (CMS) during the year and how we as an organization respond. This will include ways members can interact with the AAPM professional economics committee and other resources members may find helpful. Learning Objectives: Basics of how Medicare is structured and how reimbursement rates are set. Basic understanding of proposed changes to the 2016 Medicare rules. What resources are available from the AAPM and how to interact with the professional economics committee. Ownership in pxAlpha, LLC, a medical device start up company.
49 CFR 1544.213 - Use of explosives detection systems.
2010-10-01
... SECURITY ADMINISTRATION, DEPARTMENT OF HOMELAND SECURITY CIVIL AVIATION SECURITY AIRCRAFT OPERATOR SECURITY... security program, each aircraft operator required to conduct screening under a security program must use an...
22 CFR 213.31 - Termination-general.
2010-04-01
... Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT CLAIMS COLLECTION Suspension or Termination of.... Unless otherwise provided for by DOJ regulations or procedures, requests to terminate collection on debts in excess of $100,000 are referred to the Commercial Litigation Branch, Civil Division, Department of...
24 CFR 213.253 - Premiums upon initial endorsement.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Premiums upon initial endorsement... upon initial endorsement. (a) Management and Sales Types and Investor Sponsored Projects. The mortgagee, upon the initial endorsement of the mortgage for insurance, shall pay to the Commissioner a first...
Lifescience Database Archive (English)
Full Text Available *resfnrigks*pklai*stske kllts*yl*ss*rd*cr*sid*sckhfnwfrfhi*rdickei*rlfrwlenencigkstl l*trsiit**tfksfrftclclv...na**ny hcttsscivcrtrgnw**ynsiglcigs**rkkmvt**resfnrigks*pklai*stske kllts*yl*ss*r...d*cr*sid*sckhfnwfrfhi*rdickei*rlfrwlenencigkstl l*trsiit**tfksfrftclclvreifksmgsyiigcis*sfip**gc**yhlhsxiksw
22 CFR 1203.735-213 - Recommendations for employment.
2010-04-01
... manner, if such is the case. Also, an AID Mission Director may provide names of persons or firms from which a cooperating government may select an employee or firm to be used in some phase of the AID...
47 CFR 213.1 - Background and purpose.
2010-10-01
... Telecommunication OFFICE OF SCIENCE AND TECHNOLOGY POLICY AND NATIONAL SECURITY COUNCIL GOVERNMENT AND PUBLIC... handling of messages and calls transmitted over Government and public correspondence facilities in all... standards, procedures, policies, and regulations that together, constitute this single integrated precedence...
Lifescience Database Archive (English)
Full Text Available tomato flower buds 8 mm to pre-anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOC2D20 5'...|BF187220.1 EST443507 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA39D17 5' sequence...|BE473010.1 EST417863 potato stolon, Cornell University Solanum tuberosum cDNA clone cSTA35F24, mRNA
49 CFR 213.329 - Curves, elevation and speed limitations.
2010-10-01
..., will exceed three inches. This notification shall be in writing and shall contain, at a minimum, the... the written consent of the other affected track owners. [63 FR 34029, June 22, 1998; 63 FR 46102, Aug. 28, 1998] ...
All projects related to | Page 213 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2012-03-05
Understanding the complex factors that can lead to HIV infection is crucial to addressing the problem among vulnerable populations, such as female sex workers. Start Date: March 5, 2012. End Date: September 5, 2014. Topic: DISEASE TRANSMISSION, TRAINING PROGRAMMES, RESEARCH PROJECTS, ...
Lifescience Database Archive (English)
Full Text Available te sequence, segment 1/2. 60 1e-08 4 BM493927 |BM493927.1 NXLV_071_F02_F NXLV (Nsf Xylem Late wood Vertical)... Pinus taeda cDNA clone NXLV_071_F02 5', mRNA sequence. 50 5e-08 2 BQ634402 |BQ634402.1 NXRV068_E06_F NXRV (Nsf Xylem Root wood Verti...cal) Pinus taeda cDNA clone NXRV068_E06 5', mRNA sequence. 50 6e-08 2 BI416760 |BI4
Energy Technology Data Exchange (ETDEWEB)
Pipman, Y.
2015-06-15
AAPM projects and collaborations in Africa Adam Shulman (AA-SC Chair) The African Affairs Subcommittee (AA-SC) of the AAPM will present a multi-institutional approach to medical physics support in Africa. Current work to increase the quality of care and level of safety for the medical physics practice in Senegal, Ghana, and Zimbabwe will be presented, along with preliminary projects in Nigeria and Botswana. Because the task of addressing the needs of medical physics in countries across Africa is larger than one entity can accomplish on its own, the AA-SC has taken the approach of joining forces with multiple organizations such as Radiating Hope and TreatSafely (NGO’s), the IAEA, companies like BrainLab, Varian and Elekta, medical volunteers and academic institutions such as NYU and Washington University. Elements of current projects include: 1) Distance training and evaluation of the quality of contouring and treatment planning, teaching treatment planning and other subjects, and troubleshooting using modern telecommunications technology in Senegal, Ghana, and Zimbabwe; 2) Assistance in the transition from 2D to 3D in Senegal and Zimbabwe; 3) Assistance in the transition from 3D to IMRT using in-house compensators in Senegal; 4) Modernizing the cancer center in Senegal and increasing safety and; 5) Training on on 3D techniques in Ghana; 6) Assisting a teaching and training radiation oncology center to be built in Zimbabwe; 7) Working with the ISEP Program in Sub-Saharan Africa; 8) Creating instructional videos on linac commissioning; 9) Working on a possible collaboration to train physicists in Nigeria. Building on past achievements, the subcommittee seeks to make a larger impact on the continent, as the number and size of projects increases and more human resources become available. The State of Medical Physics Collaborations and Projects in Latin America Sandra Guzman (Peru) The lack of Medical Physicists (MP) in many Latin American (LA) countries leads to recruitment of professionals with incomplete education. In most LA countries only one MP responsible for each Center is currently mandated. Currently there is a large disparity among MP training programs and there is significant debate about the standards of MP graduate education in many LA countries. There are no commonly recognized academic programs, not enough clinical training sites and clinical training is not typically considered as part of the MP work. Economic pressures and high workloads also impede the creation of more training centers. The increasing need of qualified MPs require establishing a coordinated system of national Education & Training Centers (ETC), to meet the international standards of education and training in Medical Physics. This shortfall calls for support of organizations such as the IOMP, AAPM, ALFIM, IAEA, etc. Examples from various LA countries, as well as some proposed solutions, will be presented. In particular, we will discuss the resources that the AAPM and its members can offer to support regional programs. The ‘Medical Imaging’ physicist in the emerging world: Challenges and opportunities - Caridad Borrás (WGNIMP Chair) While the role of radiation therapy physicists in the emerging world is reasonably well established, the role of medical imaging physicists is not. The only perceived needs in radiology departments are equipment quality control and radiation protection, tasks that can be done by a technologist or a service engineer. To change the situation, the International Basic Safety Standard, which is adopted/adapted world-wide as national radiation protection regulations, states: “For diagnostic radiological procedures and image guided interventional procedures, the requirements of these Standards for medical imaging, calibration, dosimetry and quality assurance, including the acceptance and commissioning of medical radiological equipment, are fulfilled by or under the oversight of, or with the documented advice of a medical physicist, whose degree of involvement is determined by the complexity of the radiological procedures and the associated radiation risks”. Details on how these requirements can be carried out in resource-limited settings will be described. IAEA support to medical physics in Africa and Latin America: achievements and challenges Ahmed Meghzifene (IAEA) Shortage of clinically qualified medical physicists in radiotherapy and imaging, insufficient and inadequate education and training programs, as well as a lack of professional recognition were identified as the main issues to be addressed by the IAEA. The IAEA developed a series of integrated projects aiming specifically at promoting the essential role of medical physicists in health care, developing harmonized guidelines on dosimetry and quality assurance, and supporting education and clinical training programs. The unique feature of the IAEA approach is support it provides for implementation of guidelines and education programs in Member States through its technical cooperation project. The presentation will summarize IAEA support to Latin America and Africa in the field of medical physics and will highlight how the new International Basic Safety Standards are expected to impact the medical physics practice in low and middle income countries. Learning Objectives: Learn about the shortage of qualified Medical Physicists in Africa and Latin America. Understand the reasons of this shortage. Learn about the ways to improve the situation and AAPM role in this process.
WE-AB-213-03: Challenges and Opportunities
Energy Technology Data Exchange (ETDEWEB)
Borras, C.
2015-06-15
AAPM projects and collaborations in Africa Adam Shulman (AA-SC Chair) The African Affairs Subcommittee (AA-SC) of the AAPM will present a multi-institutional approach to medical physics support in Africa. Current work to increase the quality of care and level of safety for the medical physics practice in Senegal, Ghana, and Zimbabwe will be presented, along with preliminary projects in Nigeria and Botswana. Because the task of addressing the needs of medical physics in countries across Africa is larger than one entity can accomplish on its own, the AA-SC has taken the approach of joining forces with multiple organizations such as Radiating Hope and TreatSafely (NGO’s), the IAEA, companies like BrainLab, Varian and Elekta, medical volunteers and academic institutions such as NYU and Washington University. Elements of current projects include: 1) Distance training and evaluation of the quality of contouring and treatment planning, teaching treatment planning and other subjects, and troubleshooting using modern telecommunications technology in Senegal, Ghana, and Zimbabwe; 2) Assistance in the transition from 2D to 3D in Senegal and Zimbabwe; 3) Assistance in the transition from 3D to IMRT using in-house compensators in Senegal; 4) Modernizing the cancer center in Senegal and increasing safety and; 5) Training on on 3D techniques in Ghana; 6) Assisting a teaching and training radiation oncology center to be built in Zimbabwe; 7) Working with the ISEP Program in Sub-Saharan Africa; 8) Creating instructional videos on linac commissioning; 9) Working on a possible collaboration to train physicists in Nigeria. Building on past achievements, the subcommittee seeks to make a larger impact on the continent, as the number and size of projects increases and more human resources become available. The State of Medical Physics Collaborations and Projects in Latin America Sandra Guzman (Peru) The lack of Medical Physicists (MP) in many Latin American (LA) countries leads to recruitment of professionals with incomplete education. In most LA countries only one MP responsible for each Center is currently mandated. Currently there is a large disparity among MP training programs and there is significant debate about the standards of MP graduate education in many LA countries. There are no commonly recognized academic programs, not enough clinical training sites and clinical training is not typically considered as part of the MP work. Economic pressures and high workloads also impede the creation of more training centers. The increasing need of qualified MPs require establishing a coordinated system of national Education & Training Centers (ETC), to meet the international standards of education and training in Medical Physics. This shortfall calls for support of organizations such as the IOMP, AAPM, ALFIM, IAEA, etc. Examples from various LA countries, as well as some proposed solutions, will be presented. In particular, we will discuss the resources that the AAPM and its members can offer to support regional programs. The ‘Medical Imaging’ physicist in the emerging world: Challenges and opportunities - Caridad Borrás (WGNIMP Chair) While the role of radiation therapy physicists in the emerging world is reasonably well established, the role of medical imaging physicists is not. The only perceived needs in radiology departments are equipment quality control and radiation protection, tasks that can be done by a technologist or a service engineer. To change the situation, the International Basic Safety Standard, which is adopted/adapted world-wide as national radiation protection regulations, states: “For diagnostic radiological procedures and image guided interventional procedures, the requirements of these Standards for medical imaging, calibration, dosimetry and quality assurance, including the acceptance and commissioning of medical radiological equipment, are fulfilled by or under the oversight of, or with the documented advice of a medical physicist, whose degree of involvement is determined by the complexity of the radiological procedures and the associated radiation risks”. Details on how these requirements can be carried out in resource-limited settings will be described. IAEA support to medical physics in Africa and Latin America: achievements and challenges Ahmed Meghzifene (IAEA) Shortage of clinically qualified medical physicists in radiotherapy and imaging, insufficient and inadequate education and training programs, as well as a lack of professional recognition were identified as the main issues to be addressed by the IAEA. The IAEA developed a series of integrated projects aiming specifically at promoting the essential role of medical physicists in health care, developing harmonized guidelines on dosimetry and quality assurance, and supporting education and clinical training programs. The unique feature of the IAEA approach is support it provides for implementation of guidelines and education programs in Member States through its technical cooperation project. The presentation will summarize IAEA support to Latin America and Africa in the field of medical physics and will highlight how the new International Basic Safety Standards are expected to impact the medical physics practice in low and middle income countries. Learning Objectives: Learn about the shortage of qualified Medical Physicists in Africa and Latin America. Understand the reasons of this shortage. Learn about the ways to improve the situation and AAPM role in this process.
220 213 Effects of Weeds on the Profitabili
African Journals Online (AJOL)
2008-12-02
Dec 2, 2008 ... This signifies that lack of weeding decreased farm profit more than the cost of weeding. Hence, the contribution of weeding cost to farm revenue is more important than its opportunity cost. However, the production of both crops will be more profitable if the cost weeding is reduced or saved since it cannot be.
76 FR 213 - National Environmental Policy Act Implementing Procedures
2011-01-03
... DOE responses to comments would then be published in the Federal Register. What kinds of changes does... classes of actions in Section IV below. DOE also proposes to modify certain technology-specific vocabulary... improve internal consistency. For example, to update technology-specific vocabulary, DOE proposes to...
49 CFR 232.213 - Extended haul trains.
2010-10-01
..., DEPARTMENT OF TRANSPORTATION BRAKE SYSTEM SAFETY STANDARDS FOR FREIGHT AND OTHER NON-PASSENGER TRAINS AND... access to visually observe all brake and freight car inspections and tests required by this section. (b... railroad may be permitted to move a train up to, but not exceeding, 1,500 miles between brake tests and...
49 CFR 213.343 - Continuous welded rail (CWR).
2010-10-01
... and inspection of CWR, and a training program for the application of those procedures, which shall be... owner shall have in effect a comprehensive training program for the application of these written CWR... formation of a lateral mis-alinement sufficient in magnitude to constitute a deviation of 5 inches measured...
8 CFR 213a.2 - Use of affidavit of support.
2010-01-01
... executed when a sponsor signs a Form I-864 and that Form I-864 is submitted, together with the current... immigrant's application for admission or adjustment of status. In the case of a sponsor who comes to the..., and any household member's support obligation under Form I-864A, all begin when the immigration...
40 CFR 21.3 - Submission of applications.
2010-07-01
...) Additionally, if the applicant has received from a State Water Pollution Control Agency a permit issued by the...., 70 Dallas, TX 75201 Arkansas, Louisiana, New Mexico, Oklahoma, and Texas. VII Regional Administrator... assumed by the State may be obtained from either the appropriate Regional Administrator or the State Water...
Lifescience Database Archive (English)
Full Text Available SIKDEKVAAKISDSDKSTIESETESVLKWLESNQTAEKDEYEDKMKALEAVVNPIMSKLY QEGGMPQGGGMPGGMSNDSPKSSNNKVDELD*rnfse Translated...SIKDEKVAAKISDSDKSTIESETESVLKWLESNQTAEKDEYEDKMKALEAVVNPIMSKLY QEGGMPQGGGMPGGMSNDSPKSSNNKVDELD*rnfse Frame C:
Lifescience Database Archive (English)
Full Text Available ALVNSYEFPDGQVITIGNERFRCPEALFQPSFLGMESAG IHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKI*iiapp erkysvwiggsilas...FPDGQVITIGNERFRCPEALFQPSFLGMESAG IHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKI*iiapp erkysvwiggsilas
220 213 Effects of Weeds on the Profitabili
African Journals Online (AJOL)
2008-12-02
Dec 2, 2008 ... grown in mixture, proportions based on the cropping patterns were used to arrive at the cost of each operation per respondent. The cost of fixed assets used was valued by using straight line method of depreciation. Since the assets were used for crops grown in mixture, the depreciated value of each asset.
5 CFR 213.3102 - Entire executive civil service.
2010-01-01
... pending completion of competitive examining, clearances, or other procedures required for a longer...) Executive branch employees (other than employees of intelligence agencies) who are entitled to placement... intelligence agencies defined in 5 U.S.C. 2302(a)(2)(C)(ii) who are entitled to placement under § 353.110. (2...
29 CFR 1910.213 - Woodworking machinery requirements.
2010-07-01
... be so constructed that they can be firmly secured to the table or table assembly without changing... workplace for use when a standard guard cannot be used, as in dadoing, grooving, jointing, moulding, and... in contact with the material being cut but it shall not offer any considerable resistance to...
45 CFR 213.22 - Authority of presiding officer.
2010-10-01
... PROCEDURE FOR HEARINGS TO STATES ON CONFORMITY OF PUBLIC ASSISTANCE PLANS TO FEDERAL REQUIREMENTS Hearing... continue the hearing in whole or in part. In hearings pursuant to section 1116(a)(2) of the Social Security...
46 CFR 10.213 - National Driver Register.
2010-10-01
... in effect. 1 Any applicant who has ever been the user of, or addicted to the use of, a dangerous drug... of an accredited alcohol or drug abuse rehabilitation program; (2) Active membership in a... Guard in evaluating applicants who have drug or alcohol related NDR-listed convictions. Non-drug or...
TU-CD-213-04: Panel Discussion
Energy Technology Data Exchange (ETDEWEB)
Johnson, J. [MD Anderson Cancer Center (United States)
2015-06-15
As part of the AAPM’s Scope of Practice, medical physicists are expected to collaborate effectively with practioners and allied health care providers. Interpersonal skills such as communication, negotiation and persuasion are vital for successful collaboration to achieve shared goals. This session will provide some theoretical background of these interpersonal skills as well as specific techniques and practical tools to influence others. Applications of these interpersonal skills for administrative and human resource management purposes vital to medical physicists will be shared. Session attendees will gain knowledge and tools to help them effectively collaborate with administrative and physician leaders in areas such as capital and human resource selection, prioritization, and implementation. Participants will hear methods of how to articulate their goals and to understand the goals of administration, helping ensure alignment of purpose. Session speakers will present one of the topics: equipment selection, budget creation, contracts, and program-related policy development. Specifics may include designing a business case in language that administrators understand, calculating the prioritization of budget requests, and influencing policies for safe and effective care. Human resource topics may include staffing justification, recruitment for fit, employment contracts, and benefits. Speakers will provide examples in both radiation therapy and diagnostic imaging departments and will share experiences and outcomes of their approaches for better results. Learning Objectives: After this course attendees will be better able to Understand the shared goal between administrative and physicist leadership. Articulate the “why” of the technical or human resource need. Utilize communication, negotiation and persuasion tools to improve collaboration.
213 SIG et distribution spatiale des infrastructures hydrauliques ...
African Journals Online (AJOL)
CARMELLE
afriquescience.info. Sylvie Carmelle Gérardine HOUNGUEVOU et al. SIG et distribution spatiale des infrastructures hydrauliques dans la commune de Zè au Benin. Sylvie Carmelle GérardineHOUNGUEVOU1, Coovi Aimé BernadinTOHOZIN2*,.
49 CFR 213.333 - Automated vehicle inspection systems.
2010-10-01
... lateral capacity of the track structure shall not permit a gage widening ratio (GWR) greater than 0.5... caution to protect against the risk of wheel climb by the test wheelset. S = L −cV where: S = Load... instrumented car having dynamic response characteristics that are representative of other equipment assigned to...
Lifescience Database Archive (English)
Full Text Available ; 40 0.033 AK122250_1( AK122250 |pid:none) Mus musculus mRNA for mKIAA0337 pr... 40 0.033 AB001770_1( AB001770 |pid:none) Ciona savig...nyi pem-2 (posterior en... 39 0.043 protein update 2009. 7. 5 PSORT psg: 0.75 gvh:
2-(1,3-Benzoxazol-2-ylsulfanyl-1-phenylethanone
Directory of Open Access Journals (Sweden)
Hossein Loghmani-Khouzani
2009-09-01
Full Text Available In the title compound, C15H11NO2S, a new thio-benzoxazole derivative, the dihedral angle between the benzoxazole ring and the phenyl ring is 9.91 (9°. An interesting feature of the crystal structure is the short C...S [3.4858 (17 Å] contact, which is shorter than the sum of the van der Waals radii of these atoms. In the crystal structure, molecules are linked together by zigzag intermolecular C—H...N interactions into a column along the a axis. The crystal structure is further stabilized by intermolecular π–π interactions [centroid–centroid = 3.8048 (10 Å].
2-(1,3-Benzoxazol-2-ylguanidinium chloride
Directory of Open Access Journals (Sweden)
Shaaban K. Mohamed
2011-11-01
Full Text Available The non-H atoms of the cation of the title salt, C8H9N4O+·Cl−, are approximately co-planar (r.m.s. deviation = 0.024 Å with one amino group forming an intramolecular hydrogen bond to the tertiary N atom of the benzoxazole fused-ring system. The cations and anions are linked by cyclic R21(6 N—H...Cl hydrogen-bonding associations, generating linear chains running along the a-axis direction.
33 CFR 135.213 - Qualification as self-insurer.
2010-07-01
... required financial statements are prepared in consolidated form and the liability represents less than the full financial backing of the consolidated entity, otherwise they may be prepared and submitted by the... statement, and statement of changes in financial position that are certified by an independent Certified...
38 CFR 3.213 - Change of status affecting entitlement.
2010-07-01
... additional allowance is being paid to the veteran or surviving spouse for a child), or fiduciary, setting.... A statement by the veteran setting forth the month and year of death of a spouse, child, or... setting forth the month and year of remarriage and any change of name. (An award for a child or children...
Publications | Page 213 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, de la mise en commun des connaissances et de la formation. Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons à ...
48 CFR 52.213-1 - Fast Payment Procedure.
2010-10-01
... (CONTINUED) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52... post office or common carrier (or, if shipped by other means, to the point of first receipt by the Government). (b) Responsibility for supplies. (1) Title to the supplies passes to the Government upon...
12 CFR Appendix B to Part 213 - Federal Enforcement Agencies
2010-01-01
.... 1813(s)) shall have the meaning given to them in the International Banking Act of 1978 (12 U.S.C. 3101). 1. National banks and federal branches and federal agencies of foreign banks District office of the Office of the Comptroller of the Currency for the district in which the institution is located. 2. State...
Lifescience Database Archive (English)
Full Text Available NCE, 1 ordered piece. 46 0.95 1 BQ476622 |BQ476622.1 curculio3e06.g Curculio glandium cDNA Curculio glandium cDNA clone curculio...3e06 3', mRNA sequence. 46 0.95 1 BQ476340 |BQ476340.1 curculio3e06.b Curculio glandium ...cDNA Curculio glandium cDNA clone curculio3e06 5', mRNA sequence. 46 0.95 1 AP004
26 CFR 1.213-1 - Medical, dental, etc., expenses.
2010-04-01
..., a seeing eye dog, artificial teeth and limbs, a wheel chair, crutches, an inclinator or an air... the benefits are payable in cash or in services. For example, amounts paid for hospitalization... medical insurance benefits for the aged, are amounts paid for insurance covering expenses of medical care...
Tumor Immunotargeting Using Innovative Radionuclides
Directory of Open Access Journals (Sweden)
Françoise Kraeber-Bodéré
2015-02-01
Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.
Energy Technology Data Exchange (ETDEWEB)
Bourgeois, M
2007-05-15
The radio-immunotherapy is an anti cancerous therapy which consists in vectorising with immuno-specific agents very radio toxic radioelements on tumors or in their environment to destroy them. The first part of this report presents the different characteristics of antibodies as well as their means of production under monoclonal shapes specifically steered against a tumoral antigen of interest. The second part of this report replaces the importance of the immunological vectors in the context of the nuclear medicine. It is notably described that the different methods which allow to radio-label the vector, as well as the different ways of optimization which were envisaged to improve the targeting of radioelements on a tumor. These different developments allow to define the potential place of the alpha radio-immunotherapy in treatments and so re-place the interest of the experimental part. If the radio-immunotherapy, using beta emitters isotopes as the {sup 131}iodine or the{sup 90}yttrium, is today current in anti cancerous therapy, it finds limits because of the disintegration characteristics of the isotopes it uses. Indeed, compared with alpha particles, the beta particles deposit less energy by unit of length in the crossed material.The experimental part of this report aims at studying the feasibility of the coupling between an immunological vector and an alpha emitter isotope.The different tests led on the bismuth 213, the bismuth 212, the lead 212 and the astatine 211 demonstrated that the fixation of these radionuclides was possible. This research theme is strengthened by the construction in Nantes of a cyclotron with high energy ( A.R.R.O.N.A.X.) and the optimization of the obtained promising results should allow a therapeutic use in oncology of the alpha radio-immunotherapy. (N.C.)
Assessing the Role of Oxidized Methionine at Position 213 in the Formation of Prions in Hamsters
Prions are infectious proteins that are able to recruit a normal cellular prion protein and convert it into a prion. The mechanism of this conversion is unknown. Detailed mass spectrometric analysis of the normal cellular prion protein and a corresponding prion has shown they possess identical post-...
49 CFR 213.305 - Designation of qualified individuals; general qualifications.
2010-10-01
..., designated to: (a) Supervise restorations and renewals of track shall meet the following minimum requirements... writing by the track owner to prescribe remedial actions to correct or safely compensate for deviations...) Be authorized in writing by the track owner to prescribe remedial actions to correct or safely...
12 CFR Supplement I to Part 213 - Official Staff Commentary to Regulation M
2010-01-01
... from liability under section 130(f) of the Truth in Lending Act (15 U.S.C. 1640(f)). Section 130(f) protects lessors from civil liability for any act done or omitted in good faith in conformity with any.... Realized value is relevant only to leases in which the lessee's liability at early termination or at the...
SU-E-T-213: Development of a Web Wrapper to Facilitate Radiotherapy Research.
Folkerts, M; Graves, Y; Gautier, Q; Kim, G; Jia, X; Jiang, S
2012-06-01
Researchers write many computer programs with unique implementations, usually requiring a great amount of effort for other researchers to learn how to install, configure, and use. Some programs require specialized hardware platforms such as GPU workstation or CPU cluster, which may not readily available for many researchers. This work develops a general web platform to 'wrap' radiotherapy software tools into a user friendly, browser-based interface. We developed a web wrapper based on existing technologies (e.g. HTML5, JavaScript, PHP, Python, XML) to interface with command line-based research tools. This wrapper enables users to easily perform various tasks in any modern web browser, while underlying tools are launched remotely. Visitors can upload data, configure settings, process data remotely, then view, share, and download results with minimal effort. This web wrapper is developer friendly; new tools are easily integrated by editing XML configuration files. As a test case, we have successfully wrapped a set of command line tools, developed by our group, into a single web app, providing fluence map generation, CT image processing, and GPU-based Monte Carlo (MC) dose calculation. The result is a web-based quality assurance tool. With this tool, users can upload compressed DICOM-RT files, recompute dose using the MC method, and evaluate the results by viewing dose distribution, 3D gamma index distribution and DVH curves. The entire work-flow can be completed within 2 minutes provided users have a reasonable Internet connection speed. We have developed an web wrapper to increase the accessibility of radiotherapy tools and reduce users' learning curve through a friendly web-based interface. This work also allows quick and easy deployment and distribution of software tools developed by researchers to the whole community. © 2012 American Association of Physicists in Medicine.
77 FR 213 - United States Savings Bonds, Series EE and I
2012-01-04
... Parts 351, 359, and 363 United States Savings Bonds, Series EE and I AGENCY: Bureau of the Public Debt... Series EE and Series I savings bonds a person may acquire each year. DATES: Effective January 4, 2012... the amount of book- entry Series EE and Series I savings bonds a person may acquire each year. Prior...
MO-A-213-01: 2015 Economics Update Part 1
Energy Technology Data Exchange (ETDEWEB)
Dirksen, B. [Mercy Medical Center (United States)
2015-06-15
The purpose of this session is to introduce attendees to the healthcare reimbursement system and how it applies to the clinical work of a Medical Physicist. This will include general information about the different categories of payers and payees, how work is described by CPT© codes, and how various payers set values for this work in different clinical settings. 2015 is a year of significant changes to the payment system. Many CPT© codes have been deleted and replaced with new CPT© codes. These codes define some of the most common work performed in our clinics including treatment planning and delivery. This presentation will describe what work is encompassed in these codes and will give attendees an overview of the changes for 2015 as they apply to radiation oncology. Finally, some insight into what can be expected during 2016 will be presented. This includes what information is typically released by the Centers for Medicaid & Medicare Services (CMS) during the year and how we as an organization respond. This will include ways members can interact with the AAPM professional economics committee and other resources members may find helpful. Learning Objectives: Basics of how Medicare is structured and how reimbursement rates are set. Basic understanding of proposed changes to the 2016 Medicare rules. What resources are available from the AAPM and how to interact with the professional economics committee. Ownership in pxAlpha, LLC, a medical device start up company.
MO-A-213-02: 2015 Economics Update Part 2
Energy Technology Data Exchange (ETDEWEB)
Fontenot, J. [Mary Bird Perkins Cancer Center (United States)
2015-06-15
The purpose of this session is to introduce attendees to the healthcare reimbursement system and how it applies to the clinical work of a Medical Physicist. This will include general information about the different categories of payers and payees, how work is described by CPT© codes, and how various payers set values for this work in different clinical settings. 2015 is a year of significant changes to the payment system. Many CPT© codes have been deleted and replaced with new CPT© codes. These codes define some of the most common work performed in our clinics including treatment planning and delivery. This presentation will describe what work is encompassed in these codes and will give attendees an overview of the changes for 2015 as they apply to radiation oncology. Finally, some insight into what can be expected during 2016 will be presented. This includes what information is typically released by the Centers for Medicaid & Medicare Services (CMS) during the year and how we as an organization respond. This will include ways members can interact with the AAPM professional economics committee and other resources members may find helpful. Learning Objectives: Basics of how Medicare is structured and how reimbursement rates are set. Basic understanding of proposed changes to the 2016 Medicare rules. What resources are available from the AAPM and how to interact with the professional economics committee. Ownership in pxAlpha, LLC, a medical device start up company.
(2R-2-(1,3-Dioxoisoindolin-2-yl-3-methylbutanoic acid
Directory of Open Access Journals (Sweden)
Abdul Rauf Raza
2011-09-01
Full Text Available In the title compound, C13H13NO4, the dihedral angle between the nine-membered phthalimino ring system and the carboxylic acid group is 67.15 (9°. An intramolecular C—H...O close contact, which forms an S(6 ring, may help to establish the molecular conformation. In the crystal, molecules are linked by O—H...O hydrogen bonds, thereby forming C(7 chains propagating in [010].
Yang et al., Afr J Tradit Complement Altern Med. (2014) 11(1):213-221
African Journals Online (AJOL)
cadewumi
... (70 %±10 %) in a 12h-light and 12h-dark cycle (lights on from 8:00 am to 8:00 ... The levels of TNF-α, IL-6, in serum were measured according to the ... band intensities was measured with gel image processing system. ..... L-O2 injury. Chin J.
213 The Role of Stock Market Development on Economic Growth in ...
African Journals Online (AJOL)
User
should make policies that boost the interest of domestic investors in Nigeria as this might spur investors' interest and boost stock market activity. Keywords: Stock Market Development, Economic Growth, Time Series. Analysis, Nigeria ... suggests that openness to world trade and stock market development are among the key ...
48 CFR 1852.213-70 - Offeror Representations and Certifications-Other Than Commercial Items.
2010-10-01
... (persons with origins from Burma, Thailand, Malaysia, Indonesia, Singapore, Brunei, Japan, China, Taiwan... black college or university” means an institution determined by the Secretary of Education to meet the... institution of higher education meeting the requirements of Section 1046(3) of the Higher Education Act of...
MO-E-213-01: Increasing Role of Medical Physicist in Radiation Protection
Energy Technology Data Exchange (ETDEWEB)
Rehani, M. [Massachusetts General Hospital (United States)
2015-06-15
The focus of work of medical physicists in 1980’s was on quality control and quality assurance. Radiation safety was important but was dominated by occupational radiation protection. A series of over exposures of patients in radiotherapy, nuclear medicine and observation of skin injuries among patients undergoing interventional procedures in 1990’s started creating the need for focus on patient protection. It gave medical physicists new directions to develop expertise in patient dosimetry and dose management. Publications creating awareness on cancer risks from CT in early part of the current century and over exposures in CT in 2008 brought radiation risks in public domain and created challenging situations for medical physicists. Increasing multiple exposures of individual patient and patient doses of few tens of mSv or exceeding 100 mSv are increasing the role of medical physicists. Expansion of usage of fluoroscopy in the hands of clinical professionals with hardly any training in radiation protection shall require further role for medical physicists. The increasing publications in journals, recent changes in Safety Standards, California law, all increase responsibilities of medical physicists in patient protection. Newer technological developments in dose efficiency and protective devices increase percentage of time devoted by medical physicists on radiation protection activities. Without radiation protection, the roles, responsibilities and day-to-day involvement of medical physicists in diagnostic radiology becomes questionable. In coming years either medical radiation protection may emerge as a specialty or medical physicists will have to keep major part of day-to-day work on radiation protection. Learning Objectives: To understand how radiation protection has been increasing its role in day-to-day activities of medical physicist To be aware about international safety Standards, national and State regulations that require higher attention to radiation protection than in past To be aware about possible emergence of medical radiation protection as a specialty and challenges for medical physicists.
MO-E-213-03: Newer Radiation Protection Requirements in Last Decade
Energy Technology Data Exchange (ETDEWEB)
Clements, J. [Kaiser Permanente (United States)
2015-06-15
The focus of work of medical physicists in 1980’s was on quality control and quality assurance. Radiation safety was important but was dominated by occupational radiation protection. A series of over exposures of patients in radiotherapy, nuclear medicine and observation of skin injuries among patients undergoing interventional procedures in 1990’s started creating the need for focus on patient protection. It gave medical physicists new directions to develop expertise in patient dosimetry and dose management. Publications creating awareness on cancer risks from CT in early part of the current century and over exposures in CT in 2008 brought radiation risks in public domain and created challenging situations for medical physicists. Increasing multiple exposures of individual patient and patient doses of few tens of mSv or exceeding 100 mSv are increasing the role of medical physicists. Expansion of usage of fluoroscopy in the hands of clinical professionals with hardly any training in radiation protection shall require further role for medical physicists. The increasing publications in journals, recent changes in Safety Standards, California law, all increase responsibilities of medical physicists in patient protection. Newer technological developments in dose efficiency and protective devices increase percentage of time devoted by medical physicists on radiation protection activities. Without radiation protection, the roles, responsibilities and day-to-day involvement of medical physicists in diagnostic radiology becomes questionable. In coming years either medical radiation protection may emerge as a specialty or medical physicists will have to keep major part of day-to-day work on radiation protection. Learning Objectives: To understand how radiation protection has been increasing its role in day-to-day activities of medical physicist To be aware about international safety Standards, national and State regulations that require higher attention to radiation protection than in past To be aware about possible emergence of medical radiation protection as a specialty and challenges for medical physicists.
MO-E-213-00: What Is Medical Physics Without Radiation Safety?
Energy Technology Data Exchange (ETDEWEB)
NONE
2015-06-15
The focus of work of medical physicists in 1980’s was on quality control and quality assurance. Radiation safety was important but was dominated by occupational radiation protection. A series of over exposures of patients in radiotherapy, nuclear medicine and observation of skin injuries among patients undergoing interventional procedures in 1990’s started creating the need for focus on patient protection. It gave medical physicists new directions to develop expertise in patient dosimetry and dose management. Publications creating awareness on cancer risks from CT in early part of the current century and over exposures in CT in 2008 brought radiation risks in public domain and created challenging situations for medical physicists. Increasing multiple exposures of individual patient and patient doses of few tens of mSv or exceeding 100 mSv are increasing the role of medical physicists. Expansion of usage of fluoroscopy in the hands of clinical professionals with hardly any training in radiation protection shall require further role for medical physicists. The increasing publications in journals, recent changes in Safety Standards, California law, all increase responsibilities of medical physicists in patient protection. Newer technological developments in dose efficiency and protective devices increase percentage of time devoted by medical physicists on radiation protection activities. Without radiation protection, the roles, responsibilities and day-to-day involvement of medical physicists in diagnostic radiology becomes questionable. In coming years either medical radiation protection may emerge as a specialty or medical physicists will have to keep major part of day-to-day work on radiation protection. Learning Objectives: To understand how radiation protection has been increasing its role in day-to-day activities of medical physicist To be aware about international safety Standards, national and State regulations that require higher attention to radiation protection than in past To be aware about possible emergence of medical radiation protection as a specialty and challenges for medical physicists.
MO-E-213-02: Medical Physicist Involvement in Implementing Patient Protection Standards
Energy Technology Data Exchange (ETDEWEB)
Seibert, J. [UC Davis Medical Center (United States)
2015-06-15
The focus of work of medical physicists in 1980’s was on quality control and quality assurance. Radiation safety was important but was dominated by occupational radiation protection. A series of over exposures of patients in radiotherapy, nuclear medicine and observation of skin injuries among patients undergoing interventional procedures in 1990’s started creating the need for focus on patient protection. It gave medical physicists new directions to develop expertise in patient dosimetry and dose management. Publications creating awareness on cancer risks from CT in early part of the current century and over exposures in CT in 2008 brought radiation risks in public domain and created challenging situations for medical physicists. Increasing multiple exposures of individual patient and patient doses of few tens of mSv or exceeding 100 mSv are increasing the role of medical physicists. Expansion of usage of fluoroscopy in the hands of clinical professionals with hardly any training in radiation protection shall require further role for medical physicists. The increasing publications in journals, recent changes in Safety Standards, California law, all increase responsibilities of medical physicists in patient protection. Newer technological developments in dose efficiency and protective devices increase percentage of time devoted by medical physicists on radiation protection activities. Without radiation protection, the roles, responsibilities and day-to-day involvement of medical physicists in diagnostic radiology becomes questionable. In coming years either medical radiation protection may emerge as a specialty or medical physicists will have to keep major part of day-to-day work on radiation protection. Learning Objectives: To understand how radiation protection has been increasing its role in day-to-day activities of medical physicist To be aware about international safety Standards, national and State regulations that require higher attention to radiation protection than in past To be aware about possible emergence of medical radiation protection as a specialty and challenges for medical physicists.
48 CFR 213.270 - Use of the Governmentwide commercial purchase card.
2010-10-01
... exception for an electronic commerce/electronic data interchange system or operational requirement that... Medical Electronic Catalog Program are two examples where use of the purchase card may not be cost...
49 CFR 40.213 - What training requirements must STTs and BATs meet?
2010-10-01
.... (f) Error Correction Training. If you make a mistake in the alcohol testing process that causes a... demonstrate proficiency in alcohol testing under this part by completing seven consecutive error-free mock tests (BATs) or five consecutive error-free tests (STTs). (1) Another person must monitor and evaluate...
MO-D-213-01: Workflow Monitoring for a High Volume Radiation Oncology Center
Energy Technology Data Exchange (ETDEWEB)
Laub, S [CDH Proton Center, Warrenville, IL (United States); Dunn, M [Proton Collaborative Group, Warrenville, Illinois (United States); Galbreath, G [ProCure Treatment Centers Inc., New York, NY (United States); Gans, S [Northwestern Memorial Chicago Proton Center, Warrenville, Illinois (United States); Pankuch, M [Northwestern Medicine Chicago Proton Center, Warrenville, IL (United States)
2015-06-15
Purpose: Implement a center wide communication system that increases interdepartmental transparency and accountability while decreasing redundant work and treatment delays by actively monitoring treatment planning workflow. Methods: Intake Management System (IMS), a program developed by ProCure Treatment Centers Inc., is a multi-function database that stores treatment planning process information. It was devised to work with the oncology information system (Mosaiq) to streamline interdepartmental workflow.Each step in the treatment planning process is visually represented and timelines for completion of individual tasks are established within the software. The currently active step of each patient’s planning process is highlighted either red or green according to whether the initially allocated amount of time has passed for the given process. This information is displayed as a Treatment Planning Process Monitor (TPPM), which is shown on screens in the relevant departments throughout the center. This display also includes the individuals who are responsible for each task.IMS is driven by Mosaiq’s quality checklist (QCL) functionality. Each step in the workflow is initiated by a Mosaiq user sending the responsible party a QCL assignment. IMS is connected to Mosaiq and the sending or completing of a QCL updates the associated field in the TPPM to the appropriate status. Results: Approximately one patient a week is identified during the workflow process as needing to have his/her treatment start date modified or resources re-allocated to address the most urgent cases. Being able to identify a realistic timeline for planning each patient and having multiple departments communicate their limitations and time constraints allows for quality plans to be developed and implemented without overburdening any one department. Conclusion: Monitoring the progression of the treatment planning process has increased transparency between departments, which enables efficient communication. Having built-in timelines allows easy prioritization of tasks and resources and facilitates effective time management.
Synthesis and antibacterial evaluation of 2-(1,3- Benzodioxol-5 ...
African Journals Online (AJOL)
The structural formulae of the synthesized compounds were characterized by infra red spectroscopy (IR), proton nuclear magnetic resonance (1H-NMR) and electron impact mass spectrometry (EI-MS). The compounds were screened for in vitro antibacterial activity by determining their minimum inhibitory concentration ...
30 CFR 250.213 - What general information must accompany the EP?
2010-07-01
... stop the blowout, the availability of a rig to drill a relief well, and rig package constraints... OFFSHORE OIL AND GAS AND SULPHUR OPERATIONS IN THE OUTER CONTINENTAL SHELF Plans and Information Contents... conduct your proposed exploration activities. (b) Drilling fluids. A table showing the projected amount...
213 The Role of Stock Market Development on Economic Growth in ...
African Journals Online (AJOL)
User
E-mail:bluebenresearch@yahoo.com. Tel: + ... time series data. Also, a very recent study by Ake and Ognaligui (2010) posited that Douala Stock Exchange does not affect Cameroonian economic growth. Vol. 5 (6), Serial No. ... markets can give a big boost to economic development (Rousseau and. Wachtel, 2000).
2012-03-22
... from last full plenary meeting Review and approve updated terms of reference for submittal to PMC..., September/October Europe) Adjourn Attendance is open to the interested public but limited to space...
48 CFR 1352.213-70 - Evaluation utilizing simplified acquisition procedures.
2010-10-01
... parties, proactive management and customer satisfaction. (4) Price. (End of clause) ... offeror whose quotation results in the best value to the Government, considering both price and non-price...
SU-D-213-01: Transparent Photon Detector For The Online Monitoring Of IMRT Beams
Energy Technology Data Exchange (ETDEWEB)
Delorme, R; Arnoud, Y; Fabbro, R; Boyer, B; Rossetto, O; Gallin-Martel, L; Gallin-Martel, M; Pelissier, A; Fonteille, I [LPSC, Universite Joseph Fourier Grenoble 1, CNRS/IN2P3, Grenoble INP, Grenoble (France); Giraud, J [Centre Hospitalier Universitaire de Grenoble, Inserm U836, La Tronche (France)
2015-06-15
Purpose: An innovative Transparent Detector for Radiotherapy (TraDeRa) has been developed. The detector aims at real-time monitoring of modulated beam ahead of the patient during delivery sessions, with a field cover up to 40×40 cm {sup 2}. Methods: TraDeRa consists in a pixelated matrix of ionization chambers with a patented electrodes design. An in-house designed specific integrated circuit allows to extract the signal and provides a real-time map of beam intensity and shape, at the linac pulse-scale. The measurements under irradiation are made with a 6 MV clinical X-Ray beam. Dose calculations are performed with the Monte Carlo code PENELOPE, modeling the full accelerator head and the TraDeRa detector. Results: A 2 % attenuation of the beam was measured in the presence of TraDeRa and the PENELOPE dosimetric study showed no significant modification of the photon beam properties. TraDeRa detects error leaf position as small as 1 mm compared to a reference field, for both static and modulated fields. In addition, measurements are accurate over a large dynamic range from low intensity signals, as inter-leaves leaks, to very high intensities as obtained on the medical line of the European Synchrotron Radiation Facility. The detector is fully operational for conventional and high dose rate beams as FFF modes (up to 2400 MU/min). Conclusion: The current version of TraDeRa shows promising results for IMRT quality assurance (QA), allowing pulse-scale monitoring of the beam and high sensitivity for errors detection. The attenuation is small enough not to hinder the irradiation while keeping the beam upstream of the patient under constant control. A final prototype under development will include 1600 independent electrodes, half of them with a high resolution centered on the beam axis. This compact detector provides an independent set of measurements for a better QA. Funding support : This work was supported by the LABEX PRIMES (ANR-11-LABX-0063) of Universite de Lyon, within the program “Investissements d’Avenir” (ANR-11-IDEX-0007) operated by the French National Research Agency (ANR) and within the project “INSPIRA” operated by the OSEO institution.
High resolution infrared spectroscopy of carbon dioxide clusters up to (CO2)13
Norooz Oliaee, J.; Dehghany, M.; McKellar, A. R. W.; Moazzen-Ahmadi, N.
2011-01-01
Thirteen specific infrared bands in the 2350 cm−1 region are assigned to carbon dioxide clusters, (CO2)N, with N = 6, 7, 9, 10, 11, 12 and 13. The spectra are observed in direct absorption using a tuneable infrared laser to probe a pulsed supersonic jet expansion of a dilute mixture of CO2 in He carrier gas. Assignments are aided by cluster structure calculations made using two reliable CO2 intermolecular potential functions. For (CO2)6, two highly symmetric isomers are observed, one with S6 ...
WE-G-213CD-06: Implementation of Real-Time Tumor Tracking Using Robotic Couch.
Buzurovic, I; Yu, Y; Podder, T
2012-06-01
The purpose of this study was to present a novel method for real- time tumor tracking using a commercially available robotic treatment couch, and to evaluate tumor tracking accuracy. Commercially available robotic couches are capable of positioning patients with high level of accuracy; however, currently there is no provision for compensating tumor motion using these systems. Elekta's existing commercial couch (PreciseTM Table) was used without changing its design. To establish the real-time couch motion for tracking, a novel control system was developed and implemented. The tabletop could be moved in horizontal plane (laterally and longitudinally) using two Maxon-24V motors with gearbox combination. Vertical motion was obtained using robust 70V-Rockwell Automation motor. For vertical motor position sensing, we used Model 755A-Accu- Coder encoder. Two Baumer-ITD_01_4mm shaft encoders were used for the lateral and longitudinal motions of the couch. Motors were connected to the Advance Motion Controls (AMC) amplifiers: for the vertical motion, motor AMC-20A20-INV amplifier was used, and two AMC-Z6A8 amplifiers were applied for the lateral and longitudinal couch motions. The Galil DMC-4133 controller was connected to standard PC computer using USB port. The system had two independent power supplies: Galil PSR-12- 24-12A, 24vdc power supply with diodes for controller and 24vdc motors and amplifiers, and Galil-PS300W72 72vdc power supply for vertical motion. Control algorithms were developed for position and velocity adjustment. The system was tested for real-time tracking in the range of 50mm in all 3 directions (superior-inferior, lateral, anterior- posterior). Accuracies were 0.15, 0.20, and 0.18mm, respectively. Repeatability of the desired motion was within ± 0.2mm. Experimental results of couch tracking show feasibility of real-time tumor tracking with high level of accuracy (within sub-millimeter range). This tracking technique potentially offers a simple and effective method to minimize healthy tissues irradiation.Acknowledgement: Study supported by Elekta,Ltd. Study supported by Elekta, Ltd. © 2012 American Association of Physicists in Medicine.
WE-AB-213-01: AAPM Projects and Collaborations in Africa
Energy Technology Data Exchange (ETDEWEB)
Shulman, A.
2015-06-15
AAPM projects and collaborations in Africa Adam Shulman (AA-SC Chair) The African Affairs Subcommittee (AA-SC) of the AAPM will present a multi-institutional approach to medical physics support in Africa. Current work to increase the quality of care and level of safety for the medical physics practice in Senegal, Ghana, and Zimbabwe will be presented, along with preliminary projects in Nigeria and Botswana. Because the task of addressing the needs of medical physics in countries across Africa is larger than one entity can accomplish on its own, the AA-SC has taken the approach of joining forces with multiple organizations such as Radiating Hope and TreatSafely (NGO’s), the IAEA, companies like BrainLab, Varian and Elekta, medical volunteers and academic institutions such as NYU and Washington University. Elements of current projects include: 1) Distance training and evaluation of the quality of contouring and treatment planning, teaching treatment planning and other subjects, and troubleshooting using modern telecommunications technology in Senegal, Ghana, and Zimbabwe; 2) Assistance in the transition from 2D to 3D in Senegal and Zimbabwe; 3) Assistance in the transition from 3D to IMRT using in-house compensators in Senegal; 4) Modernizing the cancer center in Senegal and increasing safety and; 5) Training on on 3D techniques in Ghana; 6) Assisting a teaching and training radiation oncology center to be built in Zimbabwe; 7) Working with the ISEP Program in Sub-Saharan Africa; 8) Creating instructional videos on linac commissioning; 9) Working on a possible collaboration to train physicists in Nigeria. Building on past achievements, the subcommittee seeks to make a larger impact on the continent, as the number and size of projects increases and more human resources become available. The State of Medical Physics Collaborations and Projects in Latin America Sandra Guzman (Peru) The lack of Medical Physicists (MP) in many Latin American (LA) countries leads to recruitment of professionals with incomplete education. In most LA countries only one MP responsible for each Center is currently mandated. Currently there is a large disparity among MP training programs and there is significant debate about the standards of MP graduate education in many LA countries. There are no commonly recognized academic programs, not enough clinical training sites and clinical training is not typically considered as part of the MP work. Economic pressures and high workloads also impede the creation of more training centers. The increasing need of qualified MPs require establishing a coordinated system of national Education & Training Centers (ETC), to meet the international standards of education and training in Medical Physics. This shortfall calls for support of organizations such as the IOMP, AAPM, ALFIM, IAEA, etc. Examples from various LA countries, as well as some proposed solutions, will be presented. In particular, we will discuss the resources that the AAPM and its members can offer to support regional programs. The ‘Medical Imaging’ physicist in the emerging world: Challenges and opportunities - Caridad Borrás (WGNIMP Chair) While the role of radiation therapy physicists in the emerging world is reasonably well established, the role of medical imaging physicists is not. The only perceived needs in radiology departments are equipment quality control and radiation protection, tasks that can be done by a technologist or a service engineer. To change the situation, the International Basic Safety Standard, which is adopted/adapted world-wide as national radiation protection regulations, states: “For diagnostic radiological procedures and image guided interventional procedures, the requirements of these Standards for medical imaging, calibration, dosimetry and quality assurance, including the acceptance and commissioning of medical radiological equipment, are fulfilled by or under the oversight of, or with the documented advice of a medical physicist, whose degree of involvement is determined by the complexity of the radiological procedures and the associated radiation risks”. Details on how these requirements can be carried out in resource-limited settings will be described. IAEA support to medical physics in Africa and Latin America: achievements and challenges Ahmed Meghzifene (IAEA) Shortage of clinically qualified medical physicists in radiotherapy and imaging, insufficient and inadequate education and training programs, as well as a lack of professional recognition were identified as the main issues to be addressed by the IAEA. The IAEA developed a series of integrated projects aiming specifically at promoting the essential role of medical physicists in health care, developing harmonized guidelines on dosimetry and quality assurance, and supporting education and clinical training programs. The unique feature of the IAEA approach is support it provides for implementation of guidelines and education programs in Member States through its technical cooperation project. The presentation will summarize IAEA support to Latin America and Africa in the field of medical physics and will highlight how the new International Basic Safety Standards are expected to impact the medical physics practice in low and middle income countries. Learning Objectives: Learn about the shortage of qualified Medical Physicists in Africa and Latin America. Understand the reasons of this shortage. Learn about the ways to improve the situation and AAPM role in this process.
WE-AB-213-02: Status of Medical Physics Collaborations, and Projects in Latin America
Energy Technology Data Exchange (ETDEWEB)
Guzman, S.
2015-06-15
AAPM projects and collaborations in Africa Adam Shulman (AA-SC Chair) The African Affairs Subcommittee (AA-SC) of the AAPM will present a multi-institutional approach to medical physics support in Africa. Current work to increase the quality of care and level of safety for the medical physics practice in Senegal, Ghana, and Zimbabwe will be presented, along with preliminary projects in Nigeria and Botswana. Because the task of addressing the needs of medical physics in countries across Africa is larger than one entity can accomplish on its own, the AA-SC has taken the approach of joining forces with multiple organizations such as Radiating Hope and TreatSafely (NGO’s), the IAEA, companies like BrainLab, Varian and Elekta, medical volunteers and academic institutions such as NYU and Washington University. Elements of current projects include: 1) Distance training and evaluation of the quality of contouring and treatment planning, teaching treatment planning and other subjects, and troubleshooting using modern telecommunications technology in Senegal, Ghana, and Zimbabwe; 2) Assistance in the transition from 2D to 3D in Senegal and Zimbabwe; 3) Assistance in the transition from 3D to IMRT using in-house compensators in Senegal; 4) Modernizing the cancer center in Senegal and increasing safety and; 5) Training on on 3D techniques in Ghana; 6) Assisting a teaching and training radiation oncology center to be built in Zimbabwe; 7) Working with the ISEP Program in Sub-Saharan Africa; 8) Creating instructional videos on linac commissioning; 9) Working on a possible collaboration to train physicists in Nigeria. Building on past achievements, the subcommittee seeks to make a larger impact on the continent, as the number and size of projects increases and more human resources become available. The State of Medical Physics Collaborations and Projects in Latin America Sandra Guzman (Peru) The lack of Medical Physicists (MP) in many Latin American (LA) countries leads to recruitment of professionals with incomplete education. In most LA countries only one MP responsible for each Center is currently mandated. Currently there is a large disparity among MP training programs and there is significant debate about the standards of MP graduate education in many LA countries. There are no commonly recognized academic programs, not enough clinical training sites and clinical training is not typically considered as part of the MP work. Economic pressures and high workloads also impede the creation of more training centers. The increasing need of qualified MPs require establishing a coordinated system of national Education & Training Centers (ETC), to meet the international standards of education and training in Medical Physics. This shortfall calls for support of organizations such as the IOMP, AAPM, ALFIM, IAEA, etc. Examples from various LA countries, as well as some proposed solutions, will be presented. In particular, we will discuss the resources that the AAPM and its members can offer to support regional programs. The ‘Medical Imaging’ physicist in the emerging world: Challenges and opportunities - Caridad Borrás (WGNIMP Chair) While the role of radiation therapy physicists in the emerging world is reasonably well established, the role of medical imaging physicists is not. The only perceived needs in radiology departments are equipment quality control and radiation protection, tasks that can be done by a technologist or a service engineer. To change the situation, the International Basic Safety Standard, which is adopted/adapted world-wide as national radiation protection regulations, states: “For diagnostic radiological procedures and image guided interventional procedures, the requirements of these Standards for medical imaging, calibration, dosimetry and quality assurance, including the acceptance and commissioning of medical radiological equipment, are fulfilled by or under the oversight of, or with the documented advice of a medical physicist, whose degree of involvement is determined by the complexity of the radiological procedures and the associated radiation risks”. Details on how these requirements can be carried out in resource-limited settings will be described. IAEA support to medical physics in Africa and Latin America: achievements and challenges Ahmed Meghzifene (IAEA) Shortage of clinically qualified medical physicists in radiotherapy and imaging, insufficient and inadequate education and training programs, as well as a lack of professional recognition were identified as the main issues to be addressed by the IAEA. The IAEA developed a series of integrated projects aiming specifically at promoting the essential role of medical physicists in health care, developing harmonized guidelines on dosimetry and quality assurance, and supporting education and clinical training programs. The unique feature of the IAEA approach is support it provides for implementation of guidelines and education programs in Member States through its technical cooperation project. The presentation will summarize IAEA support to Latin America and Africa in the field of medical physics and will highlight how the new International Basic Safety Standards are expected to impact the medical physics practice in low and middle income countries. Learning Objectives: Learn about the shortage of qualified Medical Physicists in Africa and Latin America. Understand the reasons of this shortage. Learn about the ways to improve the situation and AAPM role in this process.
Subtask 2.13 - Advanced Hybrid Particulate Collector-Fundamental Performance
Energy Technology Data Exchange (ETDEWEB)
Stanley Miller
2007-07-01
Under the Power Plant Improvement Initiative Program funded by the U.S. Department of Energy, a full-scale Advanced Hybrid{trademark} filter was installed at the Big Stone Plant, with start-up in October 2002. The Advanced Hybrid{trademark} filter was retrofitted into Fields 2-4 of the old Big Stone electrostatic precipitator (ESP). While many aspects of the operation were satisfactory, pressure drop was higher than expected. To achieve acceptable pressure drop and successfully demonstrate the Advanced Hybrid{trademark} filter technology, the first fields of the ESP were also converted into an Advanced Hybrid{trademark} filter in 2005. However, since start-up in June 2005, the first fields have been inoperable for multiple reasons. The fundamental cause of the dysfunctional performance of the first fields was attributed to spacing and alignment problems, which led to excessive sparking and shutdown of the high-voltage power. In spite of attempts to correct the problems, satisfactory performance of the first fields was never achieved. Because of the uncertainties of how to achieve acceptable performance with a new technology, the Big Stone Plant made the decision to convert the entire Advanced Hybrid{trademark} filter housing into a pulse-jet fabric filter.
213 Re-Positioning Nigeria's Radio Broadcast as a Catalyst for ...
African Journals Online (AJOL)
USER
politics, sports, governance, and economy are portrayed only as selectively as these areas favour them. Culture and cultural aspects are emphasised as strong areas of concern as culture subsumes many social issues; however, there seem to exist a man-made gulf that is being perpetrated by use of technological credence ...
Analysis of 213 currently used rehabilitation protocols in foot and ankle fractures.
Pfeifer, Christian G; Grechenig, Stephan; Frankewycz, Borys; Ernstberger, Antonio; Nerlich, Michael; Krutsch, Werner
2015-10-01
Fractures of the ankle, hind- and midfoot are amongst the five most common fractures. Besides initial operative or non-operative treatment, rehabilitation of the patients plays a crucial role for fracture union and long term functional outcome. Limited evidence is available with regard to what a rehabilitation regimen should include and what guidelines should be in place for the initial clinical course of these patients. This study therefore investigated the current rehabilitation concepts after fractures of the ankle, hind- and midfoot. Written rehabilitation protocols provided by orthopedic and trauma surgery institutions in terms of recommendations for weight bearing, range of motion (ROM), physiotherapy and choice of orthosis were screened and analysed. All protocols for lateral ankle fractures type AO 44A1, AO 44B1 and AO 44C1, for calcaneal fractures and fractures of the metatarsal as well as other not specific were included. Descriptive analysis was carried out and statistical analysis applied where appropriate. 209 rehabilitation protocols for ankle fractures type AO 44B1 and AO 44C1, 98 for AO 44A1, 193 for metatarsal fractures, 142 for calcaneal fractures, 107 for 5(th) metatarsal base fractures and 70 for 5(th) metatarsal Jones fractures were evaluated. The mean time recommended for orthosis treatment was 6.04 (SD 0.04) weeks. While the majority of protocols showed a trend towards increased weight bearing and increased ROM over time, the best consensus was noted for weight bearing recommendations. Our study shows that there exists a huge variability in rehabilitation of fractures of the ankle-, hind- and midfoot. This may be contributed to a lack of consensus (e.g. missing publication of guidelines), individualized patient care (e.g. in fragility fractures) or lack of specialization. This study might serve as basis for prospective randomized controlled trials in order to optimize rehabilitation for these common fractures. Copyright © 2015 Elsevier Ltd. All rights reserved.
MO-D-213CD-04: 4D X-Ray DSA and 4D Fluoroscopy.
Mistretta, C
2012-06-01
During the past decade the use of undersampled acquisition and constrained reconstruction have led to significant increases in data acquisition speed, SNR, spatial resolution and temporal resolution in MR imaging. When a separately acquired constraining image is combined with an angiographic time series the traditional tradeoff between spatial and temporal resolution is greatly reduced. Artifacts and limited resolution that would normally be associated with a rapid highly undersampled temporal image series are mitigated by the constrained reconstruction process which transfers the SNR and spatial resolution of the constraining image to the individual time frames. In rotational C-Arm DSA a 3D image volume is formed from all the projections acquired during the C-Arm rotation. Although the individual projections contain temporal information, the reconstructed 3D image has no temporal information and represents a composite of the vascular filling that has occurred during the iodine injection. However, the 3D cone beam CT reconstruction can be used to constrain the reconstruction of one 3D volume for each of the rotational projections. This extends the traditional DSA time series of 2D images to a series of 3D volumes at rates up to 30 per second. Similar techniques can be used to provide fluoroscopy that can be embedded in the 3D space of the constraining volume and viewed from arbitrary angles without gantry motion. This overcomes the problem of forbidden views and guarantees that an intervention can be done without having to send patients to surgery. Unlike 4D DSA which requires only one source and receptor, 4D Fluoroscopy requires a bi-plane fluoroscopy system. 1. To understand the application of under sampling and constrained reconstruction to 4D DSA and Fluoroscopy. © 2012 American Association of Physicists in Medicine.
Yang et al., Afr J Tradit Complement Altern Med. (2014) 11(1):213-221
African Journals Online (AJOL)
cadewumi
-years history of use. Chaihu-Shugan-San (CSS), an ancient classical formula from “Jingyue Quanshu” written by Jingyue Zhang of China in 1640 A.D. It is composed of seven Chinese herbs: Bupleurum chinese DC (6g), Pericarpium citri ...
Masses in the Neck: A Histopathological Analysis of 213 Cases In ...
African Journals Online (AJOL)
Fifty nine percent of the neck masses in the University of Calabar Teaching Hospital, Calabar, Nigeria are caused by lymphoid tissues. Thyroid masses and congenital cysts account for the remaining 41%. Under the age of 20, malignant lymphomas (particularly Hodgkin's disease) are common while those aged over 20 ...
SU-C-213-03: Custom 3D Printed Boluses for Radiation Therapy
Energy Technology Data Exchange (ETDEWEB)
Zhao, B; Yang, M; Yan, Y; Rahimi, A; Chopra, R; Jiang, S [UT Southwestern Medical Center, Dallas, TX (United States)
2015-06-15
Purpose: To develop a clinical workflow and to commission the process of creating custom 3d printed boluses for radiation therapy. Methods: We designed a workflow to create custom boluses using a commercial 3D printer. Contours of several patients were deformably mapped to phantoms where the test bolus contours were designed. Treatment plans were created on the phantoms following our institutional planning guideline. The DICOM file of the bolus contours were then converted to stereoLithography (stl) file for the 3d printer. The boluses were printed on a commercial 3D printer using polylactic acid (PLA) material. Custom printing parameters were optimized in order to meet the requirement of bolus composition. The workflow was tested on multiple anatomical sites such as skull, nose and chest wall. The size of boluses varies from 6×9cm2 to 12×25cm2. To commission the process, basic CT and dose properties of the printing materials were measured in photon and electron beams and compared against water and soft superflab bolus. Phantoms were then scanned to confirm the placement of custom boluses. Finally dose distributions with rescanned CTs were compared with those computer-generated boluses. Results: The relative electron density(1.08±0.006) of the printed boluses resemble those of liquid tap water(1.04±0.004). The dosimetric properties resemble those of liquid tap water(1.04±0.004). The dosimetric properties were measured at dmax with an ion chamber in electron and photon open beams. Compared with solid water and soft bolus, the output difference was within 1% for the 3D printer material. The printed boluses fit well to the phantom surfaces on CT scans. The dose distribution and DVH based on the printed boluses match well with those based on TPS generated boluses. Conclusion: 3d printing provides a cost effective and convenient solution for patient-specific boluses in radiation therapy.
Yeast Interacting Proteins Database: YGL213C, YBR059C [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available ociation (0 or 1,YPD) 0 Complex (0 or 1,YPD) 0 Synthetic lethality (0 or 1,YPD) 0 C...iterature shared by bait and prey 3 Literature sharing score 5 CuraGen (0 or 1) 0 S. Fields (0 or 1) 0 Ass
49 CFR 350.213 - What must a State CVSP include?
2010-10-01
... brief narrative describing how the State program addresses the national program elements listed in § 350.... The rationale for the resource allocation decision must be explained. The narrative section must... responsible for its collection, maintenance, and analysis. (d) Performance objectives, stated in quantifiable...
5 CFR 532.213 - Industries included in regular appropriated fund wage surveys.
2010-01-01
.... 482 Rail transportation. 484 Truck transportation. 485 (except 4853) Transit and ground passenger... food service and laundry establishments and industries having peculiar employment conditions that...
TU-CD-213-03: Communication, Negotiation, and Persuasion: Approaches for Better Results
Energy Technology Data Exchange (ETDEWEB)
Wells, M. [Piedmont Cancer (United States)
2015-06-15
As part of the AAPM’s Scope of Practice, medical physicists are expected to collaborate effectively with practioners and allied health care providers. Interpersonal skills such as communication, negotiation and persuasion are vital for successful collaboration to achieve shared goals. This session will provide some theoretical background of these interpersonal skills as well as specific techniques and practical tools to influence others. Applications of these interpersonal skills for administrative and human resource management purposes vital to medical physicists will be shared. Session attendees will gain knowledge and tools to help them effectively collaborate with administrative and physician leaders in areas such as capital and human resource selection, prioritization, and implementation. Participants will hear methods of how to articulate their goals and to understand the goals of administration, helping ensure alignment of purpose. Session speakers will present one of the topics: equipment selection, budget creation, contracts, and program-related policy development. Specifics may include designing a business case in language that administrators understand, calculating the prioritization of budget requests, and influencing policies for safe and effective care. Human resource topics may include staffing justification, recruitment for fit, employment contracts, and benefits. Speakers will provide examples in both radiation therapy and diagnostic imaging departments and will share experiences and outcomes of their approaches for better results. Learning Objectives: After this course attendees will be better able to Understand the shared goal between administrative and physicist leadership. Articulate the “why” of the technical or human resource need. Utilize communication, negotiation and persuasion tools to improve collaboration.
TU-CD-213-00: Administrative Aspects of Medical Physics
Energy Technology Data Exchange (ETDEWEB)
NONE
2015-06-15
As part of the AAPM’s Scope of Practice, medical physicists are expected to collaborate effectively with practioners and allied health care providers. Interpersonal skills such as communication, negotiation and persuasion are vital for successful collaboration to achieve shared goals. This session will provide some theoretical background of these interpersonal skills as well as specific techniques and practical tools to influence others. Applications of these interpersonal skills for administrative and human resource management purposes vital to medical physicists will be shared. Session attendees will gain knowledge and tools to help them effectively collaborate with administrative and physician leaders in areas such as capital and human resource selection, prioritization, and implementation. Participants will hear methods of how to articulate their goals and to understand the goals of administration, helping ensure alignment of purpose. Session speakers will present one of the topics: equipment selection, budget creation, contracts, and program-related policy development. Specifics may include designing a business case in language that administrators understand, calculating the prioritization of budget requests, and influencing policies for safe and effective care. Human resource topics may include staffing justification, recruitment for fit, employment contracts, and benefits. Speakers will provide examples in both radiation therapy and diagnostic imaging departments and will share experiences and outcomes of their approaches for better results. Learning Objectives: After this course attendees will be better able to Understand the shared goal between administrative and physicist leadership. Articulate the “why” of the technical or human resource need. Utilize communication, negotiation and persuasion tools to improve collaboration.
TU-CD-213-02: Communication, Negotiation, and Persuasion: Approaches for Better Results
Energy Technology Data Exchange (ETDEWEB)
Clements, J. [Kaiser Permanente (United States)
2015-06-15
As part of the AAPM’s Scope of Practice, medical physicists are expected to collaborate effectively with practioners and allied health care providers. Interpersonal skills such as communication, negotiation and persuasion are vital for successful collaboration to achieve shared goals. This session will provide some theoretical background of these interpersonal skills as well as specific techniques and practical tools to influence others. Applications of these interpersonal skills for administrative and human resource management purposes vital to medical physicists will be shared. Session attendees will gain knowledge and tools to help them effectively collaborate with administrative and physician leaders in areas such as capital and human resource selection, prioritization, and implementation. Participants will hear methods of how to articulate their goals and to understand the goals of administration, helping ensure alignment of purpose. Session speakers will present one of the topics: equipment selection, budget creation, contracts, and program-related policy development. Specifics may include designing a business case in language that administrators understand, calculating the prioritization of budget requests, and influencing policies for safe and effective care. Human resource topics may include staffing justification, recruitment for fit, employment contracts, and benefits. Speakers will provide examples in both radiation therapy and diagnostic imaging departments and will share experiences and outcomes of their approaches for better results. Learning Objectives: After this course attendees will be better able to Understand the shared goal between administrative and physicist leadership. Articulate the “why” of the technical or human resource need. Utilize communication, negotiation and persuasion tools to improve collaboration.
TU-CD-213-01: Communication, Negotiation, and Persuasion: Approaches for Better Results
Energy Technology Data Exchange (ETDEWEB)
Johnson, J. [MD Anderson Cancer Center (United States)
2015-06-15
As part of the AAPM’s Scope of Practice, medical physicists are expected to collaborate effectively with practioners and allied health care providers. Interpersonal skills such as communication, negotiation and persuasion are vital for successful collaboration to achieve shared goals. This session will provide some theoretical background of these interpersonal skills as well as specific techniques and practical tools to influence others. Applications of these interpersonal skills for administrative and human resource management purposes vital to medical physicists will be shared. Session attendees will gain knowledge and tools to help them effectively collaborate with administrative and physician leaders in areas such as capital and human resource selection, prioritization, and implementation. Participants will hear methods of how to articulate their goals and to understand the goals of administration, helping ensure alignment of purpose. Session speakers will present one of the topics: equipment selection, budget creation, contracts, and program-related policy development. Specifics may include designing a business case in language that administrators understand, calculating the prioritization of budget requests, and influencing policies for safe and effective care. Human resource topics may include staffing justification, recruitment for fit, employment contracts, and benefits. Speakers will provide examples in both radiation therapy and diagnostic imaging departments and will share experiences and outcomes of their approaches for better results. Learning Objectives: After this course attendees will be better able to Understand the shared goal between administrative and physicist leadership. Articulate the “why” of the technical or human resource need. Utilize communication, negotiation and persuasion tools to improve collaboration.
WE-G-213-01: Roentgen and the Birth of Modern Medical Physics
Energy Technology Data Exchange (ETDEWEB)
Sprawls, P. [Sprawls Educational Foundation (United States)
2015-06-15
Roentgen and the Birth of Modern Medical Physics – Perry Sprawls Wilhelm Roentgen is well known for his discovery of x-radiation. What is less known and appreciated is his intensive research following the discovery to determine the characteristics of the “new kind of radiation” and demonstrate its great value for medical purposes. In this presentation we will imagine ourselves in Roentgen’s mind and follow his thinking, including questions and doubts, as he designs and conducts a series of innovative experiments that provided the foundation for the rapid growth of medical physics. Learning Objectives: Become familiar with the personal characteristics and work of Prof. Roentgen that establishes him as an inspiring model for the medical physics profession. Observe the thought process and experiments that determined and demonstrated the comprehensive characteristics of x-radiation. The AAPM Award Eponyms: William D. Coolidge, Edith H. Quimby, and Marvin M.D. Williams - Who were they and what did they do? – Lawrence N. Rothenberg William David Coolidge (1873–1975) William Coolidge was born in Hudson, NY in 1873. He obtained his BS at the Massacusetts Institute of Technology in 1896. Coolidge then went to the University of Leipzig, Germany for graduate study with physicists Paul Drude and Gustave Wiedemann and received a Ph.D. in 1899. While in Germany he met Wilhelm Roentgen. Coolidge returned to the US to teach at MIT where he was associated with Arthur A. Noyes of the Chemistry Department, working on the electrical conductivity of aqueous solutions. Willis R. Whitney, under whom Coolidge had worked before going to Germany, became head of the newly formed General Electric Research Laboratory and he invited Coolidge to work with him. In 1905, Coolidge joined the staff of the GE laboratory and was associated with it for the remainder of his life. He developed ductile tungsten filaments to replace fragile carbon filaments as the material for electric light bulb filaments. Until that innovation light bulbs had a notoriously short life. He later incorporated the ductile tungsten as a filament material for a hot cathode, fully evacuated x-ray tube, first described in 1912, which allowed higher current and x-ray output, and greater reliability than had previously been possible. These “Coolidge x-ray tubes” were far superior to the cold cathode, partial pressure gas x-ray tubes that had been in use since Roentgen’s discovery of x-rays in 1895. The Coolidge tube with incremental developments is now the key component for x-ray production in all of our modern x-ray imaging devices, such as CT scanners, interventional radiology systems, and mammography units. Coolidge was also involved in the development of sectional x-ray tubes for research and treatment that were initially designed to reach 800 kV. Additional improvements led to 1 MV and 2 MV devices. In 1932 Coolidge became director of the General Electric Research Laboratory, and in 1940, was made Vice-President and Director of Research. In 1945 he retired and was named Director Emeritus of the laboratory. Coolidge held 83 patents and was recognized for these and many other achievements by election to the National Academy of Engineers, a place in the Engineering Hall of Fame and the National Inventor’s Hall of Fame. The AAPM’s highest honor, the Coolidge Award, was named after him. He accepted Honorary Membership in the AAPM and was the first recipient of the AAPM Coolidge Award, which was presented to him in a special ceremony in Schenectady, NY in 1972 when he was 100 years old. Edith Hinckley Quimby (1891–1982) Edith Quimby was born in Rockford, IL in 1891. She graduated from Whitman College in Walla Walla, WA with a B.S. in 1913, and then obtained a masters degree from the University of California at Berkeley. Later in her career, after many significant achievements, Quimby was awarded honorary doctorates by Whitman College and Rutgers University. Edith Quimby was hired by Giacchino Failla as a radiation physicist at Memorial Hospital for Cancer in New York City. Failla had studied with Madame Curie and obtained his doctoral degree in her laboratory. After many groundbreaking medical physics studies from 1919 until 1942, they both moved to Columbia University. Dr. Quimby developed a widely employed dosimetry system for single plane implants with radium and radon seeds, and a dosimetry methodology for internal radionuclides. She was author of more than 75 scientific publications, and of significant textbooks including the first comprehensive physics textbook for radiologists “Physical Foundations of Radiology”, which was co-authored with Otto Glasser, Lauriston Taylor and James Weatherwax in the first edition, with Russell Morgan added for the second edition and Paul Goodwin for the fourth edition. With Sergei Feitelberg, M.D. she published two editions of “Radioactive Isotopes in Medicine and Biology: Basic Physics and Instrumentation”. Quimby became a renowned examiner for the American Board of Radiology when the third ABR examination, given in 1936, added physics. She served as President of the American Radium Society, received the RSNA Gold Medal, and also numerous prestigious awards given to women in science. Edith Quimby was a Charter Member of AAPM. The AAPM Lifetime Achievement Award was renamed the Edith H. Quimby Lifetime Achievement Award in her honor in 2011. Marvin Martin Dixon Williams (1902–1981) Marvin Williams was born in Walla Walla, WA in 1902, and attended the same college as Edith Quimby, graduating from Whitman College in 1926. He was greatly influenced to go into medical physics by her accomplishments. During his early career, Williams worked with James Weatherwax in Philadelphia while he was working toward an M.S. from the University of Pennsylvania. In 1931 Williams was awarded a Ph.D. in Biophysics from the University of Minnesota, with the work actually performed at the Mayo Clinic Graduate School of the University. While completing his Ph.D. studies, Marvin met Dr. Paul Hodges who had returned from the Peiping Union Medical College in Peiping (now Beijing), China. Hodges suggested that a physicist be sent to Peiping to install x-ray therapy equipment and a radon plant. Williams accepted the position and, in 1931, he and his wife Orpha left for China. Before going to China, Williams had spent time with the physics group at Memorial Hospital to learn about the operation of a radon plant. In China, he constructed the radon plant, employing 0.25 g of radium, and also installed the x-ray therapy unit. Williams and his wife returned to the US in 1935, and he accepted a research position at the Mayo Clinic. In 1950, he became Professor of Biophysics at Mayo, where he taught physics and biophysics until his retirement in 1967. Williams was also very active in the American Board of Radiology where, from 1944 through 1977, he examined over 3000 radiologists and 250 physicists. Marvin Williams was a Charter member of AAPM, served as the fourth President of AAPM in 1963, and was the fourth recipient the AAPM Coolidge Award in 1975. The Marvin Williams Award was originally established as the highest award of the American College of Medical Physics. When various functions of the ACMP were absorbed into the AAPM in 2012, the Marvin M D Williams Professional Achievement Award became one of the AAPM’s highest honors. Learning Objectives: Become familiar with the persons in whose honor the three major AAPM Award are named Learn about the achievements and activities which influenced the AAPM to name these awards in their honor.
1976-01-01
means of carefully controlled cutting and/or scratching, and with more precise control by a combination of electron-beam lithography and ion milling...conditions and demonstrates the potential for conductivity anomaly detection. 4.4.2 Biomagnetism The use of SQUID magnetometers to measure magnetic
CALiPER Report 21.3: Cost-Effectiveness of Linear (T8) LED Lamps
Energy Technology Data Exchange (ETDEWEB)
Miller, Naomi J.; Perrin, Tess E.; Royer, Michael P.
2014-05-27
Meeting performance expectations is important for driving adoption of linear LED lamps, but cost-effectiveness may be an overriding factor in many cases. Linear LED lamps cost more initially than fluorescent lamps, but energy and maintenance savings may mean that the life-cycle cost is lower. This report details a series of life-cycle cost simulations that compared a two-lamp troffer using LED lamps (38 W total power draw) or fluorescent lamps (51 W total power draw) over a 10-year study period. Variables included LED system cost ($40, $80, or $120), annual operating hours (2,000 hours or 4,000 hours), LED installation time (15 minutes or 30 minutes), and melded electricity rate ($0.06/kWh, $0.12/kWh, $0.18/kWh, or $0.24/kWh). A full factorial of simulations allows users to interpolate between these values to aid in making rough estimates of economic feasibility for their own projects. In general, while their initial cost premium remains high, linear LED lamps are more likely to be cost-effective when electric utility rates are higher than average and hours of operation are long, and if their installation time is shorter.
CALiPER Report 21.3. Cost Effectiveness of Linear (T8) LED Lamps
Energy Technology Data Exchange (ETDEWEB)
None
2014-05-01
Meeting performance expectations is important for driving adoption of linear LED lamps, but cost-effectiveness may be an overriding factor in many cases. Linear LED lamps cost more initially than fluorescent lamps, but energy and maintenance savings may mean that the life-cycle cost is lower. This report details a series of life-cycle cost simulations that compared a two-lamp troffer using LED lamps (38 W total power draw) or fluorescent lamps (51 W total power draw) over a 10-year study period. Variables included LED system cost ($40, $80, or $120), annual operating hours (2,000 hours or 4,000 hours), LED installation time (15 minutes or 30 minutes), and melded electricity rate ($0.06/kWh, $0.12/kWh, $0.18/kWh, or $0.24/kWh). A full factorial of simulations allows users to interpolate between these values to aid in making rough estimates of economic feasibility for their own projects. In general, while their initial cost premium remains high, linear LED lamps are more likely to be cost-effective when electric utility rates are higher than average and hours of operation are long, and if their installation time is shorter.
Page 1 2.13 Proc. Indian Acad, Sci (Chem. Sci), Vol. 111, No. 1 ...
Indian Academy of Sciences (India)
Type I collagen is the principal extracellular matrix protein of skin, tendon bone and dentin. The main body of the molecule is the familiar triple helix structure, a compound set of three intertwined polypeptide chain helices. All 3 chains (2 cl and one a2) have the same length and triplet Gly-X-Y repeat sequence throughout.
Facile Synthesis of 2-(1,3-Benzoxazol/benzothiazol-2-yl)- 3 H ...
African Journals Online (AJOL)
benzoxazol/benzothiazol-2-yl)-3H-benzo [ƒ]chromen-3-one derivatives 3a-p by the Knoevenagel condensation between 2-hydroxy-1-naphthaldehyde and benzothiazole-2-yl-aceatates or N-methyl benzoxazole-2-yl-acetates using choline ...
Characterization of neutron detector combined with NE213 and CaF{sub 2}(Eu)
Energy Technology Data Exchange (ETDEWEB)
Takada, Masashi; Nakamura, Takashi [Tohoku Univ., Sendai (Japan). Cyclotron and Radioisotope Center; Sibata, Tokushi
1996-07-01
In this work, the property of the n-{gamma} discrimination and the response functions of the developed phoswich detector were measured with gamma rays from radioactive sources and neutrons from a Be+Cu target bombarded by protons from the RIKEN ring cyclotron at the Institute of Physical and Chemical Research. The measured response functions were compared with Monte Carlo calculations. We also tested to measure a small amount of neutrons under the intense charged-particles mixed field which was realized in the RIKEN ring cyclotron for the space application. (J.P.N.)
Page 1 Photo-Elastic Constants of Sodium Chlorate 213 The value ...
Indian Academy of Sciences (India)
At the suggestion of one of us (G. N. R.) these measurements were made by Mr. Vedam in this. Laboratory. We are grateful to him for handing over to us the results of his measurements. In the calculation of the results, allowance was made for the fact that the crystal was optically active. The following values were found: - * , .
MO-D-213AB-01: A Brief History of Medical Physics Reimbursement.
Hevezi, J
2012-06-01
"Corporate memory" is important in many areas of medical physics, but especially so in the area of economics. To appreciate where medical physics currently resides in the reimbursement arena, it is imperative that we know from whence we came. This talk will trace the history of medical physics reimbursement, chiefly in the area of radiation oncology since most of our reimbursement codes appear in that clinical specialty. We will begin with the initiation of the Harvard RBRVS system and the effect it had on our field. Subsequently, we will trace the impact of new technological advances in the field and how, at each juncture, the reimbursement associated with these advances directly impacted our employment opportunities and salaries. Although much of the operations of the three chief panels associated with health care reimbursement, the Current Procedural Terminology (CPT) Editorial Panel, the Relative-Value Update Committee (RUC) and the Centers for Medicare and Medicaid Services (CMS) are confidential in nature, the history of how these panels operate and their impact on how health care is reimbursed is important to our field. For those of us who have labored in this arena over the years, there are successes and failures as new procedures in radiation oncology were taken for reimbursement consideration, initially by the Joint Economics Committee of ACR and ASTRO, and later by ASTRO in collaboration with AAPM. These will be discussed in a general sense to avoid confidentiality breaches. As we progressed from the use of CT planning images with 3D conventional therapy, brachytherapy -high and low dose rate systems, IMRT planning and delivery (with concomitant plan verification work) to the latest procedures of SRS and SBRT with Image Guided Radiation Therapy (IGRT), each procedure has its own story surrounding how its reimbursement was developed. Where no confidentiality issues are involved, the stories behind the scenes will be discussed as these procedures were taken forward in the reimbursement process. Going forward, changes in how we are reimbursed for our services will inevitably occur. For our imaging colleagues, their work will still be classed as a cost center for their departments. AAPM PEC is evaluating how they can begin being reimbursed with explicit CPT codes, but this will take some effort. 1. Understand where medical physics reimbursement came from in radiation oncology 2. Understand the arrangement of our societies and interaction with reimbursement entities 3. Understand how medical physics workforce and remuneration for services is structured 4. Understand what the future may bring in medical physics reimbursement. © 2012 American Association of Physicists in Medicine.
CCDC 1436716: Experimental Crystal Structure Determination : 5-fluoro-4-iodo-2,1,3-benzothiadiazole
Shi, Qinqin
2016-01-01
An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.
The role of alpha therapy for local and systemic treatment of cancer
Energy Technology Data Exchange (ETDEWEB)
Allen, B.J. [St George Hospital, Kogarah, NSW (Australia)
1998-03-01
Major problems in the management of cancer relate to the inability to control some primary lesions, e.g. glioblastoma multiforme (GBM), and the inability to deal with metastatic cancer arising from malignant cancers such as melanoma, breast and other cancers. Binary alpha therapy using neutron capture in boron-10 offers the potential for improved prognosis for high grade brain tumours such as GBM and melanoma metastases to the brain. Metastatic cancer proceeds through a number of quite separate stages in the development of lethal disease, i e. cells in transit, preangiogenic lesions, subclinical and clinical lesions. Early stages offer the potential for control if targeted alpha therapy is applied. However, the dose must be localised to the cancer cell and this requirement rules out beta-emitting radionuclides, which are more suited for clinical lesions. Alpha-emitting radionuclides are the most appropriate toxins, as their efficacy depends on the linear energy transfer (LET) and range of the alpha particles. After matching the cancer stage, radiolabel and carrier, we find that {sup 149}Tb is the radionuclide of choice for systemic therapy in all aspects except production. The production of {sup 149}Tb in {mu}Ci (kBq) quantities has been achieved using the heavy ion reaction at the ANU tandem accelerator at Canberra and in multi-mCi (MBq) quantities using the spallation reaction in combination with on-line isotope separation technology of ISOLDE at CERN. Terbium is ideally suited for chelation to monoclonal antibodies to produce stable radio-immunoconjugates (RIC). Astatine-211 is a halide and has potential for the elimination of early stage melanoma metastases as At-MTB. However, the availability of the alpha generators {sup 228}Th-{sup 212}Bi and {sup 225}Ac-{sup 213}Bi facilitates the use of Bi-RIC in clinical trials for acute myeloid leukaemia and cystic glioma. Alpha therapy has the potential to control refractory cancers when treated at the minimum residual
Pizzutiello, R
2012-06-01
Based on direction from AAM Board of Directors, JMPLSC has redefined its scope and name. On November 4, 2011 the subcommittee renamed itself the Medical Physics Licensure and Regulatory Recognition Subcommittee. Its newly defined charge is to promote the protection of the public through the recognition of the profession of medical physics by legislation or regulation. The following pathways shall be implemented. 1. Recognition of the profession of medical physics through licensure by legislation: a. Support the formation and activities of state committee focused on professional licensure b. Provide model legislation c. Provide consultation on regulatory language to implement professional licensure 2. Recognition of the profession of medical physics through regulation. a. Support the formation and activities of state committee focused on the regulatory approach b. Provide model regulation c. Provide consultation on regulatory language to implement professional licensure d. Collaborate with the CRCPD Subcommittee 3. Annually prepare status of subcommittees' activities. This presentation will describe recent efforts of the subcommittee and report on its successes, challenges and works in progress. © 2012 American Association of Physicists in Medicine.
2010-07-28
..., United Kingdom, Phone: +44 (0) 1293 768821. Logistics: If attending, please inform Terry Neale no later... Morning Plenary discussion (sign-in at 0830). Introductions and administrative items. Review and approve... public but limited to space availability. With the approval of the chairmen, members of the public may...
TU-D-213AB-01: How You Can Be the Speaker and Communicator Everyone Wants You to Be.
Collins, J; Aydogan, B
2012-06-01
Effectiveness of an oral presentation depends on the ability of the speaker to communicate with the audience. An important part of this communication is focusing on two to five key points and emphasizing those points during the presentation. Every aspect of the presentation should be purposeful and directed at facilitating learners' achievement of the objectives. This necessitates that the speaker has carefully developed the objectives and built the presentation around attainment of the objectives. A presentation should be designed to include as much audience participation as possible, no matter the size of the audience. Techniques to encourage audience participation include questioning, brainstorming, small-group activities, role-playing, case-based examples, directed listening, and use of an audience response system. It is first necessary to motivate and gain attention of the learner for learning to take place. This can be accomplished through appropriate use of humor, anecdotes, and quotations. This course will review adult learning principles and effective presentation skills, Learning Objectives: 1. Apply adult learning principles. 2. Demonstrate effective presentations skills. © 2012 American Association of Physicists in Medicine.
catena-Poly[[[diaquacopper(II]-bis[μ2-1,3-bis(1,2,4-triazol-1-ylpropane
Directory of Open Access Journals (Sweden)
Wen Feng
2009-10-01
Full Text Available The title CuII coordination polymer, {[Cu(C7H10N62(H2O2](NO32·H2O}n, was obtained by the reaction of equimolar Cu(NO32·4H2O and 1,3-bis(1,2,4-triazol-1-ylpropane (btp in a water–methanol solvent. The CuII atom is located on a centre of inversion and has an elongated octahedral coordination geometry formed by four N atoms from four symmetry-related btp ligands and two coordinated water molecules. Adjacent CuII atoms are connected by btp ligands, generating a double-stranded chain. The nitrate anion is disordered over two positions in a 0.828 (7:0.172 (2 ratio.
WE-E-213CD-05: A Non-Rigid Image Registration Algorithm That Accommodates Organ Segmentation Error.
Zhang, C; Christensen, G E; Kurtek, S; Srivastava, A; Weiss, E; Murphy, M J; Williamson, J F
2012-06-01
To introduce a new deformable image registration algorithm based on surface matching that accommodates organ delineation error in daily Cone-beam CT images based on a priori knowledge of inter-observer segmentation uncertainty. The dataset includes four prostate cancer patients who underwent primary external beam radiotherapy and had tumors that were confined to the prostate. All imaging was performed without intravenous contrast. Organ surface segmentation errors in a multiple observer-contouring study on the pelvic organs in Fan-beam CT (FBCT) and Cone-beam CT (CBCT) were estimated from the training dataset. A novel deformable image registration algorithm is presented where the organ surface matching is penalized by this error. Portions of the organ surface that are delineated reliably are used to guide the registration whereas the portions that are highly uncertain are ignored. This approach reduces the impact of delineation errors in CBCT. An evaluation experiment compares three algorithms, namely intensity-only registration (INT), equally-weighted surface and image registration (EWSIR) and the proposed uncertainty- weighted surface and image registration. The surface dissimilarity was reduced from 0.172 to 0.134, 0.043 and 0.044 respectively after registration. The Jacobian of the transformation found by the proposed method was closer to one than that of EWSIR in the prostate. In prostate external-beam radiotherapy, slice-by-slice 2D manual contouring has variable spatial accuracy. For deformable image registration methods that match segmented surfaces, regions of high inaccuracy can misguide the registration. In contrast to the image registration methods where the FBCT and CBCT surfaces (or other features) are assumed to be exact, our method takes this uncertainty into account. Preliminary results show an improved registration performance suggesting a potential use in IGRT. This work was supported by National Cancer Institute Grant No. P01 CA 116602. © 2012 American Association of Physicists in Medicine.
Directory of Open Access Journals (Sweden)
Victor R Gordeuk
2012-01-01
Full Text Available BACKGROUND: HFEC282Y homozygotes have an increased risk for developing increased iron stores and related disorders. It is controversial whether dietary iron restrictions should be recommended to such individuals.
Taillie, Lindsey Smith; Afeiche, Myriam C; Eldridge, Alison L; Popkin, Barry M
2015-11-01
Little is known about the dietary behaviors of Mexican children with regard to frequency, amount, and quality of foods consumed at eating occasions and their impact on total daily energy intake. The objectives were to 1) describe foods consumed across eating occasions and 2) examine whether the number or type of total eating occasions was associated with increased total daily energy intake and differed between 2- to 5-y-old and 6- to 13-y-old Mexican children. A nationally representative sample of 5031 children from the 2012 ENSANUT (Encuesta Nacional de Salud y Nutrición) was used to examine the percentage of meals and snacks consumed, mean energy intake from meals and snacks, and the top food groups contributing to meals and snacks. Multivariate linear regression was used to examine the association between meals, snacks, and total eating occasions with daily energy intake for 2- to 5-y-old and 6- to 13-y-old children. Eating patterns were similar across age groups (per capita mean intake of 3 meals and 1.4-1.6 snacks/d). Each additional snack was associated with greater increases in mean daily energy for older children (+191-289 kcal/d; P eating occasion was associated with greater increases in mean daily energy for older children (+323 kcal/d; P eating occasion was linked to even greater increases in total daily energy intake. © 2015 American Society for Nutrition.
2-(1,3-Dioxoisoindolin-2-ylacetic acid–N′-[(E-2-methoxybenzylidene]pyridine-4-carbohydrazide (1/1
Directory of Open Access Journals (Sweden)
Shaaban K. Mohamed
2012-08-01
Full Text Available In the title 1:1 cocrystal, C10H7NO4·C14H13N3O2, molecules are linked by intermolecular C—H...O, N—H...O and O—H...N hydrogen bonds, forming a three-dimensional network. In addition, π–π stacking interactions [with centroid–centroid distances of 3.5723 (19 and 3.6158 (18 Å] are observed.
Nielsen, Christian B.
2015-01-01
An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.
National Oceanic and Atmospheric Administration, Department of Commerce — Habitat maps of the main Hawaiian Islands were created by visual interpretation of aerial photos and hyperspectral imagery using the Habitat Digitizer extension....
National Oceanic and Atmospheric Administration, Department of Commerce — Habitat maps of the main Hawaiian Islands were created by visual interpretation of aerial photos and hyperspectral imagery using the Habitat Digitizer extension....
National Research Council Canada - National Science Library
Murphy, K; Oaklander, A L; Elias, G; Kathuria, S; Long, D M
2016-01-01
There has been a steady progression of case reports and a small surgical series that report successful surgical treatment of Tarlov cysts with concomitant relief of patients' symptoms and improvement...
[Nebraska 4-H Wheat Science School Enrichment Project, Teacher/Leader Guides 213-222 and 227.
Nebraska Univ., Lincoln. Inst. of Agriculture and Natural Resources.
Through the 4-H Wheat Science project, students learn the importance of wheat from the complete process of growing wheat to the final product of bread. The curriculum is designed to include hands-on experiences in science, consumer education, nutrition, production economics, vocabulary, and applied mathematics. Teachers can select those units out…
Wieben, O
2012-06-01
Traditional clinical MR Angiography (MRA) provides volumetric datasets to characterize the vessel lumen. These MRA techniques can be generally separated into two categories: • contrast-enhanced MRA, which requires the venous injection of a paramagnetic contrast agent in form of a Gadolinium chelate and • non-contrast-enhanced MRA (NCE MRA), which relies on signal properties of the blood or the motion of the blood to create signal differences between the blood pool and the surrounding tissues. Time-of-Flight (TOF) and Phase- Contrast (PC) imaging have been developed as NCE techniques in the early days of MR imaging. However, widespread clinical adaptation of MRA did not occur until the introduction of CE-MRA in the mid-1990ies with significantly improved robustness. Recent developments have renewed the interest in imaging approaches that do not rely on any external contrast agents. Advances in hardware, especially gradient amplifiers and multi-channel coil technology, have reduced imaging times, improved the signal-to-noise ratio, and reduced artefacts so that NCE MRA is becoming competitive again. These approaches provide viable alternatives in patients that are at risk for nephrogenic systemic fibrosis (NSF) and should not receive a Gd-based contrast agent. In addition, some of those approaches provide insights in functional information beyond the standard luminography. For example, arterial spin labeling (ASL) imaging can be used as a 'pseudo arterial injection' by labeling blood in targeted volumes and tracking its distribution over time. Novel '4D MR Flow' imaging is an extension of traditional PC MRA to capture volumetric velocity vector fields throughout the cardiac cycle, thereby allowing for direct measures of hemdodynamic parameters such as pressure gradient, wall shear stress, pulse wave velocity, kinetic energy, and more. This lecture will provide an overview of the underlying contrast mechanisms of time-of-flight, phase-contrast, balanced steady state free precession (bSSFP), and ASL MRA. Current and potential future roles of these approaches in clinical imaging will also be discussed. 1. Understand the various origins of MRA contrast mechanisms that do not require a contrast agent. 2. Understand the issues related to NCE-MRA imaging including design, acquisition and processing. 3. Understand the benefits, pitfalls, and future potentials of these approaches. My research is sponsored by GE Healthcare. © 2012 American Association of Physicists in Medicine.
A. Attarbaschi (Andishe); Carraro, E. (Elisa); O. Abla (Oussama); Barzilai-Birenboim, S. (Shlomit); S. Bomken (Simon); L. Brugières (Laurence); Bubanska, E. (Eva); B. Burkhardt (Birgit); Chiang, A.K.S. (Alan K. S.); M. Csoka (Monika); Fedorova, A. (Alina); J. Jazbec; E. Kabickova (Edita); Z. Krenova (Zdenka); Lazic, J. (Jelena); J. Loeffen; Mann, G. (Georg); F. Niggli (Felix); Miakova, N. (Natalia); Osumi, T. (Tomoo); Ronceray, L. (Leila); A. Uyttebroeck (Anne); D. Williams; Woessmann, W. (Wilhelm); G. Wrobel (Grazyna); Pillon, M. (Marta)
2016-01-01
textabstractChildren and adolescents with pre-existing conditions such as DNA repair defects or other primary immunodeficiencies have an increased risk of non-Hodgkin lymphoma. However, largescale data on patients with non-Hodgkin lymphoma and their entire spectrum of pre-existing conditions are
Energy Technology Data Exchange (ETDEWEB)
Meghzifene, A. [International Atomic Energy Agency, Vienna (Austria)
2015-06-15
AAPM projects and collaborations in Africa Adam Shulman (AA-SC Chair) The African Affairs Subcommittee (AA-SC) of the AAPM will present a multi-institutional approach to medical physics support in Africa. Current work to increase the quality of care and level of safety for the medical physics practice in Senegal, Ghana, and Zimbabwe will be presented, along with preliminary projects in Nigeria and Botswana. Because the task of addressing the needs of medical physics in countries across Africa is larger than one entity can accomplish on its own, the AA-SC has taken the approach of joining forces with multiple organizations such as Radiating Hope and TreatSafely (NGO’s), the IAEA, companies like BrainLab, Varian and Elekta, medical volunteers and academic institutions such as NYU and Washington University. Elements of current projects include: 1) Distance training and evaluation of the quality of contouring and treatment planning, teaching treatment planning and other subjects, and troubleshooting using modern telecommunications technology in Senegal, Ghana, and Zimbabwe; 2) Assistance in the transition from 2D to 3D in Senegal and Zimbabwe; 3) Assistance in the transition from 3D to IMRT using in-house compensators in Senegal; 4) Modernizing the cancer center in Senegal and increasing safety and; 5) Training on on 3D techniques in Ghana; 6) Assisting a teaching and training radiation oncology center to be built in Zimbabwe; 7) Working with the ISEP Program in Sub-Saharan Africa; 8) Creating instructional videos on linac commissioning; 9) Working on a possible collaboration to train physicists in Nigeria. Building on past achievements, the subcommittee seeks to make a larger impact on the continent, as the number and size of projects increases and more human resources become available. The State of Medical Physics Collaborations and Projects in Latin America Sandra Guzman (Peru) The lack of Medical Physicists (MP) in many Latin American (LA) countries leads to recruitment of professionals with incomplete education. In most LA countries only one MP responsible for each Center is currently mandated. Currently there is a large disparity among MP training programs and there is significant debate about the standards of MP graduate education in many LA countries. There are no commonly recognized academic programs, not enough clinical training sites and clinical training is not typically considered as part of the MP work. Economic pressures and high workloads also impede the creation of more training centers. The increasing need of qualified MPs require establishing a coordinated system of national Education & Training Centers (ETC), to meet the international standards of education and training in Medical Physics. This shortfall calls for support of organizations such as the IOMP, AAPM, ALFIM, IAEA, etc. Examples from various LA countries, as well as some proposed solutions, will be presented. In particular, we will discuss the resources that the AAPM and its members can offer to support regional programs. The ‘Medical Imaging’ physicist in the emerging world: Challenges and opportunities - Caridad Borrás (WGNIMP Chair) While the role of radiation therapy physicists in the emerging world is reasonably well established, the role of medical imaging physicists is not. The only perceived needs in radiology departments are equipment quality control and radiation protection, tasks that can be done by a technologist or a service engineer. To change the situation, the International Basic Safety Standard, which is adopted/adapted world-wide as national radiation protection regulations, states: “For diagnostic radiological procedures and image guided interventional procedures, the requirements of these Standards for medical imaging, calibration, dosimetry and quality assurance, including the acceptance and commissioning of medical radiological equipment, are fulfilled by or under the oversight of, or with the documented advice of a medical physicist, whose degree of involvement is determined by the complexity of the radiological procedures and the associated radiation risks”. Details on how these requirements can be carried out in resource-limited settings will be described. IAEA support to medical physics in Africa and Latin America: achievements and challenges Ahmed Meghzifene (IAEA) Shortage of clinically qualified medical physicists in radiotherapy and imaging, insufficient and inadequate education and training programs, as well as a lack of professional recognition were identified as the main issues to be addressed by the IAEA. The IAEA developed a series of integrated projects aiming specifically at promoting the essential role of medical physicists in health care, developing harmonized guidelines on dosimetry and quality assurance, and supporting education and clinical training programs. The unique feature of the IAEA approach is support it provides for implementation of guidelines and education programs in Member States through its technical cooperation project. The presentation will summarize IAEA support to Latin America and Africa in the field of medical physics and will highlight how the new International Basic Safety Standards are expected to impact the medical physics practice in low and middle income countries. Learning Objectives: Learn about the shortage of qualified Medical Physicists in Africa and Latin America. Understand the reasons of this shortage. Learn about the ways to improve the situation and AAPM role in this process.
Energy Technology Data Exchange (ETDEWEB)
NONE
2015-06-15
The African Affairs Subcommittee (AA-SC) of the AAPM will present a multi-institutional approach to medical physics support in Africa. Current work to increase the quality of care and level of safety for the medical physics practice in Senegal, Ghana, and Zimbabwe will be presented, along with preliminary projects in Nigeria and Botswana. Because the task of addressing the needs of medical physics in countries across Africa is larger than one entity can accomplish on its own, the AA-SC has taken the approach of joining forces with multiple organizations such as Radiating Hope and TreatSafely (NGO’s), the IAEA, companies like BrainLab, Varian and Elekta, medical volunteers and academic institutions such as NYU and Washington University. Elements of current projects include: 1) Distance training and evaluation of the quality of contouring and treatment planning, teaching treatment planning and other subjects, and troubleshooting using modern telecommunications technology in Senegal, Ghana, and Zimbabwe; 2) Assistance in the transition from 2D to 3D in Senegal and Zimbabwe; 3) Assistance in the transition from 3D to IMRT using in-house compensators in Senegal; 4) Modernizing the cancer center in Senegal and increasing safety and; 5) Training on on 3D techniques in Ghana; 6) Assisting a teaching and training radiation oncology center to be built in Zimbabwe; 7) Working with the ISEP Program in Sub-Saharan Africa; 8) Creating instructional videos on linac commissioning; 9) Working on a possible collaboration to train physicists in Nigeria. Building on past achievements, the subcommittee seeks to make a larger impact on the continent, as the number and size of projects increases and more human resources become available. The State of Medical Physics Collaborations and Projects in Latin America Sandra Guzman (Peru) The lack of Medical Physicists (MP) in many Latin American (LA) countries leads to recruitment of professionals with incomplete education. In most LA countries only one MP responsible for each Center is currently mandated. Currently there is a large disparity among MP training programs and there is significant debate about the standards of MP graduate education in many LA countries. There are no commonly recognized academic programs, not enough clinical training sites and clinical training is not typically considered as part of the MP work. Economic pressures and high workloads also impede the creation of more training centers. The increasing need of qualified MPs require establishing a coordinated system of national Education & Training Centers (ETC), to meet the international standards of education and training in Medical Physics. This shortfall calls for support of organizations such as the IOMP, AAPM, ALFIM, IAEA, etc. Examples from various LA countries, as well as some proposed solutions, will be presented. In particular, we will discuss the resources that the AAPM and its members can offer to support regional programs. The ‘Medical Imaging’ physicist in the emerging world: Challenges and opportunities - Caridad Borrás (WGNIMP Chair) While the role of radiation therapy physicists in the emerging world is reasonably well established, the role of medical imaging physicists is not. The only perceived needs in radiology departments are equipment quality control and radiation protection, tasks that can be done by a technologist or a service engineer. To change the situation, the International Basic Safety Standard, which is adopted/adapted world-wide as national radiation protection regulations, states: “For diagnostic radiological procedures and image guided interventional procedures, the requirements of these Standards for medical imaging, calibration, dosimetry and quality assurance, including the acceptance and commissioning of medical radiological equipment, are fulfilled by or under the oversight of, or with the documented advice of a medical physicist, whose degree of involvement is determined by the complexity of the radiological procedures and the associated radiation risks”. Details on how these requirements can be carried out in resource-limited settings will be described. IAEA support to medical physics in Africa and Latin America: achievements and challenges Ahmed Meghzifene (IAEA) Shortage of clinically qualified medical physicists in radiotherapy and imaging, insufficient and inadequate education and training programs, as well as a lack of professional recognition were identified as the main issues to be addressed by the IAEA. The IAEA developed a series of integrated projects aiming specifically at promoting the essential role of medical physicists in health care, developing harmonized guidelines on dosimetry and quality assurance, and supporting education and clinical training programs. The unique feature of the IAEA approach is support it provides for implementation of guidelines and education programs in Member States through its technical cooperation project. The presentation will summarize IAEA support to Latin America and Africa in the field of medical physics and will highlight how the new International Basic Safety Standards are expected to impact the medical physics practice in low and middle income countries. Learning Objectives: Learn about the shortage of qualified Medical Physicists in Africa and Latin America. Understand the reasons of this shortage. Learn about the ways to improve the situation and AAPM role in this process.
Boiras, C; Bourland, J; Gonzalez, L Brualla; Bulychkin, P; Ford, E; Kazantsev, P; Krylova, T; Medina, A Lopez; Prusova, M; Romanov, D; Ferrando, J Rosello; Willoughby, T; Yan, D; Yu, C; Zvereva, A
2012-06-01
The AAPM has signed two formal Educational Exchange Agreements with the Spanish (SEFM) and the Russian (AMPR) medical physics societies. While the primary purpose of the Agreements is to provide educational opportunities for young medical physicists, the Agreements also contemplate holding joint sessions at scientific congresses. The purpose of this professional AAPM/SEFM/AMPR Joint Symposium is to explore the challenges that medical physicists in the three countries face when new external beam radiotherapy technologies are introduced in their facilities and to suggest potential solutions to limitations in testing equipment and lack of familiarity with protocols. Speakers from the three societies will present reviews of the technical aspects of IMRT, Arc EVIRT (IMAT/VMAT/Rapid Arc), SRS/SRBT, and IGRT/Adaptive radiotherapy, and will describe the status of these technologies in their countries, including the challenges found in tasks such as developing anatomical and biological dose optimization techniques and implementing QA management, risk assessment and patient safety programs. The SEFM will offer AAPM and AMPR members the possibility to participate in collaborative proposals for future research bids in UE and USA based on an ongoing Spanish project for adaptive radiotherapy using functional imaging. A targeted discussion will debate three propositions: the cost/benefit ratio of IGRT, whether IMRT requires IGRT, and the use of non-ionizing radiation technologies for realtime monitoring of prostate IGRT. For these debates, each society has designated one speaker to present and defend either "For" or "Against" the proposition, followed by discussion by all participants. The Symposium presentations and the country-tailored recommendations drawn will be made available to each society for inclusion in their websites. The WGNIMP, the AAPM Work Group charged with executing the AAPM/SEFM and AAPM/AMPR Agreements, will follow up on the commitments made by the AAPM.Di Yan's research on adaptive radiotherapy has been financially supported by: 1) NIH Research Grants, 2) Elekta Research Grants 3) Philips Research GrantConflicts of interest for Cedric X Yu: 1) Board Member of Prowess, Inc., 2) Shareholder of Xcision Medical Systems, LLC, 3) Inventor on patents licensed by Varian Medical Systems, Inc. 1. Describe fundamental aspects for four advanced radiotherapy techniques: IMRT, IGRT, SBRT, and adaptive radiotherapy. 2. Review technical and professional challenges for implementation of advanced techniques as a function of resources and capabilities available within each scientific society: AAPM, SEFM, and AMPR. 3. Discuss and plan a proposal for an international trial on IMRT/IGRT based on functional imaging. 4. Debate important implementation aspects of IMRT and IGRT according to country-specific resources. © 2012 American Association of Physicists in Medicine.
WE-D-213AB-03: Preparing for the ABR Diagnostic Medical Physics Board Exams - Oral Exam.
Leng, S; Chen, L; Shu, Y; McCollough, C
2012-06-01
Part III (oral exam) is the final part of ABR board exam for Diagnostic Medical Physics. In this exam, each of five oral examiners questions the candidate in each of five question categories. Oral exam has unique challenges to the candidate compared with the written exams. The candidate is expected to have not only adequate knowledge on each aspect of imaging physics, but also extensive clinical experience on different imaging modalities. The candidate needs to demonstrate her/his knowledge and clinical experience by correctly and effectively answering specific questions during the exam. Depending on the response of the candidate to original question, different follow-up questions are usually asked. Therefore, the interaction with examiners plays a critical role in the oral exam. The format and question categories of the oral exam in diagnostic medical physics will be reviewed. Study materials and effective study methods will be discussed. Practical tips on answering questions and interactions with examiners during the oral exam will also be shared. 1. Understand the format and scope of oral exam. 2. Develop an effective method for exam preparation. 3. Learn how to effectively answer questions and interact with examiners during the exam. © 2012 American Association of Physicists in Medicine.
An 80 Kb P1 clone from chromosome 3p21.3 suppresses tumor growth in vivo
Todd, MC; Xiang, RH; Garcia, DK; Kerbacher, KE; Moore, SL; Hensel, CH; Liu, P; Siciliano, MJ; Kok, K; van den Berg, Anke; Veldhuis, P; Buys, CHCM; Killary, AM; Naylor, SL
1996-01-01
High frequencies of allelic loss on the short arm of chromosome 3 in small cell lung cancer (SCLC) and a number of other tumors suggest the existence of a tumor suppressor gene(s) within the deleted regions. Two small cell lung cancer lines, NCI H740 and GLC20, have been described which have
DEFF Research Database (Denmark)
Petersen, Martin Helgesen; Gevorgyan, Suren; Krebs, Frederik C
2009-01-01
a reduced band gap in the range of 1.69−1.75 eV and were explored in polymer photovoltaic devices as mixtures with the soluble fullerene PCBM. High open circuit voltages of up to 0.93 V and power conversion efficiencies (PCE) of up to 2.22% was observed for materials without the thermally labile groups...... performance than for the soluble precursor polymers; however, we found processing conditions that lead to a higher performance for the thermocleaved product, where open circuit voltages of up to 0.9 V could be obtained with power conversion efficiencies of up to 0.42%, representing a doubling as compared...... to the soluble precursor polymer. Copyright © 2009 American Chemical Society...
2012-09-26
... Register on June 1, 2012, at 77 FR 32658, allowing for a 60-day public comment period. USCIS did receive... time estimated for an average respondent to respond: Form I-864, 439,500 responses at 6 hours per...
Energy Technology Data Exchange (ETDEWEB)
NONE
2015-06-15
The International Electrotechnical Commission (IEC) writes standards that manufacturers of electrical equipment must comply with. Medical electrical equipment, such as medical imaging, radiation therapy, and radiation dosimetry devices, fall under Technical Committee 62. Of particular interest to medical physicists are the standards developed within Subcommittees (SC) 62B, which addresses diagnostic radiological imaging equipment, and 62C, which addresses equipment for radiation therapy, nuclear medicine and dosimetry. For example, a Working Group of SC 62B is responsible for safety and quality assurance standards for CT scanners and a Working Group of SC 62C is responsible for standards that set requirements for dosimetric safety and accuracy of linacs and proton accelerators. IEC standards thus have an impact on every aspect of a medical physicist’s job, including equipment testing, shielding design, room layout, and workflow. Consequently, it is imperative that US medical physicists know about existing standards, as well as have input on those under development or undergoing revision. The structure of the IEC and current standards development work will be described in detail. The presentation will explain how US medical physicists can learn about IEC standards and contribute to their development. Learning Objectives: Learn about the structure of the IEC and the influence that IEC standards have on the design of equipment for radiology and radiation therapy. Learn about the mechanisms by which the US participates in the development and revision of standards. Understand the specific requirements of several standards having direct relevance to diagnostic and radiation therapy physicists.
SU-C-213-02: Characterizing 3D Printing in the Fabrication of Variable Density Phantoms
Energy Technology Data Exchange (ETDEWEB)
Madamesila, J; McGeachy, P; Villarreal-Barajas, J; Khan, R [The University of Calgary, Calgary, AB (Canada)
2015-06-15
Purpose: In this work, we present characterization, process flow, quality control and application of 3D fabricated low density phantoms for radiotherapy quality assurance. Methods: A Rostock delta 3D printer using polystyrene filament of diameter 1.75 mm was used to print geometric volumes of 2×2×1 cm{sup 3} of varying densities. The variable densities of 0.1 to 0.75 g/cm {sup 3} were created by modulating the infill. A computed tomography (CT) scan was performed to establish an infill-density calibration curve as well as characterize the quality of the print such as uniformity and the infill pattern. The time required to print these volumes was also recorded. Using the calibration, two low density cones (0.19, 0.52 g/cm{sup 3}) were printed and benchmarked against commercially available phantoms. The dosimetric validation of the low density scaling of Anisotropic Analytical Algorithm (AAA) was performed by using a 0.5 g/cm{sup 3} slab of 10×10×2.4 cm{sup 3} with EBT3 GafChromic film. The gamma analysis at 3%/3mm criteria were compared for the measured and computed dose planes. Results: Analysis of the volume of air pockets in the infill resulted in a reasonable uniformity for densities 0.4 to 0.75 g/cm{sup 3}. Printed phantoms with densities below 0.4 g/cm{sup 3} exhibited a higher ratio of air to polystyrene resulting in large non-uniformity. Compared to the commercial inserts, good agreement was observed only for the printed 0.52 g/cm{sup 3} cone. Dosimetric comparison for a printed low density volume placed in-between layers of solid water resulted in >95% gamma agreement between AAA calculated dose planes and measured EBT3 films for a 6MV 5×5 cm{sup 2} clinical beam. The comparison showed disagreement in the penumbra region. Conclusion: In conclusion, 3D printing technology opens the door to desktop fabrication of variable density phantoms at economical prices in an efficient manner for the quality assurance needs of a small clinic.
National Oceanic and Atmospheric Administration, Department of Commerce — Habitat maps of the main Hawaiian Islands were created by visual interpretation of aerial photos and hyperspectral imagery using the Habitat Digitizer extension....
Energy Technology Data Exchange (ETDEWEB)
Cheung, J; Morin, O [University of California San Francisco, San Francisco, CA (United States)
2015-06-15
Purpose: To evaluate the influence of a new commercial transmission detector on radiotherapy beams of various energies. Methods: A transmission detector designed for online treatment monitoring was characterized on a TrueBeam STx linear accelerator with 6MV, 6FFF, 10MV, and 10FFF beams. Measurements of beam characteristics including percentage depth doses (PDDs), inplane and crossplane off-axis profiles at different depths, transmission factors, and skin dose were acquired at field sizes of 3×3cm, 5×5m, 10×10cm, and 20×20cm at 100cm and 80cm source-to-surface distance (SSD). All measurements were taken with and without the transmission detector in the path of the beam. A CC04 chamber was used for all profile and transmission factor measurements. Skin dose was assessed at 100cm, 90cm, and 80cm SSD and using a variety of detectors (Roos and Markus parallel-plate chambers, and OSLD). Results: The PDDs showed small differences between the unperturbed and perturbed beams for both 100cm and 80cm SSD (≤4mm dmax difference and <1.2% average profile difference). The differences were larger for the flattened beams and at larger field sizes. The off-axis profiles showed similar trends. The penumbras looked similar with and without the transmission detector. Comparisons in the central 80% of the profile showed a maximum average (maximum) profile difference between all field sizes of 0.756% (1.535%) and 0.739% (3.682%) for 100cm and 80cm SSD, respectively. The average measured skin dose at 100cm (80cm) SSD for 10×10cm field size was <4% (<35%) dose increase for all energies. For 20×20cm field size, this value increased to <10% (≤45%). Conclusion: The transmission detector has minimal effect on the clinically relevant radiotherapy beams for IMRT and VMAT (field sizes 10×10cm and less). For larger field sizes, some perturbations are observable which would need to be assessed for clinical impact. The authors of this publication has research support from IBA Dosimetry.
WE-G-213CD-03: A Dual Complementary Verification Method for Dynamic Tumor Tracking on Vero SBRT.
Poels, K; Depuydt, T; Verellen, D; De Ridder, M
2012-06-01
to use complementary cine EPID and gimbals log file analysis for in-vivo tracking accuracy monitoring. A clinical prototype of dynamic tracking (DT) was installed on the Vero SBRT system. This prototype version allowed tumor tracking by gimballed linac rotations using an internal-external correspondence model. The DT prototype software allowed the detailed logging of all applied gimbals rotations during tracking. The integration of an EPID on the vero system allowed the acquisition of cine EPID images during DT. We quantified the tracking error on cine EPID (E-EPID) by subtracting the target center (fiducial marker detection) and the field centroid. Dynamic gimbals log file information was combined with orthogonal x-ray verification images to calculate the in-vivo tracking error (E-kVLog). The correlation between E-kVLog and E-EPID was calculated for validation of the gimbals log file. Further, we investigated the sensitivity of the log file tracking error by introducing predefined systematic tracking errors. As an application we calculate gimbals log file tracking error for dynamic hidden target tests to investigate gravity effects and decoupled gimbals rotation from gantry rotation. Finally, calculating complementary cine EPID and log file tracking errors evaluated the clinical accuracy of dynamic tracking. A strong correlation was found between log file and cine EPID tracking error distribution during concurrent measurements (R=0.98). We found sensitivity in the gimbals log files to detect a systematic tracking error up to 0.5 mm. Dynamic hidden target tests showed no gravity influence on tracking performance and high degree of decoupled gimbals and gantry rotation during dynamic arc dynamic tracking. A submillimetric agreement between clinical complementary tracking error measurements was found. Redundancy of the internal gimbals log file with x-ray verification images with complementary independent cine EPID images was implemented to monitor the accuracy of gimballed tumor tracking on Vero SBRT. Research was financially supported by the Flemish government (FWO), Hercules Foundation and BrainLAB AG. © 2012 American Association of Physicists in Medicine.
Facile Synthesis of 2-(1,3-Benzoxazol/benzothiazol-2-yl)- 3H-benzo[f
African Journals Online (AJOL)
NICO
benzoxazol/benzothiazol-2-yl)-3H-benzo. [f]chromen-3-one derivatives by the Knoevenagel condensation between 2-hydroxy-1-naphthaldehyde and benzothiazole-2-yl-aceatates or N-methyl benzoxazole-2-yl-acetates using choline chloride/urea ...
National Oceanic and Atmospheric Administration, Department of Commerce — Habitat maps of the main Hawaiian Islands were created by visual interpretation of aerial photos and hyperspectral imagery using the Habitat Digitizer extension....
2010-10-01
... professions student loans as students of medicine, osteopathic medicine, dentistry or optometry prior to... practicing in a rural shortage area characterized by low family income. The regulations set forth in 42 CFR...
Structure, crystallization and dielectric resonances in 2-13 GHz of waste-derived glass-ceramic
Yao, Rui; Liao, SongYi; Chen, XiaoYu; Wang, GuangRong; Zheng, Feng
2016-12-01
Structure, kinetics of crystallization, and dielectric resonances of waste-derived glass-ceramic prepared via quench-heating route were studied as a function of dosage of iron ore tailing (IOT) within 20-40 wt% using X-ray diffraction (XRD), fourier transform infrared spectroscopy (FTIR), differential scanning calorimetry (DSC), scanning electron microscopy (SEM) with energy dispersive X-ray spectroscopy (EDS), X-ray photoelectron spectroscopy (XPS), and vector network analyzer (VNA) measurements. The glass-ceramic mainly consisted of ferrite crystals embedded in borosilicate glass matrix. Crystallization kinetics and morphologies of ferrite crystals as well as coordination transformation of boron between [BO4] and [BO3] in glass network were adjustable by changing the amount of IOT. Dielectric resonances in 6-13 GHz were found to be dominated by oscillations of Ca2+ cations in glass network with [SiO4] units on their neighboring sites. Ni2+ ions made a small contribution to those resonances. Diopside formed when IOT exceeded 35 wt%, which led to weakening of the resonances.
2007-04-19
the emission of 7 alpha particles and 4 beta particles. Three radionuclides ( francium -223, astatine-215, and polonium-211) are not listed below...no no Uranium-233 159,200 y alpha yes no Thorium-229 7,300 y alpha yes no Radium-225 14.9 d beta no no Actinium-225 10.0 d alpha no no Francium
δ37Cl : the geochemistry of chlorine isotopes
Eggenkamp, H.G.M.
1994-01-01
In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine.
δ³⁷Cl : the geochemistry of chlorine isotopes
Eggenkamp, H.G.M.
1994-01-01
In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine. This thesis presents the first chlorine
Energy Technology Data Exchange (ETDEWEB)
Jaszczak, R.J.
1995-12-01
Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.
$\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams
We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.
Maiti, Moumita
2011-01-01
Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.
Production cross section of At radionuclides from 7Li+natPb and 9Be+natTl reactions
Maiti, Moumita; Lahiri, Susanta
2011-12-01
Earlier we reported theoretical studies on the probable production of astatine radionuclides from 6,7Li- and 9Be-induced reactions on natural lead and thallium targets, respectively. The production of astatine radionuclides were investigated experimentally with two heavy-ion-induced reactions: 9Be + natTl and 7Li + natPb. Formation cross sections of the evaporation residues, 207,208,209,210At, produced in the (HI,xn) channel, were measured by the stacked-foil technique followed by off-line γ spectrometry at low incident energies (<50 MeV). Measured excitation functions were interpreted in terms of a compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach models. Measured cross-section values are lower than the respective theoretical predictions.
Energy Technology Data Exchange (ETDEWEB)
Feng, Y [East Carolina Univ, Greenville, NC (United States); Huang, Z [East Carolina University, Greenville, NC (United States); Lo, S [Case Western Reserve University, Cleveland, OH (United States); Mayr, N; Yuh, W [University of Washington, Seattle, WA (United States)
2015-06-15
Purpose: To improve Gamma Knife SRS treatment efficiency for brain metastases and compare the differences of treatment time and radiobiological effects between two different planning methods of automatic filling and manual placement of shots with inverse planning. Methods: T1-weighted MRI images with gadolinium contrast from five patients with a single brain metastatic-lesion were used in this retrospective study. Among them, two were from primary breast cancer, two from primary melanoma cancer and one from primary prostate cancer. For each patient, two plans were generated in Leksell GammaPlan10.1.1 for radiosurgical treatment with a Leksell GammaKnife Perfexion machine: one with automatic filling, automatic sector configuration and inverse optimization (Method1); and the other with manual placement of shots, manual setup of collimator sizes, manual setup of sector blocking and inverse optimization (Method2). Dosimetric quality of the plans was evaluated with parameters of Coverage, Selectivity, Gradient-Index and DVH. Beam-on Time, Number-of-Shots and Tumor Control Probability(TCP) were compared for the two plans while keeping their dosimetric quality very similar. Relative reduction of Beam-on Time and Number-of-Shots were calculated as the ratios among the two plans and used for quantitative analysis. Results: With very similar dosimetric and radiobiological plan quality, plans created with Method 2 had significantly reduced treatment time. Relative reduction of Beam-on Time ranged from 20% to 51 % (median:29%,p=0.001), and reduction of Number-of-Shots ranged from 5% to 67% (median:40%,p=0.0002), respectively. Time of plan creation for Method1 and Method2 was similar, approximately 20 minutes, excluding the time for tumor delineation. TCP calculated for the tumors from differential DVHs did not show significant difference between the two plans (p=0.35). Conclusion: The method of manual setup combined with inverse optimization in LGP for treatment of brain metastatic lesions with the Perfexion can achieve significantly higher time efficiency without degrading treatment quality.
Li, Shizhe; An, Li; Yu, Shao; Ferraris Araneta, Maria; Johnson, Christopher S; Wang, Shumin; Shen, Jun
2016-03-01
Carbon-13 ((13)C) MR spectroscopy (MRS) of the human brain at 7 Tesla (T) may pose patient safety issues due to high radiofrequency (RF) power deposition for proton decoupling. The purpose of present work is to study the feasibility of in vivo (13)C MRS of human brain at 7 T using broadband low RF power proton decoupling. Carboxylic/amide (13)C MRS of human brain by broadband stochastic proton decoupling was demonstrated on a 7 T scanner. RF safety was evaluated using the finite-difference time-domain method. (13)C signal enhancement by nuclear Overhauser effect (NOE) and proton decoupling was evaluated in both phantoms and in vivo. At 7 T, the peak amplitude of carboxylic/amide (13)C signals was increased by a factor of greater than 4 due to the combined effects of NOE and proton decoupling. The 7 T (13)C MRS technique used decoupling power and average transmit power of less than 35 watts (W) and 3.6 W, respectively. In vivo (13)C MRS studies of human brain can be performed at 7 T, well below the RF safety threshold, by detecting carboxylic/amide carbons with broadband stochastic proton decoupling. © 2015 Wiley Periodicals, Inc.
Energy Technology Data Exchange (ETDEWEB)
Szczykutowicz, T; Rubert, N; Ranallo, F [University Wisconsin-Madison, Madison, WI (United States)
2015-06-15
Purpose: A framework for explaining differences in image quality to non-technical audiences in medial imaging is needed. Currently, this task is something that is learned “on the job.” The lack of a formal methodology for communicating optimal acquisition parameters into the clinic effectively mitigates many technological advances. As a community, medical physicists need to be held responsible for not only advancing image science, but also for ensuring its proper use in the clinic. This work outlines a framework that bridges the gap between the results from quantitative image quality metrics like detectability, MTF, and NPS and their effect on specific anatomical structures present in diagnostic imaging tasks. Methods: Specific structures of clinical importance were identified for a body, an extremity, a chest, and a temporal bone protocol. Using these structures, quantitative metrics were used to identify the parameter space that should yield optimal image quality constrained within the confines of clinical logistics and dose considerations. The reading room workflow for presenting the proposed changes for imaging each of these structures is presented. The workflow consists of displaying images for physician review consisting of different combinations of acquisition parameters guided by quantitative metrics. Examples of using detectability index, MTF, NPS, noise and noise non-uniformity are provided. During review, the physician was forced to judge the image quality solely on those features they need for diagnosis, not on the overall “look” of the image. Results: We found that in many cases, use of this framework settled mis-agreements between physicians. Once forced to judge images on the ability to detect specific structures inter reader agreement was obtained. Conclusion: This framework will provide consulting, research/industrial, or in-house physicists with clinically relevant imaging tasks to guide reading room image review. This framework avoids use of the overall “look” or “feel” to dictate acquisition parameter selection. Equipment grants GE Healthcare.
H.S. Chan (Ho Sze); M. Konijnenberg (Mark); Daniels, T. (Tamara); Nysus, M. (Monique); Makvandi, M. (Mehran); E. de Blois (Erik); W.A.P. Breeman (Wouter); Atcher, R.W. (Robert W.); M. de Jong (Marcel); J.P. Norenberg (Jeffrey)
2016-01-01
textabstractBackground: Targeted alpha therapy (TAT) offers advantages over current β-emitting conjugates for peptide receptor radionuclide therapy (PRRT) of neuroendocrine tumors. PRRT with 177Lu-DOTATATE or 90Y-DOTATOC has shown dose-limiting nephrotoxicity due to radiopeptide retention in the
Energy Technology Data Exchange (ETDEWEB)
Singh, B.N.; Taehtinen, S. [VTT Manufacturing Technology (Finland)
2001-12-01
The present report summarizes and highlights the main results of the work carried out during the last 5 - 6 years on effects of neutron irradiation on physical and mechanical properties of copper and copper alloys. The work was an European contribution to ITER Research and Development programme and was carried out by the Associations Euratom - Risoe and Euratom - Tekes. Details of the investigations carried out within the framework of the present task and the main results have been reported in various reports and journal publication. On the basis of these results some conclusions are drawn regarding the suitability of a copper alloy for its use in the first wall and divertor components of ITER. It is pointed out that the present work has managed only to identify some of the critical problems and limitations of the copper alloys for their employment in the hostile environment of 14 MeV neutrons. A considerable amount of further effort is needed to find a realistic and optimum solution. (au)
Vikraman, Sundeep; Fryar, Cheryl D.; Ogden, Cynthia L.
2015-01-01
Consumption of fast food has been linked to weight gain in adults. Fast food has also been associated with higher caloric intake and poorer diet quality in children and adolescents. From 1994 through 2006, caloric intake from fast food increased from 10% to 13% among children aged 2-18 years. This report presents the most recent data on the…
213. Evolución del fallo primario del injerto en los 25 años de trasplante cardíaco
Directory of Open Access Journals (Sweden)
P. Martínez
2010-01-01
Conclusiones: A pesar de los avances en los últimos años se observa un aumento de la incidencia de FPI Sin embargo, la mortalidad temprana del FPI ha disminuido con la experiencia, lo que podría estar asociado con el tratamiento más temprano y agresivo de soporte circulatorio mecánico de los últimos tiempos.
Nielsen, Christian B.
2016-01-01
An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.
Nielsen, Christian B.
2015-01-01
An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.
National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...
Directory of Open Access Journals (Sweden)
W J Wessels
2005-10-01
Full Text Available In this article the Old Testament prophetic literature will be the focus of discussion with regard to the matter of restoring broken relationships, be it between God and humans or between humans as such. The relationship between Yahweh and his people was formally established by means of a covenant. The presentation of the prophetic material is done with a narrow focus on the issues of reconciliation and restoration. Prophets and prophetic� texts are selected with the mentioned focus in mind and presented as the results of research done on the chosen texts. It is therefore done with a real awareness of the complexity of the prophetic material and the historical embedding of prophetic material. A detailed discussion of introductory and theological issues are therefore not presented, but taken into account. What result in this paper is a focussed presentation on the mentioned topics in some of the prophetic material. Although the word reconciliation is not an Old Testament concept, it is clear that the idea of re-establishment and renewal of� the relationship between God and people was ever present. The prophets had the duty to address the reasons for damage to this covenant relationship and to warn the people of the consequences if they continue to disobey the stipulations and ethical demands of this relationship. The prophets not only served as witnesses of the efforts of Yahweh to reconcile with his people, but also as instruments to bring it about.�
Mohamed, Shaaban K.; Farrukh, Muhammad Akhyar; Akkurt, Mehmet; Albayati, Mustafa R.; Abdelhamid, Antar A.
2012-01-01
In the title 1:1 cocrystal, C10H7NO4·C14H13N3O2, molecules are linked by intermolecular C—H⋯O, N—H⋯O and O—H⋯N hydrogen bonds, forming a three-dimensional network. In addition, π–π stacking interactions [with centroid–centroid distances of 3.5723 (19) and 3.6158 (18) Å] are observed. PMID:22904889
Mohamed, Shaaban K; Farrukh, Muhammad Akhyar; Akkurt, Mehmet; Albayati, Mustafa R; Abdelhamid, Antar A
2012-08-01
In the title 1:1 cocrystal, C(10)H(7)NO(4)·C(14)H(13)N(3)O(2), mol-ecules are linked by inter-molecular C-H⋯O, N-H⋯O and O-H⋯N hydrogen bonds, forming a three-dimensional network. In addition, π-π stacking inter-actions [with centroid-centroid distances of 3.5723 (19) and 3.6158 (18) Å] are observed.
National Aeronautics and Space Administration — The Filled Land Surface Albedo Product is a global data set of spatially complete albedo maps. It was derived from the MODIS MOD43B3 Land product and includes both...
Energy Technology Data Exchange (ETDEWEB)
Edwards, D.J. [Pacific Northwest National Lab., Richland, WA (United States); Fabritsiev, S.A. [D.V. Efremov Inst., St. Petersburg (Russian Federation); Pokrovsky, A.S. [SRIAR, Dimitrovgrad (Russian Federation); Zinkle, S.J. [Oak Ridge National Lab., TN (United States)] [and others
1996-04-01
Specimen fabrication is underway for an irradiation screening experiment planned to start in January 1996 in the SM-2 reactor in Dimitrovgrad, Russia. The purpose of the experiment is to evaluate the effects of neutron irradiation at ITER-relevant temperatures on the bond integrity performance of Cu/SS and Be/Cu joints, as well as to further investigate the base metal properties of irradiated copper alloys. Specimens from each of the four ITER parties (U.S., EU, japan, and RF) will be irradiated to a dose of {approx}0.2 dpa at two different temperatures, 150 and 300{degrees}C. The specimens will consist of Cu/SS and Be/Cu joints in several different geometries, as well as a large number of specimens from the base materials. Fracture toughness data on base metal and Cu/SS bonded specimens will be obtained from specimens supplied by the U.S. Due to lack of material, the Be/Cu specimens supplied by the U.S will only be irradiated as TEM disks.
Directory of Open Access Journals (Sweden)
Gy. Ézsöl
2012-01-01
Full Text Available The PMK-2 facility is a full-pressure thermal-hydraulic model of the primary and partly the secondary circuit of the VVER-type units of Paks NPP. The facility was the first integral-type facility for VVERs. The PMK-2 was followed later by the PACTEL (for VVER-440, the ISB, and PSB for VVER-1000. Since the startup of the facility in 1985, 55 experiments have been performed primarily in international frameworks with the participation of experts from 29 European and overseas countries forming a scientific school to better understand VVER system behaviour and reach a high level of modelling of accident sequences. The ATHLET, CATHARE, and RELAP5 codes have been validated including both qualitative and quantitative assessments. The former was almost exclusively applied to the early phase of validation by integral experiments, while the quantitative assessments have been performed by the Fast Fourier Transform Based Method. Paper gives comprehensive information on the design features of PMK-2 facility with a special respect to the representativeness of phenomena, the experiments performed, and the results of the validation of ATHLET, CATHARE, and RELAP5 codes. Safety significance of the PMK-2 projects is also discussed.
Wucher, Philipp
2013-01-01
An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.
Energy Technology Data Exchange (ETDEWEB)
Vitzthum, L; Ehler, E; Sterling, D; Reynolds, T; Higgins, P; Dusenbery, K [University of Minnesota, Minneapolis, MN (United States)
2015-06-15
Purpose: To evaluate a novel 3D printed bolus fabricated from a copper-plastic composite as a thin flexible, custom fitting device that can replicate doses achieved with conventional bolus techniques. Methods: Two models of bolus were created on a 3D printer using a composite copper-PLA/PHA. Firstly, boluses were constructed at thicknesses of 0.4, 0.6 and 0.8 mm. Relative dose measurements were performed under the bolus with an Attix Chamber as well as with radiochromic film. Results were compared to superficial Attix Chamber measurements in a water equivalent material to determine the dosimetric water equivalence of the copper-PLA/PHA plastic. Secondly, CT images of a RANDO phantom were used to create a custom fitting bolus across the anterolateral scalp. Surface dose with the bolus placed on the RANDO phantom was measured with radiochromic film at tangential angles with 6, 10, 10 flattening filter free (FFF) and 18 MV photon beams. Results: Mean surface doses for 6, 10, 10FFF and 18 MV were measured as a percent of Dmax for the flat bolus devices of each thickness. The 0.4 mm thickness bolus was determined to be near equivalent to 2.5 mm depth in water for all four energies. Surface doses ranged from 59–63% without bolus and 85–90% with the custom 0.4 mm copper-plastic bolus relative to the prescribed dose for an oblique tangential beam arrangement on the RANDO phantom. Conclusion: Sub-millimeter thickness, 3D printed composite copper-PLA/PHA bolus can provide a build-up effect equivalent to conventional bolus. At this thickness, the 3D printed bolus allows a level of flexure that may provide more patient comfort than current 3D printing materials used in bolus fabrication while still retaining the CT based custom patient shape. Funding provided by an intra-department grant of the University of Minnesota Department of Radiation Oncology.
Energy Technology Data Exchange (ETDEWEB)
Ehler, E; Sterling, D; Higgins, P [University of Minnesota, Minneapolis, MN (United States)
2015-06-15
Purpose: 3D printed phantoms constructed of multiple tissue approximating materials could be useful in both clinical and research aspects of radiotherapy. This work describes a 3D printed phantom constructed with tissue substitute plastics for both bone and soft tissue; air cavities were included as well. Methods: 3D models of an anonymized nasopharynx patient were generated for air cavities, soft tissues, and bone, which were segmented by Hounsfield Unit (HU) thresholds. HU thresholds were chosen to define air-to-soft tissue boundaries of 0.65 g/cc and soft tissue-to-bone boundaries of 1.18 g/cc based on clinical HU to density tables. After evaluation of several composite plastics, a bone tissue substitute was identified as an acceptable material for typical radiotherapy x-ray energies, composed of iron and PLA plastic. PET plastic was determined to be an acceptable soft tissue substitute. 3D printing was performed on a consumer grade dual extrusion fused deposition model 3D printer. Results: MVCT scans of the 3D printed heterogeneous phantom were acquired. Rigid image registration of the patient and the 3D printed phantom scans was performed. The average physical density of the soft tissue and bone regions was 1.02 ± 0.08 g/cc and 1.39 ± 0.14 g/cc, respectively, for the patient kVCT scan. In the 3D printed phantom MVCT scan, the average density of the soft tissue and bone was 1.01 ± 0.09 g/cc and 1.44 ± 0.12 g/cc, respectively. Conclusion: A patient specific phantom, constructed of heterogeneous tissue substitute materials was constructed by 3D printing. MVCT of the 3D printed phantom showed realistic tissue densities were recreated by the 3D printing materials. Funding provided by intra-department grant by University of Minnesota Department of Radiation Oncology.
Energy Technology Data Exchange (ETDEWEB)
Lee, M; Suh, T [Department of Biomedical Engineering, College of Medicine, The Catholic University of Korea, Seoul (Korea, Republic of); Research Institute of Biomedical Engineering, College of Medicine, The Catholic University of Korea, Seoul (Korea, Republic of); Han, B; Xing, L [Department of Radiation Oncology, Stanford University School of Medicine, Palo Alto, CA (United States); Jenkins, C [Department of Radiation Oncology, Stanford University School of Medicine, Palo Alto, CA (United States); Department of Mechanical Engineering, Stanford University, Palo Alto, CA (United States)
2015-06-15
Purpose: To develop and validate an innovative method of using depth sensing cameras and 3D printing techniques for Total Body Irradiation (TBI) treatment planning and compensator fabrication. Methods: A tablet with motion tracking cameras and integrated depth sensing was used to scan a RANDOTM phantom arranged in a TBI treatment booth to detect and store the 3D surface in a point cloud (PC) format. The accuracy of the detected surface was evaluated by comparison to extracted measurements from CT scan images. The thickness, source to surface distance and off-axis distance of the phantom at different body section was measured for TBI treatment planning. A 2D map containing a detailed compensator design was calculated to achieve uniform dose distribution throughout the phantom. The compensator was fabricated using a 3D printer, silicone molding and tungsten powder. In vivo dosimetry measurements were performed using optically stimulated luminescent detectors (OSLDs). Results: The whole scan of the anthropomorphic phantom took approximately 30 seconds. The mean error for thickness measurements at each section of phantom compare to CT was 0.44 ± 0.268 cm. These errors resulted in approximately 2% dose error calculation and 0.4 mm tungsten thickness deviation for the compensator design. The accuracy of 3D compensator printing was within 0.2 mm. In vivo measurements for an end-to-end test showed the overall dose difference was within 3%. Conclusion: Motion cameras and depth sensing techniques proved to be an accurate and efficient tool for TBI patient measurement and treatment planning. 3D printing technique improved the efficiency and accuracy of the compensator production and ensured a more accurate treatment delivery.
Verburg, J; Shih, H; Seco, J
2012-06-01
The impact of nuclear reaction model differences on simulation of prompt gamma-ray imaging for proton therapy range verification was assessed. Four nuclear reaction models were used to simulate gamma emission in proton beams, and were validated against experimental cross-sections. Proton-induced nuclear reactions on carbon, oxygen, nitrogen and calcium were investigated with the Monte Carlo toolkits GEANT4 9.5 and MCNPX 2.7, and the dedicated nuclear reaction codes TALYS 1.4 and EMPIRE 3.1. Absolute cross-sections of discrete prompt gamma lines and the total gamma production were obtained for the 1-200 MeV incident proton energy range. They were compared to 34 discrete line measurements reported in literature. Using these cross-sections, we analyzed the gamma production along the path of proton beams passing through various tissues. The differences in absolute discrete line cross-sections as predicted by the models ranged from almost zero to an order of magnitude, depending on the gamma line and incident proton energy. Overall, the dedicated nuclear reaction codes provided a better fit to most experimental excitation functions. For a 150 MeV proton beam stopping in soft tissue, these differences amount to a variation by a factor of 4 of the gamma emission around the Bragg peak location. The maximum of gamma production near the end of proton range differed by 7 mm, and the change of the 50% emission fall-off position was 4 mm. There is a clear need for improvement of nuclear reaction models to accurately simulate proton range verification using prompt gamma-rays. Current simulation codes show large uncertainties in both the total gamma yield and the correlation of gamma emission with the proton Bragg peak. GEANT4 and MCNPX in particular appear to have limited predictive power. © 2012 American Association of Physicists in Medicine.
Energy Technology Data Exchange (ETDEWEB)
1994-08-01
The Electric Power Research Institute (EPRI) is preparing a compendium of technical requirements, referred to as the {open_quotes}Advanced Light Water Reactor [ALWR] Utility Requirements Document{close_quotes}, that is acceptable to the design of an ALWR power plant. When completed, this document is intended to be a comprehensive statement of utility requirements for the design, construction, and performance of an ALWR power plant for the 1990s and beyond. The Requirements Document consists of three volumes. Volume I, {open_quotes}ALWR Policy and Summary of Top-Tier Requirements{close_quotes}, is a management-level synopsis of the Requirements Document, including the design objectives and philosophy, the overall physical configuration and features of a future nuclear plant design, and the steps necessary to take the proposed ALWR design criteria beyond the conceptual design state to a completed, functioning power plant. Volume II consists of 13 chapters and contains utility design requirements for an evolutionary nuclear power plant [approximately 1350 megawatts-electric (MWe)]. Volume III contains utility design requirements for nuclear plants for which passive features will be used in their designs (approximately 600 MWe). In April 1992, the staff of the Office of Nuclear Reactor Regulation, U.S. Nuclear Regulatory Commission, issued Volume 1 and Volume 2 (Parts 1 and 2) of its safety evaluation report (SER) to document the results of its review of Volumes 1 and 2 of the Requirements Document. Volume 1, {open_quotes}NRC Review of Electric Power Research Institute`s Advanced Light Water Reactor Utility Requirements Document - Program Summary{close_quotes}, provided a discussion of the overall purpose and scope of the Requirements Document, the background of the staff`s review, the review approach used by the staff, and a summary of the policy and technical issues raised by the staff during its review.
Directory of Open Access Journals (Sweden)
Denise Gonçaleves Moura Pinheiro
2012-01-01
Full Text Available In the treatment of ischemic cardiopathy, the prevention has a main role and the modifications in the lifestyle are indispensable for the good prognosis of the disease. The goal of the study was to describe the lifestyle regarding the prevalence of cardiovascular risk factors, such as smoking, alcohol consumption, dietary habits and sedentary behaviors before myocardial revascularization surgery and during the period of cardiac rehabilitation in a private institution that did not comprise structured health education activities. This was a retrospective, observational study, with a qualitative approach, held with 50 patients submitted to cardiac rehabilitation (36 men and 14 women; age 61±12.74 years. The data were collected from clinical records of the pre-cardiac rehabilitation evaluation which consisted of clinical data and information referring to the patients’ lifestyle. Amongst the most prevalent co-morbidities in the sample, there were: the hypertension (n=24; 48%, the diabetes mellitus (n=18; 36% and dyslipidemias (n=17; 34%. A high rate of smoke cessation (100% and 58% of sedentary behaviors (n=29 was observed after the cardiac surgery. This same number (n=29; 58% referred to have adhered to changes in dietary habits after the myocardial acute infarct. There was also an increase in the prevalence of alcohol consumption (n=21; 42% after myocardial revascularization. We conclude with this research that a cardiac rehabilitation program should provide to their patients, health education actions, for a necessary and real change in lifestyle habits, with the presence of a multidisciplinary team.
Energy Technology Data Exchange (ETDEWEB)
Deffet, S; Macq, B [Universite catholique de Louvain, Louvain-la-Neuve (Belgium); Farace, P; Righetto, R [Trento Hospital / APSS, Trento (Italy); Vander Stappen, F [Ion Beam Applications (IBA), Louvain-la-Neuve (Belgium)
2016-06-15
Purpose: The conversion from Hounsfield units (HU) to stopping powers is a major source of range uncertainty in proton therapy (PT). Our contribution shows how proton radiographs (PR) acquired with a multi-layer ionization chamber in a PT center can be used for accurate patient positioning and subsequently for patient-specific optimization of the conversion from HU to stopping powers. Methods: A multi-layer ionization chamber was used to measure the integral depth-dose (IDD) of 220 MeV pencil beam spots passing through several anthropomorphic phantoms. The whole area of interest was imaged by repositioning the couch and by acquiring a 45×45 mm{sup 2} frame for each position. A rigid registration algorithm was implemented to correct the positioning error between the proton radiographs and the planning CT. After registration, the stopping power map obtained from the planning CT with the calibration curve of the treatment planning system was used together with the water equivalent thickness gained from two proton radiographs to generate a phantom-specific stopping power map. Results: Our results show that it is possible to make a registration with submillimeter accuracy from proton radiography obtained by sending beamlets separated by more than 1 mm. This was made possible by the complex shape of the IDD due to the presence of lateral heterogeneities along the path of the beam. Submillimeter positioning was still possible with a 5 mm spot spacing. Phantom specific stopping power maps obtained by minimizing the range error were cross-verified by the acquisition of an additional proton radiography where the phantom was positioned in a random but known manner. Conclusion: Our results indicate that a CT-PR registration algorithm together with range-error based optimization can be used to produce a patient-specific stopping power map. Sylvain Deffet reports financial funding of its PhD thesis by Ion Beam Applications (IBA) during the confines of the study and outside the submitted work. Francois Vander Stappen reports being employed by Ion Beam Applications (IBA) during the confines of the study and outside the submitted work.
Ethyl 2-[1-(3-methyl-but-yl)-4-phenyl-1H-1,2,3-triazol-5-yl]-2-oxo-acetate.
Ahmed, Muhammad Naeem; Yasin, Khawaja Ansar; Tahir, M Nawaz; Hafeez, Muhammad; Aziz, Shahid
2013-11-13
In the title compound, C17H21N3O3, the non-planar (r.m.s. deviation = 0.212 Å) ethyl (oxo)acetate group is oriented towards the phenyl substituent. The triazole and benzene rings are twisted with respect to each other, making a dihedral angle of 41.69 (6)°. In the crystal, mol-ecules are arranged into centrosymmetric R 2 (2)(10) dimers via pairs of C-H⋯O inter-actions involving the ethyl (oxo)acetate groups. In addition, the triazole rings show π-π stacking inter-actions, with their centroids at a distance of 3.745 (2) Å.
Energy Technology Data Exchange (ETDEWEB)
NONE
2015-06-15
The North American medical physics community validates the education received by medical physicists and the clinical qualifications for medical physicists through accreditation of educational programs and certification of medical physicists. Medical physics educational programs (graduate education and residency education) are accredited by the Commission on Accreditation of Medical Physics Education Programs (CAMPEP), whereas medical physicists are certified by several organizations, the most familiar of which is the American Board of Radiology (ABR). In order for an educational program to become accredited or a medical physicist to become certified, the applicant must meet certain specified standards set by the appropriate organization. In this Symposium, representatives from both CAMPEP and the ABR will describe the process by which standards are established as well as the process by which qualifications of candidates for accreditation or certification are shown to be compliant with these standards. The Symposium will conclude with a panel discussion. Learning Objectives: Recognize the difference between accreditation of an educational program and certification of an individual Identify the two organizations primarily responsible for these tasks Describe the development of educational standards Describe the process by which examination questions are developed GS is Executive Secretary of CAMPEP.
Energy Technology Data Exchange (ETDEWEB)
Arena, J.F.; Lubs, H. [Univ. of Miami School of Medicine, Miami, FL (United States); Schwartz, C. [Greenwood Genetic Center, SC (United States)] [and others
1996-07-12
We reevaluated a family previously described as having nonspecific X-linked mental retardation (XLMR) by Snyder and Robinson (MINI 309583). Clinical and DNA studies were conducted on 17 relatives, including 6 males with mild-to-moderate mental retardation, 3 carrier females, and 8 normal males. In contrast to the normal appearance and minimal clinical findings reported 22 years ago, affected males were found to have a characteristic set of clinical findings. These developed gradually over the first 2 decades, and included thin body build with diminished muscle mass, osteoporosis and kyphoscoliosis, slight facial asymmetry with a prominent lower lip, nasal speech, high narrow or cleft palate, and long great toes. Carrier females were clinically normal. Multipoint linkage analysis indicated linkage to markers distal to the 3{prime} end of DMD (DXS41 and DXS989), with a maximal lod score of 4.7. On the basis of these findings, this entity is redefined as XLMR syndrome. 22 refs., 6 figs., 2 tabs.
Hsi, W; Kang, Y; Ding, X; Iannello, J; Mascia, A; Schreuder, N; Smith, J; Zeidan, O; Zheng, Y
2012-06-01
A chair, coupled to a robotic patient positioning system (PPS) was manufactured to treat an intracranial tumor in a proton incline beam-line system. Treating patients in the seated position as accurately and efficiently as a treatment table requires the essential functions of isocentric rotation and a weight-sagging-correction algorithm for positioning patients in the seated position. The chair design incorporated a down-slope arm to achieve the desired beam-line height. To overcome this limitation of only 125 degree rotation on PPS, five indexed positions of the seat-base-plate (SBP) were implemented. An in-house developed optical tracking system using a six degree-of-freedom optical camera system was used to align the treatment room coordinate system with the chair coordinate system at all SBP positions. Furthermore, this optical tracking system quantified the sagging effect due to both the height and weight of a variety of patients. The optical tracking system can measure accuracy of 0.1 degree and 0.1 mm. The SBP rotating axis was aligned within 0.1 degree to PPS rotating axis. A residual precession of chair rotation was found to be an ellipse with long axis of 2.0 mm and short axis of 1.0 mm. An additional 0.75 mm deviation occurred between rotating of SBP and PPS axes. Sagging tilt of 0.6 degree was found on the SBP for the home position for every additional 162 lbs load. This resulted in a 1.1cm shift (0.65 cm forward and 0.87 cm) for an isocenter 90 cm away from the SBP plate. Using in-house developed optical tracking system, the overall maximum displacement of treatment chair system from isocenter is within 3.0 mm with known sagging characteristics. This characterization is essential to reduce the total treatment time and limited the number of X-rays required for accurate patient alignment in the seated position. © 2012 American Association of Physicists in Medicine.
National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...
DEFF Research Database (Denmark)
Gottfredsen, Randi Heidemann; Goldstrohm, David; Hartney, John
2014-01-01
Extracellular superoxide dismutase (EC-SOD) is responsible for the dismutation of the superoxide radical produced in the extracellular space and known to be expressed by inflammatory cells, including macrophages and neutrophils. Here we show that EC-SOD is produced by resting macrophages and asso......Extracellular superoxide dismutase (EC-SOD) is responsible for the dismutation of the superoxide radical produced in the extracellular space and known to be expressed by inflammatory cells, including macrophages and neutrophils. Here we show that EC-SOD is produced by resting macrophages...... and associated with the cell surface via the extracellular matrix (ECM)-binding region. Upon cellular activation induced by lipopolysaccharide, EC-SOD is relocated and detected both in the cell culture medium and in lipid raft structures. Although the secreted material presented a significantly reduced ligand...
Trilleras, Jorge; Velásquez, Kelly; Cobo, Justo; Glidewell, Christopher
2013-06-01
The title compound, C16H9FN2S, crystallizes as a nonmerohedral twin with twin rotation about the reciprocal-lattice vector [101]*. The molecules are nearly planar and the dihedral angle between the planes of the two aryl rings is only 4.4 (2)°. The molecules are linked by pairs of C-H···N hydrogen bonds to form cyclic centrosymmetric R2(2)(18) dimers, which are linked into chains by an aromatic π-π stacking interaction. Comparisons are made with some related 3-aryl-2-thienylacrylonitriles.
Kirby, N; Chuang, C; Pouliot, J
2012-06-01
To objectively evaluate the accuracy of 11 different deformable registration techniques for bladder filling. The phantom represents an axial plane of the pelvic anatomy. Urethane plastic serves as the bony anatomy and urethane rubber with three levels of Hounsfield units (HU) is used to represent fat and organs, including the prostate. A plastic insert is placed into the phantom to simulate bladder filling. Nonradiopaque markers reside on the phantom surface. Optical camera images of these markers are used to measure the positions and determine the deformation from the bladder insert. Eleven different deformable registration techniques are applied to the full- and empty-bladder computed tomography images of the phantom to calculate the deformation. The applied algorithms include those from MIMVista Software and Velocity Medical Solutions and 9 different implementations from the Deformable Image Registration and Adaptive Radiotherapy Toolbox for Matlab. The distance to agreement between the measured and calculated deformations is used to evaluate algorithm error. Deformable registration warps one image to make it similar to another. The root-mean-square (RMS) difference between the HUs at the marker locations on the empty-bladder phantom and those at the calculated marker locations on the full-bladder phantom is used as a metric for image similarity. The percentage of the markers with an error larger than 3 mm ranges from 3.1% to 28.2% with the different registration techniques. This range is 1.1% to 3.7% for a 7 mm error. The least accurate algorithm at 3 mm is also the most accurate at 7 mm. Also, the least accurate algorithm at 7 mm produces the lowest RMS difference. Different deformation algorithms generate very different results and the outcome of any one algorithm can be misleading. Thus, these algorithms require quality assurance. The two-dimensional phantom is an objective tool for this purpose. © 2012 American Association of Physicists in Medicine.
Genuardi, M; Calvieri, F; Tozzi, C; Coslovi, R; Neri, G
1994-10-01
We describe a boy with an interstitial deletion of the proximal portion of chromosome 3q. Prominent physical characteristics were a dysmorphic face with apparent hypertelorism, signs of prenatal lymphedema, foot contractures and agenesis of the corpus callosum. The finding of corpus callosum agenesis in a previously reported patient with an overlapping deletion suggests an additional locus for this malformation.
National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...
Energy Technology Data Exchange (ETDEWEB)
Koziorowski, J
1998-10-01
Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on {sup 211}At and {sup 124}I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[{sup 211}At]astato-2`-deoxyuridine (AUdR) and N-succinimidyl-4-[{sup 211}At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [{sup 124}I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[{sup 124}I]iodo-2`-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for
DEFF Research Database (Denmark)
Beltoft, Vibe Meister; Nørby, Karin Kristiane
. Moreover, the Panel reconsidered the available data on p-mentha-1,4(8)-dien-3-one [FL-no: 07.127], based on new data on the structurally related substance pulegone, and concluded that additional genotoxicity data are needed to rule out the concern for genotoxicity of p-mentha-1,4(8)-dien-3-one [FL-no: 07.127]....
Directory of Open Access Journals (Sweden)
Maurício Hostim Silva
2007-11-01
Full Text Available Diversos aspectos da biologia reprodutiva da garoupa verdadeira Epinephelus marginatus foram abordados através de uma metodologia colaborativa. Ao todo, 193 exemplares da garoupa verdadeira foram obtidas em peixarias colaboradoras no município de São Francisco do Sul, Estado de Santa Catarina, Brasil. Os funcionários das peixarias foram treinados e incentivados a realizar a coleta de todo material biológico necessário para estudos reprodutivos, possibilitando o acesso a um grande número de vísceras que teriam de outra maneira sido dispensadas. Epinephelus marginatus esteve em atividade reprodutiva no inicio do verão, com desova provável entre novembro e dezembro. Fêmeas atingiram a maturidade sexual com aproximadamente 460 mm de comprimento total. Machos variaram de 900mm a 1000 mm e fêmeas de 300 mm a 960 mm. Não foram observados machos em transição sexual. A equação de regressão da relação entre o comprimento total (CT (mm e peso total (PT (g foi dada (PT = 4.4 x 10-5 CT2. 8. Sugestões são dadas ainda para o aumento da performance de futuras abordagens colaborativas de pesquisa.Several aspects of the reproductive biology of the dusky grouper Epinephelus marginatus were investigated using a collaborative methodology. 193 specimens of dusky groupers were obtained in collaboration with fish market personnel in the city of São Francisco do Sul, Santa Catarina State, Southern Brazil. Fish market staff were trained and encouraged to collect biological material required for reproductive studies, giving access to many specimens which otherwise would have been unavailable. E. marginatus was found to reproduce in early summer, spawning between November and December. Females reached sexual maturity at approximately 460 mm total length. Sampled males ranged from 900- 1000 mm and females from 300-960 mm in total length. No transitional (i.e. sex changing males were observed. The regression equation for the relationship between total length (TL (mm and total weight (TW (g was TW = 4.4x10-5TL2.8. Suggestions to improve the performance of future collaborative sampling projects are discussed.
DEFF Research Database (Denmark)
Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena
2014-01-01
Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...
Wucher, Philipp
2013-01-01
An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.