WorldWideScience

Sample records for astatine 212

  1. Radiochemistry of astatine

    Energy Technology Data Exchange (ETDEWEB)

    Ruth, T J; Dombsky, M; D' Auria, J M; Ward, T E

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs. (DLC)

  2. Discovery of the astatine, radon, francium, and radium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-09-15

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  3. Discovery of the astatine, radon, francium, and radium isotopes

    CERN Document Server

    Fry, C

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Discovery of the astatine, radon, francium, and radium isotopes

    Science.gov (United States)

    Fry, C.; Thoennessen, M.

    2013-09-01

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  5. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Energy Technology Data Exchange (ETDEWEB)

    Uusitalo, J.; Jakobsson, U. [Department of Physics, University of Jyvaeskylae (Finland); Collaboration: RITU-Gamma Gollaboration

    2011-11-30

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  6. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Science.gov (United States)

    Uusitalo, J.; Jakobsson, U.

    2011-11-01

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  7. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  8. Measurement of the first ionization potential of astatine by laser ionization spectroscopy.

    Science.gov (United States)

    Rothe, S; Andreyev, A N; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yuri; Köster, U; Lane, J F W; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt, K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine.

  9. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Jakobsson, U., E-mail: ulrjak@kth.se; Cederwall, B. [KTH, The Division of Nuclear Physics, AlbaNova University Center, SE-10691 Stockholm (Sweden); Uusitalo, J.; Auranen, K.; Badran, H.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; Herzáň, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J. [University of Jyvaskyla, Department of Physics, P.O. Box 35, FI-40014 University of Jyvaskyla (Finland); and others

    2015-10-15

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2{sup +} state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2{sup +} state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2{sup +} state and the spherical 9/2{sup −} ground state in {sup 203}Fr and {sup 205}Fr.

  10. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Science.gov (United States)

    Jakobsson, U.; Uusitalo, J.; Auranen, K.; Badran, H.; Cederwall, B.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; HerzáÅ, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J.; Scholey, C.; Sorri, J.; Stolze, S.

    2015-10-01

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2+ state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2+ state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2+ state and the spherical 9/2- ground state in 203Fr and 205Fr.

  11. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...

  12. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    NARCIS (Netherlands)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Koester, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjoedin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical

  13. 48 CFR 212.212 - Computer software.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Computer software. 212.212... Acquisition of Commercial Items 212.212 Computer software. (1) Departments and agencies shall identify and... technology development), opportunities for the use of commercial computer software and other non...

  14. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  15. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even sing...... of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies....

  16. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  17. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  18. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  19. 49 CFR 571.212 - Standard No. 212; Windshield mounting.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 6 2010-10-01 2010-10-01 false Standard No. 212; Windshield mounting. 571.212 Section 571.212 Transportation Other Regulations Relating to Transportation (Continued) NATIONAL HIGHWAY TRAFFIC SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION FEDERAL MOTOR VEHICLE SAFETY STANDARDS Federal Motor Vehicle Safety Standards § 571.212...

  20. Adsorption of the astatine species on a gold surface: A relativistic density functional theory study

    Science.gov (United States)

    Demidov, Yuriy; Zaitsevskii, Andréi

    2018-01-01

    We report first-principle based studies of the adsorption interaction of astatine species on a gold surface. These studies are aimed primarily at the support and interpretation of gas chromatographic experiments with superheavy elements, tennessine (Ts, Z = 117), a heavier homologue of At, and possibly its pseudo-homologue nihonium (Nh, Z = 113). We use gold clusters with up to 69 atoms to simulate the adsorption sites and estimate the desorption energies of At & AtOH from a stable gold (1 1 1) surface. To describe the electronic structure of At -Aun and AtOH -Aun complexes, we combine accurate shape-consistent relativistic pseudopotentials and non-collinear two-component relativistic density functional theory. The predicted desorption energies of At and AtOH on gold are 130 ± 10 kJ/mol and 90 ± 10 kJ/mol, respectively. These results confirm the validity of the estimates derived from chromatographic data (147 ± 15 kJ/mol for At, and 100-10+20 kJ/mol for AtOH).

  1. Comment: 212 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available Oryzias javanicus Oryzias javanicus Oryzias_javanicus_L.png 212.png Kiyoshi Naruse ...(National Institute for Basic Biology) licensed under CC Attribution2.1 Japan ジャワメダカ (Oryzias javanicus) インド

  2. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  3. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  4. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  5. 8 CFR 212.10 - Section 212(k) waiver.

    Science.gov (United States)

    2010-01-01

    ...) waiver. Any applicant for admission who is in possession of an immigrant visa, and who is excludable under sections 212(a)(14), (20), or (21) of the Act, may apply to the district director at the port of...

  6. 49 CFR 212.105 - Agreements.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Agreements. 212.105 Section 212.105 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STATE SAFETY PARTICIPATION REGULATIONS State/Federal Roles § 212.105 Agreements. (a) Scope. The...

  7. 49 CFR 212.113 - Program termination.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Program termination. 212.113 Section 212.113 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STATE SAFETY PARTICIPATION REGULATIONS State/Federal Roles § 212.113 Program...

  8. 49 CFR 212.115 - Enforcement actions.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Enforcement actions. 212.115 Section 212.115 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STATE SAFETY PARTICIPATION REGULATIONS State/Federal Roles § 212.115 Enforcement...

  9. 12 CFR 741.212 - Share insurance.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Share insurance. 741.212 Section 741.212 Banks... INSURANCE Regulations Codified Elsewhere in NCUA's Regulations as Applying to Federal Credit Unions That Also Apply to Federally Insured State-Chartered Credit Unions § 741.212 Share insurance. (a) Member...

  10. 28 CFR 36.212 - Insurance.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Insurance. 36.212 Section 36.212 Judicial... COMMERCIAL FACILITIES General Requirements § 36.212 Insurance. (a) This part shall not be construed to... benefit plan that is not subject to State laws that regulate insurance. (b) Paragraphs (a) (1), (2), and...

  11. 42 CFR 59.212 - Grantee accountability.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Grantee accountability. 59.212 Section 59.212 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS GRANTS FOR FAMILY PLANNING SERVICES Grants for Family Planning Service Training § 59.212 Grantee accountability. (a...

  12. 25 CFR 212.7 - Environmental studies.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Environmental studies. 212.7 Section 212.7 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEASING OF ALLOTTED LANDS FOR MINERAL DEVELOPMENT General § 212.7 Environmental studies. The provisions of § 211.7 of this subchapter...

  13. 32 CFR 212.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 212.5 Section 212.5 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS...) INSTALLATIONS § 212.5 Responsibilities. (a) The Principal Deputy Under Secretary for Personnel and Readiness...

  14. 48 CFR 212.211 - Technical data.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Technical data. 212.211 Section 212.211 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT... Acquisition of Commercial Items 212.211 Technical data. The DoD policy for acquiring technical data for...

  15. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  16. 48 CFR 212.7002 - Pilot program.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Pilot program. 212.7002... OF DEFENSE ACQUISITION PLANNING ACQUISITION OF COMMERCIAL ITEMS Pilot Program for Transition to Follow-On Contracting After Use of Other Transaction Authority 212.7002 Pilot program. ...

  17. 49 CFR 212.107 - Certification.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Certification. 212.107 Section 212.107... Certification. (a) Scope. In the event the FRA and the State agency do not agree on terms for the participation... the Federal Railroad Safety Act of 1970, the State shall file an annual certification with respect to...

  18. 36 CFR 212.3 - Cooperative work.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Cooperative work. 212.3... MANAGEMENT Administration of the Forest Transportation System § 212.3 Cooperative work. (a) Cooperative... for expenditure from the appropriation “Cooperative Work, Forest Service.” If a State, county or other...

  19. 31 CFR 800.212 - Foreign entity.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Foreign entity. 800.212 Section 800.212 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF INVESTMENT SECURITY, DEPARTMENT OF THE TREASURY REGULATIONS PERTAINING TO MERGERS, ACQUISITIONS, AND...

  20. 40 CFR 86.212-94 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false 86.212-94 Section 86.212-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty Passenger...

  1. 48 CFR 871.212 - Contract clauses.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clauses. 871.212... Rehabilitation and Employment Service 871.212 Contract clauses. Contracting officers must use the following clauses, as appropriate, in solicitations and contracts for vocational rehabilitation and employment...

  2. 5 CFR 9701.212 - Bands.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Bands. 9701.212 Section 9701.212 Administrative Personnel DEPARTMENT OF HOMELAND SECURITY HUMAN RESOURCES MANAGEMENT SYSTEM (DEPARTMENT OF HOMELAND SECURITY-OFFICE OF PERSONNEL MANAGEMENT) DEPARTMENT OF HOMELAND SECURITY HUMAN RESOURCES...

  3. Dicty_cDB: VHB212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB212 (Link to dictyBase) - - - Contig-U16430-1 - (Link to Original site) VHB...212F 358 - - - - - - Show VHB212 Library VH (Link to library) Clone ID VHB212 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB2-A/VHB212Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB212 (VHB212Q) /CSM/VH/VHB2-A/VHB212Q.Seq.d/ ATATTTNATTTTTTTTT...ucing significant alignments: (bits) Value VHB212 (VHB212Q) /CSM/VH/VHB2-A/VHB212Q.Seq.d/ 432 e-120 VHG251 (

  4. Dicty_cDB: SHF212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHF212 (Link to dictyBase) - - - Contig-U16288-1 | Contig-U16338-1 SHF...212P (Link to Original site) SHF212F 164 SHF212Z 438 SHF212P 582 - - Show SHF212 Library SH (Link to library) Clone ID SHF...88-1 | Contig-U16338-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SH/SHF2-A/SHF...212Q.Seq.d/ Representative seq. ID SHF212P (Link to Original site) Representative DNA sequence >SHF212 (SHF...212Q) /CSM/SH/SHF2-A/SHF212Q.Seq.d/ AAATTCATTTGTATATATATAACTTCACACACCTCAAAACAATTTATTTGATTATTTAAA

  5. Tribological and microstructural comparison of HIPped PM212 and PM212/Au self-lubricating composites

    Science.gov (United States)

    Bogdanski, Michael S.; Sliney, Harold E.; Dellacorte, Christopher

    1992-01-01

    The feasibility of replacing the silver with the volumetric equivalent of gold in the chromium carbide-based self-lubricating composite PM212 (70 wt percent NiCo-Cr3C2, 15 percent BaF2/CaF2 eutectic) was studied. The new composite, PM212/Au has the following composition: 62 wt percent NiCo-Cr3C2, 25 percent Au, 13 percent BaF2/CaF2 eutectic. The silver was replaced with gold to minimize the potential reactivity of the composite with possible environmental contaminants such as sulfur. The composites were fabricated by hot isostatic pressing (HIPping) and machined into pin specimens. The pins were slid against nickel-based superalloy disks. Sliding velocities ranged from 0.27 to 10.0 m/s and temperatures from 25 to 900 C. Frictions coefficients ranged from 0.25 to 0.40 and wear factors for the pin and disk were typically low 10(exp -5) cu mm/N-m. HIPped PM212 measured fully dense, whereas PM212/Au had 15 percent residual porosity. Examination of the microstructures with optical and scanning electron microscopy revealed the presence of pores in PM212/Au that were not present in PM212. Though the exact reason for the residual porosity PM212/Au was not determined, it may be due to practice morphology differences between the gold and silver and their effect on powder metallurgy processing.

  6. 49 CFR 212.101 - Program principles.

    Science.gov (United States)

    2010-10-01

    ... Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STATE SAFETY PARTICIPATION REGULATIONS State/Federal Roles § 212.101 Program... principal role of the State Safety Participation Program in the national railroad safety effort is to...

  7. 48 CFR 12.212 - Computer software.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Computer software. 12.212... software. (a) Commercial computer software or commercial computer software documentation shall be acquired... required to— (1) Furnish technical information related to commercial computer software or commercial...

  8. 32 CFR 552.212 - Scope.

    Science.gov (United States)

    2010-07-01

    ... Installation of Aberdeen Proving Ground, Maryland § 552.212 Scope. (a) The provisions of this subpart apply to all elements of U.S. Army Garrison, Aberdeen Proving Ground (USAGAPG), and the supported organizations and activities on the Aberdeen and Edgewood Areas of Aberdeen Proving Ground. (b) The provisions of...

  9. 40 CFR 94.212 - Labeling.

    Science.gov (United States)

    2010-07-01

    ... model year. (4) The per-cylinder displacement of the engine. (5) Engine family and configuration... EMISSIONS FROM MARINE COMPRESSION-IGNITION ENGINES Certification Provisions § 94.212 Labeling. (a) General requirements. (1) Each new engine covered by a certificate of conformity under § 94.208 shall be labeled by the...

  10. 49 CFR 212.3 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... them. (b) Associate Administrator means the Associate Administrator for Safety, Federal Railroad Administration (FRA), or the Deputy Associate Administrator for Safety, FRA. (c) FRA means the Federal Railroad... the annual work plan required by § 212.109 of this part that provide basic surveillance of railroad...

  11. Development and Testing of a 212Pb/212Bi Peptide for Targeting Metastatic Melanoma

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, Darrell R.

    2012-10-25

    The purpose of this project is to develop a new radiolabeled peptide for imaging and treating metastatic melanoma. The immunoconjugate consists of a receptor-specific peptide that targets melanoma cells. The beta-emitter lead-212 (half-life = 10.4 hours) is linked by coordination chemistry to the peptide. After injection, the peptide targets melanoma receptors on the surfaces of melanoma cells. Lead-212 decays to the alpha-emitter bismuth-212 (half-life = 60 minutes). Alpha-particles that hit melanoma cell nuclei are likely to kill the melanoma cell. For cancer cell imaging, the lead-212 is replaced by lead-203 (half-life = 52 hours). Lead-203 emits 279 keV photons (80.1% abundance) that can be imaged and measured for biodistribution analysis, cancer imaging, and quantitative dosimetry.

  12. An automated flow system incorporating in-line acid dissolution of bismuth metal from a cyclotron irradiated target assembly for use in the isolation of astatine-211

    Energy Technology Data Exchange (ETDEWEB)

    O’Hara, Matthew J.; Krzysko, Anthony J.; Niver, Cynthia M.; Morrison, Samuel S.; Owsley, Stanley L.; Hamlin, Donald K.; Dorman, Eric F.; Scott Wilbur, D.

    2017-04-01

    Astatine-211 (211At) is a promising cyclotron-produced radionuclide being investigated for use in targeted alpha therapy of blood borne and metastatic cancers, as well as treatment of tumor remnants after surgical resections. The isolation of trace quantities of 211At, produced within several grams of a Bi metal cyclotron target, involves a complex, multi-step procedure: (1) Bi metal dissolution in strong HNO3, (2) distillation of the HNO3 to yield Bi salts containing 211At, (3) dissolution of the salts in strong HCl, (4) solvent extraction of 211At from bismuth salts with diisopropyl ether (DIPE), and (5) back-extraction of 211At from DIPE into NaOH, leading to a purified 211At product. Step (1) has been addressed first to begin the process of automating the onerous 211At isolation process. A computer-controlled Bi target dissolution system has been designed. The system performs in-line dissolution of Bi metal from the target assembly using an enclosed target dissolution block, routing the resulting solubilized 211At/Bi mixture to the subsequent process step. The primary parameters involved in Bi metal solubilization (HNO3 concentration and influent flow rate) were optimized prior to evaluation of the system performance on replicate cyclotron irradiated targets. The results indicate that the system performs reproducibly, having nearly quantitative release of 211At from irradiated targets, with cumulative 211At recoveries that follow a sigmoidal function. The predictable nature of the 211At release profile allows the user to tune the system to meet target processing requirements.

  13. Reagents for astatination of biomolecules. 2. Conjugation of anionic boron cage pendant groups to a protein provides a method for direct labeling that is stable to in vivo deastatination.

    Science.gov (United States)

    Wilbur, D Scott; Chyan, Ming-Kuan; Hamlin, Donald K; Vessella, Robert L; Wedge, Timothy J; Hawthorne, M Frederick

    2007-01-01

    Cancer-targeting biomolecules labeled with 211At must be stable to in vivo deastatination, as control of the 211At distribution is critical due to the highly toxic nature of alpha-particle emission. Unfortunately, no astatinated aryl conjugates have shown in vivo stability toward deastatination when (relatively) rapidly metabolized proteins, such as monoclonal antibody Fab' fragments, are labeled. As a means of increasing the in vivo stability of 211At-labeled proteins, we have been investigating antibody conjugates of boron cage moieties. In this investigation, protein-reactive derivatives containing a nido-carborane (2), a bis-nido-carborane derivative (Venus Flytrap Complex, 3), and four 2-nonahydro-closo-decaborate(2-) derivatives (4-7) were prepared and conjugated with an antibody Fab' fragment such that subsequent astatination and in vivo tissue distributions could be obtained. To aid in determination of stability toward in vivo deastatination, the Fab'-borane conjugates were also labeled with 125I, and that material was coinjected with the 211At-labeled Fab'. For comparison, direct labeling of the Fab' with 125I and 211At was conducted. Direct labeling with Na[125I]I and Chloramine-T gave an 89% radiochemical yield. However, direct labeling of the Fab' with Na[211At]At and Chloramine-T resulted in a yield of Studies to optimize the closo-decaborate(2-) conjugates for protein labeling are underway.

  14. 14 CFR 13.212 - Computation of time.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Computation of time. 13.212 Section 13.212... INVESTIGATIVE AND ENFORCEMENT PROCEDURES Rules of Practice in FAA Civil Penalty Actions § 13.212 Computation of..., or default, after which a designated time period begins to run, is not included in a computation of...

  15. 49 CFR 212.103 - Investigative and surveillance authority.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Investigative and surveillance authority. 212.103 Section 212.103 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STATE SAFETY PARTICIPATION REGULATIONS State/Federal Roles § 212.103...

  16. 49 CFR 212.111 - Monitoring and other inspections.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Monitoring and other inspections. 212.111 Section 212.111 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STATE SAFETY PARTICIPATION REGULATIONS State/Federal Roles § 212.111...

  17. 7 CFR 1400.212 - Growers of hybrid seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Growers of hybrid seed. 1400.212 Section 1400.212... AND SUBSEQUENT CROP, PROGRAM, OR FISCAL YEARS Payment Eligibility § 1400.212 Growers of hybrid seed. The existence of a hybrid seed contract for a person or legal entity will not be taken into account...

  18. 27 CFR 20.212 - Deposit in receiving tanks.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Deposit in receiving tanks. 20.212 Section 20.212 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Alcohol, Specially Denatured Rum, or Articles § 20.212 Deposit in receiving tanks. All recovered denatured...

  19. 10 CFR 212.78 - Tertiary incentive crude oil.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Tertiary incentive crude oil. 212.78 Section 212.78 Energy DEPARTMENT OF ENERGY OIL MANDATORY PETROLEUM PRICE REGULATIONS Producers of Crude Oil § 212.78 Tertiary incentive crude oil. Annual prepaid expenses report. By January 31 of each year after 1980, the project...

  20. 19 CFR 212.23 - Comments by other parties.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Comments by other parties. 212.23 Section 212.23... Comments by other parties. Any party to the adversary adjudication other than the applicant and the... an answer within 15 days after it is served. A commenting party may not participate further in...

  1. 49 CFR 212.109 - Joint planning of inspections.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Joint planning of inspections. 212.109 Section 212.109 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD... Joint planning of inspections. Prior to the beginning of each calendar year, each participating State...

  2. 36 CFR 212.5 - Road system management.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Road system management. 212.5... MANAGEMENT Administration of the Forest Transportation System § 212.5 Road system management. (a) Traffic rules. Rules set forth under 36 CFR part 261 and this section shall apply to all National Forest System...

  3. 22 CFR 212.13 - Incorporation by reference.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Incorporation by reference. 212.13 Section 212.13 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT PUBLIC INFORMATION Publication in the... are reasonably available to the class of persons affected thereby are deemed to be published in the...

  4. 48 CFR 212.7003 - Technical data and computer software.

    Science.gov (United States)

    2010-10-01

    ... computer software. 212.7003 Section 212.7003 Federal Acquisition Regulations System DEFENSE ACQUISITION... data and computer software. For purposes of establishing delivery requirements and license rights for technical data under 227.7102 and for computer software under 227.7202, there shall be a rebuttable...

  5. 22 CFR 212.22 - Protection of personal privacy.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Protection of personal privacy. 212.22 Section... Information for Public Inspection and Copying § 212.22 Protection of personal privacy. To the extent required to prevent a clearly unwarranted invasion of personal privacy, USAID may delete identifying details...

  6. 5 CFR 9901.212 - Pay schedules and pay bands.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Pay schedules and pay bands. 9901.212... SECURITY PERSONNEL SYSTEM (NSPS) Classification Classification Structure § 9901.212 Pay schedules and pay bands. (a) For purposes of identifying relative levels of work and corresponding pay ranges, the...

  7. 20 CFR 410.212 - Conditions of entitlement; child.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Conditions of entitlement; child. 410.212...; Filing of Claims and Evidence § 410.212 Conditions of entitlement; child. (a) An individual is entitled to benefits if such individual: (1) Is the child or stepchild (see § 410.330) of (i) a deceased miner...

  8. 8 CFR 212.1 - Documentary requirements for nonimmigrants.

    Science.gov (United States)

    2010-01-01

    .... 212.1 Section 212.1 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS..., under age 19 who is traveling with a public or private school group, religious group, social or cultural... aircraft, the alien satisfied the examining U.S. immigration officer at the Bahamas, that he or she is...

  9. 14 CFR 212.6 - Operation of gambling junket charters.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Operation of gambling junket charters. 212.6 Section 212.6 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION... Operation of gambling junket charters. A gambling junket charter operated by a certificated or foreign air...

  10. 29 CFR 780.212 - Hatchery employees working on farms.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Hatchery employees working on farms. 780.212 Section 780... Agriculture as It Relates to Specific Situations Hatchery Operations § 780.212 Hatchery employees working on farms. The work of hatchery employees in connection with the maintenance of the quality of the poultry...

  11. 8 CFR 1212.10 - Section 212(k) waiver.

    Science.gov (United States)

    2010-01-01

    ... § 1212.10 Section 212(k) waiver. Any applicant for admission who is in possession of an immigrant visa... director at the port of entry for a waiver under section 212(k) of the Act. If the application for waiver...

  12. 40 CFR 60.212 - Standard for fluorides.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 6 2010-07-01 2010-07-01 false Standard for fluorides. 60.212 Section... Industry: Superphosphoric Acid Plants § 60.212 Standard for fluorides. (a) On and after the date on which... facility any gases which contain total fluorides in excess of 5.0 g/megagram (Mg) of equivalent P2O5 feed...

  13. 14 CFR 212.9 - Prior authorization requirements.

    Science.gov (United States)

    2010-01-01

    ... PROCEEDINGS) ECONOMIC REGULATIONS CHARTER RULES FOR U.S. AND FOREIGN DIRECT AIR CARRIERS § 212.9 Prior... operating rights of U.S. air carriers, or engaged in unfair, discriminatory, or restrictive practices with...

  14. An Improved SEL Test of the ADV212 Video Codec

    Science.gov (United States)

    Wilcox, Edward P.; Campola, Michael J.; Nadendla, Seshagiri; Kadari, Madhusudhan; Gigliuto, Robert A.

    2017-01-01

    Single-event effect (SEE) test data is presented on the Analog Devices ADV212. Focus is given to the test setup used to improve data quality and validate single-event latch-up (SEL) protection circuitry.

  15. Dicty_cDB: CHR212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR212 (Link to dictyBase) - - - Contig-U10972-1 | Contig-U131... library) Clone ID CHR212 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U109...72-1 | Contig-U13146-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...SVETFACHVYGIHGIQKLLQYLSPDQVESIIASIKGKVIQLSKDNKGNYLIQS FLKQFSPEVNQFVCDATMGNIEEICTHKVGCTVVNRCIDNANPEQLEKLVDKIT...SVETFACHVYGIHGIQKLLQYLSPDQVESIIASIKGKVIQLSKDNKGNYLIQS FLKQFSPEVNQFVCDATMGNIEEICTHKVGCTVVNRCIDNANPEQLEKLVDKIT

  16. Properties of Extruded PS-212 Type Self-Lubricating Materials

    Science.gov (United States)

    Waters, W. J.; Sliney, H. E.; Soltis, R. F.

    1993-01-01

    Research has been underway at the NASA Lewis Research Center since the 1960's to develop high temperature, self-lubricating materials. The bulk of the research has been done in-house by a team of researchers from the Materials Division. A series of self-lubricating solid material systems has been developed over the years. One of the most promising is the composite material system referred to as PS-212 or PM-212. This material is a powder metallurgy product composed of metal bonded chromium carbide and two solid lubricating materials known to be self-lubricating over a wide temperature range. NASA feels this material has a wide potential in industrial applications. Simplified processing of this material would enhance its commercial potential. Processing changes have the potential to reduce processing costs, but tribological and physical properties must not be adversely affected. Extrusion processing has been employed in this investigation as a consolidation process for PM-212/PS-212. It has been successful in that high density bars of EX-212 (extruded PM-212) can readily be fabricated. Friction and strength data indicate these properties have been maintained or improved over the P.M. version. A range of extrusion temperatures have been investigated and tensile, friction, wear, and microstructural data have been obtained. Results indicate extrusion temperatures are not critical from a densification standpoint, but other properties are temperature dependent.

  17. Synthesis and evaluation of tetraphosphonates labelled with {sup 212}Bi, {sup 212}Pb and {sup 165}Er

    Energy Technology Data Exchange (ETDEWEB)

    Hassfjell, S.P

    1997-08-01

    The main goal of this work has been to achieve a synthesis of radiolabelled phosphonates for the improvement of diagnostic and therapy of osteoblastic osteosarcoma and sclerotic bone metastases. {sup 212}Bi-DOTMP is shown to be an in vivo stable bone seeking radiopharmaceutical with a potential for a {alpha}-particle therapy of the above mentioned diseases. It has biodistribution characteristics similar to {sup 153}Sm-EDTMP, which is now formally approved in several countries, most recently in the US. {sup 212}Pb-DOTMP is also a promising candidate having the advantage of increasing the effective half life of the {alpha}-emitter, although loss of some of the in vivo generated {sup 212}Bi may be a problem. A generator has been developed for the production of the {alpha}-emitting radionuclide {sup 212}Bi and its parent nuclide {sup 212}Pb. The generator is based on the emanation of {sup 220}Rn from ({sup 228}Th)barium stearate. The decay product of {sup 220}Rn, {sup 212}Pb deposits on the walls of a polyethylene bottle, and can be wasted off with distilled water. The generator shows no leakage of any long-lived parent nuclides, is easy to operate and has a high degree of radiation safety.

  18. 50 CFR 660.212 - Fixed gear fishery-prohibitions.

    Science.gov (United States)

    2010-10-01

    ... Section 660.212 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND... days thereafter. (c) Fishing in conservation areas. (1) Operate a vessel registered to a limited entry..., Painted Cave, Anacapa Island, Carrington Point, Judith Rock, Skunk Point, Footprint, Gull Island, South...

  19. 36 CFR 212.2 - Forest transportation program.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Forest transportation program... TRAVEL MANAGEMENT Administration of the Forest Transportation System § 212.2 Forest transportation... public at the headquarters of that administrative unit. (b) Forest transportation atlas. A forest...

  20. 29 CFR 1910.212 - General requirements for all machines.

    Science.gov (United States)

    2010-07-01

    ... tools. (i) Forming rolls and calenders. (4) Barrels, containers, and drums. Revolving drums, barrels...) Anchoring fixed machinery. Machines designed for a fixed location shall be securely anchored to prevent... 29 Labor 5 2010-07-01 2010-07-01 false General requirements for all machines. 1910.212 Section...

  1. 36 CFR 212.21 - Pacific Crest National Scenic Trail.

    Science.gov (United States)

    2010-07-01

    ... AGRICULTURE TRAVEL MANAGEMENT Administration of the Forest Transportation System § 212.21 Pacific Crest National Scenic Trail. The Pacific Crest National Scenic Trail as defined by the National Trails Systems... necessary to meet emergencies or to enable landowners or land users to have reasonable access to their lands...

  2. 22 CFR 212.33 - Procedure for making requests.

    Science.gov (United States)

    2010-04-01

    ... the Public Reading Room identified in § 212.24(a), may be made by a member of the public in writing... records and materials available at the Public Reading Room. (b) Requests for records may be made directly...-person requests other than to the Public Reading Room, cannot be accepted. If a written request not...

  3. 31 CFR 0.212 - Influencing legislation or petitioning Congress.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Influencing legislation or... DEPARTMENT OF THE TREASURY EMPLOYEE RULES OF CONDUCT Rules of Conduct § 0.212 Influencing legislation or... Congress to favor or oppose any legislation. This prohibition does not apply to the official handling...

  4. 20 CFR 498.212 - Computation of time.

    Science.gov (United States)

    2010-04-01

    ... Employees' Benefits SOCIAL SECURITY ADMINISTRATION CIVIL MONETARY PENALTIES, ASSESSMENTS AND RECOMMENDED EXCLUSIONS § 498.212 Computation of time. (a) In computing any period of time under this part or in an order... Government, in which event it includes the next business day. (b) When the period of time allowed is less...

  5. 27 CFR 24.212 - High fermentation wine.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false High fermentation wine. 24..., DEPARTMENT OF THE TREASURY LIQUORS WINE Production of Other Than Standard Wine § 24.212 High fermentation wine. High fermentation wine is wine made with the addition of sugar within the limitations prescribed...

  6. 31 CFR 31.212 - Personal conflicts of interest.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Personal conflicts of interest. 31... RELIEF PROGRAM Conflicts of Interest § 31.212 Personal conflicts of interest. (a) Retained entity's responsibility. A retained entity shall ensure that all management officials performing work under the...

  7. 8 CFR 212.5 - Parole of aliens into the United States.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Parole of aliens into the United States. 212.5 Section 212.5 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS DOCUMENTARY REQUIREMENTS: NONIMMIGRANTS; WAIVERS; ADMISSION OF CERTAIN INADMISSIBLE ALIENS; PAROLE § 212.5...

  8. 38 CFR 21.212 - General policy in furnishing supplies during periods of rehabilitation.

    Science.gov (United States)

    2010-07-01

    ... furnishing supplies during periods of rehabilitation. 21.212 Section 21.212 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) VOCATIONAL REHABILITATION AND EDUCATION Vocational Rehabilitation and Employment Under 38 U.S.C. Chapter 31 Supplies § 21.212 General policy in furnishing supplies...

  9. 40 CFR 2.212 - Establishment of control offices for categories of business information.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Establishment of control offices for categories of business information. 2.212 Section 2.212 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL PUBLIC INFORMATION Confidentiality of Business Information § 2.212 Establishment of...

  10. 8 CFR 212.12 - Parole determinations and revocations respecting Mariel Cubans.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Parole determinations and revocations respecting Mariel Cubans. 212.12 Section 212.12 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS DOCUMENTARY REQUIREMENTS: NONIMMIGRANTS; WAIVERS; ADMISSION OF CERTAIN INADMISSIBLE ALIENS; PAROLE § 212.12 Parole...

  11. Deuterated Formaldehyde in the low mass protostar HH212

    Science.gov (United States)

    Sahu, Dipen; Minh, YC; Lee, Chin-Fei; Liu, Sheng-Yuan; Das, Ankan; Chakrabarti, SK; Sivaraman, Bhala

    2018-01-01

    HH212, a nearby (400 pc) object in Orion, is a Class 0 protostellar system with a Keplerian disk and collimated bipolar SiO jets. Deuterated water, HDO and a deuterated complex molecule, methanol (CH2DOH) have been reported in the source. Here, we report the HDCO (deuterated formaldehyde) line observation from ALMA data to probe the inner region of HH212. We compare HDCO line with other molecular lines to understand the possible chemistry and physics of the source. The distribution of HDCO emission suggests it may be associated with the base of the outflow. The emission also shows a rotation but it is not associated with the Keplerian rotation of disk or the rotating infalling envelope, rather it is associated with the outflow as previously seen in C34S. From the possible deuterium fractionation, we speculate that the gas phase formation of deuterated formaldehyde is active in the central hot region of the low-mass protostar system, HH212.

  12. Epigenetic regulation of miR-212 expression in lung cancer.

    Directory of Open Access Journals (Sweden)

    Mariarosaria Incoronato

    Full Text Available Many studies have shown that microRNA expression in cancer may be regulated by epigenetic events. Recently, we found that in lung cancer miR-212 was strongly down-regulated. However, mechanisms involved in the regulation of miR-212 expression are unknown. Therefore, we addressed this point by investigating the molecular mechanisms of miR-212 silencing in lung cancer. We identified histone modifications rather than DNA hypermethylation as epigenetic events that regulate miR-212 levels in NSCLC. Moreover, we found that miR-212 silencing in vivo is closely associated with the severity of the disease.

  13. Tribological and mechanical comparison of sintered and hipped PM212: High temperature self-lubricating composites

    Science.gov (United States)

    Dellacorte, Christopher; Sliney, Harold E.; Bogdanski, Michael S.

    1992-01-01

    Selected tribological, mechanical and thermophysical properties of two versions of PM212 (sintered and hot isostatically pressed, HIPped) are compared. PM212, a high temperature self-lubricating composite, contains 70 wt percent metal bonded chromium carbide, 15 wt percent CaF2/BaF2 eutectic and 15 wt percent silver. PM212 in the sintered form is about 80 percent dense and has previously been shown to have good tribological properties from room temperature to 850 C. Tribological results of a fully densified, HIPped version of PM212 are given. They are compared to sintered PM212. In addition, selected mechanical and thermophysical properties of both types of PM212 are discussed and related to the tribological similarities and differences between the two PM212 composites. In general, both composites display similar friction and wear properties. However, the fully dense PM212 HIPped composite exhibits slight lower friction and wear than sintered PM212. This may be attributed to its generally higher strength properties. The sintered version displays stable wear properties over a wide load range indicating its promise for use in a variety of applications. Based upon their properties, both the sintered and HIPped PM212 have potential as bearing and seal materials for advanced high temperature applications.

  14. Tribological and mechanical comparison of sintered and HIPped PM212 - High temperature self-lubricating composites

    Science.gov (United States)

    Dellacorte, Christopher; Sliney, Harold E.; Bogdanski, Michael S.

    1992-01-01

    Selected tribological, mechanical and thermophysical properties of two versions of PM212 (sintered and hot isostatically pressed, HIPped) are compared. PM212, a high temperature self-lubricating composite, contains 70 wt percent metal bonded chromium carbide, 15 wt percent CaF2/BaF2 eutectic and 15 wt percent silver. PM212 in the sintered form is about 80 percent dense and has previously been shown to have good tribological properties from room temperature to 850 C. Tribological results of a fully densified, HIPped version of PM212 are given. They are compared to sintered PM212. In addition, selected mechanical and thermophysical properties of both types of PM212 are discussed and related to the tribological similarities and differences between the two PM212 composites. In general, both composites display similar friction and wear properties. However, the fully dense PM212 HIPped composite exhibits slight lower friction and wear than sintered PM212. This may be attributed to its generally higher strength properties. The sintered version displays stable wear properties over a wide load range indicating its promise for use in a variety of applications. Based upon their properties, both the sintered and HIPped PM212 have potential as bearing and seal materials for advanced high temperature applications.

  15. 23 CFR 973.212 - Indian lands safety management system (SMS).

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Indian lands safety management system (SMS). 973.212... HIGHWAYS MANAGEMENT SYSTEMS PERTAINING TO THE BUREAU OF INDIAN AFFAIRS AND THE INDIAN RESERVATION ROADS PROGRAM Bureau of Indian Affairs Management Systems § 973.212 Indian lands safety management system (SMS...

  16. 21 CFR 212.10 - What personnel and resources must I have?

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false What personnel and resources must I have? 212.10.... 12-12-2011) Personnel and Resources § 212.10 What personnel and resources must I have? You must have... to perform their assigned functions. You must have adequate resources, including facilities and...

  17. 20 CFR 404.212 - Computing your primary insurance amount from your average indexed monthly earnings.

    Science.gov (United States)

    2010-04-01

    ... which was not covered by Social Security. (c) Computing your primary insurance amount from the benefit... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Computing your primary insurance amount from your average indexed monthly earnings. 404.212 Section 404.212 Employees' Benefits SOCIAL SECURITY...

  18. 14 CFR 212.5 - Operation of affinity (pro rata) charters.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Operation of affinity (pro rata) charters. 212.5 Section 212.5 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION... Operation of affinity (pro rata) charters. An affinity (pro rata) charter operated by a certificated or...

  19. 29 CFR 778.212 - Gifts, Christmas and special occasion bonuses.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Gifts, Christmas and special occasion bonuses. 778.212... COMPENSATION Payments That May Be Excluded From the âRegular Rateâ Bonuses § 778.212 Gifts, Christmas and... Christmas time or on other special occasions, as a reward for service, the amounts of which are not measured...

  20. 36 CFR 212.9 - Principles for sharing use of roads.

    Science.gov (United States)

    2010-07-01

    ... minor amounts, will be conditioned upon improvement or supplemental construction of the road to safety... roads. 212.9 Section 212.9 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE... of roads. The use of roads under arrangements for sharing costs or performance shall be in accordance...

  1. 18 CFR 157.212 - Synthetic and liquefied natural gas facilities.

    Science.gov (United States)

    2010-04-01

    ... natural gas facilities. 157.212 Section 157.212 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT OF ENERGY REGULATIONS UNDER NATURAL GAS ACT APPLICATIONS FOR CERTIFICATES... 7 OF THE NATURAL GAS ACT Interstate Pipeline Blanket Certificates and Authorization Under Section 7...

  2. 25 CFR 212.4 - Authority and responsibility of the Bureau of Land Management (BLM).

    Science.gov (United States)

    2010-04-01

    ... limited to, resource evaluation, approval of drilling permits, mining and reclamation, production plans... Management (BLM). 212.4 Section 212.4 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND...: Unproven Area, 43 CFR part 3260—Geothermal Resources Operations, 43 CFR part 3280—Geothermal Resources Unit...

  3. 25 CFR 212.46 - Inspection of premises, books, and accounts.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Inspection of premises, books, and accounts. 212.46 Section 212.46 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEASING OF... premises, books, and accounts. The provisions of § 211.46 of this subchapter are applicable to leases under...

  4. 40 CFR 33.212 - What conduct is prohibited by this subpart?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false What conduct is prohibited by this subpart? 33.212 Section 33.212 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GRANTS AND OTHER FEDERAL ASSISTANCE PARTICIPATION BY DISADVANTAGED BUSINESS ENTERPRISES IN UNITED STATES ENVIRONMENTAL...

  5. 37 CFR 212.5 - Recordation of distinctive identification of vessel hull designer.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Recordation of distinctive identification of vessel hull designer. 212.5 Section 212.5 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE... of distinctive identification of vessel hull designer. (a) General. Any owner of a vessel hull may...

  6. Tribology and Microstructure of PS212 with a Cr2O3 Seal Coat

    Science.gov (United States)

    Sliney, Harold E.; Benoy, Patricia A.; Korenyi-Both, Andras; Dellacorte, Christopher

    1994-01-01

    PS212 is a plasma sprayed metal bonding chrome carbide coating with solid lubricant additives which has lubricating properties at temperatures up to about 900 deg C. The coating is diamond ground to achieve an acceptable tribological surface. But, as with many plasma spray coatings, PS212 is not fully-dense. In this study, a chromium oxide base seal coating is used in an attempt to seal any porosity that is open to the surface of the PS212 coating, and to study the effect of the sealant on the tribological properties of PS212. The results indicate that the seal coating reduces friction and wear when it is applied and then diamond ground leaving a thin layer of seal coating which fills in the surface pits of the PS212 coating.

  7. The tribology of PS212 coatings and PM212 composites for the lubrication of titanium 6Al-4V components of a Stirling engine space power system

    Science.gov (United States)

    Sliney, Harold E.; Lukaszewicz, Victor; Dellacorte, Christopher

    1994-01-01

    The Stirling space power machine incorporates a linear alternator to generate electrical power. The alternator is a reciprocating device that is driven by a solar or nuclear-powered Stirling engine. The power piston and cylinder are made of titanium 6Al-4V (Ti6-4) alloy, and are designed to be lubricated by a hydrodynamically-generated gas film. Rubbing occurs during starts and stops and there is the possibility of an occasional high speed rub. Since titanium is known to have a severe galling tendency in sliding contacts, a 'back-up', self-lubricating coating on the cylinder and/or the piston is needed. This report describes the results of a research program to study the lubrication of Ti6-4 with the following chromium carbide based materials: plasma-sprayed PS212 coatings and sintered PM212 counterfaces. Program objectives are to achieve adherent coatings on Ti6-4 and to measure the friction and wear characteristics of the following sliding combinations under conditions simulative of the Stirling-driven space power linear alternator: Ti6-4/Ti6-4 baseline, Ti6-4/PS212-coated Ti6-4, and PS212-coated Ti6-4/PM212.

  8. Novel gene PUS3 c.A212G mutation in Ukrainian family with intellectual disability

    Directory of Open Access Journals (Sweden)

    Gulkovskyi R. V.

    2015-04-01

    Full Text Available Aim. To evaluate a possible role of a novel c.A212G substitution in the PUS3 gene at intellectual disability (ID. Methods. The observed group consisted of the ID Ukrainian family members (parents and two affected children and the control group – of 300 healthy individuals from general population of Ukraine. Sanger sequencing of the PUS3 gene exon 1 was performed for the family members. Polymorphic variants of c.A212G were analyzed using ARMS PCR. The homology models of wild type and p.Y71C mutant catalytic domains of human Pus3 were generated using the crystal structure of the human Pus1 catalytic domain (PDB ID: 4NZ6 as a template. Results. It was shown that the father of the affected siblings was the c.A212G substitution heterozygous carrier whereas the mother was a wild type allele homozygote, and the exom sequencing result was confirmed – the affected children are 212G homozygotes. We supposed de novo mutation in the maternal germ line. A low frequency of 212G allele (0.0017 was shown in the population of Ukraine. Homology modelling of the wild type and p.Y71C mutant catalytic domain of human Pus3 revealed that substitution p.Y71C is located in close proximity to its active site. Conclusions. The absence of hypoproteinemia in our patients, homozygous for the 212C allele allows us to assume that the mutation c.A212G PUS3 is rather neutral and cannot be the major cause of ID. However, considering a low frequency of the 212G allele in the population and close localization of p.Y71C substitution to the active site of hPus3 we cannot exclude that the c.A212G mutation in PUS3 may be a modifier for some pathologies including syndromic ID.

  9. 47 CFR 90.212 - Provisions relating to the use of scrambling devices and digital voice modulation.

    Science.gov (United States)

    2010-10-01

    ... devices and digital voice modulation. 90.212 Section 90.212 Telecommunication FEDERAL COMMUNICATIONS... Standards § 90.212 Provisions relating to the use of scrambling devices and digital voice modulation. (a... techniques or digital voice modulation requires the specific authorization of F1E or G1E emission, and these...

  10. 42 CFR 435.212 - Individuals who would be ineligible if they were not enrolled in an MCO or PCCM.

    Science.gov (United States)

    2010-10-01

    ... not enrolled in an MCO or PCCM. 435.212 Section 435.212 Public Health CENTERS FOR MEDICARE & MEDICAID... Disabled § 435.212 Individuals who would be ineligible if they were not enrolled in an MCO or PCCM. The State agency may provide that a recipient who is enrolled in an MCO or PCCM and who becomes ineligible...

  11. B7-H3-targeted 212Pb radioimmunotherapy of ovarian cancer in preclinical models.

    Science.gov (United States)

    Kasten, Benjamin B; Arend, Rebecca C; Katre, Ashwini A; Kim, Harrison; Fan, Jinda; Ferrone, Soldano; Zinn, Kurt R; Buchsbaum, Donald J

    2017-04-01

    Novel therapies that effectively kill both differentiated cancer cells and cancer initiating cells (CICs), which are implicated in causing chemotherapy-resistance and disease recurrence, are needed to reduce the morbidity and mortality of ovarian cancer. These studies used monoclonal antibody (mAb) 376.96, which recognizes a B7-H3 epitope expressed on ovarian cancer cells and CICs, as a carrier molecule for targeted α-particle radioimmunotherapy (RIT) in preclinical models of human ovarian cancer. mAb 376.96 was conjugated to the chelate 2-(4-isothiocyanotobenzyl)-1,4,7,10-tetraaza-1,4,7,10-tetra-(2-carbamoylmethyl)-cyclododecane (TCMC) and radiolabeled with 212Pb, a source of α-particles. In vitro Scatchard assays determined the specific binding of 212Pb-376.96 to adherent differentiated or non-adherent CIC-enriched ES-2 and A2780cp20 ovarian cancer cells. Adherent ovarian cancer cells and non-adherent CIC-enriched tumorspheres treated in vitro with 212Pb-376.96 or the irrelevant isotype-matched 212Pb-F3-C25 were assessed for clonogenic survival. Mice bearing i.p. ES-2 or A2780cp20 xenografts were injected i.p. with 0.17-0.70MBq 212Pb-376.96 or 212Pb-F3-C25 and were used for in vivo imaging, ex vivo biodistribution, and therapeutic survival studies. 212Pb-376.96 was obtained in high yield and purity (>98%); Kd values ranged from 10.6-26.6nM for ovarian cancer cells, with 104-105 binding sites/cell. 212Pb-376.96 inhibited the clonogenic survival of ovarian cancer cells up to 40 times more effectively than isotype-matched control 212Pb-F3-C25; combining 212Pb-376.96 with carboplatin significantly decreased clonogenic survival compared to either agent alone. In vivo imaging and biodistribution analysis 24h after i.p. injection of 212Pb-376.96 showed high peritoneal retention and tumor tissue accumulation (28.7% ID/g in ES-2 ascites, 73.1% ID/g in A2780cp20 tumors); normal tissues showed lower and comparable uptake for 212Pb-376.96 and 212Pb-F3-C25. Tumor

  12. Toxicological Studies of 212Pb Intravenously or Intraperitoneally Injected into Mice for a Phase 1 Trial

    Directory of Open Access Journals (Sweden)

    Diane E. Milenic

    2015-07-01

    Full Text Available Faced with the novelty of a 212Pb-labeled monoclonal antibody (mAb for clinical translation, concerns were expressed by the Food and Drug Administration (FDA regarding 212Pb prematurely released from the mAb-chelate conjugate. The objective of this study was to simulate the worst case scenario of such a failure. Groups of Balb/c mice (n = 9–20 were administered 212Pb by intraperitoneal (0.0925–1.85 MBq or intravenous (0.0925–1.11 MBq injection and then euthanized at 7 or 90 days to assess acute or chronic effects. Weights were recorded prior to injection of the 212Pb and at the end of the observation periods. Blood samples were collected for clinical chemistry and blood cell analysis. Thirty tissues were harvested and formalin fixed for histopathological examination. Treatment related effects of the 212Pb were observed in the bone marrow, spleen, kidneys and the liver. Histological alterations in these organs were considered mild to moderate, indicating low grade toxicity, and not considered severe enough to affect function. This data was presented to the FDA and determined to be acceptable. The clinical trial with 212Pb-TCMC-trastuzumab was approved in January 2011 and the trial opened at the University of Alabama at Birmingham (UAB in July.

  13. Aptamer-miRNA-212 Conjugate Sensitizes NSCLC Cells to TRAIL

    Directory of Open Access Journals (Sweden)

    Margherita Iaboni

    2016-01-01

    Full Text Available TNF-related apoptosis-inducing ligand (TRAIL is a promising antitumor agent for its remarkable ability to selectively induce apoptosis in cancer cells, without affecting the viability of healthy bystander cells. The TRAIL tumor suppressor pathway is deregulated in many human malignancies including lung cancer. In human non-small cell lung cancer (NSCLC cells, sensitization to TRAIL therapy can be restored by increasing the expression levels of the tumor suppressor microRNA-212 (miR-212 leading to inhibition of the anti-apoptotic protein PED/PEA-15 implicated in treatment resistance. In this study, we exploited a previously described RNA aptamer inhibitor of the tyrosine kinase receptor Axl (GL21.T expressed on lung cancer cells, as a means to deliver miR-212 into human NSCLC cells expressing Axl. We demonstrate efficient delivery of miR-212 following conjugation of the miR to GL21.T (GL21.T-miR212 chimera. We show that the chimera downregulates PED and restores TRAIL-mediate cytotoxicity in cancer cells. Importantly, treatment of Axl+ lung cancer cells with the chimera resulted in (i an increase in caspase activation and (ii a reduction of cell viability in combination with TRAIL therapy. In conclusion, we demonstrate that the GL21.T-miR212 chimera can be employed as an adjuvant to TRAIL therapy for the treatment of lung cancer.

  14. Streptomyces sp. MUM212 as a Source of Antioxidants with Radical Scavenging and Metal Chelating Properties

    Directory of Open Access Journals (Sweden)

    Loh Teng-Hern Tan

    2017-05-01

    Full Text Available Reactive oxygen species and other radicals potentially cause oxidative damage to proteins, lipids, and DNA which may ultimately lead to various complications including mutations, carcinogenesis, neurodegeneration, cardiovascular disease, aging, and inflammatory disease. Recent reports demonstrate that Streptomyces bacteria produce metabolites with potent antioxidant activity that may be developed into therapeutic drugs to combat oxidative stress. This study shows that Streptomyces sp. MUM212 which was isolated from mangrove soil in Kuala Selangor, Malaysia, could be a potential source of antioxidants. Strain MUM212 was characterized and determined as belonging to the genus Streptomyces using 16S rRNA gene phylogenetic analysis. The MUM212 extract demonstrated significant antioxidant activity through DPPH, ABTS and superoxide radical scavenging assays and also metal-chelating activity of 22.03 ± 3.01%, 61.52 ± 3.13%, 37.47 ± 1.79%, and 41.98 ± 0.73% at 4 mg/mL, respectively. Moreover, MUM212 extract was demonstrated to inhibit lipid peroxidation up to 16.72 ± 2.64% at 4 mg/mL and restore survival of Vero cells from H2O2-induced oxidative damages. The antioxidant activities from the MUM212 extract correlated well with its total phenolic contents; and this in turn was in keeping with the gas chromatography–mass spectrometry analysis which revealed the presence of phenolic compounds that could be responsible for the antioxidant properties of the extract. Other chemical constituents detected included hydrocarbons, alcohols and cyclic dipeptides which may have contributed to the overall antioxidant capacity of MUM212 extract. As a whole, strain MUM212 seems to have potential as a promising source of novel molecules for future development of antioxidative therapeutic agents against oxidative stress-related diseases.

  15. Memory formation and retention are affected in adult miR-132/212 knockout mice.

    Science.gov (United States)

    Hernandez-Rapp, Julia; Smith, Pascal Y; Filali, Mohammed; Goupil, Claudia; Planel, Emmanuel; Magill, Stephen T; Goodman, Richard H; Hébert, Sébastien S

    2015-01-01

    The miR-132/212 family is thought to play an important role in neural function and plasticity, while its misregulation has been observed in various neurodegenerative disorders. In this study, we analyzed 6-month-old miR-132/212 knockout mice in a battery of cognitive and non-cognitive behavioral tests. No significant changes were observed in reflexes and basic sensorimotor functions as determined by the SHIRPA primary screen. Accordingly, miR-132/212 knockout mice did not differ from wild-type controls in general locomotor activity in an open-field test. Furthermore, no significant changes of anxiety were measured in an elevated plus maze task. However, the mutant mice showed retention phase defects in a novel object recognition test and in the T-water maze. Moreover, the learning and probe phases in the Barnes maze were clearly altered in knockout mice when compared to controls. Finally, changes in BDNF, CREB, and MeCP2 were identified in the miR-132/212-deficient mice, providing a potential mechanism for promoting memory loss. Taken together, these results further strengthen the role of miR-132/212 in memory formation and retention, and shed light on the potential consequences of its deregulation in neurodegenerative diseases. Copyright © 2015 Elsevier B.V. All rights reserved.

  16. Lifetime measurements of 214Po and 212Po with the CTF liquid scintillator detector at LNGS

    Energy Technology Data Exchange (ETDEWEB)

    Bellini, G.; Benziger, J.; Bick, D.; Bonfini, G.; Bravo, D.; Buizza Avanzini, M.; Caccianiga, B.; Cadonati, L.; Calaprice, F.; Carraro, C.; Cavalcante, P.; Chavarria, A.; Chepurnov, A.; Chubakov, V.; D’Angelo, D.; Davini, S.; Derbin, A.; Etenko, A.; Fomenko, K.; Franco, D.; Galbiati, C.; Gazzana, S.; Ghiano, C.; Giammarchi, M.; Göger-Neff, M.; Goretti, A.; Grandi, L.; Guardincerri, E.; Hardy, S.; Ianni, Aldo; Ianni, Andrea; Kobychev, V.; Korablev, D.; Korga, G.; Koshio, Y.; Kryn, D.; Laubenstein, M.; Lewke, T.; Lissia, Marcello; Litvinovich, E.; Loer, B.; Lombardi, F.; Lombardi, P.; Ludhova, L.; Machulin, I.; Manecki, S.; Maneschg, W.; Manuzio, G.; Meindl, Q.; Meroni, E.; Miramonti, L.; Misiaszek, M.; Montanari, D.; Mosteiro, P.; Mantovani, F.; Muratova, V.; Nisi, S.; Oberauer, L.; Obolensky, M.; Ortica, F.; Otis, K.; Pallavicini, M.; Papp, L.; Perasso, L.; Perasso, S.; Pocar, A.; Ranucci, G.; Razeto, A.; Re, A.; Romani, A.; Rossi, N.; Sabelnikov, A.; Saldanha, R.; Salvo, C.; Schönert, S.; Simgen, H.; Skorokhvatov, M.; Smirnov, O.; Sotnikov, A.; Sukhotin, S.; Suvorov, Y.; Tartaglia, R.; Testera, G.; Vogelaar, R. B.; von Feilitzsch, F.; Winter, J.; Wojcik, M.; Wright, A.; Wurm, M.; Xhixha, G.; Xu, J.; Zaimidoroga, O.; Zavatarelli, S.; Zuzel, G.

    2013-07-01

    We have studied the alpha decays of 214Po into 210Pb and of 212Po into 208Pb tagged by the coincidence with the preceding beta decays from 214Bi and 212Bi, respectively. The employed 222Rn, 232Th, and 220Rn sources were sealed inside quartz vials and inserted in the Counting Test Facility at the underground Gran Sasso National Laboratory in Italy. We find that the mean lifetime of 214Po is (236.00 +- 0.42(stat) +- 0.15(syst)) \\mu s and that of 212Po is (425.1 +- 0.9(stat) +- 1.2(syst)) ns. Our results, obtained from data with signal-to-background ratio larger than 1000, reduce the overall uncertainties and are compatible with previous measurements.

  17. The effect of processing and compositional changes on the tribology of PM212 in air

    Energy Technology Data Exchange (ETDEWEB)

    Bogdanski, M.S. [Case Western Reserve Univ., Cleveland, OH (United States); Sliney, H.E.; DellaCorte, C. [National Aeronautics and Space Administration, Cleveland, OH (United States). Lewis Research Center

    1993-04-01

    The effects of processing and compositional variations on the tribological performance of PM212 were investigated. PM212 is a self-lubricating powder metallurgy composite, comprised of a wear-resistant metal bonded chromium carbide matrix, containing the solid lubricants barium fluoride/calcium fluoride eutectic and silver. Several composites were formulated which had lubricant, matrix, and processing variations. Processing variations included sintering and hot isostatic pressing. Pins fabricated from the composites were slid against superalloy disks in a pinon-disk tribometer to study the tribological properties. Several composites exhibited low friction and wear in sliding against a nickel-based superalloy. The good tribological performance by several different composites showed that the composition of PM212 can be altered without dramatically affecting performance.

  18. The effect of processing and compositional changes on the tribology of PM212 in air

    Energy Technology Data Exchange (ETDEWEB)

    Bogdanski, M.S. (Case Western Reserve Univ., Cleveland, OH (United States)); Sliney, H.E.; DellaCorte, C. (National Aeronautics and Space Administration, Cleveland, OH (United States). Lewis Research Center)

    1993-01-01

    The effects of processing and compositional variations on the tribological performance of PM212 were investigated. PM212 is a self-lubricating powder metallurgy composite, comprised of a wear-resistant metal bonded chromium carbide matrix, containing the solid lubricants barium fluoride/calcium fluoride eutectic and silver. Several composites were formulated which had lubricant, matrix, and processing variations. Processing variations included sintering and hot isostatic pressing. Pins fabricated from the composites were slid against superalloy disks in a pinon-disk tribometer to study the tribological properties. Several composites exhibited low friction and wear in sliding against a nickel-based superalloy. The good tribological performance by several different composites showed that the composition of PM212 can be altered without dramatically affecting performance.

  19. Free radical detection by means of {sup 2}12Pb mirrors; Deteccion de radicales libres mediante espejos de Pb{sup 2}12

    Energy Technology Data Exchange (ETDEWEB)

    Molera, M.J.; Gamboa, J. M.; Garcia Guijarro, E.

    1961-07-01

    Radicals have been detected at low temperatures (550-700 degree centigrade) in the thermal decomposition of dimethyl and methyl-ethyl-ketone by the Paneth method. the sensitivity of the method has been increased by the use of radioactive mirrors of PB{sup 2}12. They have proved to detect one radical among 2.10{sup 6} molecules. (Author) 18 refs.

  20. In vitro studies using the alpha-emitter {sup 212}Bi: development of therapy for microscopic carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Rotmensch, J.; Whitlock, J.L.; Hines, J.J. [Chicago Univ., IL (United States). Dept. of Obstetrics and Gynecology; Schwartz, J.L. [Washington Univ., WA (United States). Dept. of Radiation Oncology

    1997-12-31

    We have been investigating the use of the alpha-emitting radionuclide {sup 212}Bi against microscopic carcinoma. Our in vitro studies show that {sup 212}Bi is 2 to 4 times more effective in eradicating microscopic cells grown in monolayer or multicellular spheroid. Autoradiographs show that {sup 212}Bi diffuses within the spheroids by 2 hours after exposure. There was no difference in cell kill if cells were grown in monolayer or 100 {mu}m and 800 {mu}m spheroids. From our study, {sup 212}Bi appears to be a suitable candidate to investigate for clinical use against microscopic carcinoma. (orig.)

  1. 22 CFR 212.25 - Procedures for obtaining materials under this subpart.

    Science.gov (United States)

    2010-04-01

    ...) The direct costs of any necessary duplication will be charged in accordance with the fee schedule set... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Procedures for obtaining materials under this... Availability of Information for Public Inspection and Copying § 212.25 Procedures for obtaining materials under...

  2. 43 CFR 2.12 - When can I expect the response?

    Science.gov (United States)

    2010-10-01

    ... Section 2.12 Public Lands: Interior Office of the Secretary of the Interior RECORDS AND TESTIMONY; FREEDOM...) Basic time limit. Ordinarily, a bureau has 20 workdays from the date of receipt to determine whether to... nonresponse within these time limits as a denial of records and file a formal appeal (see § 2.28(a)(3)) or...

  3. Page 1 212 A K Panda, S Misra and S C Misra Module of geometry ...

    Indian Academy of Sciences (India)

    212 A K Panda, S Misra and S C Misra. Module of geometry and material properties. Geometric and faterial properties are reac/generated and di Spa Cement boundary Conditions are taken Care Of. 00p. Over elements. Module of StiffneSS matrix. The element Stiffness matrix is formed by USing Uſer iCal integration.

  4. 36 CFR 212.81 - Use by over-snow vehicles.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Use by over-snow vehicles... TRAVEL MANAGEMENT Use by Over-Snow Vehicles § 212.81 Use by over-snow vehicles. (a) General. Use by over-snow vehicles on National Forest System roads and National Forest System trails and in areas on...

  5. 28 CFR 2.212 - Execution of warrant and service of summons.

    Science.gov (United States)

    2010-07-01

    ... Supervised Releasees § 2.212 Execution of warrant and service of summons. (a) Any officer of any Federal or District of Columbia correctional institution, any Federal Officer authorized to serve criminal process, or any officer or designated civilian employee of the Metropolitan Police Department of the District of...

  6. Tribological properties of PM212: A high-temperature, self-lubricating, powder metallurgy composite

    Science.gov (United States)

    Dellacorte, Christopher; Sliney, Harold E.

    1989-01-01

    This paper describes a research program to develop and evaluate a new high temperature, self-lubricating powder metallurgy composite, PM212. PM212 has the same composition as the plasma-sprayed coating, PS212, which contains 70 wt percent metal-bonded chromium carbide, 15 wt percent silver and 15 wt percent barium fluoride/calcium fluoride eutectic. The carbide acts as a wear resistant matrix and the silver and fluorides act as low and high temperature lubricants, respectively. The material is prepared by sequential cold press, cold isostatic pressing and sintering techniques. In this study, hemispherically tipped wear pins of PM212 were prepared and slid against superalloy disks at temperatures from 25 to 850 C in air in a pin-on-disk tribometer. Friction coefficients range from 0.29 to 0.38 and the wear of both the composite pins and superalloy disks was moderate to low in the 10(exp -5) to 10(exp -6) cubic mm/N-m range. Preliminary tests indicate that the material has a compressive strength of at least 130 MPa over the entire temperature range of 25 to 900 C. This material has promise for use as seal inserts, bushings, small inside diameter parts and other applications where plasma-sprayed coatings are impractical or too costly.

  7. Tribological properties of PM212 - A high temperature, self-lubricating, powder metallurgy composite

    Science.gov (United States)

    Dellacorte, Christopher; Sliney, Harold E.

    1990-01-01

    This paper describes a research program to develop and evaluate a new high temperature, self-lubricating powder metallurgy composite, PM212. PM212 has the same composition as the plasma-sprayed coating, PS212, which contains 70 wt percent metal-bonded chromium carbide, 15 wt percent silver and 15 wt percent barium fluoride/calcium fluoride eutectic. The carbide acts as a wear resistant matrix and the silver and fluorides act as low and high temperature lubricants, respectively. The material is prepared by sequential cold press, cold isostatic pressing and sintering techniques. In this study, hemispherically tipped wear pins of PM212 were prepared and slid against superalloy disks at temperatures from 25 to 850 C in air in a pin-on-disk tribometer. Friction coefficients range from 0.29 to 0.38 and the wear of both the composite pins and superalloy disks was moderate to low in the 10(exp -5) to 10(exp -6) cubic mm/N-m range. Preliminary tests indicate that the material has a compressive strength of at least 130 MPa over the entire temperature range of 25 to 900 C. This material has promise for use as seal inserts, bushings, small inside diameter parts and other applications where plasma-sprayed coatings are impractical or too costly.

  8. Angiotensin II Regulates microRNA-132/-212 in Hypertensive Rats and Humans

    DEFF Research Database (Denmark)

    Eskildsen, Tilde V; Jeppesen, Pia L; Schneider, Mikael

    2013-01-01

    analyzed tissue samples of mammary artery obtained from surplus arterial tissue after coronary bypass operations. Indeed, we found a decrease in expression levels of miR-132 and miR-212 in human arteries from bypass-operated patients treated with AT1R blockers, whereas treatment with β-blockers had...

  9. 21 CFR 212.2 - What is current good manufacturing practice for PET drugs?

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false What is current good manufacturing practice for... HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR POSITRON EMISSION TOMOGRAPHY DRUGS (Eff. 12-12-2011) General Provisions § 212.2 What is current good manufacturing practice for...

  10. 27 CFR 25.212 - Beer returned to brewery from which removed.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Beer returned to brewery... TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS BEER Beer Returned to Brewery § 25.212 Beer returned to brewery from which removed. If beer on which the tax has been determined or paid is returned to...

  11. 42 CFR 3.212 - Nonidentification of patient safety work product.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Nonidentification of patient safety work product. 3... PROVISIONS PATIENT SAFETY ORGANIZATIONS AND PATIENT SAFETY WORK PRODUCT Confidentiality and Privilege Protections of Patient Safety Work Product § 3.212 Nonidentification of patient safety work product. (a...

  12. 41 CFR 301-71.212 - Should we report late payment fees as wages on a Form W-2?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 4 2010-07-01 2010-07-01 false Should we report late payment fees as wages on a Form W-2? 301-71.212 Section 301-71.212 Public Contracts and Property... late payment fees as wages on a Form W-2? No, the Internal Revenue Service (IRS) has determined that...

  13. 21 CFR 212.61 - What must I do to ensure the stability of my PET drug products through expiry?

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false What must I do to ensure the stability of my PET drug products through expiry? 212.61 Section 212.61 Food and Drugs FOOD AND DRUG ADMINISTRATION... the stability of my PET drug products through expiry? (a) Stability testing program. You must...

  14. 25 CFR 212.42 - Annual rentals and expenditures for development on leases other than oil and gas, and geothermal...

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Annual rentals and expenditures for development on leases other than oil and gas, and geothermal resources. 212.42 Section 212.42 Indians BUREAU OF INDIAN AFFAIRS... other than oil and gas, and geothermal resources. The provisions of § 211.42 of this subchapter are...

  15. 32 CFR Appendix A to Part 212 - Non-Federal Entities Having Statutory Authorization for Particular Support

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Non-Federal Entities Having Statutory Authorization for Particular Support A Appendix A to Part 212 National Defense Department of Defense (Continued... ENTITIES AUTHORIZED TO OPERATE ON DEPARTMENT OF DEFENSE (DOD) INSTALLATIONS Pt. 212, App. A Appendix A to...

  16. 8 CFR 212.14 - Parole determinations for alien witnesses and informants for whom a law enforcement authority...

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Parole determinations for alien witnesses and informants for whom a law enforcement authority (âLEAâ) will request S classification. 212.14 Section 212.14 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS DOCUMENTARY REQUIREMENTS: NONIMMIGRANTS; WAIVERS; ADMISSIO...

  17. 22 CFR 212.41 - Exemptions from publication and disclosure requirements of subparts B, C, and D.

    Science.gov (United States)

    2010-04-01

    ... State, local or foreign agency or authority or any private institution which furnished information on a... requirements of subparts B, C, and D. 212.41 Section 212.41 Foreign Relations AGENCY FOR INTERNATIONAL... national defense or foreign policy and are in fact properly classified pursuant to such Executive Order; (b...

  18. Preparation of (212)Pb-labeled monoclonal antibody using a novel (224)Ra-based generator solution.

    Science.gov (United States)

    Westrøm, Sara; Generalov, Roman; Bønsdorff, Tina B; Larsen, Roy H

    2017-08-01

    Alpha-emitting radionuclides have gained considerable attention as payloads for cancer targeting molecules due to their high cytotoxicity. One attractive radionuclide for this purpose is (212)Pb, which by itself is a β-emitter, but acts as an in vivo generator for its short-lived α-emitting daughters. The standard method of preparing (212)Pb-labeled antibodies requires handling and evaporation of strong acids containing high radioactivity levels by the end user. An operationally easier and more rapid process could be useful since the 10.6h half-life of (212)Pb puts time constraints on the preparation protocol. In this study, an in situ procedure for antibody labeling with (212)Pb, using a solution of the generator nuclide (224)Ra, is proposed as an alternative protocol for preparing (212)Pb-radioimmunoconjugates. Radium-224, the generator radionuclide of (212)Pb, was extracted from its parent nuclide, (228)Th. Lead-212-labeling of the TCMC-chelator conjugated monoclonal antibody trastuzumab was carried out in a solution containing (224)Ra in equilibrium with progeny. Subsequently, the efficiency of separating the (212)Pb-radioimmunoconjugate from (224)Ra and other unconjugated daughter nuclides in the solution using either centrifugal separation or a PD-10 desalting size exclusion column was evaluated and compared. Radiolabeling with (212)Pb in (224)Ra-solutions was more than 90% efficient after only 30min reaction time at TCMC-trastuzumab concentrations from 0.15mg/mL and higher. Separation of (212)Pb-labeled trastuzumab from (224)Ra using a PD-10 column was clearly superior to centrifugal separation. This method allowed recovery of approximately 75% of the (212)Pb-antibody-conjugate in the eluate, and the remaining amount of (224)Ra was only 0.9±0.8% (n=7). The current work demonstrates a novel method of producing (212)Pb-based radioimmunoconjugates from a (224)Ra-solution, which may be simpler and less time-consuming for the end user compared with the method

  19. Synergy of circulating miR-212 with markers for cardiovascular risks to enhance estimation of atherosclerosis presence

    Science.gov (United States)

    Lee, Seo Hyun; Hwang, Junha; Shin, Jong Wook; Song, Kyu Sang; Lee, Sukhoon

    2017-01-01

    Synergy of specific microRNAs (miRNAs) with cardiovascular risk factors to estimate atherosclerosis presence in ischemic stroke patients has not been investigated. The present study aimed to identify atherosclerosis-related circulating miRNAs and to evaluate interaction with other cardiovascular markers to improve the estimation of atherosclerosis presence. We performed a miRNA profiling study using serum of 15 patients with acute ischemic stroke who were classified by the presence of no (n = 8) or severe (n = 7) stenosis on intracranial and extracranial vessels, which identified miR-212, -372, -454, and -744 as miRNAs related with atherosclerosis presence. Of the 4 miRNAs, only miR-212 showed a significant increase in expression in atherosclerosis patients in a validation study (atherosclerotic patients, n = 32, non-atherosclerotic patients, n = 33). Hemoglobin A1c, a high-density lipoprotein cholesterol, and lipoprotein(a), both established risk markers, were independently related with atherosclerosis presence in the validation population. miR-212 enhanced the accuracy of atherosclerosis presence by the three existing markers (three markers, 78.5%; three markers+miR-212, 84.6%, P<0.05) and significantly added to the area under the receiver operating characteristic curve (three markers, 0.8258; three markers+miR-212, 0.8646, P<0.05). The inclusion of miR-212 increased the reclassification index calculated using net reclassification improvement (0.4527, P<0.05) and integrated discrimination improvement (0.0737, P<0.05). We identified circulating miR-212 as a novel marker of atherosclerosis. miR-212 enhanced the estimation of atherosclerosis presence in combination with hemoglobin A1c, high-density lipoprotein cholesterol, and lipoprotein(a). Thus, miR-212 is expected to improve the estimation of atherosclerosis using peripheral blood of patients. PMID:28557988

  20. {sup 212}Pb as tracer for PM deposition on urban vegetation

    Energy Technology Data Exchange (ETDEWEB)

    Voltaggio, Mario; Spadoni, Massimo; Carloni, Serena; Guglietta, Daniela

    2016-11-01

    {sup 212}Pb concentration in outdoor air is closely correlated with fine suspended particulate matter in the atmosphere. Thanks to this association, this isotope can be used to trace the sinking processes of particulate matter due to the vegetation, also providing accurate estimations of the deposition velocity on foliar surfaces. This approach is particularly effective in areas with high thoron fluxes and, consequently, high {sup 212}Pb fluxes from soil. The contribution of vegetation to the improvement of air quality (AQImp) in the municipality area (MA) of Rome (Latium, Italy), almost entirely located on Th-enriched volcanic soils, was estimated by studying {sup 212}Pb deposition velocity on the grasses (0.9–2.5 mm·s{sup −} {sup 1}) and on the most common tree classes, namely conifers (1.5–15 mm·s{sup −} {sup 1}), evergreen (1–4 mm·s{sup −} {sup 1}) and deciduous (0.2–1.5 mm·s{sup −} {sup 1}). {sup 212}Pb activity in outdoor air was determined by gamma spectrometry after air pumping with accumulation on cellulose filters and after collection on artificial electrostatically charged surfaces (ECS). The high {sup 212}Pb activity values obtained from this analysis (0.90 ± 0.6 Bq m{sup −} {sup 3} and 0.58 ± 0.15 Bq m{sup −} {sup 3}, respectively near and far from the soil) are consistent both with the average regional thoron flux from volcanic soils (2.9 · 10{sup 4} Bq m{sup −} {sup 2}·h{sup −} {sup 1}) and with the thoron flux measured in the volcanic soils of the study area. Thoron and {sup 212}Pb fluxes were also measured both in laboratory and in the field under different soil moisture conditions. The total AQImp for the period from September 2014 to September 2015, calculated after the classification of the MA of Rome into six classes of vegetation, provided a value of 0.20 corresponding to 2.3 Tons per day of removed PM{sub 10}. The role of grasslands in the PM{sub 10} removal, the contribution of the vegetation to the

  1. Synthesis and spasmolytic activities of 2-(1,2-benzisoxazol-3-yl)-3-[[omega-(dialkylamino)alkoxy]phenyl]acrylonitriles.

    Science.gov (United States)

    Naruto, S; Mizuta, H; Sawayama, T; Yoshida, T; Uno, H; Kawashima, K; Sohji, Y; Kadokawa, T; Nishimura, H

    1982-10-01

    Several 2-(1,2-benzisoxazol-3-yl)-3-[[omega-(dialkylamino)alkoxy]phenyl]acrylonitrile derivatives were synthesized and screened for potential spasmolytic activity. The effect of structural variation of these molecules on biological activities was systematically examined. Among these compounds, (Z)-2-(1,2-benzisoxazol-3-yl)-3-[2-(2-piperidinoethoxy)-phenyl]acrylonitrile (1d), (Z)-2-(1,2-benzisoxazol-3-yl)-3-[2-(2-morpholinoethoxy)phenyl]acrylonitrile (1f), and their analogues (3c,d) having a methoxy substituent at C5 of the benzoisoxazole ring showed potent antispasmodic activities in the in vitro and in vivo studies.

  2. Pharmacologically induced hypothermia with cannabinoid receptor agonist WIN55, 212-2 after cardiopulmonary resuscitation.

    Science.gov (United States)

    Sun, Shijie; Tang, Wanchun; Song, Fengqing; Chung, Sung Phil; Weng, Yinlun; Yu, Tao; Weil, Max Harry

    2010-12-01

    To investigate whether hypothermia could be induced pharmacologically after resuscitation with the cannabinoid CB1/CB2 receptor agonist in a rat model and its effects on outcomes of cardiopulmonary resuscitation. Prospective, randomized, placebo-controlled experimental study. University-affiliated animal research laboratory. Ten healthy male Sprague-Dawley rats. Ventricular fibrillation was induced and untreated for 6 mins. Defibrillation was attempted after 8 mins of cardiopulmonary resuscitation. Thirty minutes after resuscitation, animals were randomized to receive either WIN55, 212-2 (1.0 mg/kg/hr) or vehicle placebo (1.4 mL/kg/hr) for 6 hrs. Before infusion, the temperature was maintained at 37°C in all the animals with the help of a heating lamp. The same temperature environment was maintained for both groups after infusion. Hemodynamic measurements and cardiac output, ejection fraction, and myocardial performance index were measured at baseline and hourly for 6 hrs after resuscitation. Survival time up to 72 hrs was observed. Blood temperature decreased progressively after infusion of WIN55, 212-2 from 37°C to 34°C 4 hrs after resuscitation. There was no significant change in blood temperature after 6 hrs of placebo infusion of the same volume and same infusate temperature. Significantly better postresuscitation myocardial function and longer durations of survival were observed in WIN55, 212-2-treated animals. The selective cannabinoid agonist, WIN55, 212-2, produced a significant reduction in blood temperature and improved postresuscitation myocardial functions and survival after cardiopulmonary resuscitation. The study results may provide a further option for early and effective induction of therapeutic hypothermia in settings of cardiopulmonary resuscitation.

  3. A Prototype {sup 212}Pb Medical Dose Calibrator for Alpha Radioimmunotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Mueller, W.F.; Patil, A.; Russ, W.R.; Newman, J. [CANBERRA Industries, Inc. (United States); Torgue, J. [AREVA Med (United States)

    2015-07-01

    AREVA Med, an AREVA group subsidiary, is developing innovative cancer-fighting therapies involving the use of {sup 212}Pb for alpha radioimmunotherapy. Canberra Industries, the nuclear measurement subsidiary of AREVA, has been working with AREVA Med to develop a prototype measurement system to assay syringes containing a {sup 212}Pb solution following production by an elution system. The relative fraction of emitted radiation from the source associated directly with the {sup 212}Pb remains dynamic for approximately 6 hours after the parent is chemically purified. A significant challenge for this measurement application is that the short half-life of the parent nuclide requires assay prior to reaching equilibrium with progeny nuclides. A gross counting detector was developed to minimize system costs and meet the large dynamic range of source activities. Prior to equilibrium, a gross counting system must include the period since the {sup 212}Pb was pure to calculate the count rate attributable to the parent rather than the progeny. The dynamic state is determined by solving the set of differential equations, or Bateman equations, describing the source decay behavior while also applying the component measurement efficiencies for each nuclide. The efficiencies were initially estimated using mathematical modeling (MCNP) but were then benchmarked with source measurements. The goal accuracy of the system was required to be within 5%. Independent measurements of the source using a high resolution spectroscopic detector have shown good agreement with the prototype system results. The prototype design was driven by cost, compactness and simplicity. The detector development costs were minimized by using existing electronics and firmware with a Geiger-Mueller tube derived from Canberra's EcoGamma environmental monitoring product. The acquisition electronics, communications and interface were controlled using Python with the EcoGamma software development kit on a Raspberry

  4. The microRNA-132/212 family fine-tunes multiple targets in Angiotensin II signalling in cardiac fibroblasts

    DEFF Research Database (Denmark)

    Eskildsen, Tilde V; Schneider, Mikael; Sandberg, Maria B

    2015-01-01

    function including regulation of cardiac hypertrophy, heart failure and blood pressure possibly through AT1R signalling. However, the miR-132/212 targets in the heart remain unknown. MATERIALS AND METHODS: To understand the role of these miRNAs in cardiac signalling networks, we undertook comprehensive......INTRODUCTION: MicroRNAs (miRNAs) are emerging as key regulators of cardiovascular development and disease; however, the cardiac miRNA target molecules are not well understood. We and others have described the Angiotensin II (AngII)-induced miR-132/212 family as novel regulators of cardiovascular...... in silico and in vitro experiments to identify miR-132/212 molecular targets in primary rat cardiac fibroblasts. RESULTS: MiR-132/212 overexpression increased fibroblast cell size and mRNA arrays detected several hundred genes that were differentially expressed, including a wide panel of receptors...

  5. 9 CFR 205.212 - “Buyer in ordinary course of business” and “security interest.”

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false âBuyer in ordinary course of businessâ and âsecurity interest.â 205.212 Section 205.212 Animals and Animal Products GRAIN INSPECTION, PACKERS... business” and “security interest.” The terms “buyer in ordinary course of business” and “security interest...

  6. SU-C-201-05: Imaging 212Pb-TCMC-Trastuzumab for Alpha Radioimmunotherapy for Ovarian Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Shen, S; Meredith, R; Azure, M; Yoder, D [University of Alabama, Birmingham, AL (United States); Torgue, J; Banaga, E [AREVA Med LLC, Bethesda, MD (United States)

    2015-06-15

    Purpose: To support the phase I trial for toxicity, biodistribution and pharmacokinetics of intra-peritoneal (IP) 212Pb-TCMC-trastuzumab in patients with HER-2 expressing malignancy. A whole body gamma camera imaging method was developed for estimating amount of 212Pb-TCMC-trastuzumab left in the peritoneal cavity. Methods: {sup 212}Pb decays to {sup 212}Bi via beta emission. {sup 212}Bi emits an alpha particle at an average of 6.1 MeV. The 238.6 keV gamma ray with a 43.6% yield can be exploited for imaging. Initial phantom was made of saline bags with 212Pb. Images were collected for 238.6 keV with a medium energy general purpose collimator. There are other high energy gamma emissions (e.g. 511keV, 8%; 583 keV, 31%) that penetrate the septae of the collimator and contribute scatter into 238.6 keV. An upper scatter window was used for scatter correction for these high energy gammas. Results: A small source containing 212Pb can be easily visualized. Scatter correction on images of a small 212Pb source resulted in a ∼50% reduction in the full width at tenth maximum (FWTM), while change in full width at half maximum (FWHM) was <10%. For photopeak images, substantial scatter around phantom source extended to > 5 cm outside; scatter correction improved image contrast by removing this scatter around the sources. Patient imaging, in the 1st cohort (n=3) showed little redistribution of 212Pb-TCMC-trastuzumab out of the peritoneal cavity. Compared to the early post-treatment images, the 18-hour post-injection images illustrated the shift to more uniform anterior/posterior abdominal distribution and the loss of intensity due to radioactive decay. Conclusion: Use of medium energy collimator, 15% width of 238.6 keV photopeak, and a 7.5% upper scatter window is adequate for quantification of 212Pb radioactivity inside peritoneal cavity for alpha radioimmunotherapy of ovarian cancer. Research Support: AREVA Med, NIH 1UL1RR025777-01.

  7. miR-132 and miR-212 are increased in pancreatic cancer and target the retinoblastoma tumor suppressor

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jong-Kook [College of Pharmacy, Ohio State University, Columbus, OH 43210 (United States); Henry, Jon C. [Department of Surgery, Ohio State University, Columbus, OH 43210 (United States); Jiang, Jinmai [College of Pharmacy, Ohio State University, Columbus, OH 43210 (United States); Esau, Christine [Regulus Therapeutics, Carlsbad, CA (United States); Gusev, Yuriy [Lombardi Cancer Center, Georgetown University, Washington, DC (United States); Lerner, Megan R. [Veterans Affairs Medical Center, Oklahoma City, OK (United States); Postier, Russell G. [Department of Surgery, University of Oklahoma Health Sciences Center, Oklahoma City, OK (United States); Brackett, Daniel J. [Veterans Affairs Medical Center, Oklahoma City, OK (United States); Schmittgen, Thomas D., E-mail: Schmittgen.2@osu.edu [College of Pharmacy, Ohio State University, Columbus, OH 43210 (United States)

    2011-03-25

    Research highlights: {yields} The expression of miR-132 and miR-212 are significantly increased in pancreatic cancer. {yields} miR-132 and miR-212 target the tumor suppressor pRb, resulting in enhanced proliferation. {yields} miR-132 and miR-212 expression is increased by a {beta}2 adrenergic receptor agonist, suggesting a novel mechanism for pancreatic cancer progression. -- Abstract: Numerous microRNAs (miRNAs) are reported as differentially expressed in cancer, however the consequence of miRNA deregulation in cancer is unknown for many miRNAs. We report that two miRNAs located on chromosome 17p13, miR-132 and miR-212, are over-expressed in pancreatic adenocarcinoma (PDAC) tissues. Both miRNAs are predicted to target the retinoblastoma tumor suppressor, Rb1. Validation of this interaction was confirmed by luciferase reporter assay and western blot in a pancreatic cancer cell line transfected with pre-miR-212 and pre-miR-132 oligos. Cell proliferation was enhanced in Panc-1 cells transfected with pre-miR-132/-212 oligos. Conversely, antisense oligos to miR-132/-212 reduced cell proliferation and caused a G{sub 2}/M cell cycle arrest. The mRNA of a number of E2F transcriptional targets were increased in cells over expressing miR-132/-212. Exposing Panc-1 cells to the {beta}2 adrenergic receptor agonist, terbutaline, increased the miR-132 and miR-212 expression by 2- to 4-fold. We report that over-expression of miR-132 and miR-212 result in reduced pRb protein in pancreatic cancer cells and that the increase in cell proliferation from over-expression of these miRNAs is likely due to increased expression of several E2F target genes. The {beta}2 adrenergic pathway may play an important role in this novel mechanism.

  8. Analysis of the clustering in 212Po, 218Rn and 232U

    Science.gov (United States)

    Ibrahim, T. T.; Wyngaardt, S. M.; Kimene Kaya, B. D. C.

    2017-10-01

    We studied the ground state band properties of 212Po, 218Rn and 232U using the binary cluster model. The nuclei are treated as a 208Pb-core plus a cluster interacting via a local potential of Saxon-Woods type functional form whose parameters are derived from Michigan-3-Yukawa (M3Y) microscopic potential model. Further correction in the internal structure of the hybrid potential model is attributed to the nucleon distribution in the overlap region of the core-cluster system. Overall our calculated results are found to compare favourably well with available experimental data.

  9. miR-132 and miR-212 are increased in pancreatic cancer and target the retinoblastoma tumor suppressor.

    Science.gov (United States)

    Park, Jong-Kook; Henry, Jon C; Jiang, Jinmai; Esau, Christine; Gusev, Yuriy; Lerner, Megan R; Postier, Russell G; Brackett, Daniel J; Schmittgen, Thomas D

    2011-03-25

    Numerous microRNAs (miRNAs) are reported as differentially expressed in cancer, however the consequence of miRNA deregulation in cancer is unknown for many miRNAs. We report that two miRNAs located on chromosome 17p13, miR-132 and miR-212, are over-expressed in pancreatic adenocarcinoma (PDAC) tissues. Both miRNAs are predicted to target the retinoblastoma tumor suppressor, Rb1. Validation of this interaction was confirmed by luciferase reporter assay and western blot in a pancreatic cancer cell line transfected with pre-miR-212 and pre-miR-132 oligos. Cell proliferation was enhanced in Panc-1 cells transfected with pre-miR-132/-212 oligos. Conversely, antisense oligos to miR-132/-212 reduced cell proliferation and caused a G(2)/M cell cycle arrest. The mRNA of a number of E2F transcriptional targets were increased in cells over expressing miR-132/-212. Exposing Panc-1 cells to the β2 adrenergic receptor agonist, terbutaline, increased the miR-132 and miR-212 expression by 2- to 4-fold. We report that over-expression of miR-132 and miR-212 result in reduced pRb protein in pancreatic cancer cells and that the increase in cell proliferation from over-expression of these miRNAs is likely due to increased expression of several E2F target genes. The β2 adrenergic pathway may play an important role in this novel mechanism. Copyright © 2011 Elsevier Inc. All rights reserved.

  10. The tribology of PS212 coatings and PM212 composites for the lubrication of titanium 6A1-4V components of a Stirling engine space power system

    Science.gov (United States)

    Sliney, Harold E.; Dellacorte, Christopher; Lukaszewicz, Victor

    1995-01-01

    The Stirling space power machine incorporates a linear alternator to generate electrical power. The alternator is a reciprocating device that is driven by a solar or nuclear-powered Stirling engine. The power piston and cylinder are made of titanium 6A1-4V (Ti6-4) alloy, and are designed to be lubricated by a hydrodynamically-generated gas film. Rubbing occurs during starts and stops and there is a possibility of an occasional high speed rub. Since titanium is known to have a severe galling tendency in sliding contacts, a 'backup,' self-lubricating coating on the cylinder and/or the piston is needed. This report describes the results of a research program to study the lubrication of Ti6-4 with the following chromium carbide based materials: plasma-sprayed PS212 coatings and sintered PM212 counterfaces. Program objectives are to achieve adherent coatings on Ti6-4 and to measure the friction and wear characteristics of the following sliding combinations under conditions simulative of the Stirling-driven space power linear alternator: Ti6-4/Ti6-4 baseline, Ti6-4/PS212 coated Ti6-4, and Ps212 coated Ti6-4/PM212

  11. Cellular uptake of {sup 212}BiOCl by Ehrlich ascites cells: A dosimetric analysis

    Energy Technology Data Exchange (ETDEWEB)

    Roeske, J.C.; Whitlock, J.L.; Harper, P.V.; Rotmensch, J. [Univ. of Chicago, IL (United States); Stinchcomb, T.G. [DePaul Univ., Chicago, IL (United States). Dept. of Physics; Schwartz, J.L. [Univ. of Washington, Seattle, WA (United States). Dept. of Radiation Oncology; Hines, J.J. [Argonne National Lab., IL (United States). Chemistry Div.

    1999-01-01

    Bi-212 is an alpha-emitting radionuclide being investigated as a therapeutic agent in the intraperitoneal treatment of micrometastatic ovarian carcinoma. In evaluating a new therapeutic modality, cell-survival studies are often used as a means of quantifying the biological effects of radiation. In this analysis, Ehrlich ascites cells were irradiated under conditions similar to therapy in various concentrations of Bi-212. Immediately following irradiation, a cell survival assay was performed in which cells were plated and colonies were counted after 10--14 days. Both a macrodosimetric and a microdosimetric approach were used in analyzing these data. These models used as input the fraction of activity within the cell and in solution, the distribution of cell sizes, and the variation of LET along individual alpha-particle tracks. The results indicate that the energy deposited within the nucleus varies significantly among individual cells. There is a small fraction of cell nuclei which receive no hits, while the remaining cells receive energy depositions which can differ significantly from the mean value. These dosimetric parameters are correlated with measured cell survival and will be a useful predictor of outcome for therapeutic doses.

  12. Deuterated formaldehyde in HH212: physics and chemistry of a typical protostar

    Science.gov (United States)

    Sahu, Dipen; Chakrabarti, Sandip Kumar; Minh, Young Chol

    2016-07-01

    HH212 is a nearby (400 pc) source in Orion. Recent observation (Codella et al., 2014) with ALMA using 24 no. of 12 m antenna revealed the source with high angular resolution and sensitivity (HPBW=0.65arc × 0.47 arc, σ - 3 to 4 mJy/beam/0.43 km s^-1) than previous SMA observation (Lee et al., 2007). This allows observations of several molecular lines e.g., SO, SO^2, C^{17}O, CO, and SiO. Emissions from these species probe different regions of this young stellar object, e.g., the outflow, the molecular jet, the envelop and the disk. The source might be the Class 0 protostellar system with a Keplerian disc and collimated bipolar SiO jets. Physics and chemistry of this region are very interesting. No deuterated molecule has been reported in this source except the recent report of deuterated water, HDO (Codella et al., 2016). Here, we report the HDCO (deuterated formaldehyde) line observation from ALMA data to probe the inner region of HH212. We compare HDCO line with other molecular lines to explain the possible chemistry and physics of the source, and also discussed the deuterium enrichment of molecular species.

  13. μ Opioid Receptor Expression after Morphine Administration Is Regulated by miR-212/132 Cluster.

    Directory of Open Access Journals (Sweden)

    Adrian Garcia-Concejo

    Full Text Available Since their discovery, miRNAs have emerged as a promising therapeutical approach in the treatment of several diseases, as demonstrated by miR-212 and its relation to addiction. Here we prove that the miR-212/132 cluster can be regulated by morphine, through the activation of mu opioid receptor (Oprm1. The molecular pathways triggered after morphine administration also induce changes in the levels of expression of oprm1. In addition, miR-212/132 cluster is actively repressing the expression of mu opioid receptor by targeting a sequence in the 3' UTR of its mRNA. These findings suggest that this cluster is closely related to opioid signaling, and function as a post-transcriptional regulator, modulating morphine response in a dose dependent manner. The regulation of miR-212/132 cluster expression is mediated by MAP kinase pathway, CaMKII-CaMKIV and PKA, through the phosphorylation of CREB. Moreover, the regulation of both oprm1 and of the cluster promoter is mediated by MeCP2, acting as a transcriptional repressor on methylated DNA after prolonged morphine administration. This mechanism explains the molecular signaling triggered by morphine as well as the regulation of the expression of the mu opioid receptor mediated by morphine and the implication of miR-212/132 in these processes.

  14. Lifetime measurements of {sup 214}Po and {sup 212}Po with the CTF liquid scintillator detector at LNGS

    Energy Technology Data Exchange (ETDEWEB)

    Bellini, G.; Buizza Avanzini, M.; Caccianiga, B.; D' Angelo, D.; Giammarchi, M.; Lombardi, P.; Ludhova, L.; Meroni, E.; Miramonti, L.; Perasso, L.; Ranucci, G.; Re, A. [Universita Milano (Italy); INFN, Dipartimento di Fisica, Milano (Italy); Benziger, J. [Princeton University, Chemical Engineering Department, Princeton, NJ (United States); Bick, D. [Universitaet Hamburg, Institut fuer Experimentalphysik, Hamburg (Germany); Bonfini, G.; Cavalcante, P.; Gazzana, S.; Ghiano, C.; Ianni, Aldo; Korga, G.; Koshio, Y.; Laubenstein, M.; Lombardi, F.; Nisi, S.; Razeto, A.; Rossi, N.; Tartaglia, R. [INFN, Laboratori Nazionali del Gran Sasso, Assergi (Italy); Bravo, D.; Hardy, S.; Manecki, S.; Vogelaar, R.B. [Virginia Polytechnic Institute and State University, Physics Department, Blacksburg, VA (United States); Cadonati, L.; Otis, K.; Pocar, A. [University of Massachusetts, Physics Department, Amherst, MA (United States); Calaprice, F.; Chavarria, A.; Galbiati, C.; Goretti, A.; Grandi, L.; Ianni, Andrea; Loer, B.; Mosteiro, P.; Saldanha, R.; Wright, A.; Xu, J. [Princeton University, Physics Department, Princeton, NJ (United States); Carraro, C.; Davini, S.; Guardincerri, E.; Manuzio, G.; Pallavicini, M.; Perasso, S.; Salvo, C.; Testera, G.; Zavatarelli, S. [Universita Genova (Italy); INFN, Dipartimento di Fisica, Genova (Italy); Chepurnov, A. [Lomonosov Moscow State University, Institute of Nuclear Physics, Moscow (Russian Federation); Chubakov, V.; Mantovani, F.; Xhixha, G. [Universita Ferrara (Italy); INFN, Dipartimento di Fisica, Ferrara (Italy); Derbin, A.; Muratova, V. [St. Petersburg Nuclear Physics Institute, Gatchina (Russian Federation); Etenko, A.; Litvinovich, E.; Machulin, I.; Sabelnikov, A.; Skorokhvatov, M.; Sukhotin, S. [NRC Kurchatov Institute, Moscow (Russian Federation); Fomenko, K. [INFN, Laboratori Nazionali del Gran Sasso, Assergi (Italy); Joint Institute for Nuclear Research, Dubna (Russian Federation); Franco, D.; Kryn, D.; Obolensky, M. [Obs de Paris, Sorbonne, APC, Univ. Paris Diderot, CNRS/IN2P3, CEA/Irfu, Paris Cite (France); Goeger-Neff, M.; Lewke, T.; Meindl, Q.; Oberauer, L.; Feilitzsch, F. von; Winter, J.; Wurm, M. [Technische Universitaet Muenchen, Physik Department, Garching (Germany); Kobychev, V. [Kiev Institute for Nuclear Research, Kiev (Ukraine); Korablev, D.; Smirnov, O.; Sotnikov, A.; Zaimidoroga, O. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Lissia, Marcello [INFN, Sezione di Cagliari, Monserrato (Italy); Maneschg, W.; Simgen, H. [Max-Plank-Institut fuer Kernphysik, Heidelberg (Germany); Misiaszek, M.; Wojcik, M. [Jagiellonian University, M. Smoluchowski Institute of Physics, Krakow (Poland); Montanari, D. [Fermi National Accelerator Laboratory, Batavia, IL (United States); Ortica, F.; Romani, A. [Universita Perugia (Italy); INFN, Dipartimento di Chimica, Perugia (Italy); Papp, L. [INFN, Laboratori Nazionali del Gran Sasso, Assergi (Italy); Virginia Polytechnic Institute and State University, Physics Department, Blacksburg, VA (United States); Schoenert, S. [Technische Universitaet Muenchen, Physik Department, Garching (Germany); Max-Plank-Institut fuer Kernphysik, Heidelberg (Germany); Suvorov, Y. [INFN, Laboratori Nazionali del Gran Sasso, Assergi (Italy); NRC Kurchatov Institute, Moscow (Russian Federation); Zuzel, G. [Max-Plank-Institut fuer Kernphysik, Heidelberg (Germany); Jagiellonian University, M. Smoluchowski Institute of Physics, Krakow (Poland); Collaboration: Borexino Collaboration

    2013-07-15

    We have studied the {alpha}-decays of {sup 214}Po into {sup 210}Pb and of {sup 212}Po into {sup 208}Pb tagged by the coincidence with the preceding {beta}-decays from {sup 214}Bi and {sup 212}Bi, respectively. The {sup 222}Rn, {sup 232}Th, and {sup 220}Rn sources used were sealed inside quartz vials and inserted in the Counting Test Facility at the underground Gran Sasso National Laboratory in Italy. We find that the mean lifetime of {sup 214}Po is (236.00 {+-} 0.42(stat) {+-} 0.15(syst)) {mu}s and that of {sup 212}Po is (425.1 {+-} 0.9(stat) {+-} 1.2(syst)) ns. Our results, obtained from data with signal-to-background ratio larger than 1000, reduce the overall uncertainties and are compatible with previous measurements. (orig.)

  15. Mechanical strength and thermophysical properties of PM212: A high temperature self-lubricating powder metallurgy composite

    Science.gov (United States)

    Edwards, Phillip M.; Sliney, Harold E.; Dellacorte, Christopher; Whittenberger, J. Daniel; Martineau, Robert R.

    1990-01-01

    A powder metallurgy composite, PM212, composed of metal bonded chromium carbide and solid lubricants is shown to be self-lubricating to a maximum application temperature of 900 C. The high temperature compressive strength, tensile strength, thermal expansion and thermal conductivity data needed to design PM212 sliding contact bearings and seals are reported for sintered and isostatically pressed (HIPed) versions of PM212. Other properties presented are room temperature density, hardness, and elastic modulus. In general, both versions appear to have adequate strength to be considered as sliding contact bearing materials, but the HIPed version, which is fully dense, is much stronger than the sintered version which contains about 20 percent pore volume. The sintered material is less costly to make, but the HIPed version is better where high compressive strength is important.

  16. Sodium, Saturated Fat, and Sugar Added Intake of The Diet of Children 2-12 Years Old

    OpenAIRE

    Angga Hardiansyah; Hardinsyah Hardinsyah; Dadang Sukandar

    2015-01-01

    The aims of the study were to analyze intake of sodium, saturated fat (SFA), and added sugar of children 2-12 years old. For this purpose, 38.890 children 2-12 years old from the food consumption data of the basic health survey of the Ministry of Health were analyzed. The intake of sodium, SFA, and added sugar were calculated by using food composition table (FCT) of Indonesia and USDA, and from nutrition facts of labeled foods.The sodium and SFA calculated include both natural resources and w...

  17. The HH212 Protostar as Observed by ALMA: the Jet, the Cavity, and the Forming Disk

    Science.gov (United States)

    Codella, C.; Cabrit, S.; Gueth, F.; Bachiller, R.; Gusdorf, A.; Lefloch, B.; Leurini, S.; Nisini, B.; Podio, L.; Santangelo, G.; Tafalla, M.; Yvart, W.

    2015-12-01

    We report ALMA observations of HH212, a protostar driving a strikingly bipolar H2/SiO collimated jet. We show how ALMA-Band 7 data can trace in unprecedented detail, and within a single spectral set-up, all the crucial ingredients involved in the star-disk formation recipe, namely: (i) the dusty protostar; (ii) the axial jet launched from it; (iii) the biconical outflow and its cavities; (iv) the parent infalling envelope; (v) the forming disk. We reveal different kinematics among chemical tracers, and more asymmetric structures than predicted by simple models, with significant contribution from the rotating swept-up cavity. In particular, we focus on the C17O emission indicating a combination of infall and rotation, with a keplerian disk nested inside

  18. 77 FR 41795 - Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and Nationality Act

    Science.gov (United States)

    2012-07-16

    ... SECURITY Office of the Secretary Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and...(d)(3)(B)(i) of the Immigration and ] Nationality Act (INA), 8 U.S.C. 1182(d)(3)(B)(i), as amended.... Implementation of this determination will be made by U.S. Citizenship and Immigration Services (USCIS), in...

  19. 76 FR 14419 - Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and Nationality Act

    Science.gov (United States)

    2011-03-16

    ... SECURITY Office of the Secretary Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and...(d)(3)(B)(i) of the Immigration and Nationality Act (INA), 8 U.S.C. 1182(d)(3)(B)(i), as amended, as.... Citizenship and Immigration Services (USCIS), in consultation with U.S. Immigration and Customs Enforcement...

  20. 76 FR 2131 - Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and Nationality Act

    Science.gov (United States)

    2011-01-12

    ... SECURITY Office of the Secretary Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and...(d)(3)(B)(i) of the Immigration and Nationality Act (INA), 8 U.S.C. 1182(d)(3)(B)(i), as amended, as.... Implementation of this determination will be made by U.S. Citizenship and Immigration Services (USCIS), in...

  1. Carbon isotope ratios suggest no additional methane from boreal wetlands during the rapid Greenland Interstadial 21.2

    NARCIS (Netherlands)

    Sperlich, Peter; Schaefer, Hinrich; Mikaloff Fletcher, Sara E.; Guillevic, Myriam; Lassey, Keith; Sapart, Célia J.; Roeckmann, Thomas; Blunier, Thomas

    2015-01-01

    Samples from two Greenland ice cores (NEEM and NGRIP) have been measured for methane carbon isotope ratios (δ13C-CH4) to investigate the CH4 mixing ratio anomaly during Greenland Interstadial (GI) 21.2 (85,000 years before present). This extraordinarily rapid event occurred within 150 years,

  2. 36 CFR 212.8 - Permission to cross lands and easements owned by the United States and administered by the Forest...

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Permission to cross lands and easements owned by the United States and administered by the Forest Service. 212.8 Section 212.8 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE TRAVEL MANAGEMENT Administration of...

  3. Inhibition of autophagy and enhancement of endoplasmic reticulum stress increase sensitivity of osteosarcoma Saos-2 cells to cannabinoid receptor agonist WIN55,212-2.

    Science.gov (United States)

    Zhang, Guodong; Bi, Haiyong; Gao, Ji; Lu, Xing; Zheng, Yanping

    2016-07-01

    WIN55,212-2, a cannabinoid receptor agonist, can activate cannabinoid receptors, which has proven anti-tumour effects in several tumour types. Studies showed that WIN can inhibit tumour cell proliferation and induce apoptosis in diverse cancers. However, the role and mechanism of WIN in osteosarcoma are still unclear. In this study, we examined the effect of WIN55,212-2 on osteosarcoma cell line Saos-2 in terms of cell viability and apoptosis. Meanwhile, we further explored the role of endoplasmic reticulum stress and autophagy in apoptosis induced by WIN55,212-2. Our results showed that the cell proliferation of Saos-2 was inhibited by WIN55,212-2 in a dose-dependent and time-dependent manner. WIN55,212-2-induced Saos-2 apoptosis through mitochondrial apoptosis pathway. Meanwhile, WIN55,212-2 can induce endoplasmic reticulum stress and autophagy in Saos-2 cells. Inhibition of autophagy and enhancement of endoplasmic reticulum stress increased apoptosis induced by WIN55,212-2 in Saos-2 cells. These findings indicated that WIN55,212-2 in combination with autophagic inhibitor or endoplasmic reticulum stress activator may shed new light on osteosarcoma treatment. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.

  4. 31 CFR 535.212 - Direction to transfer property in which Iran or an Iranian entity has an interest by branches and...

    Science.gov (United States)

    2010-07-01

    ... Islamic Republic of Iran with respect to the Declaration. (b) Any banking institution subject to the... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Direction to transfer property in... outside the United States. 535.212 Section 535.212 Money and Finance: Treasury Regulations Relating to...

  5. 7 CFR 868.210 - Grades and grade requirements for the classes of Rough Rice. (See also § 868.212.)

    Science.gov (United States)

    2010-01-01

    ... United States Standards for Rough Rice Principles Governing Application of Standards § 868.210 Grades and grade requirements for the classes of Rough Rice. (See also § 868.212.) Grade Maximum limits of— Seeds... Rice. (See also § 868.212.) 868.210 Section 868.210 Agriculture Regulations of the Department of...

  6. WIN55,212-2 impairs non-associative recognition and spatial memory in rats via CB1 receptor stimulation.

    Science.gov (United States)

    Galanopoulos, A; Polissidis, A; Georgiadou, G; Papadopoulou-Daifoti, Z; Nomikos, G G; Pitsikas, N; Antoniou, K

    2014-09-01

    Endogenous and exogenous cannabinoids modulate learning and memory primarily via the cannabinoid type 1 receptor (CB1R). A variety of experimental procedures has focused on the role of CB1R in various aspects of learning and memory processes. However, the picture still remains unclear as there is a lack of information on the effects of relatively low doses of CB1R agonists in relation to their effects on locomotion. The present study sought to investigate CB1R activation, using a range of relatively low doses of the CB1R agonist WIN55,212-2, on multiple aspects of learning and memory in rats. For this purpose, non-associative learning was examined using the habituation of locomotion paradigm, recognition memory was evaluated with the novel object recognition task, and the radial water maze test was selected to assess rats' spatial memory. The ability of the CB1R antagonist, SR141716A, to counteract WIN55,212-2-induced behavioral effects was also tested. WIN55,212-2 (0.3, but not 0.03 or 0.1mg/kg) disrupted non-associative learning, different aspects of short- and long-term recognition memory (storage and retrieval) and retention of spatial memory. The 0.3mg/kg dose of WIN55,212-2 also decreased ambulatory, but not vertical (rearing), activity in non-habituated rats. These effects appeared to be CB1R dependent since pretreatment with SR141716A (0.03 mg/kg) prevented the WIN55,212-2-induced behavioral effects. The present findings further support and extend the complex impact of exogenous cannabinoids on learning and memory in relation to their effects on locomotion. Copyright © 2014 Elsevier Inc. All rights reserved.

  7. [Modern algorithm for treating pudendal neuralgia: 212 cases and 104 decompressions].

    Science.gov (United States)

    Bautrant, E; de Bisschop, E; Vaini-Elies, V; Massonnat, J; Aleman, I; Buntinx, J; de Vlieger, J; Di Constanzo, M; Habib, L; Patroni, G; Siboni, S; Céas, B; Schiby, V; Uglione-Céas, M

    2003-12-01

    Clinical signs and symptoms of the pudendal neuralgia are very rich, with a great individual variability. The clinical diagnosis is difficult. It is confirmed or invalidated by the electrophysiologicals tests. Since October 1998 patient selection has been possible using a diagnosis score. Over a four-year period, the diagnosis of pudendal neuralgia was confirmed by electrophysiological investigations in 212 subjects. We rejected 12 patients because of a radiculo-medullary organic etiology. We only describe here cases of women with a peripheral pudendal nerve injury (200 patients). Thirty-eight neuropathies free of canal symptoms (obstetrical, post-traumatic...) were treated by infiltration therapy. The study of a total of 162 canal syndromes showed prevalent injury at the sacro-spino-tuberal ligamental grip which was observed in 68% of the cases, compared to the Alcock canal which was present in only 20% of the cases. One hundred four of these patients underwent surgical decompression via a trans-ischio-rectal approach after negative results of the infiltration therapy. We report here the surgical methodology, the post-op follow-up and the results, which appear quite successful: after one year 86% of the subjects are symptom-free or with a significant reduction of pain.

  8. A rotating protostellar jet launched from the innermost disk of HH 212

    Science.gov (United States)

    Lee, Chin-Fei; Ho, Paul. T. P.; Li, Zhi-Yun; Hirano, Naomi; Zhang, Qizhou; Shang, Hsien

    2017-07-01

    The central problem in forming a star is the angular momentum in the circumstellar disk, which prevents material from falling into the central stellar core. An attractive solution to the angular momentum problem appears to be the ubiquitous (low-velocity and poorly collimated) molecular outflows and (high-velocity and highly collimated) protostellar jets accompanying the earliest phase of star formation that remove angular momentum at a range of disk radii1. Previous observations have suggested that outflowing material carries away the excess angular momentum via magneto-centrifugally driven winds from the surfaces of circumstellar disks down to ˜10 au scales2,3,4,5,6, allowing the material in the outer disk to be transported to the inner disk. Here we show that highly collimated protostellar jets remove the residual angular momenta at the ˜0.05 au scale, enabling the material in the innermost region of the disk to accrete towards the central protostar. This is supported by the rotation of the jet measured down to ˜10 au from the protostar in the HH 212 protostellar system. The measurement implies a jet launching radius of ˜0.05-0.02+0.05 au on the disk, based on the magneto-centrifugal theory of jet production, which connects the properties of the jet measured at large distances with those at its base through energy and angular momentum conservation7.

  9. miR-132/212 knockout mice reveal roles for these miRNAs in regulating cortical synaptic transmission and plasticity.

    Directory of Open Access Journals (Sweden)

    Judit Remenyi

    Full Text Available miR-132 and miR-212 are two closely related miRNAs encoded in the same intron of a small non-coding gene, which have been suggested to play roles in both immune and neuronal function. We describe here the generation and initial characterisation of a miR-132/212 double knockout mouse. These mice were viable and fertile with no overt adverse phenotype. Analysis of innate immune responses, including TLR-induced cytokine production and IFNβ induction in response to viral infection of primary fibroblasts did not reveal any phenotype in the knockouts. In contrast, the loss of miR-132 and miR-212, while not overtly affecting neuronal morphology, did affect synaptic function. In both hippocampal and neocortical slices miR-132/212 knockout reduced basal synaptic transmission, without affecting paired-pulse facilitation. Hippocampal long-term potentiation (LTP induced by tetanic stimulation was not affected by miR-132/212 deletion, whilst theta burst LTP was enhanced. In contrast, neocortical theta burst-induced LTP was inhibited by loss of miR-132/212. Together these results indicate that miR-132 and/or miR-212 play a significant role in synaptic function, possibly by regulating the number of postsynaptic AMPA receptors under basal conditions and during activity-dependent synaptic plasticity.

  10. Study on the performance of Nafion 212 membrane in polymeric electrolyte fuel cells operating with air; Estudo do desempenho da membrana de Nafion 212 em celulas a combustivel de eletrolito polimerico operando com ar

    Energy Technology Data Exchange (ETDEWEB)

    Fernandes, Adriano C.; Ticianelli, Edson Antonio [Universidade de Sao Paulo (USP), Sao Carlos, SP (Brazil). Inst. de Quimica]. E-mail: edsont@iqsc.usp.br

    2008-07-01

    The operational characteristics of the Nafion 212 membrane (N212) were investigated and compared to the Nafion 112 membrane (N112), both 50 thick, in polymer electrolyte fuel cell (PEFC). The polarization measurements were performed changing the cell and gases humidification temperature and the gases pressure. The kinetic parameters obtained from the polarization curve proved that the cell with membrane N212 showed better performance than membrane N112, when they operating with air at cathode. The electrochemical impedance studies were carried out to make clear the polarization phenomena due to the resistive and diffusive effects that limit the cell performance. At high frequency region is found an arc, which dimension in depends on the current density, whereas at the mid frequency region we can find two loops with different characteristics and both dependent of current density. This behavior becomes evident that there are polarization components linked to resistive processes at high frequency, as well as charge transference and diffusional at mid and low frequency, respectively. (author)

  11. The Effect of Dorsal Hippocampal α2-Adrenegic Receptors on WIN55,212-2 State-Dependent Memory of Passive Avoidance

    Directory of Open Access Journals (Sweden)

    Zarrindast M.R.

    2010-09-01

    Full Text Available Background and Objectives: Cannabinoids are a class of psychoactive compounds that produce a wide array of effects in a large number of species. In the present study, the effects of bilateral intra-CA1 injections of an α2-adrenergic receptor agents, on WIN55,212-2 state-dependent learning were examined in adult male Wistar rats. Methods: The animals were bilaterally implanted with chronic cannulae in the CA1 regions of the dorsal hippocampus, trained in a step-down type inhibitory avoidance task, and tested 24h after training to measure step-down latency.Results: Post-training intra-CA1 injection of WIN55,212-2 (0.25 and 0.5µg/rat induced impairment of memory retention. Amnesia produced by post-training WIN55,212-2 (0.5µg/rat was reversed by pre-test administration of the same dose of WIN55,212-2 that is due to a state-dependent effect. Pre-test intra-CA1 injection of clonidine (0.5 and 0.75µg/rat, intra-CA1 improved post-training WIN55,212-2 (0.5µg/rat, intra-CA1-induced retrieval impairment, while pre-test intra-CA1 injection of yohimbine (1µg/rat, intra-CA1 2min before the administration of WIN55,212-2 (0.5µg/rat, intra-CA1 inhibited WIN55,212-2 state-dependent memory. Conclusion: These results suggest that α2-adrenergic receptors of the dorsal hippocampal CA1 regions may play an important role in Win55,212-2-induced amnesia and WIN55,212-2 state-dependent memory.

  12. 76 FR 2130 - Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and Nationality Act

    Science.gov (United States)

    2011-01-12

    ... SECURITY Office of the Secretary Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and...(d)(3)(B)(i) of the Immigration and Nationality Act (INA), 8 U.S.C. 1182(d)(3)(B)(i), as amended, as... Immigration Services (USCIS), in consultation with U.S. Immigration and Customs Enforcement (ICE), or by U.S...

  13. 76 FR 14418 - Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and Nationality Act

    Science.gov (United States)

    2011-03-16

    ... SECURITY Office of the Secretary Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and...(d)(3)(B)(i) of the Immigration and Nationality Act (INA), 8 U.S.C. 1182(d)(3)(B)(i), as amended, as... determination will be made by U.S. Citizenship and Immigration Services (USCIS), in consultation with U.S...

  14. The effect of prolonged exposure to 750{degree}C air on the tribological performance of PM212

    Energy Technology Data Exchange (ETDEWEB)

    Bemis, K.; Bogdanski, M.S. [Case Western Reserve Univ., Cleveland, OH (United States). Dept. of Mechanical and Aerospace Engineering; DellaCorte, C. [National Aeronautics and Space Administration, Cleveland, OH (United States). Lewis Research Center; Sliney, H.E. [Aerospace Design and Fabrication, Inc., Brook Park, OH (United States)

    1994-05-01

    The effect of prolonged exposure to 750C air on tribological performance and dimensional stability of PM212, a high temperature, self-lubricating composite, is studied. PM212, contains 70% metal-bonded Cr{sub 3}C{sub 2}, 15% BaF{sub 2}/CaF{sub 2} eutectic and 15% silver. Rub blocks were fabricated from PM212 by cold isostatic pressing followed by sintering. Prior to tribo-testing, the rub blocks were exposed to 750C air from 100 to 1000 hours. Then, the rub blocks were slid against nickel-based superalloy disks in a double-rub-block tribometer in air under 66N load at temperatures from 25 to 750C with a sliding velocity of 0.36 m/s. Unexposed rub blocks were tested for baseline comparison. Friction coefficients ranged from 0.24 to 0.37 for unexposed rub blocks and from 0.32 to 0.56 for the exposed ones. Wear for both the composite blocks and superalloy disks was typically in the moderate to low range of 10{sup {minus}5} to 10{sup {minus}6} mm{sup 3} /N-m. Friction and wear data were similar for the rub blocks exposed for 100, 500, and 1000 hours. Prolonged exposure to 750C air increased friction and wear of the PM212 rub blocks at room temperature, but triboperformance remained unaffected at higher temperatures, probably due to formation of lubricous metal oxides. Dimensional stability of the composite was studied by exposing specimens of varying thicknesses for 500 hours in air at 750C. Block thicknesses were found to increase with increased exposure time until steady state was reached after 100 hours of exposure, probably due to oxidation.

  15. Carbon isotope ratios suggest no additional methane from boreal wetlands during the rapid Greenland Interstadial 21.2

    Science.gov (United States)

    Sperlich, Peter; Schaefer, Hinrich; Mikaloff Fletcher, Sara; Guillevic, Myriam; Lassey, Keith; Sapart, Célia; Röckmann, Thomas; Blunier, Thomas

    2017-04-01

    Samples from two Greenland ice cores (NEEM and NGRIP) have been measured for methane carbon isotope ratios (delta 13C-CH4) to investigate the CH4 mixing ratio anomaly during Greenland Interstadial (GI) 21.2 (85,000 years before present). This extraordinarily rapid event occurred within 150 years, comprising a CH4 mixing ratio pulse of 150 ppb (˜25%). Our new measurements disclose a concomitant shift in delta 13C-CH4 of 1‰ . Keeling plot analyses reveal the delta 13C of the additional CH4 source constituting the CH4 anomaly as -56.8 ± 2.8‰ , which we confirm by means of a previously published box model. We propose tropical wetlands as the most probable additional CH4 source during GI-21.2 and present independent evidence that suggests that tropical wetlands in South America and Asia have played a key role. We find no evidence that boreal CH4 sources, such as permafrost degradation, contributed significantly to the atmospheric CH4 increase, despite the pronounced warming in the Northern Hemisphere during GI-21.2.

  16. Absence of 12q21.2q22 deletions and subtelomeric rearrangements in cardiofaciocutaneous (CFC) syndrome patients.

    Science.gov (United States)

    Kavamura, M I; Zollino, M; Lecce, R; Murdolo, M; Brunoni, D; Alchorne, M M A; Opitz, J M; Neri, G

    2003-06-01

    Recent publications described two patients with a CFC-like phenotype and the same deletion of chromosome region 12q21.2q22 [Rauen et al., 2000, 2002]. The patients did not have the classical CFC phenotype and presented other signs not usually seen in CFC patients: the first patient had hydrocephalus, and the second, a history of olygohydramnios, normal stature, pyloric stenosis, cutaneous syndactyly of toes and bilateral transverse palmar creases. In order to verify if classic CFC patients with normal chromosomes in conventional preparations have microdeletions within the 12q21.2q22 chromosome region, we performed FISH analysis using 12 BAC probes to screen this area. The average interval between the probes was of approximately 1 Mb. No deletions were found in any of the 17 classical CFC patients we examined. We conclude that the region 12q21.2q22 is not a candidate region for CFC syndrome and that the patients described by Rauen et al. [2000, 2002] probably have a different condition, i.e., an aneuploidy syndrome, with some phenotypic resemblance to the CFC syndrome. To further evaluate the possibility of other chromosome imbalances, we performed a subtelomeric analysis, by FISH technique, of all chromosomes, and did not find any subtelomeric rearrangements. Copyright 2003 Wiley-Liss, Inc.

  17. Spectral Classifications for 212 Little-Studied K and M Dwarfs in the LHS Catalogue

    Science.gov (United States)

    Wing, Robert F.; MacConnell, D. J.

    2010-01-01

    We have obtained two-dimensional spectral classifications for 212 stars listed in the LHS Catalogue (Luyten 1979). Stars selected for our observing program have southern declinations, red colors, and in most cases only color-equivalent types (k or m) in the Catalogue. The observations were originally motivated by the hope of finding dwarf carbon stars; since LHS stars by definition have proper motions exceeding 0.5 arcsec/yr, any relatively faint LHS star displaying a C-type spectrum would necessarily be dC. Observations were acquired at the CTIO 1.0-m telescope during the period 1993-95. Our data consist of narrow-band photoelectric TiO/CN photometry using the first 6 filters of Wing's eight-color system. Temperature classes are based on the strength of the strong TiO band near 7120 A; they are given to a tenth of a subtype and are on the same scale as we use for giant stars, tied to the MK scale through observations of Keenan giant standards. Our luminosity criterion is CN absorption measured at 8120 A; this feature is invariably present in giants and supergiants but is absent (depression less than 0.03 mag) in K and M dwarfs. We do not distinguish subdwarfs from main-sequence dwarfs. No new dC stars were found; 189 of the program stars were found to have measurable TiO absorption indicating spectral types ranging from K3.5 V to M6.5 V. In addition, 23 stars have too little TiO to be classified by this method but have colors consistent with being early K dwarfs.

  18. The new version 2.12 of BKG Ntrip Client (BNC)

    Science.gov (United States)

    Stürze, Andrea; Mervart, Leos; Weber, Georg; Rülke, Axel; Wiesensarter, Erwin; Neumaier, Peter

    2016-04-01

    A new version of the BKG Ntrip Client (BNC) has been released. Originally developed in cooperation of the Federal Agency for Cartography and Geodesy (BKG) and the Czech Technical University (CTU) with a focus on multi-stream real-time access to GPS observations, the software has once again been substantially extended. Promoting Open Standards as recommended by the Radio Technical Commission for Maritime Services (RTCM) remains the prime subject. Beside its Graphical User Interface (GUI), the real-time software for Windows, Linux, Mac, and Linux platforms now comes with complete Command Line Interface (CLI) and considerable post processing functionality. RINEX Version 3 file editing & Quality Check (QC) with full support of Galileo, BeiDou, and SBAS - besides GPS and GLONASS - is part of the new features. Comparison of satellite orbit/clock files in SP3 format is another fresh ability of BNC. Simultaneous multi-station Precise Point Positioning (PPP) for real-time displacement-monitoring of entire reference station networks is one more recent addition to BNC. Implemented RTCM messages for PPP (under development) comprise satellite orbit and clock corrections, code and phase observation biases, and the Vertical Total Electron Content (VTEC) of the ionosphere. The well established, mature codebase is mostly written in C++ language. Its publication under GNU GPL is thought to be well-suited for test, validation and demonstration of new approaches in precise real-time satellite navigation when IP streaming is involved. The poster highlights BNC features which are new in version 2.12 and beneficial to IAG institutions and services such as IGS/RT-IGS and to the interested public in general.

  19. Formation and Atmosphere of Complex Organic Molecules of the HH 212 Protostellar Disk

    Science.gov (United States)

    Lee, Chin-Fei; Li, Zhi-Yun; Ho, Paul T. P.; Hirano, Naomi; Zhang, Qizhou; Shang, Hsien

    2017-07-01

    HH 212 is a nearby (400 pc) Class 0 protostellar system recently found to host a “hamburger”-shaped dusty disk with a radius of ˜60 au, deeply embedded in an infalling-rotating flattened envelope. We have spatially resolved this envelope-disk system with the Atacama Large Millimeter/submillimeter Array at up to ˜16 au (0.″04) resolution. The envelope is detected in HCO+ J = 4-3 down to the dusty disk. Complex organic molecules (COMs) and doubly deuterated formaldehyde (D2CO) are detected above and below the dusty disk within ˜40 au of the central protostar. The COMs are methanol (CH3OH), deuterated methanol (CH2DOH), methyl mercaptan (CH3SH), and formamide (NH2CHO, a prebiotic precursor). We have modeled the gas kinematics in HCO+ and COMs and found a centrifugal barrier (CB) at a radius of ˜44 au, within which a Keplerian rotating disk is formed. This indicates that HCO+ traces the infalling-rotating envelope down to the CB and COMs trace the atmosphere of a Keplerian rotating disk within the CB. The COMs are spatially resolved for the first time, both radially and vertically, in the atmosphere of a disk in the earliest, Class 0 phase of star formation. Our spatially resolved observations of COMs favor their formation in the disk rather than a rapidly infalling (warm) inner envelope. The abundances and spatial distributions of the COMs provide strong constraints on models of their formation and transport in low-mass star formation.

  20. Deuterated methanol on a solar system scale around the HH212 protostar

    Science.gov (United States)

    Bianchi, E.; Codella, C.; Ceccarelli, C.; Taquet, V.; Cabrit, S.; Bacciotti, F.; Bachiller, R.; Chapillon, E.; Gueth, F.; Gusdorf, A.; Lefloch, B.; Leurini, S.; Podio, L.; Rygl, K. L. J.; Tabone, B.; Tafalla, M.

    2017-10-01

    Context. Deuterium fractionation is a valuable tool for understanding the chemical evolution during the process that leads to the formation of a Sun-like planetary system. Aims: Methanol is thought to be mainly formed during the prestellar phase, and its deuterated form keeps a memory of the conditions at that epoch. The unique combination of high angular resolution and sensitivity provided by ALMA enables us to measure methanol deuteration in the planet formation region around a Class 0 protostar and to understand its origin. Methods: We mapped both the 13CH3OH and CH2DOH distribution in the inner regions ( 100 au) of the HH212 system in Orion B. To this end, we used ALMA Cycle 1 and Cycle 4 observations in Band 7 with angular resolution down to 0.̋15. Results: We detected 6 lines of 13CH3OH and 13 lines of CH2DOH with upper level energies of up to 438 K in temperature units. We derived a rotational temperature of (171 ± 52) K and column densities of 7 × 1016 cm-2 (13CH3OH) and 1 × 1017 cm-2 (CH2DOH), respectively. This yields a D/H ratio of (2.4 ± 0.4) × 10-2, which is lower by an order of magnitude than previously measured values using single-dish telescopes toward protostars located in Perseus. Our findings are consistent with the higher dust temperatures in Orion B with respect to the temperature derived for the Perseus cloud. The emission traces a rotating structure extending up to 45 au from the jet axis, which is elongated by 90 au along the jet axis. So far, the origin of the observed emission appears to be related with the accretion disc. Only higher spatial resolution measurements will be able to distinguish between different possible scenarios, however: disc wind, disc atmosphere, or accretion shocks.

  1. A new nonsyndromic X-linked sensorineural hearing impairment linked to Xp21.2

    Energy Technology Data Exchange (ETDEWEB)

    Lalwani, A.K.; Brister, J.R.; Fex, J.; Grundfast, K.M.; Pikus, A.T.; Ploplis, B.; San Agustin, T.; Skarka, H.; Wilcox, E.R. [National Institutes of Health, Bethesda, MD (United States)

    1994-10-01

    X-linked deafness is a rare cause of hereditary hearing impairment. We have identified a family with X-linked dominant sensorineural hearing impairment, characterized by incomplete penetrance and variable expressivity in carrier females, that is linked to the Xp21.2, which contains the Duchenne muscular dystrophy (DMD) locus. The auditory impairment in affected males was congenital, bilateral, profound, sensorineural, affecting all frequencies, and without evidence of radiographic abnormality of the temporal bone. Adult carrier females manifested bilateral, mild-to-moderate high-frequency sensorineural hearing impairment of delayed onset during adulthood. Eighteen commercially available polymorphic markers from the X chromosome, generating a 10-15-cM map, were initially used for identification of a candidate region. DXS997, located within the DMD gene, generated a two-point LOD score of 2.91 at {theta} = 0, with every carrier mother heterozygous at this locus. Recombination events at DXS992 (located within the DMD locus, 3{prime} to exon 50 of the dystrophin gene) and at DXS1068 (5{prime} to the brain promoter of the dystrophin gene) were observed. No recombination events were noted with the following markers within the DMD locus: 5{prime}DYS II, intron 44, DXS997, and intron 50. There was no clinical evidence of Duchenne or Becker muscular dystrophy in any family member. It is likely that this family represents a new locus on the X chromosome, which when mutated results in nonsyndromic sensorineural hearing loss and is distinct from the heterogeneous group of X-linked hearing losses that have been previously described. 57 refs., 6 figs., 1 tab.

  2. Formation and Atmosphere of Complex Organic Molecules of the HH 212 Protostellar Disk

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Chin-Fei; Ho, Paul T. P.; Hirano, Naomi; Shang, Hsien [Academia Sinica Institute of Astronomy and Astrophysics, P.O. Box 23-141, Taipei 106, Taiwan (China); Li, Zhi-Yun [Astronomy Department, University of Virginia, Charlottesville, VA 22904 (United States); Zhang, Qizhou, E-mail: cflee@asiaa.sinica.edu.tw [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States)

    2017-07-01

    HH 212 is a nearby (400 pc) Class 0 protostellar system recently found to host a “hamburger”-shaped dusty disk with a radius of ∼60 au, deeply embedded in an infalling-rotating flattened envelope. We have spatially resolved this envelope-disk system with the Atacama Large Millimeter/submillimeter Array at up to ∼16 au (0.″04) resolution. The envelope is detected in HCO{sup +} J = 4–3 down to the dusty disk. Complex organic molecules (COMs) and doubly deuterated formaldehyde (D{sub 2}CO) are detected above and below the dusty disk within ∼40 au of the central protostar. The COMs are methanol (CH{sub 3}OH), deuterated methanol (CH{sub 2}DOH), methyl mercaptan (CH{sub 3}SH), and formamide (NH{sub 2}CHO, a prebiotic precursor). We have modeled the gas kinematics in HCO{sup +} and COMs and found a centrifugal barrier (CB) at a radius of ∼44 au, within which a Keplerian rotating disk is formed. This indicates that HCO{sup +} traces the infalling-rotating envelope down to the CB and COMs trace the atmosphere of a Keplerian rotating disk within the CB. The COMs are spatially resolved for the first time, both radially and vertically, in the atmosphere of a disk in the earliest, Class 0 phase of star formation. Our spatially resolved observations of COMs favor their formation in the disk rather than a rapidly infalling (warm) inner envelope. The abundances and spatial distributions of the COMs provide strong constraints on models of their formation and transport in low-mass star formation.

  3. A new nonsyndromic X-linked sensorineural hearing impairment linked to Xp21.2.

    Science.gov (United States)

    Lalwani, A. K.; Brister, J. R.; Fex, J.; Grundfast, K. M.; Pikus, A. T.; Ploplis, B.; San Agustin, T.; Skarka, H.; Wilcox, E. R.

    1994-01-01

    X-linked deafness is a rare cause of hereditary hearing impairment. We have identified a family with X-linked dominant sensorineural hearing impairment, characterized by incomplete penetrance and variable expressivity in carrier females, that is linked to the Xp21.2, which contains the Duchenne muscular dystrophy (DMD) locus. The auditory impairment in affected males was congenital, bilateral, profound, sensorineural, affecting all frequencies, and without evidence of radiographic abnormality of the temporal bone. Adult carrier females manifested bilateral, mild-to-moderate high-frequency sensorineural hearing impairment of delayed onset during adulthood. Eighteen commercially available, polymorphic markers from the X chromosome, generating a 10-15-cM map, were initially used for identification of a candidate region. DXS997, located within the DMD gene, generated a two-point LOD score of 2.91 at theta = 0, with every carrier mother heterozygous at this locus. Recombination events at DXS992 (located within the DMD locus, 3' to exon 50 of the dystrophin gene) and at DXS1068 (5' to the brain promoter of the dystrophin gene) were observed. No recombination events were noted with the following markers within the DMD locus: 5'DYS II, intron 44, DXS997, and intron 50. There was no clinical evidence of Duchenne or Becker muscular dystrophy in any family member. It is likely that this family represents a new locus on the X chromosome, which when mutated results in nonsyndromic sensorineural hearing loss and is distinct from the heterogeneous group of X-linked hearing losses that have been previously described. PMID:7942846

  4. Inhibition of smooth muscle contraction and platelet aggregation by peptide 204–212 of lipocortin 5: an attempt to define some structure requirements

    Directory of Open Access Journals (Sweden)

    K. G. Mugridge

    1993-01-01

    Full Text Available Peptide 204–212 of lipocortin (LC 5 inhibited porcine pancreatic phospholipase A2 (PLA2 induced rat stomach strip contractions and ADP induced rabbit platelet aggregation in a concentration dependent manner (IC30 of 10 μM and 400 μM, respectively. The first two amino acids are not necessary since the eptapeptide 206–212 was equipotent in both assays (IC30 of 12.5 μM and 420 μM. Of the two pentapeptides 204–208 and 208–212 only the latter showed inhibitory activity in both models although the potency was much reduced (IC30 of 170 μM and 630 μM compared with that of the parent nonapeptide. Comparison of peptide 204–212 effects with those of its analogues on LC1 and LC2 indicate that lysine 208 and aspartic acid 211 are essential in order to maintain a fully active nonapeptide.

  5. Oxygen Sensing via the Ethylene Response Transcription Factor RAP2.12 Affects Plant Metabolism and Performance under Both Normoxia and Hypoxia.

    Science.gov (United States)

    Paul, Melanie Verena; Iyer, Srignanakshi; Amerhauser, Carmen; Lehmann, Martin; van Dongen, Joost T; Geigenberger, Peter

    2016-09-01

    Subgroup-VII-ethylene-response-factor (ERF-VII) transcription factors are involved in the regulation of hypoxic gene expression and regulated by proteasome-mediated proteolysis via the oxygen-dependent branch of the N-end-rule pathway. While research into ERF-VII mainly focused on their role to regulate anoxic gene expression, little is known on the impact of this oxygen-sensing system in regulating plant metabolism and growth. By comparing Arabidopsis (Arabidopsis thaliana) plants overexpressing N-end-rule-sensitive and insensitive forms of the ERF-VII-factor RAP2.12, we provide evidence that oxygen-dependent RAP2.12 stability regulates central metabolic processes to sustain growth, development, and anoxic resistance of plants. (1) Under normoxia, overexpression of N-end-rule-insensitive Δ13RAP2.12 led to increased activities of fermentative enzymes and increased accumulation of fermentation products, which were accompanied by decreased adenylate energy states and starch levels, and impaired plant growth and development, indicating a role of oxygen-regulated RAP2.12 degradation to prevent aerobic fermentation. (2) In Δ13RAP2.12-overexpressing plants, decreased carbohydrate reserves also led to a decrease in anoxic resistance, which was prevented by external Suc supply. (3) Overexpression of Δ13RAP2.12 led to decreased respiration rates, changes in the levels of tricarboxylic acid cycle intermediates, and accumulation of a large number of amino acids, including Ala and γ-amino butyric acid, indicating a role of oxygen-regulated RAP2.12 abundance in controlling the flux-modus of the tricarboxylic acid cycle. (4) The increase in amino acids was accompanied by increased levels of immune-regulatory metabolites. These results show that oxygen-sensing, mediating RAP2.12 degradation is indispensable to optimize metabolic performance, plant growth, and development under both normoxic and hypoxic conditions. © 2016 American Society of Plant Biologists. All rights

  6. Sensitization of Tumor to {sup 212}Pb Radioimmunotherapy by Gemcitabine Involves Initial Abrogation of G2 Arrest and Blocked DNA Damage Repair by Interference With Rad51

    Energy Technology Data Exchange (ETDEWEB)

    Yong, Kwon Joong; Milenic, Diane E.; Baidoo, Kwamena E. [Radioimmune and Inorganic Chemistry Section, Radiation Oncology Branch, National Cancer Institute, National Institutes of Health, Bethesda, Maryland (United States); Brechbiel, Martin W., E-mail: martinwb@mail.nih.gov [Radioimmune and Inorganic Chemistry Section, Radiation Oncology Branch, National Cancer Institute, National Institutes of Health, Bethesda, Maryland (United States)

    2013-03-15

    Purpose: To elucidate the mechanism of the therapeutic efficacy of targeted α-particle radiation therapy using {sup 212}Pb-TCMC-trastuzumab together with gemcitabine for treatment of disseminated peritoneal cancers. Methods and Materials: Mice bearing human colon cancer LS-174T intraperitoneal xenografts were pretreated with gemcitabine, followed by {sup 212}Pb-TCMC-trastuzumab and compared with controls. Results: Treatment with {sup 212}Pb-TCMC-trastuzumab increased the apoptotic rate in the S-phase-arrested tumors induced by gemcitabine at earlier time points (6 to 24 hours). {sup 212}Pb-TCMC-trastuzumab after gemcitabine pretreatment abrogated G2/M arrest at the same time points, which may be associated with the inhibition of Chk1 phosphorylation and, in turn, cell cycle perturbation, resulting in apoptosis. {sup 212}Pb-TCMC-trastuzumab treatment after gemcitabine pretreatment caused depression of DNA synthesis, DNA double-strand breaks, accumulation of unrepaired DNA, and down-regulation of Rad51 protein, indicating that DNA damage repair was blocked. In addition, modification in the chromatin structure of p21 may be associated with transcriptionally repressed chromatin states, indicating that the open structure was delayed at earlier time points. Conclusion: These findings suggest that the cell-killing efficacy of {sup 212}Pb-TCMC-trastuzumab after gemcitabine pretreatment may be associated with abrogation of the G2/M checkpoint, inhibition of DNA damage repair, and chromatin remodeling.

  7. [Impact of personality disorders in a sample of 212 homeless drug users].

    Science.gov (United States)

    Combaluzier, S; Gouvernet, B; Bernoussi, A

    2009-10-01

    The impact of the mental disorders (axis I and II, according to DSM IV) on psychosocial problems (axis IV) is now a well-known fact, notably when substance abuse disorders are encountered on axis I. This leads to the conclusion that personality disorders increase the risk of substance abuse, that substance abuse increases the risk of homelessness, that dual diagnosis has a high impact on homelessness and underlines interactions between personality disorders (PD), drug abuse (DA) and homelessness. The aim of this paper is also to study these interactions. We will process the classical epidemiological measures, which have already produced interesting findings on other substance-linked disorders. We will study the multiplicative interaction (I(AB)) and the etiological fraction (EFi) linked to interaction, which evaluate the effects of two factors on another. According to the authors, the I(AB) determines whether the co-occurrence of two risk factors in a group induces more cases than each factor acting together; also if the I(AB) is greater than 1 it is possible to estimate the EFi, that proportionally measures the number of cases of the third factor that can be attributed to the co-occurrence. We will also study the interactions of homelessness and PD on DA, of the PD and DA on homelessness, and of this association DA and homelessness on PD. The data we will use in the paper deal with the prevalence of PD in general, drug users (n=226), homeless (n=999) and homeless drug abusers (n=212). The two last data are extracted from the same population and have been collected through clinical interviews, and the diagnosis follows the DSM criteria. They are comparable to Kokkevi et al.'s sample regarding the drug (heroin), the mean age (28 years for Kokkevi et al., 27 years in our sample), and the geographic origin of the populations (Mediterranean basin). The repartition of PD differs significantly (0.001) in the homeless population and the homeless drug abusers (chi(2

  8. The microRNA-132/212 family fine-tunes multiple targets in Angiotensin II signalling in cardiac fibroblasts

    DEFF Research Database (Denmark)

    Eskildsen, Tilde V; Schneider, Mikael; Sandberg, Maria B

    2015-01-01

    INTRODUCTION: MicroRNAs (miRNAs) are emerging as key regulators of cardiovascular development and disease; however, the cardiac miRNA target molecules are not well understood. We and others have described the Angiotensin II (AngII)-induced miR-132/212 family as novel regulators of cardiovascular......, signalling molecules and transcription factors. Subsequent comprehensive in silico analysis identified 24 target genes, of which 22 genes were qPCR validated. We identified seven genes involved in AngII signalling pathways. CONCLUSION: We here report novel insight of an extensive network of molecular...

  9. [A commentary on the Ruling of the Tribuna Constitucional 212/1996 of 19 December 1996 (I)].

    Science.gov (United States)

    González Morán, L

    1998-01-01

    This article is a commentary on Spain's Constitutional Court's ruling of 19 December 1996 (STC 212/1996), on the challenge (596/89) on grounds of alleged unconstitutionality made against Law 42/1988, 28 December, which regulates the donation of human embryos and foetuses or the cells, tissues and organs therefrom. The article is structured as follows: it opens with a summary of Law 42/1988, since this is felt necessary to understand the subsequent challenge made on grounds of alleged unconstitutionality. We then provide specific details of the challenge and the resulting ruling, before concluding with some critical remarks on the aforementioned Law and ruling.

  10. Selective and nonselective serotonin antagonists block the aversive stimulus properties of MK212 and m-chlorophenylpiperazine (mCPP) in mice.

    Science.gov (United States)

    Walker, Ellen A; Kohut, Stephen J; Hass, Richard W; Brown, Edward K; Prabandham, Anupama; Lefever, Timothy

    2005-12-01

    Serotonin(2C) (5-HT(2C)) receptors have been implicated to treat mood disorders such as depression and anxiety. In the present study, the capacities of two 5-HT(2C) agonists, MK212 and mCPP, to produce conditioned taste aversions in mice were evaluated. On two training days, Swiss-Webster male mice (19-34g) were trained to associate the flavor of a novel solution with the injection of various doses of MK212 or mCPP. On two alternate training days, mice were trained to associate a different flavored solution with an injection of saline. For testing, both flavored solutions were presented simultaneously and an avoidance of the MK212 or mCPP-paired solution indicated conditioned taste aversion. Robust conditioned taste aversions were observed to solutions paired with 1.0 or 10mg/kg MK212 or mCPP. Acquisition of conditioned taste aversions was blocked by nonselective serotonin antagonists cyproheptadine, bromo-LSD, metergoline, methysergide and mianserin. Selective 5-HT(2B/2C) antagonist SB206,553 blocked both MK212- and mCPP-induced conditioned taste aversion although selective 5-HT(2B/2C) antagonist SB200,646 only blocked mCPP-induced conditioned taste aversion. In a single-bottle procedure, MK212, bromo-LSD, and mianserin failed to alter acquisition rate of a LiCl-induced conditioned taste aversion. Taken together, these data indicate that the serotonin agonists MK212 and mCPP produce conditioned taste aversion and that these effects are mediated predominantly through 5-HT(2C) receptors.

  11. Quantum chemical calculations of anion complex [B12Hx(NF2)12-x]2-, x = 9 - 12

    Science.gov (United States)

    Koblova, E. A.; Saldin, V. I.; Ustinov, A. Yu

    2017-01-01

    The geometric, energetic, spectral and electronic properties of various isomers of B12Hх(NF2)12-х 2- anion complex with x = 9 - 12 have been studied using Density Functional Theory (B3LYP/6-311++G**). It was shown that the most stable isomers are characterized by the preference to form the most symmetric structures with uniformly distributed charge densities. However, when replacing a hydrogen atom with difluoramino group, an inductive effect occurs. NF2 group pulls a part of electron density that leads to the polarization of the boron core. Blue shifts in the IR spectrum compared to the vibrations of the free radical NF2 ranging from 5 to 69 cm-1 for the most stable isomers with the minimum total energy are characteristic and points to the stability of B12Hх(NF2)12-х 2- anions. The obtained results broaden the idea of aromaticity of B12H12 2- anion and will be useful in synthesis of new B12H12 2- derivatives.

  12. MicroRNA-212 Regulates the Expression of Olfactomedin 1 and C-Terminal Binding Protein 1 in Human Endometrial Epithelial Cells to Enhance Spheroid Attachment In Vitro.

    Science.gov (United States)

    Kottawatta, Kottawattage S A; So, Kam-Hei; Kodithuwakku, Suranga P; Ng, Ernest H Y; Yeung, William S B; Lee, Kai-Fai

    2015-11-01

    Successful embryo implantation requires a synchronized dialogue between a competent blastocyst and the receptive endometrium, which occurs in a limited time period known as the "window of implantation." Recent studies suggested that down-regulation of olfactomedin 1 (OLFM1) in the endometrium and fallopian tube is associated with receptive endometrium and tubal ectopic pregnancy in humans. Interestingly, the human chorionic gonadotropin (hCG) induces miR-212 expression, which modulates OLFM1 and C-terminal binding protein 1 (CTBP1) expressions in mouse granulosa cells. Therefore, we hypothesized that embryo-derived hCG would increase miR-212 expression and down-regulate OLFM1 and CTBP1 expressions to favor embryo attachment onto the female reproductive tract. We found that hCG stimulated the expression of miR-212 and down-regulated OLFM1 but not CTBP1 mRNA in both human endometrial (Ishikawa) and fallopian (OE-E6/E7) epithelial cells. However, hCG suppressed the expression of OLFM1 and CTBP1 proteins in both cell lines. The 3'UTR of both OLFM1 and CTBP1 contained binding sites for miR-212. The miR-212 precursor suppressed luciferase expression, whereas the miR-212 inhibitor stimulated luciferase expression of the wild-type (WT)-OLFM1 and WT-CTBP1 reporter constructs. Furthermore, hCG (25 IU/ml) treatments stimulated trophoblastic (Jeg-3) spheroid (blastocyst surrogate) attachment onto Ishikawa and OE-E6/E7 cells. Transfection of miR-212 precursor increased Jeg-3 spheroid attachment onto Ishikawa cells and decreased OLFM1 and CTBP1 protein expressions, whereas the opposite occurred with miR-212 inhibitor. Taken together, hCG stimulated miR-212, which in turn down-regulated OLFM1 and CTBP1 expression in fallopian and endometrial epithelial cells to favor spheroid attachment. © 2015 by the Society for the Study of Reproduction, Inc.

  13. De-repression of FOXO3a death axis by microRNA-132 and -212 causes neuronal apoptosis in Alzheimer's disease.

    Science.gov (United States)

    Wong, Hon-Kit Andus; Veremeyko, Tatiana; Patel, Nehal; Lemere, Cynthia A; Walsh, Dominic M; Esau, Christine; Vanderburg, Charles; Krichevsky, Anna M

    2013-08-01

    Alzheimer's disease (AD) is a multifactorial and fatal neurodegenerative disorder for which the mechanisms leading to profound neuronal loss are incompletely recognized. MicroRNAs (miRNAs) are recently discovered small regulatory RNA molecules that repress gene expression and are increasingly acknowledged as prime regulators involved in human brain pathologies. Here we identified two homologous miRNAs, miR-132 and miR-212, downregulated in temporal cortical areas and CA1 hippocampal neurons of human AD brains. Sequence-specific inhibition of miR-132 and miR-212 induces apoptosis in cultured primary neurons, whereas their overexpression is neuroprotective against oxidative stress. Using primary neurons and PC12 cells, we demonstrate that miR-132/212 controls cell survival by direct regulation of PTEN, FOXO3a and P300, which are all key elements of AKT signaling pathway. Silencing of these three target genes by RNAi abrogates apoptosis caused by the miR-132/212 inhibition. We further demonstrate that mRNA and protein levels of PTEN, FOXO3a, P300 and most of the direct pro-apoptotic transcriptional targets of FOXO3a are significantly elevated in human AD brains. These results indicate that the miR-132/miR-212/PTEN/FOXO3a signaling pathway contributes to AD neurodegeneration.

  14. Scientific Opinion on Flavouring Group Evaluation 212 Revision 3 (FGE.212Rev3): α,β-unsaturated alicyclic ketones and precursors from chemical subgroup 2.6 of FGE.19

    DEFF Research Database (Denmark)

    Beltoft, Vibe Meister; Nørby, Karin Kristiane

    The Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids of the European Food Safety Authority was requested to evaluate the genotoxic potential of 22 flavouring substances from subgroup 2.6 of FGE.19 in the Flavouring Group Evaluation 212. Based on available genotoxicity data...... and new genotoxicity data submitted by the Industry, the Panel concluded that genotoxic potential could be ruled out for the six carvone derivatives [FL-no: 02.062, 07.146, 07.147, 09.143, 09.215 and 09.870], the 11 isophorone derivatives [FL-no: 02.083, 02.101, 07.035, 07.098, 07.126, 07.129, 07.172, 07...... supported by Industry. Based on the available data, all 22 substances of this FGE are no longer of concern with respect to genotoxicity and can be evaluated through the Procedure....

  15. Numerical Investigations of the Deposition of Unattached {sup 218}Po and {sup 212}Pb from Natural Convection Enclosure Flow

    Energy Technology Data Exchange (ETDEWEB)

    Nazaroff, W.W.; Kong, D.; Gadgil, A.J.

    1992-02-01

    We report numerical predictions of the deposition to enclosure surfaces of unattached {sup 218}Po and {sup 212}Pb, short-lived decay products of {sup 222}Rn and {sup 220}Rn, respectively. The simulations are conducted for square and rectangular two-dimensional enclosures under laminar natural convection flow with Grashof numbers in the range 7 x 10{sup 7} to 8 x 10{sup 10}. The predictions are based upon a finite-difference natural-convection fluid-mechanics model that has been extended to simulate the behavior of indoor radon decay products. In the absence of airborne particles, the deposition velocity averaged over the enclosure surface was found to be in the range (2-4) x 10{sup -4} m s{sup -1} for {sup 218}Po and (1-3) x 10{sup -4} m s{sup -1} for {sup 212}Pb. In each simulation, the deposition rate varied by more than an order of magnitude around the surface of the enclosure with the largest rates occurring near corners. Attachment of decay products to airborne particles increased the deposition velocity; for example, attachment of {sup 218}Po at a rate of 50 h{sup -1} increased the predicted average deposition velocity by 30-70% over values in the absence of attachment. The simulation results have significance for assessing the health risk associated with indoor exposure to {sup 222}Rn and {sup 220}Rn decay products and for investigating the more general problem of the interaction of air pollutants with indoor surfaces.

  16. Linkage analysis in keratoconus: replication of locus 5q21.2 and identification of other suggestive Loci.

    Science.gov (United States)

    Bisceglia, Luigi; De Bonis, Patrizia; Pizzicoli, Costantina; Fischetti, Lucia; Laborante, Antonio; Di Perna, Michele; Giuliani, Francesco; Delle Noci, Nicola; Buzzonetti, Luca; Zelante, Leopoldo

    2009-03-01

    Keratoconus (KC) is the most common indication for corneal transplantation in the Western world, with etiologic mechanisms still poorly understood. The disease prevalence in the general population is approximately 1:2000, and familial aggregation, together with increased familial risk, suggests important genetic influences on its pathogenesis. To date, several loci for familial keratoconus have been described, without the identification of any responsible gene in the respective mapped intervals. The aim of this study was to identify causative/susceptibility genes for keratoconus. A total of 133 individuals (77 affected and 59 unaffected) of 25 families from southern Italy were genotyped using microsatellite markers and included in a genome-wide scan. Nonparametric and parametric analysis using an affected-only strategy were calculated by using genetic algorithm software. The chromosomal regions 5q32-q33, 5q21.2, 14q11.2, 15q2.32 exhibited the strongest evidence of linkage by nonparametric analysis (NPL = 3.22, 2.73, 2.62, and 2.32, respectively). The regions 5q32-q33 and 14q11.2 were also supported by multipoint parametric analysis, for which heterogeneity LOD (HLOD) scores of 2.45 (alpha = 0.54) and 2.09 (alpha = 0.46), respectively, were obtained under an affected-only dominant model. This study represents the first KC linkage replication study on the chromosomal region 5q21.2 and reports evidence of suggestive linkage in several regions for which suggestive or significant linkage has been previously detected in different populations.

  17. Combined Antiproliferative Effects of the Aminoalkylindole WIN55,212-2 and Radiation in Breast Cancer Cells

    Science.gov (United States)

    Emery, Sean M.; Alotaibi, Moureq R.; Tao, Qing; Selley, Dana E.; Lichtman, Aron H.

    2014-01-01

    The potential antitumor activity of cannabinoid receptor agonists, such as the aminoalklylindole WIN55,212-2 (WIN2), has been studied extensively, but their potential interaction with conventional cancer therapies, such as radiation, remains unknown. In the present work, the influence of WIN2 on the antiproliferative activity of radiation in human (MCF-7 and MDA-MB231) and murine (4T1) breast cancer cells was investigated. The antiproliferative effects produced by combination of WIN2 and radiation were more effective than either agent alone. The stereoisomer of WIN2, WIN55,212-3 (WIN3), failed to inhibit growth or potentiate the growth-inhibitory effects of radiation, indicative of stereospecificity. Two other aminoalkylindoles, pravadoline and JWH-015 [(2-methyl-1-propyl-1H-indol-3-yl)-1-naphthalenyl-methanone], also enhanced the antiproliferative effects of radiation, but other synthetic cannabinoids (i.e., nabilone, CP55,940 [(+)-rel-5-(1,1-dimethylheptyl)-2-[(1R,2R,5R)-5-hydroxy-2-(3-hydroxypropyl)cyclohexyl]-phenol], and methanandamide) or phytocannabinoids [i.e., Δ9-tetrahydrocannabinol (THC) and cannabidiol] did not. The combination treatment of WIN2 + radiation promoted both autophagy and senescence but not apoptosis or necrosis. WIN2 also failed to alter radiation-induced DNA damage or the apparent rate of DNA repair. Although the antiproliferative actions of WIN2 were mediated through noncannabinoid receptor-mediated pathways, the observation that WIN2 interfered with growth stimulation by sphingosine-1-phosphate (S1P) implicates the potential involvement of S1P/ceramide signaling pathways. In addition to demonstrating that aminoalkylindole compounds could potentially augment the effectiveness of radiation treatment in breast cancer, the present study suggests that THC and nabilone are unlikely to interfere with the effectiveness of radiation therapy, which is of particular relevance to patients using cannabinoid-based drugs to ameliorate the toxicity of

  18. One-phonon octupole vibrational states in {sup 211}At, {sup 212}Rn, {sup 213}Fr and {sup 214}Ra with N = 126

    Energy Technology Data Exchange (ETDEWEB)

    Hwang, J.K.; Hamilton, J.H.; Ramayya, A.V. [Vanderbilt University, Physics Department, Nashville, TN (United States)

    2013-12-15

    Excited high spin states in {sup 211}At, {sup 212}Rn, {sup 213}Fr and {sup 214}Ra with N = 126 are reorganized and interpreted in terms of the stretched weak coupling of an octupole 3{sup -} phonon. Nearly identical sequences of levels with {Delta}I = 3 and the parity change are found, for the first time, up to 25{sup -} for 20 states of {sup 214}Ra, up to 35{sup -} for 36 states of {sup 212}Rn and up to 53/2{sup +} for 16 states of {sup 213}Fr. The stretched weak coupling of an octupole phonon is extended up to the highest excitation energy of 11355 keV for {sup 212}Rn which has the largest experimental B(E3) value of 44.1(88) W.u. for the 11{sup -} {yields} 8{sub 2}{sup +} transition. The stretched weak coupling of an octupole 3{sup -} phonon needs to be considered when single particle configurations are assigned to high spin states. Average octupole excitation energies of 657(51) keV for {sup 211}At, 1101(28) keV for {sup 212}Rn, 667(25) keV for {sup 213}Fr, and 709(25) keV for {sup 214}Ra are obtained. The calculated level energies are in a good agreement with the experimental level energies within the error limit of 4.3%. (orig.)

  19. Microwave-induced combustion synthesis and electrical properties of Ce 1- xSm xO 2-1/2 x ceramics

    Science.gov (United States)

    Fu, Yen-Pei; Lin, Cheng-Hsiung; Liu, Chung-Wen; Tay, Kok-Wan; Wen, Shaw-Bing

    Ce 1- xSm xO 2-1/2 x nanopowders were successfully synthesized by microwave-induced combustion process. For the preparation, cerium(III) nitrate hexahydrate, samarium(III) nitrate hexahydrate, and urea were used for the microwave-induced combustion process. The process took only a few minutes to obtain Ce 1- xSm xO 2-1/2 x powders. Ce 1- xSm xO 2-1/2 x ceramics prepared by microwave-induced process sintered at 1400 °C for 3 h, the bulk density of Ce 1- xSm xO 2-1/2 x ceramics were over 95% of the theoretical density. The results revealed that Ce 0.84Sm 0.16O 1.92 possessed the maximum electrical conductivity was 0.0287 S cm -1 at 850 °C and the minimum activity energy, E a was 0.9565 eV determined from 500 to 850 °C.

  20. Assessment of the lethal and sublethal effects of 20 environmental chemicals in zebrafish embryos and larvae by using OECD TG 212.

    Science.gov (United States)

    Horie, Yoshifumi; Yamagishi, Takahiro; Takahashi, Hiroko; Shintaku, Youko; Iguchi, Taisen; Tatarazako, Norihisa

    2017-10-01

    Fish embryo toxicity tests are used to assess the lethal and sublethal effects of environmental chemicals in aquatic organisms. Previously, we used a short-term toxicity test published by the Organization for Economic Co-operation and Development (test no. 212: Fish, Short-term Toxicity Test on Embryo and Sac-Fry Stages [OECD TG 212]) to assess the lethal and sublethal effects of aniline and several chlorinated anilines in zebrafish embryos and larvae. To expand upon this previous study, we used OECD TG 212 in zebrafish embryos and larvae to assess the lethal and sublethal effects of 20 additional environmental chemicals that included active pharmaceutical ingredients, pesticides, metals, aromatic compounds or chlorinated anilines. Zebrafish embryos (Danio rerio) were exposed to the test chemicals until 8 days post-fertilization. A delayed lethal effect was induced by 16 of the 20 test chemicals, and a positive correlation was found between heart rate turbulence and mortality. We also found that exposure to the test chemicals at concentrations lower than the lethal concentration induced the sublethal effects of edema, body curvature and absence of swim-bladder inflation. In conclusion, the environmental chemicals assessed in the present study induced both lethal and sublethal effects in zebrafish embryos and larvae, as assessed by using OECD TG 212. Copyright © 2017 John Wiley & Sons, Ltd. Copyright © 2017 John Wiley & Sons, Ltd.

  1. Polymorphisms in a Putative Enhancer at the 10q21.2 Breast Cancer Risk Locus Regulate NRBF2 Expression

    DEFF Research Database (Denmark)

    Darabi, Hatef; McCue, Karen; Beesley, Jonathan

    2015-01-01

    Genome-wide association studies have identified SNPs near ZNF365 at 10q21.2 that are associated with both breast cancer risk and mammographic density. To identify the most likely causal SNPs, we fine mapped the association signal by genotyping 428 SNPs across the region in 89,050 European and 12,...

  2. WIN 55,212-2, agonist of cannabinoid receptors, prevents amyloid β1-42 effects on astrocytes in primary culture.

    Directory of Open Access Journals (Sweden)

    Diana Aguirre-Rueda

    Full Text Available Alzheimer's disease (AD, a neurodegenerative illness involving synaptic dysfunction with extracellular accumulation of Aβ1-42 toxic peptide, glial activation, inflammatory response and oxidative stress, can lead to neuronal death. Endogenous cannabinoid system is implicated in physiological and physiopathological events in central nervous system (CNS, and changes in this system are related to many human diseases, including AD. However, studies on the effects of cannabinoids on astrocytes functions are scarce. In primary cultured astrocytes we studied cellular viability using MTT assay. Inflammatory and oxidative stress mediators were determined by ELISA and Western-blot techniques both in the presence and absence of Aβ1-42 peptide. Effects of WIN 55,212-2 (a synthetic cannabinoid on cell viability, inflammatory mediators and oxidative stress were also determined. Aβ1-42 diminished astrocytes viability, increased TNF-α and IL-1β levels and p-65, COX-2 and iNOS protein expression while decreased PPAR-γ and antioxidant enzyme Cu/Zn SOD. WIN 55,212-2 pretreatment prevents all effects elicited by Aβ1-42. Furthermore, cannabinoid WIN 55,212-2 also increased cell viability and PPAR-γ expression in control astrocytes. In conclusion cannabinoid WIN 55,212-2 increases cell viability and anti-inflammatory response in cultured astrocytes. Moreover, WIN 55,212-2 increases expression of anti-oxidant Cu/Zn SOD and is able to prevent inflammation induced by Aβ1-42 in cultured astrocytes. Further studies would be needed to assess the possible beneficial effects of cannabinoids in Alzheimer's disease patients.

  3. Juvenile myoclonic epilepsy locus in chromosome 6p21.2-p11: Linkage to convulsions and electroencephalography trait

    Energy Technology Data Exchange (ETDEWEB)

    Liu, A.W.; Delgado-Escueta, A.V.; Serratosa, J.M. [and others

    1995-08-01

    Despite affecting 4 million Americans and 100-200 million persons worldwide, the precise molecular mechanisms of human epilepsies remain unknown. Juvenile myoclonic epilepsy (JME) is the most frequent and, hence, most important form of hereditary grand mal epilepsy. In this epilepsy, electroencephalographic (EEG) 15-30 Hz multispikes produce myoclonic and tonic-clonic convulsions beginning at 8-20 years of age. Moreover, EEG 3.5-6 Hz multispike wave complexes appear in clinically asymptomatic family members. We first studied 38 members of a four-generation LA-Belize family with classical JME but with no pyknoleptic absences. Five living members had JME; four clinically asymptomatic members had EEG multispike wave complexes. Pairwise analysis tightly linked microsatellites centromeric to HLA, namely D6S272 (peak lod score [Z{sub max}]=3.564-3.560 at male-female recombination [{theta}{sub m=f}]=0-0.001) and D6S257 (Z{sub max}=3.672-3.6667 at {theta}{sub m=f}=0-0.001), spanning 7 cM, to convulsive seizures and EEG multispike wave complexes. A recombination between D6S276 and D6S273 in one affected member placed the JME locus within or below HLA. Pairwise, multipoint, and recombination analyses in this large family independently proved that a JME gene is located in chromsome 6p, centromeric to HLA. We next screened, with the same chromosome 6p21.2-p11 short tandem-repeat polymorphic markers, seven multiplex pedigrees with classic JME. When lod scores for small multiplex families are added to lod scores of the LA-Belize pedigree, Z{sub max} values for D6S294 and D6S257 are >7 ({theta}{sub m=f}=0.000). Our results prove that in chromosome 6p21.2-p11 an epilepsy locus exists whose phenotype consists of classic JME with convulsions and/or EEG rapid multispike wave complexes. 31 refs., 6 figs., 4 tabs.

  4. WIN 55,212-2 Inhibits the Epithelial Mesenchymal Transition of Gastric Cancer Cells via COX-2 Signals

    Directory of Open Access Journals (Sweden)

    Xiangshu Xian

    2016-11-01

    Full Text Available Background: Cannabinoids (the active components of Cannabis sativa and their derivatives have received considerable interest due to reports that they can affect the tumor growth, migration, and metastasis. Previous studies showed that the cannabinoid agonist WIN 55,212-2 (WIN was associated with gastric cancer (GC metastasis, but the mechanisms were unknown. Methods: The effects of WIN on GC cell migration and invasion were analyzed by the wound-healing assay and Transwell assay. Quantitative real-time PCR and Western blot were used to evaluate changes in expression of COX-2 and EMT associated markers in SGC7901 and AGS cells. Results: WIN inhibited cell migration, invasion, and epithelial to mesenchymal transition (EMT in GC. WIN treatment resulted in the downregulation of cyclooxygenase-2 (COX-2 expression and decreased the phosphorylation of AKT, and inhibited EMT in SGC7901 cells. Decreased expression of COX-2 and vimentin, and increased expression of E-cadherin, which was induced by WIN, were normalized by overexpression of AKT, suggesting that AKT mediated, at least partially, the WIN suppressed EMT of GC cells. Conclusion: WIN can inhibit the EMT of GC cells through the downregulation of COX-2.

  5. STIR Proposal For Research Area 2.1.2 Surface Energy Balance: Transient Soil Density Impacts Land Surface Characteristics and Characterization

    Science.gov (United States)

    2015-12-22

    properties, and ii) evaluate impact of changing soil density on surface energy balance and heat and water transfer. Six soil properties were...evaluated over a range of soil densities, using a combination of ten modeling approaches. Thermal conductivity, water characteristics, hydraulic ...2015 Approved for Public Release; Distribution Unlimited Final Report: STIR Proposal For Research Area 2.1.2 Surface Energy Balance: Transient Soil

  6. Patio 2.12: Vivienda prefabricada, sostenible, autosuficiente y energéticamente eficiente. Participación en la competición Solar Decathlon Europe 2012

    Directory of Open Access Journals (Sweden)

    Terrados-Cepeda, F. J.

    2015-06-01

    Full Text Available The prototype “Patio 2.12” was Andalucía Team’s proposal for the 2012 Solar Decathlon Competition (SDE 2012, that was held in Madrid during September 2012, where it was awarded several prizes like the first one in Energy Efficiency. The team comprised a group of teachers and students from four Andalusian Universities. It worked for two years in the design and construction of a housing prototype that could be an example of several concepts at the same time: energy efficiency, architectural integration of solar systems, intermediate scale of prefabrication and a today´s interpretation of traditional Mediterranean way of living and building. Patio 2.12 was intended to be a compendium of energy, sustainability and passive conditioning devices.El prototipo Patio 2.12 fue la propuesta del equipo Andalucía Team para la competición Solar Decathlon Europe 2012 (SDE 2012, celebrada en Madrid en septiembre de 2012, en la que recibió hasta 9 premios, entre los que figura el de Eficiencia Energética. El equipo, integrado por profesores y alumnos de cuatro universidades andaluzas, trabajó durante dos años en el diseño y construcción de un prototipo de vivienda basada en la eficiencia energética, en la integración arquitectónica de los sistemas solares, en la prefabricación de escala intermedia y en una reinterpretación de la forma de vivir y construir de la tradición mediterránea. Patio 2.12 pretende ser un compendio de energía, sostenibilidad y mecanismos de acondicionamiento pasivo.

  7. Additional patient with del(12)(q21.2q22): further evidence for a candidate region for cardio-facio-cutaneous syndrome?

    Science.gov (United States)

    Rauen, Katherine A; Albertson, Donna G; Pinkel, Daniel; Cotter, Philip D

    2002-06-01

    Cardio-facio-cutaneous (CFC) syndrome is characterized by a distinct facial appearance, cardiac defects, ectodermal anomalies and developmental delay. Recently, we reported a 19-month-old girl with phenotypic manifestations consistent with the CFC syndrome who had an interstitial deletion of the long arm of chromosome 12, del(12)(q21.2q22), implicating a possible locus for CFC syndrome. Here, we report an additional patient with a cytogenetically identical interstitial deletion: 47,XYY,del(12)(q21.2q22). To further characterize this deletion we used microarray-based comparative genomic hybridization (array CGH). Array CGH confirmed both the deletion and the second Y chromosome. The deletion on chromosome 12q spanned at least 14 Mb as indicated by the positions on the genome sequence of the 4 BAC clones included in the deletion. While the proband did not have the classic features of CFC, he had some dysmorphic craniofacial characteristics, ectodermal anomalies and moderate developmental delay which were suggestive of CFC syndrome; however, this patient did not have classical CFC. The phenotypic differences between the two del(12)(q21.2q22) patients may be due to variability in the expression of the syndrome, or this deletion may present as a syndrome with overlapping features. Alternatively, the phenotypic differences may result from discordance at the molecular level, which may yield a critical minimal region of deletion for CFC. The region 12q21.2 --> q22 remains a possible candidate region for CFC syndrome. Additional characterization of these and other CFC patients may confirm and further refine this candidate region. Copyright 2002 Wiley-Liss, Inc.

  8. The synthetic cannabinoid WIN-55,212 induced-apoptosis in cytotrophoblasts cells by a mechanism dependent on CB1 receptor.

    Science.gov (United States)

    Almada, Marta; Costa, Lia; Fonseca, Bruno Miguel; Amaral, Cristina; Teixeira, Natércia; Correia-da-Silva, Georgina

    2017-06-15

    The endocannabinoid system has evolved as a key regulator in several pathological and physiological processes, including placentation, decidualization and implantation. In addition, it is known that Cannabis and cannabinoids negatively affect female reproduction. Although, the biological action of synthetic cannabinoids, such as WIN-55,212, in human fertility and pregnancy outcome remain to be unveiled. A tight balance between proliferation, differentiation and apoptosis of trophoblast cells is required for placental development and pregnancy outcome. Therefore, in this work, the effects of the synthetic cannabinoid WIN-55,212 in placental cytotrophoblast cells were explored. For that, it was used a human choriocarcinoma cell line, BeWo cells, and primary cultures of human cytotrophoblasts isolated from term placentas. Results demonstrate that this synthetic cannabinoid induces cell cycle arrest. We also observed that cell viability loss was associated with a disruption of mitochondrial membrane potential and activation of caspases -9 and -3/-7 independently of reactive oxygen species (ROS) production or recruitment of the endoplasmic reticulum stress marker CHOP. Moreover, these effects were prevented by pre-incubation with a selective cannabinoid receptor 1 (CBR1) antagonist (AM281). Thus, our results provide strong evidences of the apoptotic process induced by WIN-55,212 through the activation of the CBR1, which may reveal the impact of cannabinoids consumption during placental development. Copyright © 2017 Elsevier B.V. All rights reserved.

  9. Calibration of the E Si detector in a DE-E telescope with a ^212Pb pin source

    Science.gov (United States)

    Chan, Ka Pang

    2012-10-01

    In nuclear physics experiments, telescopes composed of two or more large area silicon strip detectors are used to identify charged particles. To use the energy loss method for particle identification, a thin (˜0.065mm) silicon detector (DE) is mounted in front of a thicker E detector (˜1.5 mm). The DE Si detector can be calibrated with 8.785, 6.778, 6.288, 5.685 and 5.423 MeV alpha particles emitted from a ^228Th source. However, this method cannot be used to calibrate the E detector as the alpha particles cannot penetrate the front DE detector. We have developed a method to calibrate the E detector by inserting a small irradiated dowel pin between the two Si detectors. The pin source is electroplated with ^212Pb nuclei which emit alpha particles with 8.785 MeV, 6.090 and 6.051 MeV. Insertion of the dowel pin is designed and guided so that the head of the pin lies near the center of the detector at a distance of 2.72 mm away from the surface of the E detector. In addition to providing two strong alpha peaks for calibrations, the close distance and high pixilation of the E detector allows accurate determination of the front dead layer of the E Si strip detector. This technique has been implemented successfully in calibrating the E Si detectors in the NSCL High Resolution Array (HiRA) consisting of 20 closely pack DE-E-CsI telescopes.

  10. Poly[[(μ2-but-2-ynedioato[μ2-1,2-(pyridin-4-ylethylene]zinc(II] dihydrate

    Directory of Open Access Journals (Sweden)

    Do Nam Lee

    2017-11-01

    Full Text Available In the title compound, poly[[(μ2-oxalato[μ2-1,2-(pyridin-4-ylethylene]zinc(II] dihydrate], {[Zn(μ2-C4O4(μ2-C12H10N2]·2H2O}n, 2-butyndioate and 1,2-bis(pyridin-4-ylethylene ligands bridge ZnII ions to form a three-dimensional network. The three-dimensional networks are fivefold interpenetrated, and each network features a 4-connected unimodal net with a Schläfli symbol of 66 (dia with the ZnII ions as the nodes. Twofold rotation axes are located at the ZnII ions and the midpoints of the C[triple-bond]C bond of 2-butyndioate and the C=C bond of 1,2-bis(pyridin-4-ylethylene. The coordination geometry around the ZnII ions is tetrahedral constructed from two O atoms from 2-butyndioate and two N atoms from 1,2-bis(pyridin-4-ylethylene. Solvate water molecules are connected with each other via hydrogen bonds to create chains running parallel to [010] that are captured in infinite channels of the three-dimensional framework through hydrogen bonds to the non-coordinating carboxylate O atoms of the 2-butyndioate units. The water molecules are disordered, with two alternative positions that are distinguished by the direction of the chains, but that share the H atom hydrogen bonded to the carboxylate O atom.

  11. Predictors of shingles reports at diagnosis of common variable immunodeficiency and selective immunoglobulin G subclass deficiency in 212 Alabama adults

    Directory of Open Access Journals (Sweden)

    James C. Barton

    2012-07-01

    Full Text Available We sought to determine predictors of shingles reports in adults with common variable immunodeficiency or immunoglobulin (Ig G subclass deficiency (CVID/IgGSD. We tabulated observations at diagnosis of CVID/IgGSD in 212 white adult index patients (165 women, 47 men who responded to a question about having had shingles. None had been vaccinated for herpes zoster. We analyzed age, sex, and shingles reports; blood levels of CD19+, CD4+, CD8+, and CD56+ mononuclear cells; serum levels of IgG subclasses, IgA, and IgM; and positivity for human leukocyte antigen (HLA-A and -B haplotypes. Cell counts and immunoglobulin levels were normalized with loge (ln transformation for analyses. Thirty-one patients (14.6% reported shingles; 11 reported recurrent or disseminated shingles. Patients with shingles reports had greater mean age at diagnosis of CVID/IgGSD [54±13 (standard deviation years vs. 47±12 years; P=0.0130] and a greater prevalence of HLA-A*01, B*08 positivity (35.5% vs. 17.7%; P=0.0227. In a 13-factor logistic regression model, there was a positive association of age with shingles reports [P=0.0151; odds ratio (1.05, 95% confidence interval 1.01, 1.08]. HLA-A*01, B*08 positivity was also positively associated with shingles reports [P=0.0480; odds ratio 2.61 (1.00, 6.81]. During a mean followup interval of 7.5 years after CVID/IgGSD diagnosis, the prevalence of recurrent shingles was almost five-fold greater in patients with previous shingles reports. In conclusion, in white adults at CVID/IgGSD diagnosis, age at diagnosis and positivity for HLA-A*01, B*08 have significant positive associations with reports of previous shingles.

  12. The cannabinoid WIN 55,212-2 prevents neuroendocrine differentiation of LNCaP prostate cancer cells.

    Science.gov (United States)

    Morell, C; Bort, A; Vara, D; Ramos-Torres, A; Rodríguez-Henche, N; Díaz-Laviada, I

    2016-09-01

    Neuroendocrine (NE) differentiation represents a common feature of prostate cancer and is associated with accelerated disease progression and poor clinical outcome. Nowadays, there is no treatment for this aggressive form of prostate cancer. The aim of this study was to determine the influence of the cannabinoid WIN 55,212-2 (WIN, a non-selective cannabinoid CB1 and CB2 receptor agonist) on the NE differentiation of prostate cancer cells. NE differentiation of prostate cancer LNCaP cells was induced by serum deprivation or by incubation with interleukin-6, for 6 days. Levels of NE markers and signaling proteins were determined by western blotting. Levels of cannabinoid receptors were determined by quantitative PCR. The involvement of signaling cascades was investigated by pharmacological inhibition and small interfering RNA. The differentiated LNCaP cells exhibited neurite outgrowth, and increased the expression of the typical NE markers neuron-specific enolase and βIII tubulin (βIII Tub). Treatment with 3 μM WIN inhibited NK differentiation of LNCaP cells. The cannabinoid WIN downregulated the PI3K/Akt/mTOR signaling pathway, resulting in NE differentiation inhibition. In addition, an activation of AMP-activated protein kinase (AMPK) was observed in WIN-treated cells, which correlated with a decrease in the NE markers expression. Our results also show that during NE differentiation the expression of cannabinoid receptors CB1 and CB2 dramatically decreases. Taken together, we demonstrate that PI3K/Akt/AMPK might be an important axis modulating NE differentiation of prostate cancer that is blocked by the cannabinoid WIN, pointing to a therapeutic potential of cannabinoids against NE prostate cancer.

  13. 212__Omoniyi-LOKOJA

    African Journals Online (AJOL)

    User

    Correspondence .... Determination of the Soil Physico-chemical. Properties. The soil pH in the suspension was determined using the method of Black (1965), textural class as adopted ..... and wastes, mine tailings, coal and bottom fly ash, fertilizers) are ...

  14. Parcels and Land Ownership, Blocks-The data set is a polygon feature consisting of 212 polygons representing city block boundaries. It was created to maintain land ownership., Published in 2008, Davis County Government.

    Data.gov (United States)

    NSGIC Local Govt | GIS Inventory — Parcels and Land Ownership dataset current as of 2008. Blocks-The data set is a polygon feature consisting of 212 polygons representing city block boundaries. It was...

  15. Polymorphisms in a Putative Enhancer at the 10q21.2 Breast Cancer Risk Locus Regulate NRBF2 Expression

    Science.gov (United States)

    Darabi, Hatef; McCue, Karen; Beesley, Jonathan; Michailidou, Kyriaki; Nord, Silje; Kar, Siddhartha; Humphreys, Keith; Thompson, Deborah; Ghoussaini, Maya; Bolla, Manjeet K.; Dennis, Joe; Wang, Qin; Canisius, Sander; Scott, Christopher G.; Apicella, Carmel; Hopper, John L.; Southey, Melissa C.; Stone, Jennifer; Broeks, Annegien; Schmidt, Marjanka K.; Scott, Rodney J.; Lophatananon, Artitaya; Muir, Kenneth; Beckmann, Matthias W.; Ekici, Arif B.; Fasching, Peter A.; Heusinger, Katharina; dos-Santos-Silva, Isabel; Peto, Julian; Tomlinson, Ian; Sawyer, Elinor J.; Burwinkel, Barbara; Marme, Frederik; Guénel, Pascal; Truong, Thérèse; Bojesen, Stig E.; Flyger, Henrik; Benitez, Javier; González-Neira, Anna; Anton-Culver, Hoda; Neuhausen, Susan L.; Arndt, Volker; Brenner, Hermann; Engel, Christoph; Meindl, Alfons; Schmutzler, Rita K.; Arnold, Norbert; Brauch, Hiltrud; Hamann, Ute; Chang-Claude, Jenny; Khan, Sofia; Nevanlinna, Heli; Ito, Hidemi; Matsuo, Keitaro; Bogdanova, Natalia V.; Dörk, Thilo; Lindblom, Annika; Margolin, Sara; Kosma, Veli-Matti; Mannermaa, Arto; Tseng, Chiu-chen; Wu, Anna H.; Floris, Giuseppe; Lambrechts, Diether; Rudolph, Anja; Peterlongo, Paolo; Radice, Paolo; Couch, Fergus J.; Vachon, Celine; Giles, Graham G.; McLean, Catriona; Milne, Roger L.; Dugué, Pierre-Antoine; Haiman, Christopher A.; Maskarinec, Gertraud; Woolcott, Christy; Henderson, Brian E.; Goldberg, Mark S.; Simard, Jacques; Teo, Soo H.; Mariapun, Shivaani; Helland, Åslaug; Haakensen, Vilde; Zheng, Wei; Beeghly-Fadiel, Alicia; Tamimi, Rulla; Jukkola-Vuorinen, Arja; Winqvist, Robert; Andrulis, Irene L.; Knight, Julia A.; Devilee, Peter; Tollenaar, Robert A.E.M.; Figueroa, Jonine; García-Closas, Montserrat; Czene, Kamila; Hooning, Maartje J.; Tilanus-Linthorst, Madeleine; Li, Jingmei; Gao, Yu-Tang; Shu, Xiao-Ou; Cox, Angela; Cross, Simon S.; Luben, Robert; Khaw, Kay-Tee; Choi, Ji-Yeob; Kang, Daehee; Hartman, Mikael; Lim, Wei Yen; Kabisch, Maria; Torres, Diana; Jakubowska, Anna; Lubinski, Jan; McKay, James; Sangrajrang, Suleeporn; Toland, Amanda E.; Yannoukakos, Drakoulis; Shen, Chen-Yang; Yu, Jyh-Cherng; Ziogas, Argyrios; Schoemaker, Minouk J.; Swerdlow, Anthony; Borresen-Dale, Anne-Lise; Kristensen, Vessela; French, Juliet D.; Edwards, Stacey L.; Dunning, Alison M.; Easton, Douglas F.; Hall, Per; Chenevix-Trench, Georgia

    2015-01-01

    Genome-wide association studies have identified SNPs near ZNF365 at 10q21.2 that are associated with both breast cancer risk and mammographic density. To identify the most likely causal SNPs, we fine mapped the association signal by genotyping 428 SNPs across the region in 89,050 European and 12,893 Asian case and control subjects from the Breast Cancer Association Consortium. We identified four independent sets of correlated, highly trait-associated variants (iCHAVs), three of which were located within ZNF365. The most strongly risk-associated SNP, rs10995201 in iCHAV1, showed clear evidence of association with both estrogen receptor (ER)-positive (OR = 0.85 [0.82–0.88]) and ER-negative (OR = 0.87 [0.82–0.91]) disease, and was also the SNP most strongly associated with percent mammographic density. iCHAV2 (lead SNP, chr10: 64,258,684:D) and iCHAV3 (lead SNP, rs7922449) were also associated with ER-positive (OR = 0.93 [0.91–0.95] and OR = 1.06 [1.03–1.09]) and ER-negative (OR = 0.95 [0.91–0.98] and OR = 1.08 [1.04–1.13]) disease. There was weaker evidence for iCHAV4, located 5′ of ADO, associated only with ER-positive breast cancer (OR = 0.93 [0.90–0.96]). We found 12, 17, 18, and 2 candidate causal SNPs for breast cancer in iCHAVs 1–4, respectively. Chromosome conformation capture analysis showed that iCHAV2 interacts with the ZNF365 and NRBF2 (more than 600 kb away) promoters in normal and cancerous breast epithelial cells. Luciferase assays did not identify SNPs that affect transactivation of ZNF365, but identified a protective haplotype in iCHAV2, associated with silencing of the NRBF2 promoter, implicating this gene in the etiology of breast cancer. PMID:26073781

  16. Consequences of Adolescent Exposure to the Cannabinoid Receptor Agonist WIN55,212-2 on Working Memory in Female Rats.

    Science.gov (United States)

    Kirschmann, Erin K; McCalley, Daniel M; Edwards, Caitlyn M; Torregrossa, Mary M

    2017-01-01

    Marijuana is a prevalent illicit substance used by adolescents, and several studies have indicated that adolescent use can lead to long-term cognitive deficits including problems with attention and memory. However, preclinical animal studies that observe cognitive deficits after cannabinoid exposure during adolescence utilize experimenter administration of doses of cannabinoids that may exceed what an organism would choose to take, suggesting that contingency and dose are critical factors that need to be addressed in translational models of consequences of cannabinoid exposure. Indeed, we recently developed an adolescent cannabinoid self-administration paradigm in male rats, and found that prior adolescent self-administration of the cannabinoid receptor agonist WIN55,212-2 (WIN) resulted in improved working memory performance in adulthood. In addition, the doses self-administered were not as high as those that are found to produce memory deficits. However, given known sex differences in both drug self-administration and learning and memory processes, it is possible that cannabinoid self-administration could have different cognitive consequences in females. Therefore, we aimed to explore the effects of self-administered vs. experimenter-administered WIN in adolescent female rats on adult cognitive function. Female rats were trained to self-administer WIN daily throughout adolescence (postnatal day 34-59). A control group self-administered vehicle solution. The acute effects of adolescent WIN self-administration on memory were determined using a short-term spatial memory test 24 h after final SA session; and the long-term effects on cognitive performance were assessed during protracted abstinence in adulthood using a delayed-match-to-sample working memory task. In a separate experiment, females were given daily intraperitoneal (IP) injections of a low or high dose of WIN, corresponding to self-administered and typical experimenter-administered doses, respectively, or

  17. Consequences of Adolescent Exposure to the Cannabinoid Receptor Agonist WIN55,212-2 on Working Memory in Female Rats

    Directory of Open Access Journals (Sweden)

    Erin K. Kirschmann

    2017-07-01

    Full Text Available Marijuana is a prevalent illicit substance used by adolescents, and several studies have indicated that adolescent use can lead to long-term cognitive deficits including problems with attention and memory. However, preclinical animal studies that observe cognitive deficits after cannabinoid exposure during adolescence utilize experimenter administration of doses of cannabinoids that may exceed what an organism would choose to take, suggesting that contingency and dose are critical factors that need to be addressed in translational models of consequences of cannabinoid exposure. Indeed, we recently developed an adolescent cannabinoid self-administration paradigm in male rats, and found that prior adolescent self-administration of the cannabinoid receptor agonist WIN55,212-2 (WIN resulted in improved working memory performance in adulthood. In addition, the doses self-administered were not as high as those that are found to produce memory deficits. However, given known sex differences in both drug self-administration and learning and memory processes, it is possible that cannabinoid self-administration could have different cognitive consequences in females. Therefore, we aimed to explore the effects of self-administered vs. experimenter-administered WIN in adolescent female rats on adult cognitive function. Female rats were trained to self-administer WIN daily throughout adolescence (postnatal day 34–59. A control group self-administered vehicle solution. The acute effects of adolescent WIN self-administration on memory were determined using a short-term spatial memory test 24 h after final SA session; and the long-term effects on cognitive performance were assessed during protracted abstinence in adulthood using a delayed-match-to-sample working memory task. In a separate experiment, females were given daily intraperitoneal (IP injections of a low or high dose of WIN, corresponding to self-administered and typical experimenter

  18. P212A Mutant of Dihydrodaidzein Reductase Enhances (S)-Equol Production and Enantioselectivity in a Recombinant Escherichia coli Whole-Cell Reaction System.

    Science.gov (United States)

    Lee, Pyung-Gang; Kim, Joonwon; Kim, Eun-Jung; Jung, EunOk; Pandey, Bishnu Prasad; Kim, Byung-Gee

    2016-01-22

    (S)-Equol, a gut bacterial isoflavone derivative, has drawn great attention because of its potent use for relieving female postmenopausal symptoms and preventing prostate cancer. Previous studies have reported on the dietary isoflavone metabolism of several human gut bacteria and the involved enzymes for conversion of daidzein to (S)-equol. However, the anaerobic growth conditions required by the gut bacteria and the low productivity and yield of (S)-equol limit its efficient production using only natural gut bacteria. In this study, the low (S)-equol biosynthesis of gut microorganisms was overcome by cloning the four enzymes involved in the biosynthesis from Slackia isoflavoniconvertens into Escherichia coli BL21(DE3). The reaction conditions were optimized for (S)-equol production from the recombinant strain, and this recombinant system enabled the efficient conversion of 200 μM and 1 mM daidzein to (S)-equol under aerobic conditions, achieving yields of 95% and 85%, respectively. Since the biosynthesis of trans-tetrahydrodaidzein was found to be a rate-determining step for (S)-equol production, dihydrodaidzein reductase (DHDR) was subjected to rational site-directed mutagenesis. The introduction of the DHDR P212A mutation increased the (S)-equol productivity from 59.0 mg/liter/h to 69.8 mg/liter/h in the whole-cell reaction. The P212A mutation caused an increase in the (S)-dihydrodaidzein enantioselectivity by decreasing the overall activity of DHDR, resulting in undetectable activity for (R)-dihydrodaidzein, such that a combination of the DHDR P212A mutant with dihydrodaidzein racemase enabled the production of (3S,4R)-tetrahydrodaidzein with an enantioselectivity of >99%. Copyright © 2016, American Society for Microbiology. All Rights Reserved.

  19. Small Deletion at the 7q21.2 Locus in a CCM Family Detected by Real-Time Quantitative PCR

    Directory of Open Access Journals (Sweden)

    Lucia Anna Muscarella

    2010-01-01

    Full Text Available Cerebral cavernous malformations (CCMs represent a common autosomal dominant disorder that predisposes patients to haemorrhagic strokes and focal neurological signs. About 56% of the hereditary forms of CCMs have been so far associated with mutations in the KRIT1 (Krev Interaction Trapped 1 gene, located at 7q21.2 (CCM1 locus. We described the complete loss of 7q21.2 locus encompassing the KRIT1 gene and 4 flanking genes in a CCM family by using a dense set of 12 microsatellite markers. The complete loss of the maternal copy of KRIT1 gene region was confirmed by Real-Time Quantitative Polymerase Chain Reaction (RT-QPCR and the same approach was used for expression analysis. Additional RT-QPCR analysis showed the extension of the deletion, for a total of 700 kb, to the adjacent downstream and upstream-located genes, MTERF, AKAP9, CYP51A1, as well as a partial loss of the ANKIB1 gene. Here we report the molecular characterization of an interstitial small genomic deletion of the 7q21.2 region in a CCMs affected family, encompassing the KRIT1 gene. Our findings confirm the loss of function mechanism for the already known CCM1 locus, without any evident involvement of the other deleted genes. Moreover, our investigations highlight the usefulness of the RT-QPCR to the molecular characterization of the breakpoints genomic deletions and to the identification of internal deleted genes involved in the human genetic diseases.

  20. P212A Mutant of Dihydrodaidzein Reductase Enhances (S)-Equol Production and Enantioselectivity in a Recombinant Escherichia coli Whole-Cell Reaction System

    Science.gov (United States)

    Lee, Pyung-Gang; Kim, Joonwon; Kim, Eun-Jung; Jung, EunOk; Pandey, Bishnu Prasad

    2016-01-01

    (S)-Equol, a gut bacterial isoflavone derivative, has drawn great attention because of its potent use for relieving female postmenopausal symptoms and preventing prostate cancer. Previous studies have reported on the dietary isoflavone metabolism of several human gut bacteria and the involved enzymes for conversion of daidzein to (S)-equol. However, the anaerobic growth conditions required by the gut bacteria and the low productivity and yield of (S)-equol limit its efficient production using only natural gut bacteria. In this study, the low (S)-equol biosynthesis of gut microorganisms was overcome by cloning the four enzymes involved in the biosynthesis from Slackia isoflavoniconvertens into Escherichia coli BL21(DE3). The reaction conditions were optimized for (S)-equol production from the recombinant strain, and this recombinant system enabled the efficient conversion of 200 μM and 1 mM daidzein to (S)-equol under aerobic conditions, achieving yields of 95% and 85%, respectively. Since the biosynthesis of trans-tetrahydrodaidzein was found to be a rate-determining step for (S)-equol production, dihydrodaidzein reductase (DHDR) was subjected to rational site-directed mutagenesis. The introduction of the DHDR P212A mutation increased the (S)-equol productivity from 59.0 mg/liter/h to 69.8 mg/liter/h in the whole-cell reaction. The P212A mutation caused an increase in the (S)-dihydrodaidzein enantioselectivity by decreasing the overall activity of DHDR, resulting in undetectable activity for (R)-dihydrodaidzein, such that a combination of the DHDR P212A mutant with dihydrodaidzein racemase enabled the production of (3S,4R)-tetrahydrodaidzein with an enantioselectivity of >99%. PMID:26801575

  1. The Endocannabinoid/Endovanilloid N-Arachidonoyl Dopamine (NADA) and Synthetic Cannabinoid WIN55,212-2 Abate the Inflammatory Activation of Human Endothelial Cells*

    Science.gov (United States)

    Wilhelmsen, Kevin; Khakpour, Samira; Tran, Alphonso; Sheehan, Kayla; Schumacher, Mark; Xu, Fengyun; Hellman, Judith

    2014-01-01

    Although cannabinoids, such as Δ9-tetrahydrocannabinol, have been studied extensively for their psychoactive effects, it has become apparent that certain cannabinoids possess immunomodulatory activity. Endothelial cells (ECs) are centrally involved in the pathogenesis of organ injury in acute inflammatory disorders, such as sepsis, because they express cytokines and chemokines, which facilitate the trafficking of leukocytes to organs, and they modulate vascular barrier function. In this study, we find that primary human ECs from multiple organs express the cannabinoid receptors CB1R, GPR18, and GPR55, as well as the ion channel transient receptor potential cation channel vanilloid type 1. In contrast to leukocytes, CB2R is only minimally expressed in some EC populations. Furthermore, we show that ECs express all of the known endocannabinoid (eCB) metabolic enzymes. Examining a panel of cannabinoids, we demonstrate that the synthetic cannabinoid WIN55,212-2 and the eCB N-arachidonoyl dopamine (NADA), but neither anandamide nor 2-arachidonoylglycerol, reduce EC inflammatory responses induced by bacterial lipopeptide, LPS, and TNFα. We find that endothelial CB1R/CB2R are necessary for the effects of NADA, but not those of WIN55,212-2. Furthermore, transient receptor potential cation channel vanilloid type 1 appears to counter the anti-inflammatory properties of WIN55,212-2 and NADA, but conversely, in the absence of these cannabinoids, its inhibition exacerbates the inflammatory response in ECs activated with LPS. These data indicate that the eCB system can modulate inflammatory activation of the endothelium and may have important implications for a variety of acute inflammatory disorders that are characterized by EC activation. PMID:24644287

  2. The endocannabinoid/endovanilloid N-arachidonoyl dopamine (NADA) and synthetic cannabinoid WIN55,212-2 abate the inflammatory activation of human endothelial cells.

    Science.gov (United States)

    Wilhelmsen, Kevin; Khakpour, Samira; Tran, Alphonso; Sheehan, Kayla; Schumacher, Mark; Xu, Fengyun; Hellman, Judith

    2014-05-09

    Although cannabinoids, such as Δ(9)-tetrahydrocannabinol, have been studied extensively for their psychoactive effects, it has become apparent that certain cannabinoids possess immunomodulatory activity. Endothelial cells (ECs) are centrally involved in the pathogenesis of organ injury in acute inflammatory disorders, such as sepsis, because they express cytokines and chemokines, which facilitate the trafficking of leukocytes to organs, and they modulate vascular barrier function. In this study, we find that primary human ECs from multiple organs express the cannabinoid receptors CB1R, GPR18, and GPR55, as well as the ion channel transient receptor potential cation channel vanilloid type 1. In contrast to leukocytes, CB2R is only minimally expressed in some EC populations. Furthermore, we show that ECs express all of the known endocannabinoid (eCB) metabolic enzymes. Examining a panel of cannabinoids, we demonstrate that the synthetic cannabinoid WIN55,212-2 and the eCB N-arachidonoyl dopamine (NADA), but neither anandamide nor 2-arachidonoylglycerol, reduce EC inflammatory responses induced by bacterial lipopeptide, LPS, and TNFα. We find that endothelial CB1R/CB2R are necessary for the effects of NADA, but not those of WIN55,212-2. Furthermore, transient receptor potential cation channel vanilloid type 1 appears to counter the anti-inflammatory properties of WIN55,212-2 and NADA, but conversely, in the absence of these cannabinoids, its inhibition exacerbates the inflammatory response in ECs activated with LPS. These data indicate that the eCB system can modulate inflammatory activation of the endothelium and may have important implications for a variety of acute inflammatory disorders that are characterized by EC activation.

  3. Étude des dommages induits dans l'ADN par irradiation laser X-UV à 21.2 nm

    Science.gov (United States)

    Cassou, K.; Ros, D.; Kazamias, S.; Klisnick, A.; Jamelot, G.; Guilbaud, O.; Rus, B.; Kozlová, M.; Polan, J.; Präg, A. R.; Stupka, M.; Eot-Houllier, G.; Sage, E.; Begusová, M.; Stísová, V.; Du Penhoat, M.-A. H.; Touati, A.; Chétioui, A.

    2005-06-01

    We report the preliminary result of the application of the collisional Ne-like soft x-ray laser as radiation source to induce DNA damage. The goal of this experiment was a test bed study of the damage yields induced by soft x-ray radiation in dried plasmid DNA sample. The saturated Ne-like soft x-ray laser available at the PALS facility, delivering several millijoules in a single 100 ps pulse at 21.2 nm was used to irradiate two different plasmids: pSP189 and pBS. The study is centered on the dose effect leading to single and double strand break in DNA.

  4. Measuring Progress on the Control of Porcine Reproductive and Respiratory Syndrome (PRRS at a Regional Level: The Minnesota N212 Regional Control Project (Rcp as a Working Example.

    Directory of Open Access Journals (Sweden)

    Pablo Valdes-Donoso

    Full Text Available Due to the highly transmissible nature of porcine reproductive and respiratory syndrome (PRRS, implementation of regional programs to control the disease may be critical. Because PRRS is not reported in the US, numerous voluntary regional control projects (RCPs have been established. However, the effect of RCPs on PRRS control has not been assessed yet. This study aims to quantify the extent to which RCPs contribute to PRRS control by proposing a methodological framework to evaluate the progress of RCPs. Information collected between July 2012 and June 2015 from the Minnesota Voluntary Regional PRRS Elimination Project (RCP-N212 was used. Demography of premises (e.g. composition of farms with sows = SS and without sows = NSS was assessed by a repeated analysis of variance. By using general linear mixed-effects models, active participation of farms enrolled in the RCP-N212, defined as the decision to share (or not to share PRRS status, was evaluated and used as a predictor, along with other variables, to assess the PRRS trend over time. Additionally, spatial and temporal patterns of farmers' participation and the disease dynamics were investigated. The number of farms enrolled in RCP-N212 and its geographical coverage increased, but the proportion of SS and NSS did not vary significantly over time. A significant increasing (p<0.001 trend in farmers' decision to share PRRS status was observed, but with NSS producers less willing to report and a large variability between counties. The incidence of PRRS significantly (p<0.001 decreased, showing a negative correlation between degree of participation and occurrence of PRRS (p<0.001 and a positive correlation with farm density at the county level (p = 0.02. Despite a noted decrease in PRRS, significant spatio-temporal patterns of incidence of the disease over 3-weeks and 3-kms during the entire study period were identified. This study established a systematic approach to quantify the effect of RCPs on

  5. EFSA CEF Penal (EFSA Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids), 2014. Scientific Opinion on Flavouring Group Evaluation 212, Revision 2 (FGE.212Rev2): α,β-Unsaturated alicyclic ketones and precursors from chemical subgroup 2.6 of FGE.19

    DEFF Research Database (Denmark)

    Beltoft, Vibe Meister; Binderup, Mona-Lise; Lund, Pia

    The Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids of the European Food Safety Authority was requested to evaluate the genotoxic potential of 24 flavouring substances from subgroup 2.6 of FGE.19 in the Flavouring Group Evaluation 212, Revision 2. The Panel concluded...... genotoxicity data from the Industry, the Panel concluded that the genotoxic potential could be ruled out for the 11 isophorone derivatives [FL-no: 02.083, 02.101, 07.035, 07.098, 07.126, 07.129, 07.172, 07.175, 07.196, 07.202 and 07.255] and the two vetiveryl derivatives [FL-no: 02.214 and 09.821] in FGE.212...

  6. Electrostatics of the photosynthetic bacterial reaction center. Protonation of Glu L 212 and Asp L 213 - A new method of calculation.

    Science.gov (United States)

    Ptushenko, Vasily V; Cherepanov, Dmitry A; Krishtalik, Lev I

    2015-12-01

    Continuum electrostatic calculation of the transfer energies of anions from water into aprotic solvents gives the figures erroneous by order of magnitude. This is due to the hydrogen bond disruption that suggests the necessity to reconsider the traditional approach of the purely electrostatic calculation of the transfer energy from water into protein. In this paper, the method combining the experimental estimates of the transfer energies from water into aprotic solvent and the electrostatic calculation of the transfer energies from aprotic solvent into protein is proposed. Hydrogen bonds between aprotic solvent and solute are taken into account by introducing an imaginary aprotic medium incapable to form hydrogen bonds with the solute. Besides, a new treatment of the heterogeneous intraprotein dielectric permittivity based on the microscopic protein structure and electrometric measurements is elaborated. The method accounts semi-quantitatively for the electrostatic effect of diverse charged amino acid substitutions in the donor and acceptor parts of the photosynthetic bacterial reaction center from Rhodobacter sphaeroides. Analysis of the volatile secondary acceptor site QB revealed that in the conformation with a minimal distance between quinone QB and Glu L 212 the proton uptake upon the reduction of QB is prompted by Glu L 212 in alkaline and by Asp L 213 in slightly acidic regions. This agrees with the pH dependences of protonation degrees and the proton uptake. The method of pK calculation was applied successfully also for dissociation of Asp 26 in bacterial thioredoxin. Copyright © 2015 Elsevier B.V. All rights reserved.

  7. 13CO2/12CO2 ratio analysis in exhaled air by lead-salt tunable diode lasers for noninvasive diagnostics in gastroenterology

    Science.gov (United States)

    Stepanov, Eugene V.; Zyrianov, Pavel V.; Miliaev, Valerii A.; Selivanov, Yurii G.; Chizhevskii, Eugene G.; Os'kina, Svetlana; Ivashkin, Vladimir T.; Nikitina, Elena I.

    1999-07-01

    An analyzer of 13CO2/12CO2 ratio in exhaled air based on lead-salt tunable diode lasers is presented. High accuracy of the carbon isotope ratio detection in exhaled carbon dioxide was achieved with help of very simple optical schematics. It was based on the use of MBE laser diodes operating in pulse mode and on recording the resonance CO2 absorption at 4.2 micrometers . Special fast acquisition electronics and software were applied for spectral data collection and processing. Developed laser system was tested in a clinical train aimed to assessment eradication efficiency in therapy of gastritis associated with Helicobacter pylori infection. Data on the 13C-urea breath test used for P.pylori detection and obtained with tunable diode lasers in the course of the trail was compared with the results of Mass-Spectroscopy analysis and histology observations. The analyzer can be used also for 13CO2/12CO2 ratio detection in exhalation to perform gastroenterology breath test based on using other compounds labeled with stable isotopes.

  8. ASUPAN KALSIUM DAN VITAMIN D PADA ANAK INDONESIA USIA 2 – 12 TAHUN [Calcium and Vitamin D Intake of Indonesian Children 2-12 Years Old

    Directory of Open Access Journals (Sweden)

    Victoria Valentina*

    2014-09-01

    Full Text Available Food consumption is playing an important role for nutritional status of children 2-12 years old. During growth and development phase, body needs macro and micro nutrients even more than later phase. The process can not be catched up at later stage therefore it is very important to pay attention to food consumption during this phase. This study used secondary data of South East Asian Nutrition Surveys (SEANUTS 2011-2012 which was covered recapitulation profile data of 300 children age 2-12 years old representative of 48 districts in Indonesia. The study showed that Indonesian children consuming less calcium and vitamin D-rich foods than the recommended daily allowance (RDA. It does not reflects on the result of anthropometry data, vitamin D on the blood and bone mass density since the dietary recall 24 hours shows only food consumption in that specific day while nutritional status shows a result of longer process. However, vitamin D in blood has a significant correlation with bone mass density of tibia bone (p<0.05. Deficiency of calcium and mainly vitamin D is a new finding at this time. Therefore, the study showed that fortification of calcium and vitamin min D in food become important to improve nutritional status of Indonesian children. 20% of RDA per serving size twice a day is recommended as well for fortification level of Calcium and Vitamin D.

  9. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  10. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  11. Differential effects of repeated low dose treatment with the cannabinoid agonist WIN 55,212-2 in experimental models of bone cancer pain and neuropathic pain

    DEFF Research Database (Denmark)

    Hald, Andreas; Ding, Ming; Egerod, Kristoffer Lihme

    2008-01-01

    Pain due to bone malignancies is one of the most difficult types of cancer pain to fully control and may further decrease the patients' quality of life. Animal models of chronic pain conditions resulting from peripheral inflammatory reactions or nerve injuries are responsive to treatment...... with cannabinoid agonists. However, the use of cannabinoid agonists in humans may be hampered by CNS related side effects and development of tolerance. In the present study, we investigated the effect of repeated low dose administration of the synthetic cannabinoid agonist WIN 55,212-2 on bone cancer pain...... and neuropathic pain in mice. In addition, we investigated the development of CNS related side effects and tolerance. We found that 0.5 mg/kg/day for 18 days reduced pain related behavior and expression of spinal glial fibrillary acidic protein in the bone cancer pain model but not in the neuropathic pain model...

  12. Paracentric inversion X(q21.2q24) associated with mental retardation in males and normal ovarian function in females

    Energy Technology Data Exchange (ETDEWEB)

    Abeliovich, D.; Dagan, J.; Kimchi-Sarfaty, C. [Hebrew Univ. Hadassah Medical School, Jerusalem (Israel)

    1995-01-30

    We describe a familial paracentric inversion (X)(q21.2 q24) in a family with 2 male and 2 female carriers. The males were mentally retarded and the females were normal with normal ovarian function. It is suggested that a recessive mental retardation (MR) gene was disrupted by one of the inversion breakpoints, although an X-linked MR gene which by chance is linked to the inv(X) could not be ruled out. In the female carriers of the paracentric inversion a random X-inactivation was demonstrated. The normal ovarian function is an exception to the concept of {open_quotes}critical region{close_quotes} at Xq13-q26. 15 refs., 3 figs.

  13. The Largest Paracentric Inversion, The Highest Rate Of Recombinant Spermatozoa. Case Report: 46,Xy, Inv(2(Q21.2Q37.3 And Literature Review

    Directory of Open Access Journals (Sweden)

    C.C. Yapan

    2014-06-01

    Full Text Available Carriers of inversions involving euchromatic regions are at risk of having unbalanced offspring due to meiotic crossover. In carriers, recombination can occur during gametogenesis and cause genetically unbalanced sperm and subsequently unbalanced embryos. Here we present segregation analysis results of an infertile male with 46,XY,inv(2 (q21.2q37.3 using fluorescent in situ hybridization (FISH on sperm cells. This is the largest paracentric inversion (PAI reported so far in a meiotic segregation analysis study. Sperm FISH revealed 28.0% recombinant spermatozoa rate for chromosome 2, which was the highest rate in PAI carriers in the literature. Our results indicate a clear correlation between the size of the inverted segment and the frequency of the recombinant spermatozoa. The results of the FISH analysis with the information of unbalanced spermatozoa rate can provide accurate counseling on the genetic risk of infertility.

  14. Female-to-male sex reversal associated with unique Xp21.2 deletion disrupting genomic regulatory architecture of the dosage-sensitive sex reversal region.

    Science.gov (United States)

    Dangle, Pankaj; Touzon, María Sol; Reyes-Múgica, Miguel; Witchel, Selma F; Rajkovic, Aleksandar; Schneck, Francis X; Yatsenko, Svetlana A

    2017-10-01

    The XX male disorder of sex development (DSD) is a rare condition that is most commonly associated with the presence of the SRY gene on one of the X chromosomes due to unequal crossing-over between sex chromosomes during spermatogenesis. However, in about 20% of the XX male individuals, SRY is missing, although these persons have at least some testis differentiation. The genetic basis of genital ambiguity and the mechanisms triggering testis development in such patients remain unknown. The proband with 46,XX SRY -negative testicular DSD was screened for point mutations by whole exome sequencing and CNVs using a high-resolution DSD gene-targeted and whole genome array comparative genomic hybridisation. The identified Xp21.2 genomic alteration was further characterised by direct sequencing of the breakpoint junctions and bioinformatics analysis. A unique, 80 kb microdeletion removing the regulatory sequences and the NR0B1 gene was detected by microarray analysis. This deletion disturbs the human-specific genomic architecture of the Xp21.2 dosage-sensitive sex (DSS) reversal region in the XX patient with male-appearing ambiguous genitalia and ovotestis. Duplication of the DSS region containing the MAGEB and NR0B1 genes has been implicated in testis repression and sex reversal. Identification of this microdeletion highlights the importance of genomic integrity in the regulation and interaction of sex determining genes during gonadal development. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  15. Tyrosine 105 and threonine 212 at outermost substrate binding subsites -6 and +4 control substrate specificity, oligosaccharide cleavage patterns, and multiple binding modes of barley alpha-amylase 1

    DEFF Research Database (Denmark)

    Bak-Jensen, K.S.; André, G.; Gottschalk, T.E.

    2004-01-01

    and oligosaccharides, respectively. Bond cleavage analysis of oligosaccharide degradation by wild-type and mutant AMY1 supports that Tyr105 is critical for binding at subsite -6. Substrate binding is improved by T212(Y/W) introduced at subsite +4 and the [Y105A/ T212(Y/W)] AMY1 double mutants synergistically enhanced......The role in activity of outer regions in the substrate binding cleft in alpha-amylases is illustrated by mutational analysis of Tyr(105) and Thr(212) localized at subsites - 6 and +4 ( substrate cleavage occurs between subsites -1 and +1) in barley alpha-amylase 1 (AMY1). Tyr(105) is conserved......% activity, respectively. Thus engineering of aromatic stacking interactions at the ends of the 10-subsite long binding cleft affects activity very differently, dependent on the substrate. Y105A dominates in dual subsite -6/+4 [Y105A/T212(Y/W)] AMY1 mutants having almost retained and low activity on starch...

  16. Regression of human prostate cancer xenografts in mice by AMG 212/BAY2010112, a novel PSMA/CD3-Bispecific BiTE antibody cross-reactive with non-human primate antigens.

    Science.gov (United States)

    Friedrich, Matthias; Raum, Tobias; Lutterbuese, Ralf; Voelkel, Markus; Deegen, Petra; Rau, Doris; Kischel, Roman; Hoffmann, Patrick; Brandl, Christian; Schuhmacher, Joachim; Mueller, Peter; Finnern, Ricarda; Fuergut, Melanie; Zopf, Dieter; Slootstra, Jerry W; Baeuerle, Patrick A; Rattel, Benno; Kufer, Peter

    2012-12-01

    For treatment of patients with prostate cancer (PCa), we developed a novel T cell-engaging (BiTE) antibody designated AMG 212 or BAY2010112 that is bispecific for prostate-specific membrane antigen (PSMA) and the CD3 epsilon subunit of the T cell receptor complex. AMG 212/BAY2010112 induced target cell-dependent activation and cytokine release of T cells, and efficiently redirected T cells for lysis of target cells. In addition to Chinese hamster ovary cells stably expressing human or cynomolgus monkey PSMA, T cells redirected by AMG 212/BAY2010112 also lysed human PCa cell lines VCaP, 22Rv1, MDA PCa 2b, C4-2, PC-3-huPSMA, and LnCaP at half maximal BiTE concentrations between 0.1 and 4 ng/mL (1.8-72 pmol/L). No lysis of PSMA-negative human PCa cell lines PC-3 and DU145 was observed. The subcutaneous (s.c.) formation of tumors from PC-3-huPSMA cells in NOD/SCID mice was significantly prevented by once daily intravenous (i.v.) injection of AMG 212/BAY2010112 at a dose level as low as 0.005 mg/kg/d. Rapid tumor shrinkage with complete remissions were observed in NOD/SCID mice bearing established s.c. 22Rv1 xenografts after repeated daily treatment with AMG 212/BAY2010112 by either the i.v. or s.c. route. Of note, 22Rv1 tumors were grown in the absence of human T cells followed by intraperitoneal injection of T cells 3 days before BiTE treatment. No effects on tumor growth were observed in the absence of human T cells or AMG 212/BAY2010112. On the basis of these preclinical results, AMG 212/BAY2010112 appears as a promising new BiTE antibody for the treatment of patients with PSMA-expressing PCa.

  17. Cloning of human and mouse EBI1, a lymphoid-specific G-protein-coupled receptor encoded on human chromosome 17q12-q21.2.

    Science.gov (United States)

    Schweickart, V L; Raport, C J; Godiska, R; Byers, M G; Eddy, R L; Shows, T B; Gray, P W

    1994-10-01

    A lymphoid-specific member of the G-protein-coupled receptor family has been identified by PCR with degenerate oligonucleotides. We have determined that this receptor, also reported as the Epstein-Barr-induced cDNA EBI1, is expressed in normal lymphoid tissues and in several B- and T-lymphocyte cell lines. While the function and the ligand for EBI1 remain unknown, its sequence and gene structure suggest that it is related to the receptors that recognize chemoattractants, such as interleukin-8, RANTES, C5a, and fMet-Leu-Phe. Like the chemoattractant receptors, EBI1 contains intervening sequences near its 5' end; however, EBI1 is unique in that both of its introns interrupt the coding region of the first extracellular domain. The gene is encoded on human chromosome 17q12-q21.2. None of the other G-protein-coupled receptors has been mapped to this region, but the C-C chemokine family has been mapped to 17q11-q21. The mouse EBI1 cDNA has also been isolated and encodes a protein with 86% identity to the human homolog.

  18. Health and exercise-related medical issues among 1,212 ultramarathon runners: baseline findings from the Ultrarunners Longitudinal TRAcking (ULTRA) Study.

    Science.gov (United States)

    Hoffman, Martin D; Krishnan, Eswar

    2014-01-01

    Regular exercise is associated with substantial health benefits; however, little is known about the health impact of extreme levels of exercise. This study examined the prevalence of chronic diseases, health-care utilization, and risk factors for exercise-related injuries among ultramarathon runners. Retrospective, self-reported enrollment data from an ongoing longitudinal observational study of 1,212 active ultramarathon runners were analyzed. The most prevalent chronic medical conditions were allergies/hay fever (25.1%) and exercise-induced asthma (13.0%), but there was a low prevalence of serious medical issues including cancers (4.5%), coronary artery disease (0.7%), seizure disorders (0.7%), diabetes (0.7%), and human immunodeficiency virus (HIV) infection (0.2%). In the year preceding enrollment, most (64.6%) reported an exercise-related injury that resulted in lost training days (median of 14 days), but little nonattendance of work or school due to illness, injury, or exercise-related medical conditions (medians of 0 days for each). The knee was the most common area of exercise-related injury. Prior year incidence of stress fractures was 5.5% with most (44.5%) involving the foot. Ultramarathon runners who sustained exercise-related injuries were younger (pexercise-related injuries but higher proportion of stress fractures involving the foot, and it is the younger and less experienced ultramarathoners who appear most at risk for injury.

  19. Family paracentric inversion of the short arm of chromosome X (Xp21.2p11.23 and connection with autism spectrum disorders

    Directory of Open Access Journals (Sweden)

    Pejović-Milovančević Milica

    2012-01-01

    Full Text Available Introduction. Autism spectrum disorders (ASDs are a group of complex pervasive developmental disorders characterized by impairments in communication, social interaction and behavior. In most cases autism is caused by a combination of genetic factors and environmental risk factors. In 10% to 20% of cases it has been shown that the cause of ASD is genetic. Case Outline. We are describing a 2-year-old boy who was referred to genetic counseling because of speech delay and certain autism-like behavior. By cytogenetic analysis the karyotype 46, inv(X,Y was obtained. The boy was a carrier of a paracentric inversion of the short arm of the chromosome X. After cytogenetic analysis of parental blood, it was detected that mother was a carrier of identical aberration, but had no clinical signs. The method of fluorescent in situ hybridization (FISH yielded the precise breakpoint in the region (p21.2p11.23. Mother and son were carriers of identical X chromosome. Conclusion. Breakpoints are located in the regions that have already been linked to autism, which indicates that the positional effect of the gene could have been a possible cause of the patient’s genotype. In addition to positional effects, in order to better understand the etiology of autism other genetic and environmental factors should be always taken into consideration. [Projekat Ministarstva nauke Republike Srbije, br. ON175013

  20. [Family paracentric inversion of the short arm of chromosome X (Xp21.2p11.23) and connection with autism spectrum disorders].

    Science.gov (United States)

    Milovančević, Milica Pejović; Vešić, Marija; Jelisavčić, Marko; Nikšić, Snežana; Pilić, Gordana Radivojević; Maravić, Vanja Mandić

    2012-01-01

    Autism spectrum disorders (ASDs) are a group of complex pervasive developmental disorders characterized by impairments in communication, social interaction and behavior. In most cases autism is caused by a combination of genetic factors and environmental risk factors. In 10% to 20% of cases it has been shown that the cause of ASD is genetic. We are describing a 2-year-old boy who was referred to genetic counseling because of speech delay and certain autism-like behavior. By cytogenetic analysis the karyotype 46, inv(X),Y was obtained. The boy was a carrier of a paracentric inversion of the short arm of the chromosome X. After cytogenetic analysis of parental blood, it was detected that mother was a carrier of identical aberration, but had no clinical signs. The method of fluorescent in situ hybridization (FISH) yielded the precise breakpoint in the region (p21.2p11.23). Mother and son were carriers of identical X chromosome. Breakpoints are located in the regions that have already been linked to autism, which indicates that the positional effect of the gene could have been a possible cause of the patient's genotype. In addition to positional effects, in order to better understand the etiology of autism other genetic and environmental factors should be always taken into consideration.

  1. Clinical Validation of a Highly Sensitive GC-MS Platform for Routine Urine Drug Screening and Real-Time Reporting of up to 212 Drugs

    Directory of Open Access Journals (Sweden)

    Hari Nair

    2013-01-01

    Full Text Available An important role of the clinical toxicology laboratory is to provide continuous diagnostic testing for patients with altered mental status and for other medical indications. To meet these needs, we have developed a new Gas Chromatography-Mass Spectrometry (GC-MS platform that facilitates routine screening and automated reporting of 212 drugs by laboratory technologists around the clock without the need to sign out by an on-site mass spectrometry-trained toxicologist. The platform uses a programmable temperature vaporizer (PTV injector for large sample volume injection and the free software Automated Mass Spectral Deconvolution and Identification System (AMDIS for data reduction and spectral matching that facilitates rapid library searching and analyte identification. Method comparison with 118 patient samples demonstrated that this platform and data searching algorithm independently provided improvements in sensitivity compared to an established GC-MS platform. Further examination of the role of the data processing software and the in-house databases used in the established versus the new platform demonstrated that the improved analytical sensitivity of the new platform was attributed to both the technical superiority of the new GC-MS instrumentation and the use of AMDIS in conjunction with the newly generated in-house library for data processing.

  2. De novo partial duplication 7(q11.2{r_arrow}q21.2) in a dysmorphic, developmentally retarded boy

    Energy Technology Data Exchange (ETDEWEB)

    Ross, M.; Pinsky, L.; Teebi, A. [McGill Univ., Quebec (Canada)] [and others

    1994-09-01

    Chromosomal abnormalities involving chromosome 7q are rare; we report a case of partial duplication 7q. The propositus was born at 34 weeks by cesarian section, decided because of oligohydramnios, severe intrauterine growth retardation and fetal immobility. At birth, the baby was under the 5th percentile for height, weight and head circumference and had dysmorphic features, including slight asymmetry of the face, bilateral epicanthus, hypoplastic nasal bridge, short globular nose, asymmetrical dysplastic ears, fifth finger clinodactyly, short second and fifth toe. Ultrasound examination showed atrial and ventricular septal defects. At 18 months, the child had a fracture of the femur, secondary to a minor trauma; skeletal X-rays showed generalized osteoporosis and normal healing. The karyotype with GTG-banding showed a de novo partial duplication of the long arm of chromosome 7 (46,XX,dup(7)(q11.23{r_arrow}q21.2)). Fluorescence in situ hybridization with a painting probe specific for chromosome 7 confirmed the intra-chromosomal rearrangement. The patient`s phenotype and his chromosomal abnormality do not match the previously reported cases of partial trisomy 7q. This case confirms the importance of FISH for the delineation of the chromosomal inbalance in structural chromosomal aberrations.

  3. Decontamination and decommissioning of 61 plutonium gloveboxes in D-Wing, Building 212 Argonne National Laboratory-East: Final project report

    Energy Technology Data Exchange (ETDEWEB)

    Cheever, C.L.; Rose, R.W.

    1996-09-01

    Argonne National Laboratory-East (ANL-E) is a government-owned, contractor operated, multipurpose research facility located 25 miles southwest of downtown Chicago on 689 hectares (1,700 acres) in DuPage County, Illinois, as shown in Figure 1.1. Building 212 is located in the central area of ANL-E, as shown in Figure 1.2. The purpose of this project was to eliminate the risk of radioactive material release from the contaminated glovebox systems and to make the laboratories available for unrestricted use. The following work objectives were established: (1) Identify and remove radioactive materials for return to ANL-E Special Materials control. (2) Remove and package the radioactively contaminated materials and equipment from the gloveboxes. (3) Decontaminate the gloveboxes to nontransuranic (non-TRU) levels. (4) Size-reduce and package the gloveboxes and support systems. (5) Document and dispose of the radioactive and mixed waste. (6) Decontaminate, survey, and release the nine laboratories and corridor areas for unrestricted use.

  4. The Use of Styrene Maleic Acid Nanomicelles Encapsulating the Synthetic Cannabinoid Analog WIN55,212-2 for the Treatment of Cancer.

    Science.gov (United States)

    Xian, Susan; Parayath, Neha N; Nehoff, Hayley; Giles, Niroshini M; Greish, Khaled

    2015-09-01

    Synthetic cannabinoid WIN55,212-2 (WIN) has shown a promise as an anticancer agent but causes psychoactive side-effects. In the present study, nano-micelles of styrene maleic acid (SMA)-conjugated WIN were synthesized to reduce side-effects and increase drug efficacy. SMA-WIN micelles were characterised and their in vitro cytotoxic effect was compared to that of free WIN against triple-negative breast cancer (MDA-MB-231), hormone receptor-positive breast cancer (MCF-7) and castration-resistant prostate cancer (PC3) cell lines. SMA-WIN micelles were synthesised with a ~15% loading, 132.7 nm average diameter, -0.0388 mV charge, and pH-dependent release rate. A dose-dependent inhibition of cell growth was observed in all three cell lines treated with both free and micellar WIN, with both formulations demonstrating equal cytotoxicity. SMA-WIN demonstrated characteristics theorized to improve in vivo drug biodistribution. Potent cytotoxicity was found against breast and prostate cancer cells in vitro, showing promise as a novel treatment against breast and prostate cancer. Copyright© 2015 International Institute of Anticancer Research (Dr. John G. Delinassios), All rights reserved.

  5. Localisation of the gene for Saethre-Chotzen syndrome by FISH using four cases with apparently balanced translocations at 7p21.2

    Energy Technology Data Exchange (ETDEWEB)

    Rose, C.S.P.; King, A.A.J.; Winter, R.M. [Institute of Child Health, London (United Kingdom)] [and others

    1994-09-01

    Saethre-Chotzen is a common autosomal dominant form of craniosynostosis, which results in the premature fusion of cranial sutures. The Saethre-Chotzen gene locus has been mapped to 7p by linkage with genetic markers. We have analyzed four patients with Saethre-Chotzen syndrome associated with apparently balanced translocations involving band 7p21.2 and different reciprocal chromosomes. We have used YACs corresponding to the Genethon series of markers as probes for FISH, and in all four patients we show that the breakpoints in 7p are situated between D7S488 and D7S493, a maximum distance of 6 centimorgans. A previous patient has been described with a translocation t(6;7) and hemizygosity for D7S135. D7S135 is contained within the same YAC as D7S488, indicating that the breakpoint in the previous patient lies close to D7S488 and in the same region as the cases described here.

  6. Remaining Sites Verification Package for the 100-B-21:2 Subsite (100-B/C Discovery Pipeline DS-100BC-002), Waste Site Reclassification Form 2008-003

    Energy Technology Data Exchange (ETDEWEB)

    J. M. Capron

    2008-06-16

    The 100-B-21:2 waste site consists of the immediate area of the DS-100BC-02 pipeline. In accordance with this evaluation, the confirmatory and verification sampling results support a reclassification of this site to Interim Closed Out. The results of verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River.

  7. A Pilot Study into the Effects of the CB1 Cannabinoid Receptor Agonist WIN55,212-2 or the Antagonist/Inverse Agonist AM251 on Sleep in Rats

    Directory of Open Access Journals (Sweden)

    Anushka V. Goonawardena

    2011-01-01

    Full Text Available The plant cannabinoid Δ9-tetrahydrocannabinol and the endocannabinoid anandamide increase the amount of sleep via a CB1 receptor mediated mechanism. Here, we explored the use of a novel electroencephalogram (EEG recording device based on wireless EEG microchip technology (Neurologger in freely-moving rats, and its utility in experiments of cannabinoids-induced alterations of EEG/vigilance stages. EEG was recorded through epidural electrodes placed above pre-frontal and parietal cortex (overlaying the dorsal hippocampus. As cannabinoids, we acutely administered the full synthetic CB1 receptor agonist, WIN55,212-2 (1 mg/kg, and the antagonist/inverse agonist, AM251 (2 mg/kg, either alone or together through the intraperitoneal route. WIN55,212-2 increased the total amount of NREM sleep and the length of each NREM bout, but this was unlikely due to CB1 receptor activation since it was not prevented by AM251. However, WIN55,212-2 also lowered overall EEG spectral power especially in theta and alpha frequency bands during wakefulness and NREM sleep, and this effect was reversed by AM251. The antagonist/inverse agonist caused no sleep alterations by itself and moderately increased spectral power in Theta, alpha and beta frequency bands during NREM sleep when administered on its own. Implications of endocannabinoid modulation of the sleep-wake cycle and its possible interactions with other transmitter systems are considered.

  8. Enhanced self-administration of the CB1 receptor agonist WIN55,212-2 in olfactory bulbectomized rats: evaluation of possible serotonergic and dopaminergic underlying mechanisms

    Directory of Open Access Journals (Sweden)

    Petra eAmchova

    2014-03-01

    Full Text Available Depression has been associated with drug consumption, including heavy or problematic cannabis use. According to an animal model of depression and substance use disorder comorbidity, we combined the olfactory bulbectomy model of depression with intravenous drug self-administration procedure to verify whether depressive-like rats displayed higher voluntary intake of the CB1 receptor agonist WIN55,212-2 (WIN, 12.5 µg/kg/infusion. To this aim, olfactory-bulbectomized (OBX and sham-operated (SHAM Lister Hooded rats were allowed to self-administer WIN by lever-pressing under a continuous (FR-1 schedule of reinforcement in 2h daily sessions. Data showed that both OBX and SHAM rats developed stable WIN intake; yet, responses in OBX were constantly higher than in SHAM rats soon after the first week of training. In addition, OBX rats took significantly longer to extinguish the drug-seeking behaviour after vehicle substitution. Acute pre-treatment with serotonin 5HT1B receptor agonist, CGS-12066B (2.5-10 mg/kg, did not significantly modify WIN intake in OBX and SHAM Lister Hooded rats. Furthermore, acute pre-treatment with CGS-12066B (10 and 15 mg/kg did not alter responses in parallel groups of OBX and SHAM Sprague Dawley rats self-administering methamphetamine under higher (FR-2 reinforcement schedule with nose-poking as operandum. Finally, dopamine levels in the nucleus accumbens of OBX rats did not increase in response to a WIN challenge, as in SHAM rats, indicating a dopaminergic dysfunction in bulbectomized rats. Altogether, our findings suggest that a depressive state may alter cannabinoid CB1 receptor agonist-induced brain reward function and that a dopaminergic rather than a 5-HT1B mechanism is likely to underlie enhanced WIN self-administration in OBX rats.

  9. Statin treatment in a cohort of 20 212 men and women in Norway according to cardiovascular risk factors and level of education.

    Science.gov (United States)

    Selmer, Randi; Sakshaug, Solveig; Skurtveit, Svetlana; Furu, Kari; Tverdal, Aage

    2009-03-01

    To study the influence of patients' education and cardiovascular risk factors on the probability of statin treatment. A prospective cohort study of participants in regional health surveys in Norway 2000-2002 with statin use recorded in the Norwegian Prescription Database 2004-2006 as outcome measure. Information on history of cardiovascular disease (CVD) and diabetes, lipid levels, blood pressure, use of cardiovascular drugs, body mass index, family history, smoking, physical activity, marital status and place of residence was obtained at baseline. A total of 20,212 men and women aged 40-41, 45-46 and 59-61 years who reported never use of statins were included. Educational level was retrieved from Statistics Norway. Adjusted relative risks (RR) were estimated by Poisson regression. Whereas 655 participants reported a history of CVD or diabetes, 19,557 reported no such history. In the non-CVD/diabetes group 1,620 persons (8%) became statin users and 222 persons (34%) in the CVD/diabetes group. RR of becoming a statin user for high vs. low education increased from 0.64 [95% confidence interval (CI) 0.55, 0.73] to 0.91 (95% CI 0.79, 1.05) after adjustment in the non-CVD/diabetes group and from 0.94 (95% CI 0.70, 1.26) to 1.35 (95% CI 1.00, 1.81) in the CVD/diabetes group. Patients with no history of CVD/diabetes were prescribed statins according to cardiovascular risk independent of education. There was a tendency to a higher probability of statin treatment among highly educated compared with people of lower educational level in the group with a history of CVD or diabetes, after adjustment for other CVD risk factors, particularly in women.

  10. Inhibition of miRNA-212/132 improves the reprogramming of fibroblasts into induced pluripotent stem cells by de-repressing important epigenetic remodelling factors.

    Science.gov (United States)

    Pfaff, Nils; Liebhaber, Steffi; Möbus, Selina; Beh-Pajooh, Abbas; Fiedler, Jan; Pfanne, Angelika; Schambach, Axel; Thum, Thomas; Cantz, Tobias; Moritz, Thomas

    2017-04-01

    MicroRNAs (miRNAs) repeatedly have been demonstrated to play important roles in the generation of induced pluripotent stem cells (iPSCs). To further elucidate the molecular mechanisms underlying transcription factor-mediated reprogramming we have established a model, which allows for the efficient screening of whole libraries of miRNAs modulating the generation of iPSCs from murine embryonic fibroblasts. Applying this model, we identified 14 miRNAs effectively inhibiting iPSC generation, including miR-132 and miR-212. Intriguingly, repression of these miRNAs during iPSC generation also resulted in significantly increased reprogramming efficacy. MiRNA target evaluation by qRT-PCR, Western blot, and luciferase assays revealed two crucial epigenetic regulators, the histone acetyl transferase p300 as well as the H3K4 demethylase Jarid1a (KDM5a) to be directly targeted by both miRNAs. Moreover, we demonstrated that siRNA-mediated knockdown of either p300 or Jarid1a recapitulated the miRNA effects and led to a significant decrease in reprogramming efficiency. Thus, conducting a full library miRNA screen we here describe a miRNA family, which markedly reduces generation of iPSC and upon inhibition in turn enhances reprogramming. These miRNAs, at least in part, exert their functions through repression of the epigenetic modulators p300 and Jarid1a, highlighting these two molecules as an endogenous epigenetic roadblock during iPSC generation. Copyright © 2017. Published by Elsevier B.V.

  11. Health and exercise-related medical issues among 1,212 ultramarathon runners: baseline findings from the Ultrarunners Longitudinal TRAcking (ULTRA Study.

    Directory of Open Access Journals (Sweden)

    Martin D Hoffman

    Full Text Available Regular exercise is associated with substantial health benefits; however, little is known about the health impact of extreme levels of exercise. This study examined the prevalence of chronic diseases, health-care utilization, and risk factors for exercise-related injuries among ultramarathon runners. Retrospective, self-reported enrollment data from an ongoing longitudinal observational study of 1,212 active ultramarathon runners were analyzed. The most prevalent chronic medical conditions were allergies/hay fever (25.1% and exercise-induced asthma (13.0%, but there was a low prevalence of serious medical issues including cancers (4.5%, coronary artery disease (0.7%, seizure disorders (0.7%, diabetes (0.7%, and human immunodeficiency virus (HIV infection (0.2%. In the year preceding enrollment, most (64.6% reported an exercise-related injury that resulted in lost training days (median of 14 days, but little nonattendance of work or school due to illness, injury, or exercise-related medical conditions (medians of 0 days for each. The knee was the most common area of exercise-related injury. Prior year incidence of stress fractures was 5.5% with most (44.5% involving the foot. Ultramarathon runners who sustained exercise-related injuries were younger (p<0.001 and less experienced (p<0.01 than those without injury. Stress fractures were more common (p<0.01 among women than men. We conclude that, compared with the general population, ultramarathon runners appear healthier and report fewer missed work or school days due to illness or injury. Ultramarathon runners have a higher prevalence of asthma and allergies than the general population, and the prevalence of serious medical issues was nontrivial and should be recognized by those providing medical care to these individuals. Ultramarathon runners, compared with shorter distance runners, have a similar annual incidence of exercise-related injuries but higher proportion of stress fractures involving

  12. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  13. Synthesis and gastroprotective activities of some zinc (II complexes derived from (E-2-(1-(2-(piperazin-1-ylethyliminoethylphenol and (E-4-(1-(2-(piperazin-1-ylethyliminoethylbenzene-1,3-diol Schiff bases against aspirin induced ulceration

    Directory of Open Access Journals (Sweden)

    Muhammad Saleh Salga

    2017-05-01

    Full Text Available This study describes the protective effects of piperazine derived compounds against aspirin induced gastric injuries and evaluated the role of nitric oxide, inflammatory cytokines and serum level of aspartate aminotransaminases (AST, alanine aminotransaminases (ALT, high density lipoprotein (HDL and malondialdehyde (MDA. The oral administration of the compounds at doses 30 and 60 mg/kg protected the gastric against the nectrotizing effects of aspirin. The level of nitric oxide (NO was elevated in the group pretreated with the compounds. The results also showed that pre-treatment with piperazine compounds has led to the decrease in the amount of MDA and increased the activity of AST, ALT and HDL. In conclusion, pre-treatment with piperazine derived compounds; (E-2-(1-(2-(piperazin-1-ylethyliminoethylphenol (2HP, (E-4-(1-(2-(piperazin-1-ylethyliminoethyl benzene-1,3-diol (DHP and their zinc complexes has provided a significant protection to the gastric from damaging effects of aspirin.

  14. A randomized, multicentre study of directed daylight exposure times of 11/2 vs. 21/2 h in daylight-mediated photodynamic therapy with methyl aminolaevulinate in patients with multiple thin actinic keratoses of the face and scalp

    DEFF Research Database (Denmark)

    Wiegell, S.R.; Fabricius, S.; Philipsen, P.A.

    2011-01-01

    Background: Actinic keratoses (AKs) are common dysplastic skin lesions that may differentiate into invasive squamous cell carcinomas. Although a superior cosmetic outcome of photodynamic therapy (PDT) is advantageous compared with equally effective treatments such as cryotherapy and curettage......, the inconvenience of clinic attendance and discomfort during therapy are significant drawbacks. Daylight-mediated PDT could potentially reduce these and may serve as an alternative to conventional PDT. Objectives: To compare the efficacy of methyl aminolaevulinate (MAL)-PDT with 11/2 vs. 21/2 h of daylight exposure......, time of day or time of year during which the treatment was performed. Treatment was well tolerated, with a mean ± SD maximal pain score of 1·3 ± 1·5. Conclusions: Daylight-mediated MAL-PDT is an effective, convenient and nearly pain-free treatment for patients with multiple thin AKs. Daylight...

  15. Large area tunnel oxide passivated rear contact n -type Si solar cells with 21.2% efficiency: Large area tunnel oxide passivated rear contact n -type Si solar cells

    Energy Technology Data Exchange (ETDEWEB)

    Tao, Yuguo [Georgia Inst. of Technology, Atlanta, GA (United States); Upadhyaya, Vijaykumar [Georgia Inst. of Technology, Atlanta, GA (United States); Chen, Chia-Wei [Georgia Inst. of Technology, Atlanta, GA (United States); Payne, Adam [Suniva Inc., Norcross GA (United States); Chang, Elizabeth Lori [Georgia Inst. of Technology, Atlanta, GA (United States); Upadhyaya, Ajay [Georgia Inst. of Technology, Atlanta, GA (United States); Rohatgi, Ajeet [Georgia Inst. of Technology, Atlanta, GA (United States); Suniva Inc., Norcross GA (United States)

    2016-01-21

    This paper reports on the implementation of carrier-selective tunnel oxide passivated rear contact for high-efficiency screen-printed large area n-type front junction crystalline Si solar cells. It is shown that the tunnel oxide grown in nitric acid at room temperature (25°C) and capped with n+ polysilicon layer provides excellent rear contact passivation with implied open-circuit voltage iVoc of 714mV and saturation current density J0b of 10.3 fA/cm2 for the back surface field region. The durability of this passivation scheme is also investigated for a back-end high temperature process. In combination with an ion-implanted Al2O3-passivated boron emitter and screen-printed front metal grids, this passivated rear contact enabled 21.2% efficient front junction Si solar cells on 239 cm2 commercial grade n-type Czochralski wafers.

  16. Coinheritance of Hb Bristol-Alesha [β67(E11)Val→Met; HBB: c.202G>A] and the α212 Patchwork Allele in a Brazilian Child with Severe Congenital Hemolytic Anemia.

    Science.gov (United States)

    Pedroso, Gisele A; Kimura, Elza M; Santos, Magnun N N; Albuquerque, Dulcinéia M; Ferruzzi, Jucilane L H; Jorge, Susan E; Costa, Fernando F; Saad, Sara T O; Sonati, Maria F

    2017-05-01

    Hb Bristol-Alesha [HBB: c.202G>A; β 67 Val>Met] is a rare structural variant of hemoglobin (Hb) resulting from a GTG>ATG substitution at codon 67 of the β-globin gene that leads to the replacement of valine by methionine in the corresponding position of the β-globin chain. The methionine residue is subsequently modified to aspartic acid [β67(E11)Val-Met→Asp], possibly by autoxidation mechanisms. This substitution prevents normal non-polar binding of Val67 to the heme group, resulting in molecular instability and severe hemolysis. We identified Hb Bristol-Alesha (in the heterozygous state), as the cause of severe congenital hemolytic anemia in an 11-month-old girl of mixed (native Indian and European) ethnic origin from the Midwestern region of Brazil, whose parents were clinically and hematologically normal. The mutation on the β-globin gene was found to have been coinherited with the α212 patchwork allele.

  17. Preoperative intra-aortic balloon pump use in high-risk patients prior to coronary artery bypass graft surgery decreases the risk for morbidity and mortality-A meta-analysis of 9,212 patients.

    Science.gov (United States)

    Deppe, Antje-Christin; Weber, Carolyn; Liakopoulos, Oliver J; Zeriouh, Mohamed; Slottosch, Ingo; Scherner, Maximilian; Kuhn, Elmar W; Choi, Yeong-Hoon; Wahlers, Thorsten

    2017-03-01

    Prophylactic intra-aortic balloon pump (IABP) support for high-risk patients before coronary artery bypass grafting (CABG) is controversial. This meta-analysis sought to determine the current role of preoperative IABP support. We performed a meta-analysis of randomized (RCT) and observational trials (OT) that fulfilled the following criteria: (1) Group comparison of patients with prophylactic IABP implantation before CABG with a control group; (2) reporting at least one desired clinical endpoint, including all-cause mortality, myocardial infarction, cerebrovascular accident (CVA), and renal failure. Pooled treatment effects (odds ratio [OR] or weighted mean difference, and 95% confidence intervals [95%CI]) were assessed using a fixed or random effects model. A total of 9,212 patients from 23 studies (7 RCT, 16 OT) were identified after a literature search of major databases using a predefined keyword list. Absolute risk reduction for mortality in RCTs was 4.4% (OR 0.43; 95%CI 0.25-0.73; p = 0.0025). Prophylactic IABP use before CABG surgery also decreased the risk for myocardial infarction (OR 0.58; 95%CI 0.43-0.78; p = 0.004), CVA (OR 0.67; 95%CI 0.47-0.97; p = 0.042), and renal failure (OR 0.62; 95%CI 0.47-0.83; p = 0.0014). Length of intensive care unit stay (p risk patients before CABG surgery. © 2017 Wiley Periodicals, Inc.

  18. Aespoe Hard Rock Laboratory. Aespoe Task Force on Engineered Barrier System. Modelling of THM-coupled processes for benchmark 2.1.1 and 2.1.2 with the code GeoSys/RockFlow

    Energy Technology Data Exchange (ETDEWEB)

    Nowak, Thomas; Kunz, Herbert (Federal Inst. for Geosciences and Natural Resources, Hannover (Germany))

    2009-03-15

    In 2004 the Swedish Nuclear Fuel and Waste Management Co. (SKB) initiated the project 'Task Force on Engineered Barrier Systems'. This project has the objectives to verify the ability to model THM-coupled processes (task 1) and gas migration processes (task 2) in the clay-rich buffer materials. The tasks are performed on the basis of appropriate benchmarks. This report describes the final results for the modelling of the THM-benchmarks 2.1.1(Buffer/Container Experiment) and 2.1.2 (Isothermal Test) with the code GeoSys/RockFlow. Both in-situ experiments were conducted in the Canadian Whiteshell Underground Research Laboratory (URL). An interim report (NOWAK 2008) documented the results of two axially symmetric models. This report documents the calculations of a laboratory experiment on the buffer material that is used as calibration for the hydraulic properties of the buffer material, the setting-up of a 3-D model of the URL for both ITT and BCE and the modelling results in comparison to measured values.

  19. Chronic co-administration of the cannabinoid receptor agonist WIN55,212-2 during puberty or adulthood reverses 3,4 methylenedioxymetamphetamine (MDMA)-induced deficits in recognition memory but not in effort-based decision making.

    Science.gov (United States)

    Schulz, Sybille; Becker, Thorsten; Nagel, Ulrich; von Ameln-Mayerhofer, Andreas; Koch, Michael

    2013-05-01

    Cannabis and 3,4 methylenedioxymetamphetamine (MDMA, "ecstasy") are the most frequently combined illegal drugs among young adults in western societies. This study examined the effects of chronic co-administration of the cannabinoid receptor agonist WIN55,212-2 (WIN) and MDMA on working memory and effort-based decision making in rats. Treatment consisted of MDMA (7.5 mg/kg), WIN (1.2 mg/kg), a combination of these substances (MDMA+WIN) or vehicle over a period of 25 days during puberty (PD40-65) or adulthood (PD80-105). Ten days after the last treatment, WIN reversed MDMA-induced working memory deficits in the object recognition test in animals treated during adulthood or puberty, but had no influence on impairment of adult rats in the effort-based T-maze task. No differences were observed between groups of pubertally treated rats in the decision making task. During a subsequent acute drug challenge MDMA and MDMA+WIN decreased high reward choices in both age groups, indicating MDMA-induced cost-aversive choice. Differential long-term interactions on the neuronal level in the hippocampus and MDMA-induced disturbances in cortico-limbic connections are suggested. Copyright © 2013 Elsevier Inc. All rights reserved.

  20. 8 CFR 212.4 - Applications for the exercise of discretion under section 212(d)(1) and 212(d)(3).

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Applications for the exercise of discretion... charge outside the United States in the districts of Bangkok, Thailand; Mexico City, Mexico; and Rome... due to infection with the etiologic agent for acquired immune deficiency syndrome (HIV infection) may...

  1. Reference: 212 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available identified in pea (Pisum sativum) using biochemical approaches. The Arabidopsis (...C75-IV, which we studied using a range of molecular, genetic, and biochemical techniques. Expression of atTO

  2. 24 CFR 1710.212 - Financial information.

    Science.gov (United States)

    2010-04-01

    ... acquisition cost or current fair market value of land. (ii) Development and improvement costs (include the... account as to down payments and deposits” shall mean an account, established in accordance with local real... made financial arrangements, such as the posting of surety bonds (corporate bonds or individual notes...

  3. 25 CFR 212.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... potential deposits of oil and gas, geothermal or solid mineral resources on the lands. Geothermal resources... to which is held in trust by the United States or is subject to restriction against alienation imposed by the United States. Indian mineral owner means any individual Indian or Alaska Native who owns...

  4. 12 CFR 212.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... immediate family. “Immediate family” means spouse, mother, father, child, grandchild, sister, brother, or... located outside an MSA. (c) Community means a city, town, or village, and contiguous and adjacent cities, towns, or villages. (d) Contiguous or adjacent cities, towns, or villages means cities, towns, or...

  5. 36 CFR 212.1 - Definitions.

    Science.gov (United States)

    2010-07-01

    ...) Redesigning, adjusting, and changing the plans, specifications, and materials to meet conditions; (3...) Inspecting, testing, and accepting materials and equipment to be installed in the work; and (5) Inspecting... designed for use over snow and that runs on a track or tracks and/or a ski or skis, while in use over snow...

  6. 43 CFR 17.212 - Employment criteria.

    Science.gov (United States)

    2010-10-01

    ... shown to be job-related for the position in question, and (2) alternative job-related tests or criteria..., manual, or speaking skills the test results accurately reflect the applicant's or employee's job skills... test purports to measure). (c) All job qualifications must be shown to be directly related to the job...

  7. 47 CFR 15.212 - Modular transmitters.

    Science.gov (United States)

    2010-10-01

    ... radiofrequency transmitter device that is typically incorporated into another product, host or device. Split... transmitter control element (or specific hardware on which the software that controls the radio operation... powered, it must comply with the AC line conducted requirements found in § 15.207. AC or DC power lines...

  8. 36 CFR 2.12 - Audio disturbances.

    Science.gov (United States)

    2010-07-01

    ... purpose of the actor's conduct, location, time of day or night, purpose for which the area was established... system, except in connection with a public gathering or special event for which a permit has been issued...

  9. Calidad de Imagen del Telescopio UNAM212

    Science.gov (United States)

    Cobos, F. J.; Teiada de Vargas, C.

    1987-05-01

    El telescopio UNAM2l2, del Observatorio Astronómico Nacional, situado en la Sierra de San Pedro Mártir (Baja California, México), cumplira en un futuro muy cercano siete años de uso para fines de investigación astronómica. Aunque en este tiempo no se ha efectuado un estudio sistemático acerca de su comportamiento óptico y de los factores que influyen en la calidad de las imágenes, se han realizado pruebas diversas, estudios parciales y reuniones especificas, cuyos resultados no siempre se han difundido ampliamente y generalmente no se han presentado por escrito. Es por ello que hemos creido necesario intentar una recopilación de la información existente para poder con ella establecer un diagnóstjco que, aunque no sea definitivo, sirva de base para futuros trabajos tendientes a optimizar el comportamiento óptico del telescopio. Es evidente que un buen número de las conclusiones que se presentan son resultado del trabajo de muchas personas ó de esfuerzos colectivos. Asimismo, hemos tratado de localizar información bibliográfica que pueda ser de utilidad. Nuestro objetivo primordial ha consistido en centrarnos en la óptica del telescopio y su calidad, pero también se han considerado otros aspectos que puedan afectar las imágenes obtenidas tales como: celda del primario, `seeing' local y externo, flexiones posibles en la estructura mecánica del telescopio, etc.

  10. 32 CFR 212.6 - Procedures.

    Science.gov (United States)

    2010-07-01

    ... discrimination by any non-Federal entity or other private organization covered by this part. (ii) Installation... discrimination by the organization. (2) Designation of management responsibilities, including the accountability... investment clubs, in which the investment of members' personal funds result in a return on investment...

  11. 29 CFR 1603.212 - Witness fees.

    Science.gov (United States)

    2010-07-01

    ... STATE AND LOCAL GOVERNMENT EMPLOYEE COMPLAINTS OF EMPLOYMENT DISCRIMINATION UNDER SECTION 304 OF THE... be paid or offered to the witness by the party requesting the subpoena at the time the subpoena is...

  12. 42 CFR 2.12 - Applicability.

    Science.gov (United States)

    2010-10-01

    ... provisions of hospital care, nursing home care, domiciliary care, and medical services under title 38, United... personnel who refer a patient to the intensive care unit for an apparent overdose, unless the primary... Armed Forces and those components of the Veterans Administration furnishing health care to veterans. (3...

  13. 7 CFR 989.212 - Substandard dockage.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing... prior agreement between handler and tenderer, Natural (sun-dried) Seedless, Golden Seedless, Dipped... paragraph (b) or (c) of this section. (b) Substandard dockage table applicable to Natural (sun-dried...

  14. 27 CFR 40.212 - Mark.

    Science.gov (United States)

    2010-04-01

    ... TREASURY (CONTINUED) TOBACCO MANUFACTURE OF TOBACCO PRODUCTS, CIGARETTE PAPERS AND TUBES, AND PROCESSED... approved as provided in § 40.65 may be used in the mark as the name of the manufacturer.) As an alternative... using the alternative, the manufacturer shall notify the appropriate TTB officer in writing of the name...

  15. 19 CFR 10.212 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... performed on the article or any of its components in the United States. Beneficiary country. “Beneficiary... countries. “Cut in one or more beneficiary countries” when used with reference to apparel articles means... country. HTSUS. “HTSUS” means the Harmonized Tariff Schedule of the United States. Knit-to-shape articles...

  16. Publications | Page 212 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

  17. 48 CFR 212.207 - Contract type.

    Science.gov (United States)

    2010-10-01

    ... OF DEFENSE ACQUISITION PLANNING ACQUISITION OF COMMERCIAL ITEMS Special Requirements for the... Defense Authorization Act for Fiscal Year 2008 (Pub. L. 110-181), use of time-and-materials and labor-hour... through use of time-and-materials or labor-hour contracts; and (D) The use of a time-and-materials or...

  18. 45 CFR 212.10 - Nondiscrimination.

    Science.gov (United States)

    2010-10-01

    ...), ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES ASSISTANCE FOR UNITED STATES... ground of race, color, or national origin be excluded from participation, be denied any benefits, or...

  19. Publications | Page 212 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Community-based dengue vector control : experiences in behavior change in Metropolitan Manila, Philippines (open access). Dengue is the most important mosquito-borne disease in the Philippines, especially in Metropolitan Manila where communities are socially and economically diverse, and city governments struggle ...

  20. 40 CFR 21.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ..., wrecked or discarded equipment, rock, sand, cellar dirt and industrial, municipal, and agricultural waste...; Provided, That it does not mean preparation or undertaking of: Plans to determine feasibility; engineering... the installation, emplacement, or introduction of materials, including those involved in construction...

  1. Coordination chemistry of the sup 212 Pb/ sup 212 Bi nuclear transformation: Alpha-emitting radiopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    Parks, N.J.; Harris, W.R.; Keen, C.L.; Cooper, S.R.

    1992-07-01

    Subdivisions of this project are: (a) the synthesis of prototypical thiolate and dithiocarbamate based hexacoordinate complexes, (b) radiochemical engineering for generation of no-carrier-added lead and bismuth radioelements, (c) the first isolation of bismuth-binding proteins from in vivo studies with cyclotron produced {sup 205/206}Bi tracer, and (d) initial development of transport mechanisms for the intracellular radiobiological study of alpha emitting bismuth, and (e) the initiation of chemical equilibrium studies and biochemical pathways with cyclotron-produced, no-carrier-added, {sup 203}Pb (T{sub 1/2} = 51 hr).

  2. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  3. Synthesis and structural characterization of symmetrical closo-4,7-I2-1,2-C2B10H10 and [(CH3)3NH][nido-2,4-I2-7,8-C2B9H10].

    Science.gov (United States)

    Ramachandran, Bhaskar M; Knobler, Carolyn B; Hawthorne, M Frederick

    2006-01-09

    The boron-atom insertion reaction of nido-9,11-I(2)-7,8-C(2)B(9)H(9)(2-), with the HBCl(2):SMe(2) complex yields closo-4,7-I(2)-1,2-C(2)B(10)H(10), 1, in excellent yield. Although the two boron atoms (B3 and B6) nearest to the carbon atoms in 1 are equally available for attack by nucleophiles, the boron-degradation reaction of 1 with alkoxide ion occurs only at the B6 vertex, yielding regioselectively [(CH(3))(3)NH][nido-2,4-I(2)-7,8-C(2)B(9)H(10)], 2. The molecular structures of 1 and 2 have been determined by X-ray diffraction studies. Crystallographic data are as follows. For 1, monoclinic, space group P2(1)/n, a = 6.9199(19) Angstroms, b = 23.9560(7) Angstroms, c = 7.2870(2) Angstroms, beta = 94.081(4) degrees, V = 1204.9(6) Angstroms(3), Z = 4, rho(calcd) = 2.18 g cm(-3), R = 0.020, R(w) = 0.0610; for 2, orthorhombic, space group Pca2(1), a = 14.1141(7) Angstroms, b = 7.0276(4) Angstroms, c = 16.4602(9) Angstroms, V = 1632.7(15) Angstroms(3), Z = 4, rho(calcd) = 1.81 gcm(-3), R = 0.022, R(w) = 0.0623.

  4. Polyoxometal cations within polyoxometalate anions. Seven-coordinate uranium and zirconium heteroatom groups in [(UO2)12(μ3-O)4(μ2-H2O)12(P2W15O56)4]32- and [Zr4(μ3-O)2(μ2-OH)2(H2O)4 (P2W16O59)2]14-

    Science.gov (United States)

    Gaunt, Andrew J.; May, Iain; Collison, David; Travis Holman, K.; Pope, Michael T.

    2003-08-01

    Two new composite polyoxotungstate anions with unprecedented structural features, [(UO2)12(μ3-O)4(μ2-H2O)12(P2W15O56)4]32- (1) and [Zr4(μ3-O)2(μ2-OH)2(H2O)4 (P2W16O59)2]14- (2) contain polyoxo-uranium and -zirconium clusters as bridging units. The anions are synthesized by reaction of Na12[P2W15O56] with solutions of UO2(NO3)2 and ZrCl4. The structure of 1 in the sodium salt contains four [P2W15O56]12- anions assembled into an overall tetrahedral cluster by means of trigonal bridging groups formed by three equatorial-edge-shared UO7 pentagonal bipyramids. The structure of anion 2 consists of a centrosymmetric assembly of two [P2W16O59]12- anions linked by a {Zr4O2(OH)2(H2O)4}10+ cluster. Both complexes in solution yield the expected two-line 31P-NMR spectra with chemical shifts of -2.95, -13.58 and -6.45, -13.69 ppm, respectively.

  5. Alpha particle emitters in medicine

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, D.R.

    1989-09-01

    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ({sup 211}At) and natural bismuth-212 ({sup 212}Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ({sup 223}Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs.

  6. Mining (except Oil and Gas) Sector (NAICS 212)

    Science.gov (United States)

    EPA Regulatory and enforcement information for the mining sector, including metal mining & nonmetallic mineral mining and quarrying. Includes information about asbestos, coal mining, mountaintop mining, Clean Water Act section 404, and abandoned mine lands

  7. Dicty_cDB: VSE212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence ---EIKTKLSDKKFISERSFGNFKXYLDLTKVLYQLDLNSINTQFENGFLTITINKKLHY SNTIKINLN*plvpfifilykymyninkf**iiis...Frame A: ---EIKTKLSDKKFISERSFGNFKXYLDLTKVLYQLDLNSINTQFENGFLTITINKKLHY SNTIKINLN*plvpfifilykymyninkf**iiis

  8. 25 CFR 212.1 - Purpose and scope.

    Science.gov (United States)

    2010-04-01

    ... development of individual Indian oil and gas, geothermal and solid mineral resources. These regulations are... the United States or is subject to restriction against alienation imposed by the United States. These regulations are intended to ensure that Indian mineral owners desiring to have their resources developed are...

  9. 9 CFR 113.212 - Bursal Disease Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... for vaccine production. All serials shall be prepared from the first through the fifth passage from... immunogenicity of vaccine prepared in accordance with the Outline of Production shall be established by a method... Production. The test shall establish that the vaccine, when used as recommended on the label, is capable of...

  10. 48 CFR 212.7002-2 - Subcontracts under the program.

    Science.gov (United States)

    2010-10-01

    ... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE ACQUISITION PLANNING ACQUISITION OF COMMERCIAL ITEMS Pilot Program... “commercial item” may be treated as a subcontract for a commercial item, if the subcontract— (1) Is for the...

  11. 22 CFR 212.1 - Statement of policy.

    Science.gov (United States)

    2010-04-01

    ... date. The Director, Office of Administrative Services, Bureau for Management, or his/her designee, is...”), pursuant to executive order and delegations of authority USAID is responsible not only for management of... agencies, foreign governments, international organizations, or non-governmental entities which do not...

  12. 212ʻ Fahrenheiti : eesti luule 2006 / Piret Bristol

    Index Scriptorium Estoniae

    Bristol, Piret, 1968-

    2008-01-01

    Järgmistest 2006. a. ilmunud luulekogudest: Ryytle, Indrek. Inglid rokijaamas. Puhja : I. Rüütle ; Runnel, Hando. Viru veri ei värise. Tartu : Ilmamaa ; Vabat, Martin. Mina olengi kirjandusklassik. Tartu : Eesti Kirjanduse Selts ; Korts, Eliina. Lööklaused murravad metsi. Tartu : Eesti Kirjanduse Selts ; Koff, Indrek. Vana laul. Luige : Verb ; Teede, Andra. Takso Tallinna taevas. Luige : Verb ; Vusser, Kaspar. Vusserduste võnked. Tallinn : P. Kukk ; Elbing, Andrus. Siin Beebilõust, tere! : häired pimelinna tänavalt = Ciao, it's Babyface : trouble from the streets of a blind city. Tallinn : Epifanio ; Hint, Miina. Vabaduse vang, ehk, Põrandaalune kirjandus. Tallinn : MR ; Jüriado, Tiiu. Luule on ime. Habaja : Kentaur ; Ligi, Katre. Naabrivalve. Tartu : Ilmamaa ; Krull, Hasso. Talv. Tallinn : Tuum ; Mets, Mae. Pühapäeval on reede. Tartu : Ilmamaa ; Ploom, Ülar. Porr ja sorry. Tallinn : Tuum ; Hirv, Indrek, Surmapõletaja. Tallinn : Tuum ; Piir, Milvi Martina. Kõrkjavaas. Tartu : Fantaasia ; Soomets, Triin. Väljas. Tallinn : Tuum ; Mathura. Kohalolu. Rapla : Allikäärne ; Afanasjev, Vahur. Katedraal Emajões. Tartu ; Brüssel : ID Salong//Sild, Ivar. Spermaga ja puha. Pärnu : Jumalikud Ilmutused ; Meiel, Kaupo. Polügrafisti käsiraamat. Pärnu : Jumalikud Ilmutused ; Kivisildnik, Sven. Vägistatud jäämägi. Pärnu : Jumalikud Ilmutused ; Arder, Ott. Luule sünnib kus sünnib kui sünnib / koost. Leelo Tungal. Tallinn : Tänapäev ; Kompus, Marko. Vallaliste jõgede tõkkejooksja. Tartu : M. Kompus

  13. 40 CFR 156.212 - Personal protective equipment statements.

    Science.gov (United States)

    2010-07-01

    ...: (body protection statement); (glove statement, if applicable); (footwear statement, if applicable... shall be based on the more toxic (lower numbered) category. 2 For labeling language for chemical-resistant gloves, see paragraph (f) of this section. 3 For labeling language for respiratory protection...

  14. 212 Soils and Nutrients Losses and Gains du

    African Journals Online (AJOL)

    2008-12-02

    Dec 2, 2008 ... Soil pH was measured in 1:2 soil/water suspensions with a glass electrode pH meter. (Mclean, 1982). Sodium (Na) and potassium (K) were determined using flame photometer, .... rain. REFERENCES. Anonymous (2003). Sokoto State Government. Ministry of Information, Youth, Sports and Culture, Sokoto.

  15. PODAAC-ASOP2-12X01

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset contains operational near-real-time Level 2 ocean surface wind vector retrievals from the Advanced Scatterometer (ASCAT) on MetOp-A at 12.5 km sampling...

  16. PODAAC-ASOP2-12C01

    Data.gov (United States)

    National Aeronautics and Space Administration — This dataset contains operational near-real-time Level 2 coastal ocean surface wind vector retrievals from the Advanced Scatterometer (ASCAT) on MetOp-A at 12.5 km...

  17. Dicty_cDB: VSI212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available YDVSAKSNYNFEKPXVWLTSKLLGNKAVTSRSTTNLKIT RNRSRFQLNEFI*krsr*cccppitrrq**lvnkfkkkkq*kkiiiiiikptinfnnlnp pkciink...VKPSQIVFHRRYNLSYYDVSAKSNYNFEKPXVWLTSKLLGNKAVTSRSTTNLKIT RNRSRFQLNEFI*krsr*cccppitrrq**lvnkfkkkkq*kkiiiiiikpt

  18. Dicty_cDB: VHH212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available MDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSGRADEQERGITIKSSSVSLHFEMPKEDKLPAGCTSHEFLINLIDSPGHVDFS ...MDRRENIRNMSVIAHVDHGKTTLSDSLIQRAGIIADKV SGDMRYMSGRADEQERGITIKSSSVSLHFEMPKEDKLPAGCTSHEFLINLIDSPGHVDFS

  19. 16 CFR 1500.212 - Definition of guaranty; suggested forms.

    Science.gov (United States)

    2010-01-01

    ... which case it may be a part of or attached to the invoice or bill of sale covering such shipment of.... (1) Limited form for use on invoice or bill of sale. (Name of person giving the guaranty or undertaking) hereby guarantees that no article listed herein is misbranded within the meaning of the Federal...

  20. 212 Soils and Nutrients Losses and Gains du

    African Journals Online (AJOL)

    2008-12-02

    Dec 2, 2008 ... fadama land during the period of the study (May-September). Over the same period, plant nutrients losses (in kg ha-1) with the eroded soil amounted to 30.8 organic matter, 0.3 K, 9.0 Na and 0.07 available P. Nutrient gains (in kg ha-1) amounted to 2.2 Total N and 4.4 Mg. Soil deposition was found to be ...

  1. 212 Emotional Intelligence and Self Efficacy as Correlates of Career ...

    African Journals Online (AJOL)

    FIRST LADY

    2011-01-18

    Jan 18, 2011 ... express their concern for the organization and its continued success and well being. Career commitment is very crucial in any organization and no doubt ... poor working condition, low status, lack of motivation and for (Fagebo, ... operating in stressful situations and under unfavourable conditions of service.

  2. Dicty_cDB: VHL212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available v*t vvrqvsftlllsivcviva*fstrgtvmpdhwsvglfdkivtcryhpldng*tplsqnpf *krkpnalececcr*h*vvgggplstlnhminrcytavsfrll...lsivcviva*fstrgtvmpdhwsvglfdkivtcryhpldng*tplsqnpf *krkpnalececcr*h*vvgggplstlnhm

  3. 76 FR 212 - Notice and Request for Comments

    Science.gov (United States)

    2011-01-03

    ... techniques or other forms of information technology, when appropriate; and (4) whether this collection of... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF TRANSPORTATION Surface Transportation Board Notice and Request for Comments AGENCY: Surface Transportation Board. ACTION...

  4. 212 Emotional Intelligence and Self Efficacy as Correlates of Career ...

    African Journals Online (AJOL)

    FIRST LADY

    2011-01-18

    Jan 18, 2011 ... (Adeyemo, 2001:Ajayi, 1999; Nwagwu and salami 1999). In Nigerian. Universities one can hardly see students choosing teaching as a profession. They opt for ... self efficacy are correlates of career commitment among secondary school ..... school students academic achievement and their relationship.

  5. All projects related to | Page 212 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    , North of Sahara, South of Sahara. Program: Maternal and Child Health. Total Funding: CA$ 41,236.00. Determination of Mucosal Secretory Factors that Influence Susceptibility to HIV Infection Among Female Sex Workers in Kenya. Project.

  6. 38 CFR 3.212 - Unexplained absence for 7 years.

    Science.gov (United States)

    2010-07-01

    ... finding of death made by another Federal agency will be accepted if the finding meets the requirements of... disappearance, and if evidence as provided in § 3.211 cannot be furnished, the death of such individual as of... presumption of death will be applicable to claims for benefits under laws administered by the Department of...

  7. 46 CFR 179.212 - Watertight bulkheads for subdivision.

    Science.gov (United States)

    2010-10-01

    ... (UNDER 100 GROSS TONS) SUBDIVISION, DAMAGE STABILITY, AND WATERTIGHT INTEGRITY Subdivision and Damage... passengers; or (2) Is constructed of wood on or after March 11, 2001, and operates in cold water. As an...

  8. Dicty_cDB: VHC212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available YNLSKLQDPRIEKLPYSIRILLESAVR NCDNFEVHEKDVENILNWENTANKVEIPFKPARVLLQDFTGVPAVVDLAAMRDAMKRLGG DPAKINPLVPV...YNLSKLQDPRIEKLPYSIRILLESAVR NCDNFEVHEKDVENILNWENTANKVEIPFKPARVLLQDFTGVPAVVDLAAMRDAMKRLGG DPAKINPLVPV

  9. 12 CFR 212.4 - Interlocking relationships permitted by statute.

    Science.gov (United States)

    2010-01-01

    ... the end of the 60-day period. (2) The Board may disapprove a notice of proposed service if it finds... and securities companies; (g) A depository organization that is closed or is in danger of closing as... depository organization. This exemption lasts for five years, beginning on the date the depository...

  10. Dicty_cDB: CHC212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce nqqr*innklrc*hsnn*kkpkkisllmkinselhqamkp*wklsri*kprttefqslkm klml*iyy*mesqkvlkscalavvplmksvsrkfisvmilhsst...c*hsnn*kkpkkisllmkinselhqamkp*wklsri*kprttefqslkm klml*iyy*mesqkvlkscalavvplmksvsrkfisvmilhsstfikrf*lyqlinkl...**itrxk elnnsvyhv--- ---tnkgk*iin*dvniqtikrnrkrfhc**k*iqsctkq*nl*wklsri*kprttefqs lkmklml*iyy*mesqkvlkscalav

  11. 18 CFR 706.212 - Miscellaneous statutory provisions.

    Science.gov (United States)

    2010-04-01

    ... prohibitions against political activities in Subchapter III of Chapter 73 of Title 5, United States Code and 18... knowingly engage in self-dealing with a private foundation (26 U.S.C. 4941, 4946). “Self-dealing” is defined... foundation. ...

  12. Dicty_cDB: VHE212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DN816506 |A Chain A, The Structure Of The Bovine Lysosomal A-Mannosidase Suggests A Novel Mechanism For Low ...26 |A Chain A, The Structure Of The Bovine Lysosomal A-Mannosidase Suggests A Novel Mechanism For Low Ph Act...hanism For Low Ph Activation, mRNA sequence. 52 2e-16 4 ...rensis cDNA, mRNA sequence. 117 2e-23 3 DN814237 |A Chain A, The Structure Of The Bovine Lysosomal A-Mannosidase Suggests A Novel Mec

  13. 7 CFR 980.212 - Import regulations; tomatoes.

    Science.gov (United States)

    2010-01-01

    ... the Federal-State Inspection Service, Food Safety and Quality Service, United States Department of.... 33 1 All other points Chief, Fresh Products Branch, Fruit and Vegetable Quality Division, Food Safety... number, the truck and trailer license number, the name of the vessel, or other identification of the...

  14. 50 CFR 300.212 - Vessel permit endorsements.

    Science.gov (United States)

    2010-10-01

    ... applicant may at any time submit a new application for consideration. (f) Validity. A WCPFC Area Endorsement... of each special product or service. The fee is specified in the application form. The appropriate fee...

  15. 7 CFR 868.212 - Special grades and requirements.

    Science.gov (United States)

    2010-01-01

    ... rough rice. Glutinous rough rice shall be special varieties of rice (Oryza sativa L. glutinosa) which... rice shall be special varieties of rice (Oryza sativa L. scented) that have a distinctive and...

  16. 25 CFR 212.56 - Geological and geophysical permits.

    Science.gov (United States)

    2010-04-01

    ... conflict with any mineral lease entered into pursuant to this part may be approved by the Secretary with..., authorize the production of, or removal of oil and gas, or geothermal resources, or other minerals except...

  17. 212 The Functionality of Being in Pantaleon's Operative ...

    African Journals Online (AJOL)

    User

    2012-01-24

    Jan 24, 2012 ... The earliest definitions of being from the ancient philosophers, through the scholastics to Descartes and Kant as that which exist have remained abstract and unsubstantive. Although they have answered the question of what is being, Pantaleon (1994) argues that they are yet to answer the question of.

  18. 26 CFR 1.212-1 - Nontrade or nonbusiness expenses.

    Science.gov (United States)

    2010-04-01

    ..., hobby, or recreation are not allowable as nontrade or nonbusiness expenses. The question whether or not... as a sport, hobby, or recreation, is not to be determined solely from the intention of the taxpayer..., campaign expenses of a candidate for public office, bar examination fees and other expenses paid or...

  19. 48 CFR 333.212 - Contracting Officer's duties upon appeal.

    Science.gov (United States)

    2010-10-01

    ... correspondence between the parties pertinent to the appeal, including the letter or letters of claim in response... Contracting Officer shall furnish the appeal file to the Government Trial Attorney for review and approval... Officer shall provide Government witnesses and specified physical and documentary evidence to the Trial...

  20. Subtask 2.12 - Air Quality Assessment and Control

    Energy Technology Data Exchange (ETDEWEB)

    Laura Raymond

    2007-07-30

    Past particulate matter (PM) research projects conducted at the Energy & Environmental Research Center included data on PM size, morphology, and chemistry. The objective of this project was to improve automated analysis capabilities of the scanning electron microscope (SEM) equipped with an energy-dispersive spectrometer. The SEM is now able to perform particle-by-particle analysis on the desired number of particles and provide size, morphology, and chemistry information for each particle. A new x-ray and image analysis system was purchased and implemented for improvements to data acquisition and analysis. This new analysis system is equipped with a digital-pulse processor, allowing for the determination of pixel-by-pixel chemistry, which significantly enhances our ability to characterize PM and other materials. In addition, this system is personal computer-based, which allows programming of the SEM to perform the automated image analysis along with detailed chemical information. This permits the incorporation of particle classification algorithms within the same computer system as the analysis is conducted. Additionally, the new Spirit software can now integrate full SEM control with imaging, elemental identification, and electron backscatter diffraction (EBSD) operation. The EBSD system has also allowed for phase identification within the SEM. Reexamination of previous samples collected on a polycarbonate filter for ambient-air PM2.5 analysis has shown that crystalline identification of individual particles can be done without further sample preparation or modification of the sample and/or sampling substrate.

  1. 8 CFR 1212.4 - Applications for the exercise of discretion under section 212(d)(1) and 212(d)(3).

    Science.gov (United States)

    2010-01-01

    ... application for admission at POEs in the United States is valid; (vii) The justification for exercising the... at U.S. POEs and may be valid for multiple entries. (ii) An authorization issued in conjunction with.... POEs and shall be valid for multiple entries. (iii) A multiple entry authorization for a person other...

  2. Coordination chemistry of the {sup 212}Pb/{sup 212}Bi nuclear transformation: Alpha-emitting radiopharmaceuticals. Final technical report

    Energy Technology Data Exchange (ETDEWEB)

    Parks, N.J.; Harris, W.R.; Keen, C.L.; Cooper, S.R.

    1992-07-01

    Subdivisions of this project are: (a) the synthesis of prototypical thiolate and dithiocarbamate based hexacoordinate complexes, (b) radiochemical engineering for generation of no-carrier-added lead and bismuth radioelements, (c) the first isolation of bismuth-binding proteins from in vivo studies with cyclotron produced {sup 205/206}Bi tracer, and (d) initial development of transport mechanisms for the intracellular radiobiological study of alpha emitting bismuth, and (e) the initiation of chemical equilibrium studies and biochemical pathways with cyclotron-produced, no-carrier-added, {sup 203}Pb (T{sub 1/2} = 51 hr).

  3. Immuno-vectorization of radioelements emitters of alpha particles: a new therapy in cancerology; Immunovectorisation de radioelements emetteurs de particules alpha: une nouvelle voie therapeutique en cancerologie

    Energy Technology Data Exchange (ETDEWEB)

    Bourgeois, M

    2007-05-15

    The radio-immunotherapy is an anti cancerous therapy which consists in vectorising with immuno-specific agents very radio toxic radioelements on tumors or in their environment to destroy them. The first part of this report presents the different characteristics of antibodies as well as their means of production under monoclonal shapes specifically steered against a tumoral antigen of interest. The second part of this report replaces the importance of the immunological vectors in the context of the nuclear medicine. It is notably described that the different methods which allow to radio-label the vector, as well as the different ways of optimization which were envisaged to improve the targeting of radioelements on a tumor. These different developments allow to define the potential place of the alpha radio-immunotherapy in treatments and so re-place the interest of the experimental part. If the radio-immunotherapy, using beta emitters isotopes as the {sup 131}iodine or the{sup 90}yttrium, is today current in anti cancerous therapy, it finds limits because of the disintegration characteristics of the isotopes it uses. Indeed, compared with alpha particles, the beta particles deposit less energy by unit of length in the crossed material.The experimental part of this report aims at studying the feasibility of the coupling between an immunological vector and an alpha emitter isotope.The different tests led on the bismuth 213, the bismuth 212, the lead 212 and the astatine 211 demonstrated that the fixation of these radionuclides was possible. This research theme is strengthened by the construction in Nantes of a cyclotron with high energy ( A.R.R.O.N.A.X.) and the optimization of the obtained promising results should allow a therapeutic use in oncology of the alpha radio-immunotherapy. (N.C.)

  4. EMPHASIS™/Nevada UTDEM User Guide Version 2.1.2

    Energy Technology Data Exchange (ETDEWEB)

    Turner, C. David [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Pasik, Michael F. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Seidel, David B. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Pointon, Timothy D. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Cartwright, Keith L. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Kramer, Richard M. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); McGregor, Duncan A. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2017-11-15

    The Unstructured Time-Domain ElectroMagnetics (UTDEM) portion of the EMPHASIS suite solves Maxwell’s equations using finite-element techniques on unstructured meshes. This document provides user-specific information to facilitate the use of the code for applications of interest.

  5. 212 Wealth Creation and Poverty Alleviation in Nigeria: The Role of ...

    African Journals Online (AJOL)

    User

    2010-10-17

    Oct 17, 2010 ... The meeting of the delegates on IT in the global village in November, 1998 pointed out “that the developing ... reached crisis level and is a major cause of absolute poverty. According to. Arizona (2008), the ... The escalation of youth unemployment in Nigeria has continued to exacerbate the poverty situation ...

  6. Immobilization of Organophosphorus Acid Anhydrolase Mutant Y212F on Silica Nanospheres

    Science.gov (United States)

    2016-09-01

    Approved for public release; distribution is unlimited. Mark A. Guelta Steven P. Harvey Melissa...5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) Guelta , Mark A.; Harvey, Steven P.; Dixon, Melissa M. (ECBC); and Baldwin, Richard...Army Edgewood Chemical Biological Center (ECBC) Agent Chemistry Branch RDCB-DRC-C ATTN: Guelta , M. Harvey, S. McMahon

  7. 21 CFR 212.5 - To what drugs do the regulations in this part apply?

    Science.gov (United States)

    2010-04-01

    ... definition of a PET drug must be manufactured in accordance with the current good manufacturing [email protected], Internet address: http://www.usp.org/USPNF/notices. You may inspect a copy at the Food and...

  8. 36 CFR 212.10 - Maximum economy National Forest System roads.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Maximum economy National... economy National Forest System roads. The Chief may acquire, construct, reconstruct, improve, and maintain... Forest Service in locations and according to specifications which will permit maximum economy in...

  9. Characteristics of premaxillary supernumerary teeth in primary and mixed dentitions: a retrospective analysis of 212 cases.

    Science.gov (United States)

    Shekhar, Madiraju G

    2012-08-01

    To investigate the characteristics and distribution of premaxillary supernumerary teeth affecting primary and mixed dentitions in Indian children. This retrospective analysis included 11 200 children, aged 3-12 years, who attended a pediatric dental clinic for dental care during the period 2007-2010. The children were divided into group I (aged 3-6 years) and group II (aged 7-12 years), and data regarding maxillary anterior supernumerary teeth, diagnosed both as isolated and/or as unexpected findings during routine clinical and radiological examinations, were gathered. Pearson's χ(2) -test, with a 0.05 level of significance, was used for the analysis. The overall prevalence of premaxillary supernumerary teeth in primary and mixed dentitions was 1.9%. Single supernumerary teeth (84.9%) and conical morphology (68.7%) were commonly seen in both groups. The most common sagittal position was palatal (92.3%) among both erupted and impacted maxillary anterior supernumerary teeth. The prevalence of premaxillary supernumerary teeth in Indian children found in this study was 1.9%, with an overall male to female ratio of 1.7:1. Single supernumerary teeth, conical morphology, and erupted supernumerary teeth were the most commonly seen. Supernumerary teeth associated with clinical complications were relatively low (48%), and axial rotation or displacement of maxillary incisors was the most common sequelae. © 2012 Blackwell Publishing Asia Pty Ltd.

  10. (E-1-(2,4-Dinitrophenyl-2-[1-(2-methoxyphenylethylidene]hydrazine

    Directory of Open Access Journals (Sweden)

    Hoong-Kun Fun

    2011-12-01

    Full Text Available The molecule of the title compound, C15H14N4O5, is in an E conformation with respect to the C=N double bond and the dihedral angle between the two benzene rings is 37.83 (7°. The ethylidenehydrazine plane makes dihedral angles of 4.93 (9 and 42.38 (9° with the two benzene rings. An intramolecular N—H...O hydrogen bond generates an S(6 ring motif. In the crystal, molecules are linked by weak C—H...O interactions into chains along the c axis which are stacked along the b axis by aromatic π–π interactions with a centroid–centroid distance of 3.5927 (10 Å.

  11. 75 FR 5681 - Airworthiness Directives; Bell Helicopter Textron, Inc. Model 205B and 212 Helicopters

    Science.gov (United States)

    2010-02-04

    ... stations 24.5 and 40.0 for an edge void, corrosion, or a crack, using a 3x power or higher magnifying glass... blade stations 24.5 and 40.0 for any corrosion or a crack using a 3x power or higher magnifying glass. If a crack is found in the paint finish, removing the paint and re-inspecting the M/R blade is...

  12. Page 1 212 Ashfaq Khokhar and Viktor K Prasanna 1. repeat 2 ...

    Indian Academy of Sciences (India)

    relations C1 and C2 are defined as follows. We say be verifies C1 (an) if: 1. Q'(a) # 9, by is in Q'(an) else by is in Sp(a));. 2. Either be # by, or an and a do not overlap. In order to expose the potential parallelism, the computations performed in the algorithm are shown in figure 3. The procedure i-pref (i, j, QT(a)) shown in figure ...

  13. 21 CFR 212.50 - What production and process controls must I have?

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false What production and process controls must I have... must I have? You must have adequate production and process controls to ensure the consistent production...) Written control procedures. You must have written production and process control procedures to ensure and...

  14. Yeast Interacting Proteins Database: YHR005C, YOR212W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available triggering an adaptive response; activates Vps34p at the endosome Rows with this bait as bait (1) Rows with this...triggering an adaptive response; activates Vps34p at the endosome Rows with this bait as bait Rows with this bait

  15. 20 CFR 702.212 - Notice; when given; when given for certain occupational diseases.

    Science.gov (United States)

    2010-04-01

    ... within thirty (30) days of the date of the injury or death. For this purpose the date of injury or death is: (1) The day on which a traumatic injury occurs; (2) The date on which the employee or claimant is..., DEPARTMENT OF LABOR LONGSHOREMEN'S AND HARBOR WORKERS' COMPENSATION ACT AND RELATED STATUTES ADMINISTRATION...

  16. SU-F-T-212: A Comparison of Treatment Strategies for Intracranial Stereotactic Radiosurgery

    Energy Technology Data Exchange (ETDEWEB)

    Lamberton, T [Loma Linda University, Loma Linda, CA (United States); Slater, J; Wroe, A [Loma Linda University Medical Center, Loma Linda, CA (United States)

    2016-06-15

    Purpose: Stereotactic radiosurgery is an effective and noninvasive treatment for intracranial lesions that uses highly focused radiation beams in a single treatment fraction. The purpose of this study is to investigate the dosimetric differences between the treatment brain metastasis with a proton beam vs. intensity modulated radiation therapy (IMRT). Methods: Ten separate brain metastasis targets where chosen and treatment plans were created for each, using three different strategies: custom proton beam shaping devices, standardized proton beam shaping devices, and IMRT. Each plan was required to satisfy set parameters for providing adequate coverage and minimizing risk to adjacent tissues. The effectiveness of each plan was calculated by comparing the homogeneity index, conformity index, and V12 for each target using a paired one tailed T-test (α=0.05). Specific comparison of the conformity indices was also made using a subcategory containing targets with volume>1cc. Results: There was no significant difference between the homogeneity indices of the three plans (p>0.05), showing that each plan has the capability of adequately covering the targets. There was a statistically significant difference (p<0.01) between the conformity indices of the custom and the standard proton plan, as with the custom proton and IMRT (p<0.01), with custom proton showing stronger conformity to the target in both cases. There was also a statistical difference between the V12 of all three plans (Custom v. Standardized: p=0.02, Custom v. IMRT: p<0.01, Standardized v. IMRT: p<0.01) with custom proton supplying the lowest dose to surrounding tissues. For large targets (volume>1cc) there was no statistical difference between the proton plans and the IMRT treatment for the conformity index. Conclusion: A custom proton plan is the recommended treatment explored in this study as it is the most reliable way of effectively treating the target while sparing the maximum amount of normal tissue.

  17. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (212-0612-332211)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  18. 10 CFR 600.212 - Special grant or subgrant conditions for “high-risk” recipients.

    Science.gov (United States)

    2010-01-01

    ... grantee or subgrantee: (1) Has a history of unsatisfactory performance, or (2) Is not financially stable, or (3) Has a management system which does not meet the management standards set forth in this subpart...) Requiring the grantee or subgrantee to obtain technical or management assistance; or (6) Establishing...

  19. Tank 241-AX-103, cores 212 and 214 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Steen, F.H.

    1998-02-05

    This document is the analytical laboratory report for tank 241-AX-103 push mode core segments collected between July 30, 1997 and August 11, 1997. The segments were subsampled and analyzed in accordance with the Tank 241-AX-103 Push Mode Core Sampling and Analysis Plan (TSAP) (Comer, 1997), the Safety Screening Data Quality Objective (DQO) (Dukelow, et al., 1995) and the Data Quality Objective to Support Resolution of the Organic Complexant Safety Issue (Organic DQO) (Turner, et al., 1995). The analytical results are included in the data summary table (Table 1). None of the samples submitted for Differential Scanning Calorimetry (DSC), Total Alpha Activity (AT), plutonium 239 (Pu239), and Total Organic Carbon (TOC) exceeded notification limits as stated in the TSAP (Conner, 1997). The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group in accordance with the Memorandum of Understanding (Schreiber, 1997) and not considered in this report.

  20. 10 CFR 72.212 - Conditions of general license issued under § 72.210.

    Science.gov (United States)

    2010-01-01

    ... areas have been designed to adequately support the static and dynamic loads of the stored casks... the Safety Analysis Report (SAR) referenced in the Certificate of Compliance and the related NRC... site parameters, including analyses of earthquake intensity and tornado missiles, are enveloped by the...

  1. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (212-0612-272217)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  2. 8 CFR 212.7 - Waiver of certain grounds of inadmissibility.

    Science.gov (United States)

    2010-01-01

    ... she will be subject to persecution on account of race, religion, or political opinion, may apply for a... account of race, religion, or political opinion, must be supported by a statement, dated and signed by the... Service's records shall be noted accordingly. (B) Denial. If the Director of USIA issues a favorable...

  3. 8 CFR 212.15 - Certificates for foreign health care workers.

    Science.gov (United States)

    2010-01-01

    ... to be non-clinical include, but are not limited to, medical teachers, medical researchers, and... independent, and free of material conflicts of interest regarding whether an alien receives a visa. (vii) The...

  4. 30 CFR 75.212 - Rehabilitation of areas with unsupported roof.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Rehabilitation of areas with unsupported roof... Rehabilitation of areas with unsupported roof. (a) Before rehabilitating each area where a roof fall has occurred... rehabilitation work shall be instructed in the clean-up and support procedures; and (3) Ineffective, damaged or...

  5. 22 CFR 212.35 - Schedule of fees and method of payment for services rendered.

    Science.gov (United States)

    2010-04-01

    ... secondary school, an institution of graduate higher education, an institution of undergraduate higher education, an institution of professional education, or an institution of vocational education which... purchase or subscription by the general public). These examples are not intended to be all-inclusive...

  6. 212 Analyse de la dynamique des pâturages autour des ouvrages ...

    African Journals Online (AJOL)

    Ali B. Béchir

    aléas climatiques. La plaine a été arasée avec remobilisation du sol sous forme d'une couche poudreuse homogène. Quelques grandes dunes subsistaient parsemées de bois mort et des chicots qui ont affleuré avec quelques rejets verdoyants des ligneux comme Acacia tortilis. En comparaison au précédent, le second.

  7. EMPHASIS™/Nevada CABANA User Guide Version 2.1.2

    Energy Technology Data Exchange (ETDEWEB)

    Turner, C. David [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Bohnhoff, William J. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Powell, Jennifer L. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2017-11-15

    The CABle ANAlysis (CABANA) portion of the EMPHASIS™ suite is designed specifically for the simulation of cable SGEMP. The code can be used to evaluate the response of a specific cable design to threat or to compare and minimize the relative response of difference designs. This document provides user-specific information to facilitate the application of the code to cables of interest.

  8. 7 CFR 1430.212 - Contract modifications and statutory changes in program.

    Science.gov (United States)

    2010-01-01

    ... the next fiscal year, death of producer on the contract, new member joining the operation, member... contract preceded the statutory change. Operations will be given the option of accepting the changes or...

  9. 20 CFR 703.212 - Required reports; examination of insurance carrier accounts.

    Science.gov (United States)

    2010-04-01

    ... statement reporting the carrier's open cases as of the date of such report, listing by State all death and... necessary, the Office may inspect or examine a carrier's books of account, records, and other papers to.... Alternatively, the Office may accept an adequate independent audit by a certified public accountant. ...

  10. Integrated radwaste treatment system lessons learned from 2{1/2} years of operation

    Energy Technology Data Exchange (ETDEWEB)

    Baker, M.N.; Fussner, R.J.

    1997-05-01

    The Integrated Radwaste Treatment System (IRTS) at the West Valley Demonstration Project (WVDP) is a pretreatment scheme to reduce the amount of salts in the high-level radioactive waste (vitrification) stream. Following removal of cesium-137 (Cs-137) by ion-exchange in the Supernatant Treatment System (STS), the radioactive waste liquid is volume-reduced by evaporation. Trace amounts of Cs-137 in the resulting distillate are removed by ion-exchange, then the distillate is discharged to the existing plant water treatment system. The concentrated product, 37 to 41 percent solids by weight, is encapsulated in cement producing a stable, low-level waste form. The Integrated Radwaste Treatment System (IRTS) operated in this mode from May 1988 through November 1990, decontaminating 450,000 gallons of high-level waste liquid; evaporating and encapsulating the resulting concentrates into 10,393 71-gallon square drums. A number of process changes and variations from the original operating plan were required to increase the system flow rate and minimize waste volumes. This report provides a summary of work performed to operate the IRTS, including system descriptions, process highlights, and lessons learned.

  11. 8 CFR 1212.3 - Application for the exercise of discretion under former section 212(c).

    Science.gov (United States)

    2010-01-01

    ... April 24, 1996. Section 440(d) of Antiterrorism and Effective Death Penalty Act of 1996 (AEDPA) shall... Effective Death Penalty Act of 1996, with respect to a conviction if the alien pleaded guilty or nolo... 440(d) of the Antiterrorism and Effective Death Penalty Act of 1996, with respect to a conviction if...

  12. 48 CFR 52.212-4 - Contract Terms and Conditions-Commercial Items.

    Science.gov (United States)

    2010-10-01

    ... infringe, any United States or foreign patent, trademark or copyright, arising out of the performance of...) and Office of Management and Budget (OMB) prompt payment regulations at 5 CFR part 1315. (h) Patent... software; (5) solicitation provisions if this is a solicitation; (6) other paragraphs of this clause; (7...

  13. Exercise, Nutrition and You: An Off-Campus Course for Grades 2?12

    Science.gov (United States)

    Snyder, Ann C.; Mauzy-Melitz, Debra K.

    2005-01-01

    Since interest in science classes has declined recently and obesity, especially in youth, continues to increase, an exercise physiology-based course was taught in public parks to promote active-learning science and healthy living. The course emphasized and integrated exercise, nutrition, and health during a 3-h session. Following an introduction,…

  14. CAVEMAN: Configuration And VErsion MANagement. User`s guide, v2.1.2

    Energy Technology Data Exchange (ETDEWEB)

    Dyer, K.M.

    1993-03-12

    The mission of the CAVEMAN project is to provide the tools for large code systems so that those who work on them can perform source control and configuration control on UNIX-based file servers, rather than the LC Crays. An outside product called cvs has been chosen as the underlying source control system. The initials stand for {open_quotes}Concurrent Versions System{close_quotes}. It is a freeware program that runs on most UNIX stations. To quote from the cvs man page: {open_quotes}cvs is a front end to the rcs revision control system which extends the notion of revision control from a collection of files in a single directory to a hierarchical collection of directories consisting of revision controlled files. These directories and files can be combined together to form a software release. cvs provides the functions necessary to manage these software releases and to control the concurrent editing of source files among multiple software developers.{close_quotes} While cvs may be run directly, there are several tasks in the LLNL environment that it seemed either safer or easier to automate. CAVEMAN provides the needed functionality, generally in the form of wrappers to cvs.

  15. Environmental Assessment: Demolish Buildings 212, 218, 819, 820 at Grand Forks Air Force Base

    Science.gov (United States)

    2007-01-31

    I (wet meadow) to Type V (open freshwater ). Approximately 59,500 acres of wetland Type I to V are used for wetland habitat. Wetland Types IV and...mosquito control. Herbicides, such as picloram, nonselective glyphosate and 2, 4-D are used to maintain areas on base. Military Public Health and

  16. 48 CFR 52.212-1 - Instructions to Offerors-Commercial Items.

    Science.gov (United States)

    2010-10-01

    ... ordered from the Department of Defense Single Stock Point (DoDSSP) by— (i) Using the ASSIST Shopping..., Facsimile (202) 619-8978. (ii) If the General Services Administration, Department of Agriculture, or Department of Veterans Affairs issued this solicitation, a single copy of specifications, standards, and...

  17. From a music therapists' diary 3/12 1996 - 2/12 1997

    DEFF Research Database (Denmark)

    Bergstrøm-Nielsen, Carl

    2009-01-01

    Graphic sketches made within a period of one year. They were made right after the sessions. Purpose was to investigate possibilities in graphic representation and to let various observarions and thoughts about the therapy become graspable. Around one third of the total quantity has been selected...

  18. 40 CFR 63.212 - What parts of my facility does this subpart cover?

    Science.gov (United States)

    2010-07-01

    ... CATEGORIES National Emission Standards for Hazardous Air Pollutants for Polyvinyl Chloride and Copolymers...) The affected source subject to this subpart is the collection of all equipment and activities in vinyl...

  19. Page 1 - 212 G Rajasekaran and K V L. Sarma Figure 6. Allowed ...

    Indian Academy of Sciences (India)

    the case K = 1 when scaling is assumed. This plot is also valid for (22/5c) as the ordinate. maximum and minimum values corresponding to the bounds (3.12). For the case of K = 1 (i.e., scaling) we see that as Ra approaches 1/3 or 3, the value of. AP. (27.15) approaches unity and hence W. approaches Aa. An interesting ...

  20. 48 CFR 52.212-3 - Offeror Representations and Certifications-Commercial Items.

    Science.gov (United States)

    2010-10-01

    ... represents, for general statistical purposes, that it □ is, □ is not a small disadvantaged business concern... in this provision— Emerging small business means a small business concern whose size is no greater.... Restricted business operations means business operations in Sudan that include power production activities...

  1. The Declaration of Independence: Save Our History[TM]. Teacher's Manual, Grades 2-12.

    Science.gov (United States)

    Hovey, Elizabeth; O'Connell, Libby Haight

    The Declaration of Independence today serves as one of the nation's most treasured symbols. The Declaration of Independence represents the moment at which the United States of America was born and embodies the reasons for its birth. This teacher's manual is designed to provide teachers with materials and activities to foster students'…

  2. Exercise, nutrition and you: an off-campus course for grades 2-12.

    Science.gov (United States)

    Snyder, Ann C; Mauzy-Melitz, Debra K

    2005-06-01

    Since interest in science classes has declined recently and obesity, especially in youth, continues to increase, an exercise physiology-based course was taught in public parks to promote active-learning science and healthy living. The course emphasized and integrated exercise, nutrition, and health during a 3-h session. Following an introduction, five hands-on laboratory-based student modules were performed. Students performed respiratory, cardiovascular, temperature regulation, energy expenditure, oxygen uptake, and exercise modules. During most modules, the students made measurements at rest and during the performance of exercise at different intensities. The students were very involved and engaged in problem solving throughout the session. The program was given for 10 days to more than 500 students representing 18 classes from 10 different schools. Evaluations indicated that the program was a real-life science experience that gave the students a new understanding of how their bodies worked and the purpose of exercise. The students and teachers also experienced "school learning" put into action as the program fit well with their science curriculum.

  3. 212 Analyse de la dynamique des pâturages autour des ouvrages ...

    African Journals Online (AJOL)

    Ali B. Béchir

    ils ont permis de lever les contraintes qui empêchent leur exploitation en saison sèche. Toutefois, leur ... permettre l'exploitation des pâturages pendant la saison sèche, plusieurs puits pastoraux y ont été installés depuis des ... des plaines, des chaines de montagnes, des ravins, des dunes et des bas-fonds. Les sols sont ...

  4. Yeast Interacting Proteins Database: YDL167C, YBR212W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ances its degradation; overexpression impairs mitochondrial function; expressed in stationary phase Rows wit...ial porin (POR1) mRNA and enhances its degradation; overexpression impairs mitochondrial function; expressed

  5. 12q21.2q22 deletion: a new patient.

    Science.gov (United States)

    Oliveira, Renata; Pereira, Cristina; Melo, Joana B; Mesquita, Sandra; Venâncio, Margarida; Carreira, Isabel Marques; Saraiva, Jorge

    2015-08-01

    Interstitial deletions of long arm of chromosome 12 are rare, and the interstitial deletion 12q21.1q22 has been reported to the best of our knowledge in only four patients. Comparing the patients reported, a characteristic phenotypic pattern (facial features like prominent forehead, short and upturned nose, low set ears, and ectodermal abnormalities) can be identified. It has been suggested to be considered a deletion syndrome [Klein et al., (2005); Am J Med Genet 138:349-354]. We report on a 34-month-old girl, who was referred to our clinic at 6 months of age, presenting at birth with axial hypotonia, enlarged anterior fontanel, ventriculomegaly, dysmorphic facies (prominent forehead, sparse hair and eyebrows, short palpebral fissures), failure to thrive and development delay. Her cytogenetic study showed an interstitial deletion of the long arm of chromosome 12: 46,XX,del(12)(q21.1q22) redefined by array comparative genomic hybridization. We compare and review our patient with the four previously reported cases, plus one with a deletion with an overlap of the chromosomal region and phenotypic similarities. As far as we know our patient is the fourth reported with this cytogenetic abnormality. This additional report allows us to support a genotype-phenotype correlation for this chromosomal abnormality. © 2015 Wiley Periodicals, Inc.

  6. Etude des générateurs in vivo Pb-212/Bi-212 et U-230/Th-226 pour la radiothérapie alpha ciblée

    OpenAIRE

    Le Du, Alicia

    2011-01-01

    Alpha-radioimmunotherapy is a promising cancer therapy that uses a-particles vectorized by monoclonal antibody to break down cancerous tumors. The notion of in vivo generator was introduced in 1989 by Leonard Mausner. The concept involves labeling of various molecular carriers (antibodies, peptides, etc) with intermediate half-life generator parents, which after accumulation in the desired tissue generate much shorter half-life daughter radionuclide. This thesis focuses on the study of two in...

  7. 48 CFR 52.212-5 - Contract Terms and Conditions Required To Implement Statutes or Executive Orders-Commercial Items.

    Science.gov (United States)

    2010-10-01

    ...). ___(2) 52.203-13, Contractor Code of Business Ethics and Conduct (APR 2010)(Pub. L. 110-252, Title VI... required by the clause— (i) 52.203-13, Contractor Code of Business Ethics and Conduct (APR 2010) (Pub. L... Business Ethics and Conduct (APR 2010) (Pub. L. 110-252, Title VI, Chapter 1 (41 U.S.C. 251 note)). (B) 52...

  8. CALiPER Report 21.2. Linear (T8) LED Lamp Performance in Five Types of Recessed Troffers

    Energy Technology Data Exchange (ETDEWEB)

    None

    2014-05-01

    Although lensed troffers are numerous, there are many other types of optical systems as well. This report looks at the performance of three linear (T8) LED lamps—chosen primarily based on their luminous intensity distributions (narrow, medium, and wide beam angles)—as well as a benchmark fluorescent lamp in five different troffer types. Also included are the results of a subjective evaluation. Results show that linear (T8) LED lamps can improve luminaire efficiency in K12-lensed and parabolic-louvered troffers, effect little change in volumetric and high-performance diffuse-lensed type luminaires, but reduce efficiency in recessed indirect troffers. These changes can be accompanied by visual appearance and visual comfort consequences, especially when LED lamps with clear lenses and narrow distributions are installed. Linear (T8) LED lamps with diffuse apertures exhibited wider beam angles, performed more similarly to fluorescent lamps, and received better ratings from observers. Guidance is provided on which luminaires are the best candidates for retrofitting with linear (T8) LED lamps.

  9. Page 1 212 S N Sen and S K Sadhya has been shown in figure 2 for ...

    Indian Academy of Sciences (India)

    mercury namely (7°S - 6°Po12) (25461 A, A4358A, A4047A) have the same upper. 1.56 i. 3.33 x 10" idis = 2 Amp | GRAD]ENT. Pair = 0.05 TORR idiº - 2.25 Amp GRADIENT. Pair = 0.90 TORR J 5.19 x 10". 1,00. G 25 50 flu Xu Exp [-(Et-E, )/ KT.s. Figure 2. Variation of (I.1)nax/1, with ſ.3, exp (-(E)-Eo)/KT-B) (A) for arc current.

  10. Radiogenic Side Effects After Hypofractionated Stereotactic Photon Radiotherapy of Choroidal Melanoma in 212 Patients Treated Between 1997 and 2007

    Energy Technology Data Exchange (ETDEWEB)

    Dunavoelgyi, Roman [Department of Ophthalmology, Medical University of Vienna, Vienna (Austria); Dieckmann, Karin [Department of Radiology, Medical University of Vienna, Vienna (Austria); Gleiss, Andreas [Section of Clinical Biometrics, Medical University of Vienna, Vienna (Austria); Sacu, Stefan; Kircher, Karl; Georgopoulos, Michael [Department of Ophthalmology, Medical University of Vienna, Vienna (Austria); Georg, Dietmar [Department of Radiology, Medical University of Vienna, Vienna (Austria); Zehetmayer, Martin, E-mail: martin.zehetmayer@meduniwien.ac.at [Department of Ophthalmology, Medical University of Vienna, Vienna (Austria); Poetter, Richard [Department of Radiology, Medical University of Vienna, Vienna (Austria)

    2012-05-01

    Purpose: To evaluate side effects of hypofractionated stereotactic photon radiotherapy for patients with choroidal melanoma. Patients and Methods: Two hundred and twelve patients with choroidal melanoma unsuitable for ruthenium-106 brachytherapy or local resection were treated stereotactically at the Medical University of Vienna between 1997 and 2007 with a Linac with 6-MV photon beams in five fractions with 10, 12, or 14 Gy per fraction. Examinations for radiogenic side effects were performed at baseline and every 3 months in the first 2 years, then every 6 months until 5 years and then once a year thereafter until 10 years after radiotherapy. Adverse side effects were assessed using slit-lamp examination, funduscopy, gonioscopy, tonometry, and, if necessary, fundus photography and fluorescein angiography. Evaluations of incidence of side effects are based on an actuarial analysis. Results: One hundred and eighty-nine (89.2%) and 168 (79.2%) of the tumors were within 3 mm of the macula and the optic disc, respectively. The five most common radiotherapy side effects were retinopathy and optic neuropathy (114 cases and 107 cases, respectively), cataract development (87 cases), neovascular glaucoma (46 cases), and corneal epithelium defects (41 cases). In total, 33.6%, 38.5%, 51.2%, 75.5%, and 77.6% of the patients were free of any radiation retinopathy, optic neuropathy, cataract, neovascular glaucoma, or corneal epithelium defects 5 years after radiotherapy, respectively. Conclusion: In centrally located choroidal melanoma hypofractionated stereotactic photon radiotherapy shows a low to moderate rate of adverse long-term side effects comparable with those after proton beam radiotherapy. Future fractionation schemes should seek to further reduce adverse side effects rate while maintaining excellent local tumor control.

  11. Oahu Hyperspectral Imagery 2000 (212-0612-332211) - Visual Interpretation from Remote Sensing Imagery Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...

  12. Di-μ1,1-azido-bis[(2-{1-[2-(isopropylaminoethylimino]ethyl}phenolatocopper(II

    Directory of Open Access Journals (Sweden)

    He-Bing Li

    2010-06-01

    Full Text Available In the centrosymmetric binuclear title complex, [Cu2(C13H19N2O2(N32], the CuII atom adopts an elongated CuON4 square-based pyramidal coordination geometry, arising from the N,N′,O-tridentate ligand and two bridging end-on azide anions. The O atom is in the basal plane, one of the azide N atoms is in the apical site and the Cu...Cu separation is 3.2365 (3 Å. A pair of intramolecular N—H...O hydrogen bonds helps to establish the molecular conformation.

  13. Oahu Hyperspectral Imagery 2000 (212-0612-272217) - Visual Interpretation from Remote Sensing Imagery Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...

  14. 48 CFR 252.212-7001 - Contract terms and conditions required to implement statutes or Executive orders applicable to...

    Science.gov (United States)

    2010-10-01

    ...) Alternate I (SEP 2008). (12) __252.225-7027, Restriction on Contingent Fees for Foreign Military Sales (APR 2003) (22 U.S.C. 2779). (13) __252.225-7028, Exclusionary Policies and Practices of Foreign Governments.... 2534(a)(3)). (16) __252.226-7001, Utilization of Indian Organizations, Indian-Owned Economic...

  15. 21 CFR 212.1 - What are the meanings of the technical terms used in these regulations?

    Science.gov (United States)

    2010-04-01

    ... HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR POSITRON... the Federal Food, Drug, and Cosmetic Act, as amended (21 U.S.C. 321 et seq.). Active pharmaceutical... intended to furnish pharmacological activity or other direct effect in the diagnosis or monitoring of a...

  16. 47 CFR 25.212 - Narrowband analog transmissions, digital transmissions, and video transmissions in the GSO Fixed...

    Science.gov (United States)

    2010-10-01

    ... be routinely licensed for transmission of SCPC services if the maximum power densities into the antenna do not exceed +0.5 dBW/4 kHz for analog SCPC carriers with bandwidths up to 200 kHz, and do not exceed −2.7 dBW/4 kHz for narrow and/or wideband digital SCPC carriers. (2) For earth stations licensed...

  17. Is asthma in 2-12 year-old children associated with physician-attended recurrent upper respiratory tract infections?

    NARCIS (Netherlands)

    Hak, Eelko; Rovers, Maroeska M; Sachs, Alfred P E; Stalman, Wim A B; Verheij, Theo J M

    2003-01-01

    In a prevalence study, we evaluated whether recurrent physician-attended URTI episodes are more common in asthmatic children as compared to age- and gender-matched controls. URTI proneness, defined as > or = 5 episodes of rhinitis/pharyngitis, sinusitis, laryngitis/tracheitis or otitis media in a

  18. 50 CFR 226.212 - Critical habitat for 13 Evolutionarily Significant Units (ESUs) of salmon and steelhead...

    Science.gov (United States)

    2010-10-01

    ....1537, -123.1267) upstream to endpoint(s) in: Dungeness River (47.9386, -123.0885); Gray Wolf River (47....6050, Long -121.6323) upstream to endpoint(s) in: Dog River (45.4655, -121.5656); East Fork Hood River...

  19. Dollar Summary of Federal Supply Classification and Service Category by Company, FY 85. Part 3 (R212-S208).

    Science.gov (United States)

    1985-01-01

    n) U )0 g u’I wIn’w u & Li w w w w WLS w In 0 O - I I LL. In cc xn I) In InI n U nn I n ) Wn U n U In acn -j 0 00 00 0 00 00 0 0 000 0 000 0 In 0...t- w. w Sf n m~ N q& tv000 IPl CM CI N O0) 04 IN 0I -4 A 44 0 m I I () 0 I " 1-I- > >a W I= w w n w zII = GIIIw w w w w w W w W L (Al Ill ZZZzzzzz

  20. Crystal structure of 1,2-bis((benzylsulfanyl{2-[1-(2-hydroxyphenylethylidene]hydrazin-1-ylidene}methyldisulfane

    Directory of Open Access Journals (Sweden)

    M. A. A. A. A. Islam

    2016-03-01

    Full Text Available The title compound, C32H30N4O2S4, consists of two Schiff base moieties, namely two S-benzyl-β-N-(2-hydroxyphenylethylidenedithiocarbazate groups, which are connected through an S—S single bond. These two moieties are twisted with respect to each other, with a dihedral angle of 87.88 (4° between the S2C=N planes. A bifurcated intramolecular O—H...(N,S hydrogen bond is observed in each moiety. In the crystal, molecules are linked by pairs of C—H...O hydrogen bonds into inversion dimers. The dimers are further stacked in a column along the b axis through weak C—H...π interactions.

  1. Time intervals from first symptom to treatment of cancer: a cohort study of 2,212 newly diagnosed cancer patients

    DEFF Research Database (Denmark)

    Hansen, Rikke P; Vedsted, Peter; Sokolowski, Ineta

    2011-01-01

    Delay in diagnosis of cancer may worsen prognosis. The aim of this study is to explore patient-, general practitioner (GP)- and system-related delay in the interval from first cancer symptom to diagnosis and treatment, and to analyse the extent to which delays differ by cancer type....

  2. 25 CFR 39.212 - Can a student be counted as enrolled in more than one school?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Can a student be counted as enrolled in more than one... Can a student be counted as enrolled in more than one school? Yes, if a student attends more than one school during an academic year, each school may count the student as enrolled once the student meets the...

  3. How Are Middle School Climate and Academic Performance Related across Schools and over Time? REL 2017-212

    Science.gov (United States)

    Voight, Adam; Hanson, Thomas

    2017-01-01

    A growing number of educators concur that, in order to improve student academic performance, schools need to focus not only on students' academic needs but also on their social, emotional, and material needs (Piscatelli & Lee, 2011). As a result, school climate--the social, emotional, and physical characteristics of a school community (Cohen,…

  4. 75 FR 28751 - Airworthiness Directives; Bell Helicopter Textron (Bell) Model 205A, 205A-1, 205B, 212, 412...

    Science.gov (United States)

    2010-05-24

    ..., Martin R. Crane, ASW-170, Aviation Safety Engineer, Rotorcraft Directorate, Rotorcraft Certification.... Contact the Manager, Rotorcraft Certification Office: ATTN: DOT/FAA Southwest Region, Martin R. Crane, ASW..., Texas, on May 3, 2010. Mark R. Schilling, Acting Manager, Rotorcraft Directorate. BILLING CODE 4910-13-P ...

  5. Consequences of Adolescent Exposure to the Cannabinoid Receptor Agonist WIN55,212-2 on Working Memory in Female Rats

    National Research Council Canada - National Science Library

    Erin K. Kirschmann; Daniel M. McCalley; Caitlyn M. Edwards; Mary M. Torregrossa

    2017-01-01

    Marijuana is a prevalent illicit substance used by adolescents, and several studies have indicated that adolescent use can lead to long-term cognitive deficits including problems with attention and memory...

  6. 8 CFR 212.2 - Consent to reapply for admission after deportation, removal or departure at Government expense.

    Science.gov (United States)

    2010-01-01

    ... also forward a recommendation as to whether the waiver should be granted. (d) Applicant for immigrant visa. Except as provided in paragraph (g)(2) of this section, an applicant for an immigrant visa who is...) Applicant for admission at port of entry. An alien may request permission at a port of entry to reapply for...

  7. 76 FR 68301 - Airworthiness Directives; Bell Helicopter Textron, Inc. (Bell), Model 205A-1, 205B, 210, and 212...

    Science.gov (United States)

    2011-11-04

    ... helicopters for signs of an edge void, corrosion, or a crack, including a hair-line crack in the blade paint... helicopter. Wipe dry with a clean cloth. (4) Immediately after accomplishing paragraph (a)(3) of this AD...

  8. {2-[1-(2-Amino-2-methylpropyliminoethyl]phenolato-κ3N,N′,O}dioxidovanadium(V

    Directory of Open Access Journals (Sweden)

    Artur Sikorski

    2009-02-01

    Full Text Available In the crystal structure of the title compound, [V(C12H17N2OO2], the vanadium(V centre is five-coordinate in a distorted square-pyramidal environment. The three atoms of the deprotonated Schiff base and a double-bonded O atom comprise the basal plane. N—H...O hydrogen bonds lead to a zigzag chain structure parallel to [001].

  9. Improved BM212 MmpL3 inhibitor analogue shows efficacy in acute murine model of tuberculosis infection.

    Directory of Open Access Journals (Sweden)

    Giovanna Poce

    Full Text Available 1,5-Diphenyl pyrroles were previously identified as a class of compounds endowed with high in vitro efficacy against M. tuberculosis. To improve the physical chemical properties and drug-like parameters of this class of compounds, a medicinal chemistry effort was undertaken. By selecting the optimal substitution patterns for the phenyl rings at N1 and C5 and by replacing the thiomorpholine moiety with a morpholine one, a new series of compounds was produced. The replacement of the sulfur with oxygen gave compounds with lower lipophilicity and improved in vitro microsomal stability. Moreover, since the parent compound of this family has been shown to target MmpL3, mycobacterial mutants resistant to two compounds have been isolated and characterized by sequencing the mmpL3 gene; all the mutants showed point mutations in this gene. The best compound identified to date was progressed to dose-response studies in an acute murine TB infection model. The resulting ED(99 of 49 mg/Kg is within the range of commonly employed tuberculosis drugs, demonstrating the potential of this chemical series. The in vitro and in vivo target validation evidence presented here adds further weight to MmpL3 as a druggable target of interest for anti-tubercular drug discovery.

  10. 21 CFR 212.70 - What controls and acceptance criteria must I have for my finished PET drug products?

    Science.gov (United States)

    2010-04-01

    ..., DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR... identity, strength, quality, purity, and, if appropriate, sterility and pyrogens. (b) Test procedures... to specifications, except for sterility. For a PET drug product produced in sub-batches, before final...

  11. Assistive Technology for Infants, Toddlers, and Young Children with Disabilities. PACER Center ACTion Information Sheets: PHP-c212

    Science.gov (United States)

    PACER Center, 2014

    2014-01-01

    Research shows that assistive technology (AT) can help young children with disabilities to learn developmental skills. Its use may help infants and toddlers to improve in many areas such as: (1) social skills including sharing and taking turns; (2) communication skills; (3) attention span; (4) fine and gross motor skills; and (5) self confidence…

  12. The role of alpha therapy for local and systemic treatment of cancer

    Energy Technology Data Exchange (ETDEWEB)

    Allen, B.J. [St George Hospital, Kogarah, NSW (Australia)

    1998-03-01

    Major problems in the management of cancer relate to the inability to control some primary lesions, e.g. glioblastoma multiforme (GBM), and the inability to deal with metastatic cancer arising from malignant cancers such as melanoma, breast and other cancers. Binary alpha therapy using neutron capture in boron-10 offers the potential for improved prognosis for high grade brain tumours such as GBM and melanoma metastases to the brain. Metastatic cancer proceeds through a number of quite separate stages in the development of lethal disease, i e. cells in transit, preangiogenic lesions, subclinical and clinical lesions. Early stages offer the potential for control if targeted alpha therapy is applied. However, the dose must be localised to the cancer cell and this requirement rules out beta-emitting radionuclides, which are more suited for clinical lesions. Alpha-emitting radionuclides are the most appropriate toxins, as their efficacy depends on the linear energy transfer (LET) and range of the alpha particles. After matching the cancer stage, radiolabel and carrier, we find that {sup 149}Tb is the radionuclide of choice for systemic therapy in all aspects except production. The production of {sup 149}Tb in {mu}Ci (kBq) quantities has been achieved using the heavy ion reaction at the ANU tandem accelerator at Canberra and in multi-mCi (MBq) quantities using the spallation reaction in combination with on-line isotope separation technology of ISOLDE at CERN. Terbium is ideally suited for chelation to monoclonal antibodies to produce stable radio-immunoconjugates (RIC). Astatine-211 is a halide and has potential for the elimination of early stage melanoma metastases as At-MTB. However, the availability of the alpha generators {sup 228}Th-{sup 212}Bi and {sup 225}Ac-{sup 213}Bi facilitates the use of Bi-RIC in clinical trials for acute myeloid leukaemia and cystic glioma. Alpha therapy has the potential to control refractory cancers when treated at the minimum residual

  13. Derivation of Soil Screening Guidelines for Gross Alpha/Beta Radioactivity for United States Air Force Deployment Sites

    Science.gov (United States)

    2007-04-19

    the emission of 7 alpha particles and 4 beta particles. Three radionuclides ( francium -223, astatine-215, and polonium-211) are not listed below...no no Uranium-233 159,200 y alpha yes no Thorium-229 7,300 y alpha yes no Radium-225 14.9 d beta no no Actinium-225 10.0 d alpha no no Francium

  14. δ37Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine.

  15. δ³⁷Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine. This thesis presents the first chlorine

  16. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  17. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  18. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita

    2011-01-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  19. Production cross section of At radionuclides from 7Li+natPb and 9Be+natTl reactions

    Science.gov (United States)

    Maiti, Moumita; Lahiri, Susanta

    2011-12-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from 6,7Li- and 9Be-induced reactions on natural lead and thallium targets, respectively. The production of astatine radionuclides were investigated experimentally with two heavy-ion-induced reactions: 9Be + natTl and 7Li + natPb. Formation cross sections of the evaporation residues, 207,208,209,210At, produced in the (HI,xn) channel, were measured by the stacked-foil technique followed by off-line γ spectrometry at low incident energies (<50 MeV). Measured excitation functions were interpreted in terms of a compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach models. Measured cross-section values are lower than the respective theoretical predictions.

  20. Oxido[2-{(E-[((1E-{(E-2-[1-(2-oxidophenylethylidene]hydrazin-1-ylidene}(prop-2-en-1-ylsulfanylmethylimino]methyl}phenolato]vanadium(IV

    Directory of Open Access Journals (Sweden)

    Reza Takjoo

    2012-08-01

    Full Text Available The VIV atom in the title complex, [V(C19H17N3O2SO], is coordinated by two N and two O atoms of the dianionic tetradentate Schiff base ligand and the terminal oxide O atom. The N2O3 donor set defines a square-pyramidal coordination geometry with the oxide O atom in the apical site. Some buckling in the tetradentate ligand is indicated by the dihedral angle of 17.92 (19° between the six-membered chelate rings. Supramolecular chains are formed along the b axis via C—H...O contacts in the crystal. The chains are connected into a layer in the ab plane via C—H...π interactions. The atoms comprising the –SCH2—CH=CH2 and methyl substituents were found to be disordered in a 0.916 (2:0.088 (2 ratio. The crystal studied was found to be twinned by nonmerohedry with a 28.1 (4% minor twin component.

  1. Extended Kindred With Recessive Late-Onset Alzheimer Disease Maps to Locus 8p22-p21.2 A Genome-wide Linkage Analysis

    NARCIS (Netherlands)

    Baron, M.; Gomez-Tortosa, E.; Bochdanovits, Z.; Gobernado, I.; Rabano, A.; Munoz, D.G.; Heutink, P.; Jimenez-Escrig, A.

    2012-01-01

    Late-onset Alzheimer disease (LOAD) is a complex genetic disorder. Although genes involved in early-onset forms were discovered more than a decade ago, LOAD research has only been able to point out small effect loci, with the exception of APOE. We mapped the gene predisposing to LOAD in an extended

  2. 76 FR 61558 - Airworthiness Directives; Dowty Propellers Type R212/4-30-4/22 and R251/4-30-4/49 Propeller...

    Science.gov (United States)

    2011-10-05

    .... Revision 6 of the ASB had an incorrect Non-Destructive Testing (NDT) reference in Effectivity paragraph 1.D... No. 61-1043, Revision 7, dated March 1, 2011, and NDT Technique NDT 175U (Appendix A of Dowty...

  3. Apparent late-onset Cockayne syndrome and interstitial deletion of the long arm of chromosome 10 (del(10)(q11.23q21.2)).

    Science.gov (United States)

    Fryns, J P; Bulcke, J; Verdu, P; Carton, H; Kleczkowska, A; Van den Berghe, H

    1991-09-01

    We present the history and data on a 24-year-old man with clinical and neurological symptoms similar to the findings in patients with late-onset Cockayne syndrome. Prometaphase chromosome studies documented an interstitial 10q211 deletion in all cells. This finding may indicate that the gene for late Cockayne syndrome is at 10q211.

  4. 21 CFR 212.40 - How must I control the components I use to produce PET drugs and the containers and closures I...

    Science.gov (United States)

    2010-04-01

    ... its written specifications. You must perform at least a visual identification of each lot of... closures in a manner that prevents contamination, mix-ups, and deterioration and ensures that they are and...

  5. First examples of a modulated bridging mu(2)-1:2kappan-triazine in double helical silver compounds. experimental and theoretical evidence.

    Science.gov (United States)

    Carranza, M Pilar; Manzano, Blanca R; Jalón, Félix A; Rodríguez, Ana M; Santos, Lucía; Moreno, Miquel

    2010-04-19

    The synthesis of several silver double helices containing bis(3,5dimethylpyrazolyl)-6-(R)-s-triazine ligands is described. The structure of two of them has been determined by X-ray difraction. Both derivatives represent the first reported examples of a new interaction mode for a triazine ring that involves a triazine N atom bridging two metal centers. Argentophilic contacts are also present. The Ag-N and Ag-Ag interactions have been demonstrated by theoretical studies, which also showed the clear influence of weak interactions with the counteranion and the effect of the symmetry of the triazine substituent. The different donor characters of these substituents allows a modulation of the strength of the bridging Ag-N(triazine) interaction. Double pi-pi stacking, anion-pi interactions, hydrogen bonds, and hydrophobic effects are observed in an unusual highly symmetrical interpenetrated three-dimensional superstructure.

  6. Federal Education Tax Benefits: Who Receives Them and to What Extent Do They Shape the Price of College Attendance? Stats in Brief. NCES 2012-212

    Science.gov (United States)

    Radford, Alexandria Walton; Berkner, Lutz

    2011-01-01

    This Statistics in Brief applies IRS rules and data to a nationally representative sample of 2007-08 undergraduates to estimate who received education tax benefits and looks at the extent to which these benefits shaped their price of college attendance. Key findings include: (1) Nearly one-half of all 2007-08 undergraduates were estimated to have…

  7. The modulated structure of the calcium aluminate Ca6(AlO2)12·Bi2O3.

    Science.gov (United States)

    Pérez, O; Malo, S; Hervieu, M

    2010-12-01

    Bismuth calcium aluminate, Bi(2)Ca(6)Al(12)O(27), has been prepared as a ceramic and a single crystal. Analysis of reciprocal space using both electron and X-ray diffraction show an R-centred hexagonal unit cell: a = b = 17.3892 (4), c = 6.986 (1) Å. Additional weak reflections are observed; they require the introduction of a modulation wavevector q = 0.0453 (2)c* for indexing. The modulated structure has been solved using the superspace formalism [superspace group X3(00γ)0]. A framework of corner-sharing AlO(4) tetrahedra forms corrugated sixfold rings and uncommon triple rings. The Ca(2+) cations exhibit an eightfold coordination sphere; edge-sharing CaO(8) polyhedra form intertwinned zigzagging rows along c creating a three-dimensional net. Bi atoms are located in large hexagonal tunnels parallel to c and form Bi(2)O(3) pairs, which adopt a trigonal bipyramidal configuration. The 6s(2) lone-electron pairs (Lp) point along c, in the opposite direction to the three Bi-O strong bonds to form two BiO(3)Lp tetrahedra with a common base. Different orientations of the Bi(2)O(3)Lp(2) pairs, rotated by 60° around c, are observed. Their stacking modes in each of the hexagonal tunnels are described. The sequence of the stacking varies along c in each of the tunnels.

  8. La fonction de Diotime dans le Banquet de Platon (201d1-212c3) : le dialogue et son double

    OpenAIRE

    Keime, Christian

    2015-01-01

    Cet article s’interroge sur les raisons pour lesquelles, dans le Banquet de Platon, Socrate prononce son éloge d’Eros sous la forme d’un dialogue rapporté qui met en scène deux personnages : Diotime et Socrate encore jeune homme. Je montre d’abord que chaque interlocuteur de ce dialogue enchâssé se présente comme une synthèse des deux personnages du dialogue cadre (Agathon et Socrate adulte, devenu un philosophe accompli) : Diotime, c’est le dialecticien Socrate vu par les yeux d’un poète et ...

  9. 76 FR 35334 - Airworthiness Directives; Bell Helicopter Textron, Inc. Model 205A, 205A-1, 205B, 212, 412, 412CF...

    Science.gov (United States)

    2011-06-17

    ... contains the AD, any comments, and other information on the Internet at http://www.regulations.gov , or in... 0.003 inch deep or less, either replace the unairworthy T/R blade with an airworthy T/R blade or... greater than 0.003 inch deep, replace the T/R blade with an airworthy T/R blade. (3) If any parent...

  10. 42 CFR 436.212 - Individuals who would be eligible for cash assistance if the State plan for OAA, AFDC, AB, APTD...

    Science.gov (United States)

    2010-10-01

    ... Options for Coverage as Categorically Needy Options for Coverage of Families and Children and Aged, Blind... may provide Medicaid to individuals who would meet the Federal definition of disability, 45 CFR 233.80, but who do not meet the State's more restrictive definitions.) (b) The agency may cover one or more...

  11. Heterospin systems constructed from [Cu2Ln]3+ and [Ni(mnt)2]1-,2- Tectons: First 3p-3d-4f complexes (mnt = maleonitriledithiolato).

    Science.gov (United States)

    Madalan, Augustin M; Avarvari, Narcis; Fourmigué, Marc; Clérac, Rodolphe; Chibotaru, Liviu F; Clima, Sergiu; Andruh, Marius

    2008-02-04

    New heterospin complexes have been obtained by combining the binuclear complexes [{Cu(H(2)O)L(1)}Ln(O(2)NO)(3)] or [{CuL(2)}Ln(O(2)NO)(3)] (L(1) = N,N'-propylene-di(3-methoxysalicylideneiminato); L(2) = N,N'-ethylene-di(3-methoxysalicylideneiminato); Ln = Gd(3+), Sm(3+), Tb(3+)), with the mononuclear [CuL(1)(2)] and the nickel dithiolene complexes [Ni(mnt)(2)](q)- (q = 1, 2; mnt = maleonitriledithiolate), as follows: (1)infinity[{CuL(1)}(2)Ln(O(2)NO){Ni(mnt)(2)}].Solv.CH(3)CN (Ln = Gd(3+), Solv = CH(3)OH (1), Ln = Sm(3+), Solv = CH(3)CN (2)) and [{(CH(3)OH)CuL(2)}(2)Sm(O(2)NO)][Ni(mnt)(2)] (3) with [Ni(mnt)2]2-, [{(CH(3)CN)CuL(1)}(2)Ln(H(2)O)][Ni(mnt)(2)]3.2CH(3)CN (Ln = Gd(3+) (4), Sm(3+) (5), Tb(3+) (6)), and [{(CH(3)OH)CuL(2)}{CuL(2)}Gd(O(2)NO){Ni(mnt)(2)}][Ni(mnt)(2)].CH(2)Cl(2) (7) with [Ni(mnt))(2]*-. Trinuclear, almost linear, [CuLnCu] motifs are found in all the compounds. In the isostructural 1 and 2, two trans cyano groups from a [Ni(mnt)2]2- unit bridge two trimetallic nodes through axial coordination to the Cu centers, thus leading to the establishment of infinite chains. 3 is an ionic compound, containing discrete [{(CH(3)OH)CuL(2)}(2)Sm(O(2)NO)](2+) cations and [Ni(mnt)(2)](2-) anions. Within the series 4-6, layers of discrete [CuLnCu](3+) motifs alternate with stacks of interacting [Ni(mnt)(2)](*-) radical anions, for which two overlap modes, providing two different types of stacks, can be disclosed. The strength of the intermolecular interactions between the open-shell species is estimated through extended Hückel calculations. In compound 7, [Ni(mnt)(2)](*-) radical anions coordinate group one of the Cu centers of a trinuclear [Cu(2)Gd] motif through a CN, while discrete [Ni(mnt)(2)](*-) units are also present, overlapping in between, but also with the coordinated ones. Furthermore, the [Cu(2)Gd] moieties dimerize each other upon linkage by two nitrato groups, both acting as chelate toward the gadolinium ion from one unit and monodentate toward a Cu ion from the other unit. The magnetic properties of the gadolinium-containing complexes have been determined. Ferromagnetic exchange interactions within the trinuclear [Cu(2)Gd] motifs occur. In the compounds 4 and 7, the [Ni(mnt)(2)](*-) radical anions contribution to the magnetization is clearly observed in the high-temperature regime, and most of it vanishes upon temperature decrease, very likely because of the rather strong antiferromagnetic exchange interactions between the open-shell species. The extent of the exchange interaction in the compound 7, which was found to be antiferromagnetic, between the coordinated Cu center and the corresponding [Ni(mnt)(2)](*-) radical anion, bearing mostly a 3p spin type, was estimated through CASSCF/CASPT2 calculations. Compound 6 exhibits a slow relaxation of the magnetization.

  12. Genome-wide association study identifies 19p13.3 (UNC13A) and 9p21.2 as susceptibility loci for sporadic amyotrophic lateral sclerosis

    NARCIS (Netherlands)

    van Es, Michael A.; Veldink, Jan H.; Saris, Christiaan G. J.; Blauw, Hylke M.; van Vught, Paul W. J.; Birve, Anna; Lemmens, Robin; Schelhaas, Helenius J.; Groen, Ewout J. N.; Huisman, Mark H. B.; van der Kooi, Anneke J.; de Visser, Marianne; Dahlberg, Caroline; Estrada, Karol; Rivadeneira, Fernando; Hofman, Albert; Zwarts, Machiel J.; van Doormaal, Perry T. C.; Rujescu, Dan; Strengman, Eric; Giegling, Ina; Muglia, Pierandrea; Tomik, Barbara; Slowik, Agnieszka; Uitterlinden, Andre G.; Hendrich, Corinna; Waibel, Stefan; Meyer, Thomas; Ludolph, Albert C.; Glass, Jonathan D.; Purcell, Shaun; Cichon, Sven; Nöthen, Markus M.; Wichmann, H.-Erich; Schreiber, Stefan; Vermeulen, Sita H. H. M.; Kiemeney, Lambertus A.; Wokke, John H. J.; Cronin, Simon; McLaughlin, Russell L.; Hardiman, Orla; Fumoto, Katsumi; Pasterkamp, R. Jeroen; Meininger, Vincent; Melki, Judith; Leigh, P. Nigel; Shaw, Christopher E.; Landers, John E.; Al-Chalabi, Ammar; Brown, Robert H.; Robberecht, Wim; Andersen, Peter M.; Ophoff, Roel A.; van den Berg, Leonard H.

    2009-01-01

    We conducted a genome-wide association study among 2,323 individuals with sporadic amyotrophic lateral sclerosis (ALS) and 9,013 control subjects and evaluated all SNPs with P <1.0 x 10(-4) in a second, independent cohort of 2,532 affected individuals and 5,940 controls. Analysis of the genome-wide

  13. Genome Wide Gene by Environment Interaction Analysis Identifies Common SNPs at 17q21.2 that Are Associated with Increased Body Mass Index Only among Asthmatics

    Science.gov (United States)

    2015-12-16

    REPORT DOCUMENTATION PAGE Form Approved OMB No. 0704-0188 Public reporting burden for this collection of information is estimated to average 1 hour...their helpful comments and sug- gestions on the analysis and the manuscript. Author Contributions Conceived and designed the experiments: AD LW

  14. 13CO2/12CO2 isotopic ratio measurements using a difference frequency-based sensor operating at 4.35 micrometers

    Science.gov (United States)

    Erdelyi, M.; Richter, D.; Tittel, F. K.

    2002-01-01

    A portable modular gas sensor for measuring the 13C/12C isotopic ratio in CO2 with a precision of 0.8%(+/-1 sigma) was developed for volcanic gas emission studies. This sensor employed a difference frequency generation (DFG)-based spectroscopic source operating at 4.35 micrometers (approximately 2300 cm-1) in combination with a dual-chamber gas absorption cell. Direct absorption spectroscopy using this specially designed cell permitted rapid comparisons of isotopic ratios of a gas sample and a reference standard for appropriately selected CO2 absorption lines. Special attention was given to minimizing undesirable precision degrading effects, in particular temperature and pressure fluctuations.

  15. DOE CALiPER Program, Report 21.2: Linear (T8) LED Lamp Performance in Five Types of Recessed Troffers

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Naomi J.; Perrin, Tess E.; Royer, Michael P.; Wilkerson, Andrea M.; Beeson, Tracy A.

    2014-05-20

    Although lensed troffers are numerous, there are many other types of optical systems as well. This report looked at the performance of three linear (T8) LED lamps chosen primarily based on their luminous intensity distributions (narrow, medium, and wide beam angles) as well as a benchmark fluorescent lamp in five different troffer types. Also included are the results of a subjective evaluation. Results show that linear (T8) LED lamps can improve luminaire efficiency in K12-lensed and parabolic-louvered troffers, effect little change in volumetric and high-performance diffuse-lensed type luminaires, but reduce efficiency in recessed indirect troffers. These changes can be accompanied by visual appearance and visual comfort consequences, especially when LED lamps with clear lenses and narrow distributions are installed. Linear (T8) LED lamps with diffuse apertures exhibited wider beam angles, performed more similarly to fluorescent lamps, and received better ratings from observers. Guidance is provided on which luminaires are the best candidates for retrofitting with linear (T8) LED lamps.

  16. Autotrophic and heterotrophic soil respiration determined with trenching, soil CO2 fluxes and 13CO2/12CO2 concentration gradients in a boreal forest ecosystem

    Science.gov (United States)

    Pumpanen, Jukka; Shurpali, Narasinha; Kulmala, Liisa; Kolari, Pasi; Heinonsalo, Jussi

    2017-04-01

    Soil CO2 efflux forms a substantial part of the ecosystem carbon balance, and it can contribute more than half of the annual ecosystem respiration. Recently assimilated carbon which has been fixed in photosynthesis during the previous days plays an important role in soil CO2 efflux, and its contribution is seasonally variable. Moreover, the recently assimilated C has been shown to stimulate the decomposition of recalcitrant C in soil and increase the mineralization of nitrogen, the most important macronutrient limiting gross primary productivity (GPP) in boreal ecosystems. Podzolic soils, typical in boreal zone, have distinctive layers with different biological and chemical properties. The biological activity in different soil layers has large seasonal variation due to vertical gradient in temperature, soil organic matter and root biomass. Thus, the source of CO2 and its components have a vertical gradient which is seasonally variable. The contribution of recently assimilated C and its seasonal as well as spatial variation in soil are difficult to assess without disturbing the system. The most common method of partitioning soil respiration into its components is trenching which entails the roots being cut or girdling where the flow of carbohydrates from the canopy to roots has been isolated by cutting of the phloem. Other methods for determining the contribution of autotrophic (Ra) and heterotrophic (Rh) respiration components in soil CO2 efflux are pulse labelling with 13CO2 or 14CO2 or the natural abundance of 13C and/or 14C isotopes. Also differences in seasonal and short-term temperature response of soil respiration have been used to separate Ra and Rh. We compared the seasonal variation in Ra and Rh using the trenching method and differences between seasonal and short-term temperature responses of soil respiration. I addition, we estimated the vertical variation in soil biological activity using soil CO2 concentration and the natural abundance of 13C and 12C in CO2 in different soil layers in a boreal forest in Southern Finland and compared them to seasonal variation in GPP. Our results show that Ra followed a seasonal variation in GPP with a time lag of about 2 weeks. The contribution of Ra on soil CO2 efflux was largest in July and August. There was also a distinct seasonal pattern in the vertical distribution of soil CO2 concentration and the abundances of natural isotopes 13C/12C in soil CO2 which reflected the changes in biological activity in the soil profile. Our results indicate that all methods were able to distinguish seasonal variability in Ra and Rh. The soil CO2 gradient method was able to reproduce the temporal variation in soil CO2 effluxes relatively well when compared to those measured with chambers. However, variation in soil moisture also causes significant variation in soil air CO2 concentrations which interferes with the variation resulted from soil temperatures and belowground allocation of carbon from recent photosynthate. Also, the assumptions used in gradient method calculations, such as soil porosity and transport distances have to be taken into account when interpreting the results.

  17. Electroproduction of lightest nucleon resonances up to Q*2=12 GeV*2 in quark models at light front

    Directory of Open Access Journals (Sweden)

    Obukhovsky I.T.

    2017-01-01

    Full Text Available The lightest nucleon resonances are described at light front as mixed states of the 3q cluster (“quark core” possessing a definite value of the inner orbital momentum L = 0,1 and a hadron molecular state, N+σ or Λ+K. Helicity amplitudes of the resonance electroproduction off the proton are calculated at large Q2 up to 12 GeV2 and compared to the last CLAS data. At this basis we have estimated the probability of quark core in lightest nucleon resonances and predicted the high Q2 behaviour of the resonance electrocoupling.

  18. Poly[{μ2-1,2-bis[4-(3-pyridylpyrimidin-2-ylsulfanyl]ethane}di-μ2-cyanido-dicopper(I

    Directory of Open Access Journals (Sweden)

    Lin Cheng

    2008-07-01

    Full Text Available The asymmetric unit of the title complex, [Cu2(CN2(C20H16N6S2]n, contains one CuI cation, one cyanide ligand and half of a centrosymmetric 1,2-bis[4-(3-pyridylpyrimidin-2-ylsulfanyl]ethane (bppe ligand. The CuI atom displays a trigonal coordination geometry, being surrounded by one C atom from one cyanide anion and two N atoms from one cyanide and one bppe ligand. In the complex, each cyanide anion links two CuI atoms in a bis-monodentate mode into a zigzag [–Cu—CN–]n chain. Two parallel chains are linked by bppe ligands into a ladder chain.

  19. Topologia differenziale Lectures Given At The Centro Internazionale Matematico Estivo (CIME) Held In Urbino (Pesaro), Italy, July 2-12, 1962

    CERN Document Server

    Vesentini, E

    2011-01-01

    J. Cerf: Invariants des paires d espaces. Applications la topologie differentielle.- A. H fliger: Vari t?'s feuillet es.- M.A. Kervaire: La m thode de Pontryagin pour la classification des applications sur une sph re.- S. Smale: Stable manifolds for differential equations and diffeomorphisms.

  20. Inhibition of miRNA-212/132 improves the reprogramming of fibroblasts into induced pluripotent stem cells by de-repressing important epigenetic remodelling factors

    Directory of Open Access Journals (Sweden)

    Nils Pfaff

    2017-04-01

    Thus, conducting a full library miRNA screen we here describe a miRNA family, which markedly reduces generation of iPSC and upon inhibition in turn enhances reprogramming. These miRNAs, at least in part, exert their functions through repression of the epigenetic modulators p300 and Jarid1a, highlighting these two molecules as an endogenous epigenetic roadblock during iPSC generation.

  1. SU-E-J-212: MR Diffusion Tensor Imaging for Assessment of Tumor and Normal Brain Tissue Responses of Juvenile Pilocytic Astrocytoma Treated by Proton Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Hou, P; Park, P; Li, H; Zhu, X; Mahajan, A; Grosshans, D [M.D. Anderson Cancer Center, Houston, TX (United States)

    2015-06-15

    Purpose: Diffusion tensor imaging (DTI) can measure molecular mobility at the cellular level, quantified by the apparent diffusion coefficient (ADC). DTI may also reveal axonal fiber directional information in the white matter, quantified by the fractional anisotropy (FA). Juvenile pilocytic astrocytoma (JPA) is a rare brain tumor that occurs in children and young adults. Proton therapy (PT) is increasingly used in the treatment of pediatric brain tumors including JPA. However, the response of both tumors and normal tissues to PT is currently under investigation. We report tumor and normal brain tissue responses for a pediatric case of JPA treated with PT assessed using DTI. Methods: A ten year old male with JPA of the left thalamus received passive scattered PT to a dose of 50.4 Gy (RBE) in 28 fractions. Post PT, the patient has been followed up in seven years. At each follow up, MRI imaging including DTI was performed to assess response. MR images were registered to the treatment planning CT and the GTV mapped onto each MRI. The GTV contour was then mirrored to the right side of brain through the patient’s middle line to represent normal brain tissue. ADC and FA were measured within the ROIs. Results: Proton therapy can completely spare contra lateral brain while the target volume received full prescribed dose. From a series of MRI ADC images before and after PT at different follow ups, the enhancement corresponding to GTV had nearly disappeared more than 2 years after PT. Both ADC and FA demonstrate that contralateral normal brain tissue were not affect by PT and the tumor volume reverted to normal ADC and FA values. Conclusion: DTI allowed quantitative evaluation of tumor and normal brain tissue responses to PT. Further study in a larger cohort is warranted.

  2. 212. Incidencia de complicaciones graves en trasplantes cardíacos urgentes y no urgentes. 10 años de experiencia

    Directory of Open Access Journals (Sweden)

    L. Donate Bertolín

    2010-01-01

    Conclusiones: En nuestra serie, el trasplante urgente no presentó una mayor mortalidad perioperatoria. Sin embargo, observamos mayor número de complicaciones graves, asociadas a mortalidad a más largo plazo, como FAI, infección bacteriana y ventilación mecánica prolongada.

  3. 21 CFR 212.71 - What actions must I take if a batch of PET drug product does not conform to specifications?

    Science.gov (United States)

    2010-04-01

    ... ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING... finished product must conform to specifications, except for sterility, before final release. ...

  4. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    Energy Technology Data Exchange (ETDEWEB)

    Koziorowski, J

    1998-10-01

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on {sup 211}At and {sup 124}I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[{sup 211}At]astato-2`-deoxyuridine (AUdR) and N-succinimidyl-4-[{sup 211}At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [{sup 124}I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[{sup 124}I]iodo-2`-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for

  5. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...

  6. catena-Poly[disilver(I)(Ag-Ag)-bis-(μ(3)-quinoline-3-carboxyl-ato)-1:2:1'κ(3)O:O':N;2:1'':2''κ(3)N:O:O'

    National Research Council Canada - National Science Library

    Liu, Chun-Bo; Cong, Yao; Sun, He-Yi

    2012-01-01

    In the title compound, [Ag(2)(C(10)H(6)NO(2))(2)](n), the Ag(I) atom is coordinated by one N atom and two O atoms from three quinoline-3-carboxyl-ate ligands in a T-shaped fashion, with an additional Ag⋯Ag distance of 2.9468 (6) Å...

  7. A new locus (SPG46) maps to 9p21.2-q21.12 in a Tunisian family with a complicated autosomal recessive hereditary spastic paraplegia with mental impairment and thin corpus callosum.

    Science.gov (United States)

    Boukhris, Amir; Feki, Imed; Elleuch, Nizar; Miladi, Mohamed Imed; Boland-Augé, Anne; Truchetto, Jérémy; Mundwiller, Emeline; Jezequel, Nadia; Zelenika, Diana; Mhiri, Chokri; Brice, Alexis; Stevanin, Giovanni

    2010-10-01

    Hereditary spastic paraplegia (HSP) with thin corpus callosum (TCC) and mental impairment is a frequent subtype of complicated HSP, often inherited as an autosomal recessive (AR) trait. It is clear from molecular genetic analyses that there are several underlying causes of this syndrome, with at least six genetic loci identified to date. However, SPG11 and SPG15 are the two major genes for this entity. To map the responsible gene in a large AR-HSP-TCC family of Tunisian origin, we investigated a consanguineous family with a diagnosis of AR-HSP-TCC excluded for linkage to the SPG7, SPG11, SPG15, SPG18, SPG21, and SPG32 loci. A genome-wide scan was undertaken using 6,090 SNP markers covering all chromosomes. The phenotypic presentation in five patients was suggestive of a complex HSP that associated an early-onset spastic paraplegia with mild handicap, mental deterioration, congenital cataract, cerebellar signs, and TCC. The genome-wide search identified a single candidate region on chromosome 9, exceeding the LOD score threshold of +3. Fine mapping using additional markers narrowed the candidate region to a 45.1-Mb interval (15.4 cM). Mutations in three candidate genes were excluded. The mapping of a novel AR-HSP-TCC locus further demonstrates the extensive genetic heterogeneity of this condition. We propose that testing for this locus should be performed, after exclusion of mutations in SPG11 and SPG15 genes, in AR-HSP-TCC families, especially when cerebellar ataxia and cataract are present.

  8. La controversia sobre la legalidad del Decreto reglamentario de la Ley de Tasas de Interés y Usura: una cuestión de interpretación de la Ley N° 18.212

    Directory of Open Access Journals (Sweden)

    Jorge Rodríguez Russo

    2010-07-01

    Full Text Available En anterior oportunidad publicamos en el Blog de Derecho y Actualidad un pequeño trabajo con las primeras reflexiones sobre el Decreto 344/009, Reglamentario de la Ley de Tasas de Intereses y Usura N° 18.2121, en el que en lo medular destacábamos su legalidad, puesto que, al amparo de lo dispuesto por el inciso 3° del artículo 10 de la Ley, vino a establecer las condiciones para que algunas cláusulas penales quedaren excluidas del cálculo de la Tasa de Interés Implícita de la operación, tanto en la opción por la ejecución forzada, como en la resolución del contrato por incumplimiento.

  9. El Ejercicio Didáctico centrado en Competencias teniendo como base el Uso de TIC, Fortalece de Manera Sustancial el Aprendizaje en Comunidad entre Alumnos y Docentes del C.B.T.i.s. No. 212

    OpenAIRE

    Sánchez Zárate, José A.

    2016-01-01

    El Subsistema de Educación Media Superior (SEMS) está promoviendo en los docentes a nivel nacional una nueva visión centrada en competencias didácticas dando respuesta a los organismos de evaluación como son: el Programa Internacional de Evaluación de los Alumnos (PISA) y la Evaluación Nacional del Logro Académico en Centros Escolares (ENLACE), es por ello que la Dirección General de Educación Tecnológica (DGETi) ubicada en Centeno #670 Col. Granjas México D.F. En sus planes de estudio plante...

  10. Biosystematic studies on Dactylis L. 2. Original research. 2.1. Morphological differentiation and occurrence of representatives of the genus Dactylis in Poland. 2.1.2. Distribution of Dactylis glomerata subsp. slovenica (Dom. Dom. in Poland and adjacent regions

    Directory of Open Access Journals (Sweden)

    Marta Mizianty

    2014-01-01

    Full Text Available This paper presents the results of analysis of herbarium materials from Poland, Czechoslovakia, the USSR, East Germany and belonging to the author, as well as data from literature dealing with the distribution of D. glomerata subsp. slovenica (Dom. Dom. in Poland and adjacent regions. It was found that D.g. subsp. slovenica occurs in 33 localities (30 herbarium and 3 literature in Poland. The distribution of this subspecies is presented for the first time for Poland. All the localities of D.g. subsp. slovenica were found in the mountainous parts of Poland (Sudety Mts. and the Carpathians. In territories adjacent to Poland, D.g. subsp. slovenica was found in the Czech Massif and in many stands in the Western and Eastern Carpathians and also in Roztocze Upland.

  11. The gaseous structure of closo-9,12-(SH)(2)-1,2-C2B10H10, a modifier of gold surfaces, as determined using electron diffraction and computational methods

    Czech Academy of Sciences Publication Activity Database

    Wann, D. A.; Lane, P. D.; Robertson, H. E.; Baše, Tomáš; Hnyk, Drahomír

    2013-01-01

    Roč. 42, č. 33 (2013), s. 12015-12019 ISSN 1477-9226 R&D Projects: GA ČR GAP208/10/2269 Institutional support: RVO:61388980 Keywords : AB-INITIO CALCULATIONS * GAUSSIAN-BASIS SETS * CORRELATED MOLECULAR CALCULATIONS * THERMOCHEMISTRY * CARBABORANES Subject RIV: CA - Inorganic Chemistry Impact factor: 4.097, year: 2013

  12. Design, construction, operation, and evaluation of solar systems for industrial process-heat applications in the intermediate-temperature range (212/sup 0/F to 550/sup 0/F). Environmental assessment

    Energy Technology Data Exchange (ETDEWEB)

    None

    1982-01-01

    The environmental impacts are assessed for a proposed 50,000 square foot field of single axis tracking, concentrating solar collectors along the Ohio River in southern Ohio. The facility is planned to produce process steam for use in the production of polystyrene. Absorbed solar energy would heat an aliphatic hydrocarbon synthetic heat transfer fluid to a maximum temperature of 500/sup 0/F. The existing environment is briefly described, particularly regarding air quality. The potential environmental impacts of the solar process heat system on the air, water, soil, endangered species and archaeological and historical resources are examined, including risks due to flood and glare and a comparison of alternatives. Also included are a Consent Judgment relating to two coal-fired boilers in violation of EPA regulations, property data of Gulf Synfluid 4CS (a candidate heat transfer fluid), piping and instrumentation diagrams and schematics, site grade and drainage plan, geological survey map, subsurface soil investigation, Ohio endangered species list, Ohio Archaeological Counsel certification list, and a study of heat transfer fluids and their properties. (LEW)

  13. NCBI nr-aa BLAST: CBRC-TTRU-01-1130 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1130 ref|ZP_02091246.1| hypothetical protein FAEPRAM212_01517 [Faecali...bacterium prausnitzii M21/2] gb|EDP21696.1| hypothetical protein FAEPRAM212_01517 [Faecalibacterium prausnitzii M21/2] ZP_02091246.1 0.008 28% ...

  14. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    Directory of Open Access Journals (Sweden)

    Ali BAYRAM

    1998-03-01

    Full Text Available In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 10, 50 and 259 mm/min. Strength properties of dual-phase steels were investigated depending on annealing temperature, ratio of martensite and loading rate.

  15. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  16. Nuclear and in-source laser spectroscopy with the ISAC yield station

    Energy Technology Data Exchange (ETDEWEB)

    Kunz, Peter, E-mail: pkunz@triumf.ca; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning [TRIUMF, 4004 Wesbrook Mall, Vancouver, British Columbia V6T 2A3 (Canada); Andreoiu, Corina; Wong, Fiona [Department of Chemistry, Simon Fraser University, Burnaby, British Columbia V5A 1S6 (Canada)

    2014-05-15

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10{sup 11} ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of {sup 46}K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  17. Nuclear and in-source laser spectroscopy with the ISAC yield station.

    Science.gov (United States)

    Kunz, Peter; Andreoiu, Corina; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning; Wong, Fiona

    2014-05-01

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10(11) ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of (46)K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  18. Radiopharmaceutical chemistry of targeted radiotherapeutics, part 4: Strategies for211At labeling at high activities and radiation doses of211At α-particles.

    Science.gov (United States)

    Pozzi, Oscar R; Zalutsky, Michael R

    2017-03-01

    Alpha particles are radiation of high energy and short range, properties that can lead to radiolysis-mediated complications in labeling chemistry at the high radioactivity levels required for clinical application. In previous papers in this series, we have shown that radiation dose has a profound effect on the astatine species that are present in the labeling reaction and their suitability for the synthesis of N-succinimidyl 3-[ 211 At]astatobenzoate. The purpose of this study was to evaluate the effects of adding N-chlorosuccinimide (NCS) to the methanol solution used for initial isolation of 211 At after distillation, a process referred to as 211 At stabilization, on 211 At chemistry after exposure to high radiation doses. High performance liquid chromatography was used to evaluate the distribution of 211 At species present in methanol in the 500-65,000Gy radiation dose range and the synthesis of SAB from N-succinimidyl 3-(tri-n-butylstannyl)benzoate in the 500-120,000Gy radiation dose range using different 211 At timeactivity combinations under conditions with/without 211 At stabilization. In the absence of NCS stabilization, a reduced form of astatine, At(2), increased with increasing radiation dose, accounting for about half the total activity by about 15,000Gy, while with stabilization, At(2) accounted for 60,000Gy. SAB yields without stabilization rapidly declined with increasing dose, falling to ~20% at about 5000Gy while with stabilization, yields >80% were obtained with 211 At solutions stored for more than 23h and receiving radiation doses >100,000Gy. Adding NCS to the methanol solution used for initial isolation of 211 At is a promising strategy for countering the deleterious effects of radiolysis on 211 At chemistry. This strategy could facilitate the ability to perform 211 At labeling at sites remote from its production and at the high activity levels required for clinical applications. Copyright © 2016 Elsevier Inc. All rights reserved.

  19. Gclust Server: 184486 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 184486 HSA_5901938 Cluster Sequences - 212 NP_008952.1 fasting induced gene ; no an...luster sequences Cluster Sequences Link to related sequences - Sequence length 212 Representative annotation NP_008952.1 fasting

  20. 46 CFR 97.12-5 - Manual.

    Science.gov (United States)

    2010-10-01

    ... Cargoes when carried in General Cargo Vessels,” 1966, 1 printed and distributed by the National Cargo Bureau, Inc., 17 Battery Place, Suite 1232, New York, NY 10004-1207 (telephone: 212-785-8300; fax: 212...

  1. NCBI nr-aa BLAST: CBRC-XTRO-01-2615 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-2615 ref|XP_710348.1| CTA212 antisense protein [Candida albicans SC531...4] ref|XP_710331.1| CTA212 antisense protein [Candida albicans SC5314] gb|EAK91068.1| CTA212 antisense prote...in [Candida albicans SC5314] gb|EAK91085.1| CTA212 antisense protein [Candida albicans SC5314] XP_710348.1 0.20 29% ...

  2. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NKTLHQLTMLWGNRLSELRLARRSHFDMKAGIWTVPKELSKTNRPIR 271 ... IWLAIERSRASTSNKTLHQLTMLWGNRLSELRLARRSHFDMKAGI...WTVPKELSKTNRPIR Sbjct: 121 IWLAIERSRASTSNKTLHQLTMLWGNRLSELRLARRSHFDMKAGIWTVPKELSK...WMQWLDS Sbjct: 1 ... QDFVTLDDCVNYWLKHYVPNLKKGTQELYRSFSRNYFLGTFPARNIETIPAREWMQWLDS 60 ... Query: 212 IWLAIERSRASTS

  3. AcEST: BP912611 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tion tr|A8SHW7|A8SHW7_9FIRM Putative uncharacterized protein OS=Faecalibacterium prausnitzii M21/2 Align len...HW7|A8SHW7_9FIRM Putative uncharacterized protein OS=Faecalibacterium prausnitzii M21/2 GN=FAEPRAM212_03491

  4. Factors influencing in vitro shoot regeneration of Macadamia ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-11-19

    Nov 19, 2008 ... Micropropagation of chestnut (Castanea sativa Mill). Symposium on In vitro Problems Related to Mass Propagation of. Horticultural. Plants. Acta. Hortic. 212. :http://www.actahort.org/books/212/212_80.htm. Mulwa RMS, Bhalla PL (2000). In vitro shoot multiplication of. Macadamia tetraphylla L. Johnson.

  5. Aqua(dicyanamido-κN1(2,9-dimethyl-1,10-phenanthroline-κ2N,N′(nitrato-κ2O,O′cobalt(II–2,9-dimethyl-1,10-phenanthroline–water (2/1/2

    Directory of Open Access Journals (Sweden)

    Pei-Zheng Zhao

    2011-10-01

    Full Text Available In the title compound, 2[Co(C2N3(NO3(C14H12N2(H2O]·C14H12N2·2H2O, the CoII ion is coordinated by a bidentate 2,9-dimethyl-1,10-phenanthroline (dmphen ligand, a bidentate nitrate anion, a water molecule and a monodentate dicyanamide group in a distorted octahedral geometry. One uncoordinated dmphen molecule is situated on a crystallographic twofold axis and the asymmetric unit is completed by one water molecule. In the crystal, molecules form a one-dimensional framework in the [001] direction through O—H...N and O—H...O hydrogen bonds. The crystal packing is further stabilized by π–π stacking interactions between the dmphen rings of neighboring molecules, with a centroid–centroid separation of 3.5641 (8 Å and a partially overlapped arrangement of parallel dmphen rings with a distance of 3.407 (2 Å.

  6. Secondary School Teachers Don’t Have Time to Engage in the Most Important Aspects of Information Literacy Due to Curricular Pressures. A Review of: Williams, D. and C. Wavell. “Secondary School Teachers’ Conceptions of Student Information Literacy.” Journal of Librarianship and Information Science 39.4 (2007: 199-212.

    Directory of Open Access Journals (Sweden)

    Lotta Haglund

    2009-03-01

    Full Text Available Objective – To examine school teachers’ understanding of student information literacy and to look at the implications of the findings for developing information literacy in students.Design – Qualitative research design (group discussions; verbal and written reflections.Setting – Secondary schools in the United Kingdom.Subjects – Secondary school teachers with various subject specializations.Methods – The study initially involved 31 secondary school teachers; 24 from seven schools in Scotland and seven from two schools in England. Participant teachers were self-selecting. The study took a phenomenographic approach. Teachers’ perceptions of their students’ abilities and their experiences and perceptions of their role in developing these abilities were examined through data collection in three stages. During the first stage, group discussions established the teacher’s initial conceptions of information literacy. Participants also filled out an information task grid which, together with focus questions, ensured that discussions were kept in the realm of practice. During the second stage of data collection, teachers observed and reflected on their students’ use of information in classroom activities. This was accompanied by informal site visits during which 26 of the participants were introduced to information literacy frameworks and definitions in order to contextualize reflections and discussions. Field notes were used to record these informal meetings. Six participants provided written feedback on reflections. In the third and final stage, a summary of themes from the first two stages was sent to 23 of the participants prior to a second group discussion in order to try to stimulate further reflection. Discussions were audio recorded and transcribed. The transcribed data were analyzed for the dimensions of variation of teachers’ conceptions of student information literacy and key elements associated with each category of description were determined.Main Results – The data revealed six main conceptions of student information literacy among the teachers: “finding information,” “linguistic understanding,” “makingmeaning,” “skills,” “critical awareness ofsources,” and “independent learning.” There was no particular hierarchy in their conceptualization, although independent learning seemed to be the ultimate goal. Teachers’ conceptions in the beginning ofthe study focused on the ability to find information, whereas after a period of reflection and further discussions, a broader and more complex understanding of information literacy appeared. Table 1 simplifies some of the data from the table in the article and shows conceptualizations as well as some of the contextual elements. Teachers felt that they had at least some control over the development of student ability to find information, develop skills, and critically appraise sources, even though these were not the highest learning priority outcomes. However, in the three areas of ability which the teachers regarded as of high learning priority (linguistic understanding, making meaning and independent learning, they felt that they had little control over the development of these abilities in the students.Conclusion – The teachers’ conceptions of student information literacy overlapped with the ideas in existing models and frameworks for information literacy. However, some areas of information literacy were not addressed by the teachers, i.e., ethical issues in the use of information. In the categories of description of high learning priority, the main reason for the low sense of control by the teachers seemed to be curricular pressures – “our content is prescribed and time allocated doing each of these things is prescribed so we have got limited room for maneuvering” (206. The teachers tended to regard information literacy as process and skills-orientated, with little connection to learning. The authors note that other research also suggests that school librarians also have difficulty relating information finding to learning in specific subject disciplines. There is a clear gap here as the authors point out that “there is a danger that students will not understand the significance of learning with information for academic achievement or for independent learning” (209.The authors suggest that the way forward for further development of information literacy in the classroom and library is through dialogue and that “librarian-teacher collaborations needs to be founded on shared understanding of the complex inter-relationship between information and learning” (209.

  7. Mosaic ring chromosome 21, monosomy 21, and isodicentric ring chromosome 21: Prenatal diagnosis, molecular cytogenetic characterization, and association with 2-Mb deletion of 21q21.1–q21.2 and 5-Mb deletion of 21q22.3

    Directory of Open Access Journals (Sweden)

    Chih-Ping Chen

    2012-03-01

    Conclusion: An extra interstitial 21q deletion can be associated with mosaic r(21 in addition to a terminal 21q deletion. aCGH is useful in determining the breakpoints and associated subtle structural abnormalities in cases of prenatally detected ring chromosome in order to facilitate genetic counseling.

  8. Safety assessment of poloxamers 101, 105, 108, 122, 123, 124, 181, 182, 183, 184, 185, 188, 212, 215, 217, 231, 234, 235, 237, 238, 282, 284, 288, 331, 333, 334, 335, 338, 401, 402, 403, and 407, poloxamer 105 benzoate, and poloxamer 182 dibenzoate as used in cosmetics.

    Science.gov (United States)

    Singh-Joy, Subhashni D; McLain, Valerie C

    2008-01-01

    Poloxamers are polyoxyethlyene, polyoxypropylene block polymers. The impurities of commercial grade Poloxamer 188, as an example, include low-molecular-weight substances (aldehydes and both formic and acetic acids), as well as 1,4-dioxane and residual ethylene oxide and propylene oxide. Most Poloxamers function in cosmetics as surfactants, emulsifying agents, cleansing agents, and/or solubilizing agents, and are used in 141 cosmetic products at concentrations from 0.005% to 20%. Poloxamers injected intravenously in animals are rapidly excreted in the urine, with some accumulation in lung, liver, brain, and kidney tissue. In humans, the plasma concentration of Poloxamer 188 (given intravenously) reached a maximum at 1 h, then reached a steady state. Poloxamers generally were ineffective in wound healing, but were effective in reducing postsurgical adhesions in several test systems. Poloxamers can cause hypercholesterolemia and hypertriglyceridemia in animals, but overall, they are relatively nontoxic to animals, with LD(50) values reported from 5 to 34.6 g/kg. Short-term intravenous doses up to 4 g/kg of Poloxamer 108 produced no change in body weights, but did result in diffuse hepatocellular vacuolization, renal tubular dilation in kidneys, and dose-dependent vacuolization of epithelial cells in the proximal convoluted tubules. A short-term inhalation toxicity study of Poloxamer 101 at 97 mg/m(3) identified slight alveolitis after 2 weeks of exposure, which subsided in the 2-week postexposure observation period. A short-term dermal toxicity study of Poloxamer 184 in rabbits at doses up to 1000 mg/kg produced slight erythema and slight intradermal inflammatory response on histological examination, but no dose-dependent body weight, hematology, blood chemistry, or organ weight changes. A 6-month feeding study in rats and dogs of Poloxamer 188 at exposures up to 5% in the diet produced no adverse effects. Likewise, Poloxamer 331 (tested up to 0.5 g/kg day(-1)), Poloxamer 235 (tested up to 1.0 g/kg day(-1)), and Poloxamer 338 (at 0.2 or 1.0 g/kg day(-1)) produced no adverse effects in dogs. Poloxamer 338 (at 5.0 g/kg day(-1)) produced slight transient diarrhea in dogs. Poloxamer 188 at levels up to 7.5% in diet given to rats in a 2-year feeding study produced diarrhea at 5% and 7.5% levels, a small decrease in growth at the 7.5% level, but no change in survival. Doses up to 0.5 mg/kg day(-1) for 2 years using rats produced yellow discoloration of the serum, high serum alkaline phosphatase activity, and elevated serum glutamicpyruvic transaminase and glutamic-oxalacetic transaminase activities. Poloxamers are minimal ocular irritants, but are not dermal irritants or sensitizers in animals. Data on reproductive and developmental toxicity of Poloxamers were not found. An Ames test did not identify any mutagenic activity of Poloxamer 407, with or without metabolic activation. Several studies have suggested anticarcinogenic effects of Poloxamers. Poloxamers appear to increase the sensitivity to anticancer drugs of multidrug-resistant cancer cells. In clinical testing, Poloxamer 188 increased the hydration of feces when used in combination with a bulk laxative treatment. Compared to controls, one study of angioplasty patients receiving Poloxamer 188 found a reduced myocardial infarct size and a reduced incidence of reinfarction, with no evidence of toxicity, but two other studies found no effect. Poloxamer 188 given to patients suffering from sickle cell disease had decreased pain and decreased hospitilization, compared to controls. Clinical tests of dermal irritation and sensitization were uniformly negative. The Cosmetic Ingredient Review (CIR) Expert Panel stressed that the cosmetic industry should continue to use the necessary purification procedures to keep the levels below established limits for ethylene oxide, propylene oxide, and 1,4-dioxane. The Panel did note the absence of reproductive and developmental toxicity data, but, based on molecular weight and solubility, there should be little skin penetration and any penetration of the skin should be slow. Also, the available data demonstrate that Poloxamers that are introduced into the body via routes other than dermal exposure have a rapid clearance from the body, suggesting that there would be no risk of reproductive and/or developmental toxicity. Overall, the available data do not suggest any concern about carcinogenesis. Although there are gaps in knowledge about product use, the overall information available on the types of products in which these ingredients are used, and at what concentration, indicates a pattern of use. Based on these safety test data and the information that the manufacturing process can be controlled to limit unwanted impurities, the Panel concluded that these Poloxamers are safe as used.

  9. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC212 (Link to dictyBase) - - - Contig-U16455-1 VFC212P (Link... to Original site) VFC212F 260 VFC212Z 343 VFC212P 603 - - Show VFC212 Library VF (Link to library) Clone ID VFC212 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16455-1 Original site URL http://dict...actor 1 alpha. 394 0.0 3 X55972 |X55972.1 D. discoideum EF1-II gene for elongation factor 1 alpha. 347 0.0 3...4.0 %: vesicles of secretory system 4.0 %: endoplasmic reticulum >> prediction fo

  10. 10 CFR 205.12 - Addresses for filing documents with the DOE.

    Science.gov (United States)

    2010-01-01

    ..., 212 North Saint Paul Street, Dallas, Texas 75201. Region 7 Iowa, Kansas, Missouri, Nebraska; Regional..., 1655 Peachtree Street NW., Atlanta, Georgia 30309. Region 5 Illinois, Indiana, Michigan, Minnesota...

  11. ORF Alignment: NC_002971 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available in PilB ... [Coxiella burnetii RSA 493] ... Length = 357 ... Query: 153 ASIVELVNQVLTDAIYREASDVHFEPMQQHYRIRMCID...GILHTTTLLPNTQSPAMSSRLK 212 ... ASIVELVNQVLTDAIYREASDVHFEPMQQHYRIRMCID...GILHTTTLLPNTQSPAMSSRLK Sbjct: 1 ... ASIVELVNQVLTDAIYREASDVHFEPMQQHYRIRMCIDGILHTTTLLPNTQSPAMSSRLK 60 ... Q

  12. α decay of the very neutron-deficient isotopes 197-199Fr

    Science.gov (United States)

    Kalaninová, Z.; Andreyev, A. N.; Antalic, S.; Heßberger, F. P.; Ackermann, D.; Andel, B.; Drummond, M. C.; Hofmann, S.; Huyse, M.; Kindler, B.; Lane, J. F. W.; Liberati, V.; Lommel, B.; Page, R. D.; Rapisarda, E.; Sandhu, K.; Šáro, Š.; Thornthwaite, A.; Van Duppen, P.

    2013-04-01

    Decay properties of the very neutron-deficient isotopes 197-199Fr were studied at the velocity filter Separator for Heavy Ion reaction Products (SHIP) at GSI in Darmstadt. The isotopes were produced in the 2n-4n evaporation channels of the fusion-evaporation reaction 60Ni+141Pr → 201Fr*. Improved α-decay properties of 199Fr were determined and the possible existence of two α-decaying states in this nucleus is discussed. For the isotope 198Fr a broad α-decay energy distribution was detected in the range of (7470-7930) keV and two α-decaying states were observed with half-lives of 1.1(7) and 15(3) ms. The new isotope 197Fr was identified based on the observation of one α-decay chain yielding Eα=7728(15) keV and T1/2=0.6-0.3+3.0 ms. The systematics of reduced α-decay widths are presented for neutron-deficient francium, radon, and astatine isotopes.

  13. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Directory of Open Access Journals (Sweden)

    Sherif S Nafee

    Full Text Available Thallium (81(217Tl, Bismuth (83(217Bi, Astatine (85(217At, Francium (87(217Fr, Actinium (89(217Ac and Protactinium (91(217Pa are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221Fr-, (221Ac- and (221Pa-α-decays.

  14. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Science.gov (United States)

    Nafee, Sherif S; Shaheen, Salem A; Al-Ramady, Amir M

    2016-01-01

    Thallium (81(217)Tl, Bismuth (83(217)Bi), Astatine (85(217)At), Francium (87(217)Fr), Actinium (89(217)Ac) and Protactinium (91(217)Pa) are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α) has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF) calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221)Fr-, (221)Ac- and (221)Pa-α-decays.

  15. On the theory of time dilation in chemical kinetics

    Science.gov (United States)

    Baig, Mirza Wasif

    2017-10-01

    The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.

  16. SPECT assay of radiolabeled monoclonal antibodies. Progress report, September 1, 1992--August 24, 1993

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1993-08-20

    The overall goal of this project is to improve the effectiveness of single photon emission computed tomography (SPECT) to image and quantify radiolabeled monoclonal antibodies. During the past year, we have made significant progress toward this goal, and this report summarizes that work. Our efforts have been mainly directed along three fronts. First, we have developed and tested new reconstruction methods including three-dimensional iterative algorithms that model non-uniform attenuation and distance-dependent detector response. Both fan beam and parallel beam collimator geometries have been modeled and novel ways of improving the efficiency of the computationally intensive methods have been introduced. Second, an ultra-high resolution, small field-of-view pinhole collimator has been constructed and evaluated. Reconstructed spatial resolution of 1 to 3 mm (FWHM) has been achieved in phantom scans with a useful field-of-view of 9 to 10 cm. Finally, we have investigated the ability of SPECT to image and quantify astatine-211 distributions. Reconstructed images of phantom data demonstrated quantitative accuracy to within 10% with proper attenuation and scatter compensation.

  17. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    Science.gov (United States)

    Marsh, B. A.; Andel, B.; Andreyev, A. N.; Antalic, S.; Atanasov, D.; Barzakh, A. E.; Bastin, B.; Borgmann, Ch.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Dehairs, M.; Derkx, X.; De Witte, H.; Fedorov, D. V.; Fedosseev, V. N.; Focker, G. J.; Fink, D. A.; Flanagan, K. T.; Franchoo, S.; Ghys, L.; Huyse, M.; Imai, N.; Kalaninova, Z.; Köster, U.; Kreim, S.; Kesteloot, N.; Kudryavtsev, Yu.; Lane, J.; Lecesne, N.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Molkanov, P. L.; Nicol, T.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Schweikhard, L.; Seliverstov, M. D.; Sels, S.; Sjödin, A. M.; Truesdale, V.; Van Beveren, C.; Van Duppen, P.; Wendt, K.; Wienholtz, F.; Wolf, R. N.; Zemlyanoy, S. G.

    2013-12-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar free ionization using the Laser Ion Source Trap, LIST (Po); isobar selective particle identification using the multi-reflection time-of-flight mass separator (MR-ToF MS) of ISOLTRAP (Au, At). These are summarized as part of an overview of the current status of the in-source resonance ionization spectroscopy setup at ISOLDE.

  18. Studies of Stable Octupole Deformations in the Radium Region

    CERN Multimedia

    2002-01-01

    The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

  19. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  20. Evaluating 99mTc Auger electrons for targeted tumor radiotherapy by computational methods.

    Science.gov (United States)

    Tavares, Adriana Alexandre S; Tavares, João Manuel R S

    2010-07-01

    Technetium-99m (99mTc) has been widely used as an imaging agent but only recently has been considered for therapeutic applications. This study aims to analyze the potential use of 99mTc Auger electrons for targeted tumor radiotherapy by evaluating the DNA damage and its probability of correct repair and by studying the cellular kinetics, following 99mTc Auger electron irradiation in comparison to iodine-131 (131I) beta minus particles and astatine-211 (211At) alpha particle irradiation. Computational models were used to estimate the yield of DNA damage (fast Monte Carlo damage algorithm), the probability of correct repair (Monte Carlo excision repair algorithm), and cell kinetic effects (virtual cell radiobiology algorithm) after irradiation with the selected particles. The results obtained with the algorithms used suggested that 99mTc CKMMX (all M-shell Coster-Kroning--CK--and super-CK transitions) electrons and Auger MXY (all M-shell Auger transitions) have a therapeutic potential comparable to high linear energy transfer 211At alpha particles and higher than 131I beta minus particles. All the other 99mTc electrons had a therapeutic potential similar to 131I beta minus particles. 99mTc CKMMX electrons and Auger MXY presented a higher probability to induce apoptosis than 131I beta minus particles and a probability similar to 211At alpha particles. Based on the results here, 99mTc CKMMX electrons and Auger MXY are useful electrons for targeted tumor radiotherapy.

  1. Radiobromination of humanized anti-HER2 monoclonal antibody trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate, a potential label for immunoPET

    Energy Technology Data Exchange (ETDEWEB)

    Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail: vladimir.tolmachev@bms.uu.se

    2005-08-01

    Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.

  2. Development and radiotherapeutic application of /sup 211/At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    Energy Technology Data Exchange (ETDEWEB)

    Adelstein, S.J.; Zalutsky, M.; Bloomer, W.

    1981-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.

  3. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  4. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  5. Download this PDF file

    African Journals Online (AJOL)

    (Eph. 2:12), far from Christ and without God in the world (Eph. 2:12), are now alive (Eph. 2:5), ..... unity of faith and of the knowledge of the Son of God, to the mature man, ..... the presence, power, agency and riches of Christ. 10 I suppose the ...

  6. 78 FR 59854 - Defense Federal Acquisition Regulation Supplement: Acquisitions in Support of Operations in...

    Science.gov (United States)

    2013-09-30

    ... writing to the address shown below on or before November 29, 2013, to be considered in the formation of a... formation of the final rule. List of Subjects in 48 CFR Parts 206, 212, 225, and 252 Government procurement. Manuel Quinones, Editor, Defense Acquisition Regulations System. Therefore, 48 CFR parts 206, 212, 225...

  7. Mapping of barley alpha-amylases and outer subsite mutants reveals dynamic high-affinity subsites and barriers in the long substrate binding cleft

    DEFF Research Database (Denmark)

    Kandra, L.; Abou Hachem, Maher; Gyemant, G.

    2006-01-01

    as binding barriers. Barley a-amylase I mutants Y105A and T212Y at subsite -6 and +4 resulted in release or anchoring of bound substrate, thus modifying the affinities of other high-affinity subsites (-2 and +2) and barriers. The double mutant Y105A-T212Y displayed a hybrid subsite affinity profile...

  8. n-Colour even self-inverse compositions

    Indian Academy of Sciences (India)

    Introduction. In the classical theory of partitions, compositions were first defined by MacMahon [1] as ordered partitions. For example, there are 5 partitions and 8 compositions of 4. The partitions are 4, 31, 22, 212, 14 and the compositions are 4, 31, 13, 22, 212, 121,. 122, 14. Agarwal and Andrews [2] defined an n-colour ...

  9. AcEST: BP915492 [AcEST

    Lifescience Database Archive (English)

    Full Text Available +L Sbjct: 100 LTHESKDAIAKKKHVYDRADIKL 122 >tr|A8SAU4|A8SAU4_9FIRM Putative uncharacterized protein OS=Faec...alibacterium prausnitzii M21/2 GN=FAEPRAM212_01472 PE=3 SV=1 Length = 428 Score = 3

  10. AcEST: BP914384 [AcEST

    Lifescience Database Archive (English)

    Full Text Available HRGF 3 DKEFRYLRTVIVTAAV+ GF Sbjct: 124 DKEFRYLRTVIVTAAVYWGF 143 >tr|A8SBJ8|A8SBJ8_9FIRM Putative uncharacterized protein OS=Faecal...9_9FIRM Putative uncharacterized protein OS=Faecalibacterium prausnitzii M21/2 GN=FAEPRAM212_00540 PE=4 SV=1

  11. Affectivity and Race: Studies from Nordic Contexts,

    DEFF Research Database (Denmark)

    Lapina, Linda

    2017-01-01

    Affectivity and Race: Studies from Nordic Contexts,, edited by Rikke Andreassen and Kathrine Vitus, Farnham, Ashgate, 2015, 212 pp., £60.00 (hardcover), ISBN 978-1-4724-5349-5......Affectivity and Race: Studies from Nordic Contexts,, edited by Rikke Andreassen and Kathrine Vitus, Farnham, Ashgate, 2015, 212 pp., £60.00 (hardcover), ISBN 978-1-4724-5349-5...

  12. appraisal of indigenous pig procution and management practices in ...

    African Journals Online (AJOL)

    Dr Adesope

    61. Britt, J. H. and Gaska, J. 1998. Comparison of two estrous synchronization programme in a large confinement housed dairy herd. Journal of the American Veterinary Medical Assoc. 212. (2): 210 – 212. Dixon, I. E. and Hopkins, G. J. 1996. Superovulation of cattle using porcine pituitary gonadotrophin preparation (Pluset ...

  13. 12 CFR 7.1016 - Independent undertakings to pay against documents.

    Science.gov (United States)

    2010-01-01

    ... Publishing, Inc., 212/206-1150; http://www.iccwbo.org); the Supplements to UCP 500 & 600 for Electronic... Electronic Presentation) (available from ICC Publishing, Inc., 212/206-1150; http://www.iccwbo.org... value other than money, the bank should ensure that market fluctuations that affect the value of the...

  14. Reduction of protein adsorption to a solid surface by a coating composed of polymeric micelles with a glass-like core

    NARCIS (Netherlands)

    Hofs, B.; Brzozowska, A.; de Keizer, A.; Norde, W.; Stuart, Martien A. Cohen

    2008-01-01

    Adsorption studies by optical reflectometry show that complex coacervate core micelles (C3Ms) composed of poly([4-(2-amino-ethylthio)-butylene]hydrochloride)(49)-block-poly(ethylene oxide)(212) and poly([4-(2carboxy-ethylthio)-butylene] sodium salt)(47)-block-poly(ethylene oxide)(212) adsorb in

  15. Reduction of protein adsorption to a solid surface by a coating composed of polymeric micelles with a glass-like core

    NARCIS (Netherlands)

    Hofs, P.S.; Brzozowska, A.M.; Keizer, de A.; Norde, W.; Cohen Stuart, M.A.

    2008-01-01

    Adsorption studies by optical reflectometry show that complex coacervate core micelles (C3Ms) composed of poly([4-(2-amino-ethylthio)-butylene] hydrochloride)49-block-poly(ethylene oxide)212 and poly([4-(2-carboxy-ethylthio)-butylene] sodium salt)47-block-poly(ethylene oxide)212 adsorb in equal

  16. DMPD: The role of viral nucleic acid recognition in dendritic cells for innate andadaptive antiviral immunity. [Dynamic Macrophage Pathway CSML Database

    Lifescience Database Archive (English)

    Full Text Available ndadaptive antiviral immunity. Eisenacher K, Steinberg C, Reindl W, Krug A. Immunobiology. 2007;212(9-10):70...rs Eisenacher K, Steinberg C, Reindl W, Krug A. Publication Immunobiology. 2007;212(9-10):701-14. Epub 2007

  17. DMPD: Molecular mechanisms of the anti-inflammatory functions of interferons. [Dynamic Macrophage Pathway CSML Database

    Lifescience Database Archive (English)

    Full Text Available varik P, Sauer I, Schaljo B. Immunobiology. 2007;212(9-10):895-901. Epub 2007 Nov 8. (.png) (.svg) (.html) (...ovarik P, Sauer I, Schaljo B. Publication Immunobiology. 2007;212(9-10):895-901. Epub 2007 Nov 8. Pathway -

  18. SPS and PS Experiments Committee

    CERN Multimedia

    CERN. Geneva

    2004-01-01

    OPEN SESSION: 09:00 Status report of NA58 / COMPASS: A. Magnon 09:40 Status report of PS212 / DIRAC: L. Tausher 10:10 PS212 / DIRAC Addendum: L. Nemenov CLOSED SESSION on Tuesday, 27 April 2004 after the open session, Main Building, 6th floor conference room

  19. 78 FR 37232 - National Institute on Aging; Notice of Closed Meetings

    Science.gov (United States)

    2013-06-20

    ... Committee: National Institute on Aging Special Emphasis Panel; NIA DBSR DATASETS. Date: July 11-12, 2013... Wisconsin Avenue, Suite 2C212, Bethesda, MD 20892, 301-402-7707, [email protected]nia.nih.gov . Name of Committee..., Gateway Building, 7201 Wisconsin Avenue, Suite 2C212, Bethesda, MD 20892, 301-402-7707, [email protected]nia...

  20. Spin-orbit relaxation of Cl(2P½) and F(2P½) in a gas of H2

    NARCIS (Netherlands)

    Abrahamsson, E.; Groenenboom, G.C.; Krems, R.V.

    2007-01-01

    The authors present quantum scattering calculations of rate coefficients for the spin-orbit relaxation of F(P-2(1/2)) atoms in a gas of H-2 molecules and Cl(P-2(1/2)) atoms in a gas of H-2 and D-2 molecules. Their calculation of the thermally averaged rate coefficient for the electronic relaxation

  1. Gclust Server: 123403 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Cluster Sequences Related Sequences(15) 212 grl-8: GRound-Like (grd related) family member (grl-8) 1 1.00e-99...Sequence length 212 Representative annotation grl-8: GRound-Like (grd related) family member (grl-8) Number

  2. ORIGINAL ARTICLE

    African Journals Online (AJOL)

    User

    The role of seminal fructose concentration does not only lie in the assessment of seminal vesicle dysfunction but in conjunction with other ... tory duct obstruction, seminal vesicle dysfunction or hy- poplasia (Aumuller and Riva, 1992). ..... tecting agenesis of seminal vesicles or the vas deferens. J Androl 21(2): 207-212.

  3. 78 FR 20935 - Changes in Flood Hazard Determinations

    Science.gov (United States)

    2013-04-08

    ..., Kannapolis, NC 28081. Wake (FEMA Docket No.: B-1274) Town of Fuquay-Varina The Honorable John W. Engineering... East Main WY 82729. Street, Sundance, WY 82729. Sweetwater (FEMA Docket No.: B- City of Rock Springs...)........ Demshar, Jr., Mayor, Works, 212 D City of Rock Springs, Street, Rock 212 D Street, Rock Springs, WY 82901...

  4. EST Table: FS736363 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS736363 E_FL_bmmt_05M04_R_0 10/09/28 68 %/212 aa gb|ADE18445.1| cytochrome c oxida...se subunit II [Bombyx mori] 10/09/03 54 %/212 aa FBpp0100177|mt:CoII-PA 10/08/28 36 %/170 aa MTCE.31#CE35351

  5. 76 FR 67628 - Airworthiness Directives; Bell Helicopter Textron, Inc. (Bell) Model 204B, 205A, 205A-1, 205B...

    Science.gov (United States)

    2011-11-02

    ... holes on yokes installed on Model 212 helicopters. That AD was intended to detect corrosion pitting and...-02, Bell has introduced a replacement stainless steel yoke, P/N 212-011-102. Bell issued Alert... configuration. The replacement stainless steel yokes have improved design characteristics addressing the...

  6. Fellowship | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Date of birth: 30 September 1947. Address: President & Dean, Tandon School of Engineering, New York University, 1242 Bobst Lib., 70 Washington Sq. South, New York, NY 10021, USA Contact: Office: (+1-212) 992 7914. Fax: (+1-212) 995 4300. Email: krs3@nyu.edu. YouTube; Twitter; Facebook; Blog ...

  7. 76 FR 73783 - Residential, Business, and Wind and Solar Resource Leases on Indian Land

    Science.gov (United States)

    2011-11-29

    ..., investment, productivity, innovation, or the ability of the U.S.-based enterprises to compete with foreign... Mexico. We requested that tribes submit written comments by April 18, 2011. We received written and oral..., but now listed in separate subparts. 162.212, 162.606 162.009, 162.212....... Bidding on advertised No...

  8. Drug: D03002 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D03002 Drug Atipamezole (USAN/INN); Antisedan (TN) C14H16N2 212.1313 212.2902 D0300...ergic receptor [HSA:150 151 152] [KO:K04138 K04139 K04140] Atipamezole D03002 Atipamezole (USAN/INN) CAS: 10

  9. Resveratrol analogue 3,4,4′,5-tetramethoxystilbene inhibits growth, arrests cell cycle and induces apoptosis in ovarian SKOV‐3 and A-2780 cancer cells

    Energy Technology Data Exchange (ETDEWEB)

    Piotrowska, Hanna; Myszkowski, Krzysztof; Ziółkowska, Alicja [Department of Toxicology, Poznan University of Medical Sciences, Poznan (Poland); Kulcenty, Katarzyna [Chair of Medical Biotechnology, Poznan University of Medical Sciences, Poznan (Poland); Wierzchowski, Marcin [Department of Chemical Technology of Drugs, Poznan University of Medical Sciences, Poznan (Poland); Kaczmarek, Mariusz [Department of Clinical Immunology, Poznan University of Medical Sciences, Poznan (Poland); Murias, Marek [Department of Toxicology, Poznan University of Medical Sciences, Poznan (Poland); Kwiatkowska-Borowczyk, Eliza [Chair of Medical Biotechnology, Poznan University of Medical Sciences, Poznan (Poland); Department of Cancer Diagnostics and Immunology, Greater Poland Cancer Centre, Poznan (Poland); Jodynis-Liebert, Jadwiga, E-mail: liebert@ump.edu.pl [Department of Toxicology, Poznan University of Medical Sciences, Poznan (Poland)

    2012-08-15

    In the screening studies, cytotoxicity of 12 methylated resveratrol analogues on 11 human cancer cell lines was examined. The most active compound 3,4,4′5-tetramethoxystilbene (DMU-212) and two ovarian cancer cell lines A-2780 (IC{sub 50} = 0.71 μM) and SKOV-3 (IC{sub 50} = 11.51 μM) were selected for further investigation. To determine the mechanism of DMU-212 cytotoxicity, its ability to induce apoptosis was examined. DMU-212 arrested cell cycle in the G2/M or G0/G1 phase which resulted in apoptosis of both cell lines. The expression level of 84 apoptosis-related genes was investigated. In SKOV-3 cells DMU-212 caused up-regulation of pro-apoptotic Bax, Apaf-1 and p53 genes, specific to intrinsic pathway of apoptosis, and a decrease in Bcl-2 and Bcl 2110 mRNA expressions. Conversely, in A-2780 cells an increased expression of pro-apoptotic genes Fas, FasL, TNF, TNFRSF10A, TNFRSF21, TNFRSF16 specific to extracellular mechanism of apoptosis was observed. There are no data published so far regarding the receptor mediated apoptosis induced by DMU-212. The activation of caspase-3/7 was correlated with decreased TRAF-1 and BIRC-2 expression level in A-2780 cells exposed to DMU-212. DMU-212 caused a decrease in CYP1A1 and CYP1B1 mRNA levels in A-2780 by 50% and 75%, and in SKOV-3 cells by 15% and 45%, respectively. The protein expression was also reduced in both cell lines. It is noteworthy that the expression of CYP1B1 protein was entirely inhibited in A-2780 cells treated with DMU-212. It can be suggested that different CYP1B1 expression patterns in either ovarian cell line may affect their sensitivity to cytotoxic activity of DMU-212. -- Highlights: ► DMU-212 was the most cytotoxic among 12 O-methylated resveratrol analogues. ► DMU-212 arrested cell cycle at G2/M and G0/G1phase ► DMU-212 triggered mitochondria- and receptor‐mediated apoptosis. ► DMU-212 entirely inhibited CYP1B1 protein expression in A-2780 cells.

  10. AcEST: BP911804 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YTQ 117 >tr|A8S6E9|A8S6E9_9FIRM Putative uncharacterized protein OS=Faecalibacterium prausnitzii M21/2 GN=FA...haracterized protein OS=Faecalibacterium prausnitzii M21/2 GN=FAEPRAM212_00542 PE=4 SV=1 Length = 117 Score ...Y Q Sbjct: 92 FESSSWVEPMDFTSNLSSRLRSLYTQ 117 >tr|A8S7R2|A8S7R2_9FIRM Putative unc

  11. Synthesis of functionalized cobaltacarboranes based on the closo-[(1,2-C2B9H11)(2)-3,3 '-Co](-) ion bearing polydentate ligands for separation of M3+ cations from nuclear waste solutions. Electrochemical and liquid-liquid extraction study of selective transfer of M3+ metal cations to an organic phase. Molecular structure of the closo-[(8-(2-CH3O-C5H4-O)-(CH2CH2O)(2)-1,2-C2B9H10)-(1 ',2 '-C2B9H11)-3,3 '-Co]Na determined by X-ray diffraction analysis

    Czech Academy of Sciences Publication Activity Database

    Plešek, Jaromír; Grüner, Bohumír; Heřmánek, Stanislav; Báča, Jiří; Mareček, Vladimír; Jänchenová, Hana; Lhotský, Alexandr; Holub, Karel; Selucký, P.; Rais, J.; Císařová, I.; Čáslavský, Josef

    2002-01-01

    Roč. 21, 9-10 (2002), s. 975-986 ISSN 0277-5387 R&D Projects: GA MŠk LN00A028; GA MŠk LB98233; GA ČR GA104/01/0142; GA ČR GA203/99/M037; GA ČR GA104/99/1096 Institutional research plan: CEZ:AV0Z4032918 Keywords : carboranes * carba metallaboranes * dicarbollides Subject RIV: CA - Inorganic Chemistry Impact factor: 1.414, year: 2002

  12. Optimizing MIBG therapy of neuroendocrine tumors: preclinical evidence of dose maximization and synergy

    Energy Technology Data Exchange (ETDEWEB)

    Mairs, Rob J. [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)], E-mail: r.mairs@beatson.gla.ac.uk; Boyd, Marie [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)

    2008-08-15

    [{sup 131}I]meta-Iodobenzylguanidine ([{sup 131}I]MIBG) has been used for the therapy of tumors of neuroectodermal origin since the 1980s. Its role in the management of these malignancies remains controversial because of the large variation in response rates. Appreciation of the mode of conveyance of [{sup 131}I]MIBG via the noradrenaline transporter into malignant cells and of factors that influence the activity of the uptake mechanism has indicated various ways in which the effectiveness of this type of targeted radiotherapy may be improved. Experimental observations indicate that radiolabeling of MIBG to high specific activity reduced the amount of cold competitor, thereby increasing tumor dose and minimizing pressor effects. We observed supra-additive tumor cell kill and inhibition of tumor growth following combined topotecan and [{sup 131}I]MIBG treatment. The improved efficacy is related to topotecan's increased disruption of DNA repair. Radiation damage to targeted tumors may also be enhanced by the use of the {alpha}-particle emitter [{sup 211}At]astatine rather than {sup 131}I as radiolabel. Furthermore, recent experimental findings indicate that [{sup 123}I]MIBG may have therapeutic potential over and above its utility as an imaging agent. It has recently been demonstrated that potent cytotoxic bystander effects were induced by the intracellular concentration of [{sup 131}I]MIBG, [{sup 123}I]MIBG or meta-[{sup 211}At]astatobenzylguanidine. Identification of the nature of bystander factors could be exploited to maximize the specificity and potency of MIBG-targeted radiotherapy. By employing a range of strategies, there are good prospects for the improvement of the [{sup 131}I]MIBG therapy of neuroectodermal tumors.

  13. Locoregional therapy with α-emitting trastuzumab against peritoneal metastasis of human epidermal growth factor receptor 2-positive gastric cancer in mice.

    Science.gov (United States)

    Li, Huizi Keiko; Morokoshi, Yukie; Nagatsu, Kotaro; Kamada, Tadashi; Hasegawa, Sumitaka

    2017-08-01

    Peritoneal metastasis of gastric cancer (PMGC) is incurable and thus has an extremely poor prognosis. We have found, however, that locoregionally administered trastuzumab armed with astatine-211 ((211) At-trastuzumab) is effective against human epidermal growth factor receptor 2 (HER2)-positive PMGC in a xenograft mouse model. We first observed that (211) At-trastuzumab can specifically bind and effectively kill NCI-N87 (N87) cells, which are HER2-positive human metastatic GC cells, both in vitro and in s.c. tumors. We established a PMGC mouse model using N87 xenografts stably expressing luciferase to test α-particle radioimmunotherapy with (211) At-trastuzumab against PMGC. Biodistribution analysis in this PMGC mouse model revealed that the i.p. administration of (211) At-trastuzumab (1 MBq) was a more efficient means of delivery of (211) At into metastatic tumors than i.v. injection; the maximum tumor uptake with i.p. administration was over 60% injected dose per gram of tissue (%ID/g) compared to approximately 18%ID/g with i.v. injection. Surprisingly, a single i.p. injection of (211) At-trastuzumab (1 MBq) was sufficient to completely eradicate intraperitoneally disseminated HER2-positive GC xenografts in two of six treated mice by inducing DNA double-strand breaks, and to drastically reduce the tumor burden in another three mice. No bodyweight loss, leukocytopenia, or significant biochemical changes in liver or kidney function were observed in the treatment group. Accordingly, locoregionally administered (211) At-trastuzumab significantly prolonged the survival time of HER2-positive PMGC mice compared with control treatments. Our results provide a proof-of-concept demonstration that locoregional therapy with (211) At-trastuzumab may offer a new treatment option for HER2-positive PMGC. © 2017 The Authors. Cancer Science published by John Wiley & Sons Australia, Ltd on behalf of Japanese Cancer Association.

  14. Staged collision and damage data. Volume 1: Report for accident reconstruction of thirty (30) test vehicles

    Science.gov (United States)

    Hand, D. H.

    1981-01-01

    The test vehicles were impacted tested for compliance with FMVSS 212/219/301-75. As a parallel nonconflicting effort, the test vehicles were instrumented with accelerometers to measure vehicle accelerator resultants.

  15. A study on oral health of children with cardiac diseases in mashhad, iran in 2004

    National Research Council Canada - National Science Library

    Talebi, Maryam; Khordi Mood, Maryam; Mahmoudi, Mohammad; Alidad, Shaili

    2007-01-01

    .... In this descriptive cross-sectional study, case group consisting of 100 patients 2-12 years old with heart disease were examined for oral and dental status in Pediatric Cardiac Center in Mashhad, Iran, in 2004...

  16. Yeast effects on Pinot noir wine phenolics, color, and tannin composition.

    Science.gov (United States)

    Carew, Anna L; Smith, Paul; Close, Dugald C; Curtin, Chris; Dambergs, Robert G

    2013-10-16

    Extraction and stabilization of wine phenolics can be challenging for wine makers. This study examined how yeast choice affected phenolic outcomes in Pinot noir wine. Five yeast treatments were applied in replicated microvinification, and wines were analyzed by UV-visible spectrophotometry. At bottling, yeast treatment Saccharomyces cerevisiae RC212 wine had significantly higher concentrations of total pigment, free anthocyanin, nonbleachable pigment, and total tannin and showed high color density. Some phenolic effects were retained at 6 months' bottle age, and RC212 and S. cerevisae EC1118 wines showed increased mean nonbleachable pigment concentrations. Wine tannin composition analysis showed three treatments were associated with a higher percentage of trihydroxylated subunits (skin tannin indicator). A high degree of tannin polymerization was observed in wines made with RC212 and Torulaspora delbruekii , whereas tannin size by gel permeation chromatography was higher only in the RC212 wines. The results emphasize the importance of yeast strain choice for optimizing Pinot noir wine phenolics.

  17. Turgi rahvad Krimmis / Ott Kurs

    Index Scriptorium Estoniae

    Kurs, Ott, 1939-

    2002-01-01

    Illustreeritud geograafilise kaardiga ; ka krimtsakidest ehk krõmtsakidest ning krimmitatarlaste naasmisest kodumaale alates 1980-ndate II poolest. Sama ilmunud ka : Kurs, Ott. Rajamaade rahvaid. - Tartu : Ilmamaa, 2006, lk. 212-223

  18. 21 CFR 180.22 - Acrylonitrile copolymers.

    Science.gov (United States)

    2010-04-01

    ... 212 °F using 3 percent acetic acid as the hydrolic agent. Acrylonitrile monomer levels, acrylonitrile... oral administration of the test material, (3) assessment of teratogenic and mutagenic potentials, (4...

  19. 78 FR 73472 - Defense Federal Acquisition Regulation Supplement: Application of Certain Clauses to Acquisitions...

    Science.gov (United States)

    2013-12-06

    ... before February 4, 2014, to be considered in the formation of a final rule. ADDRESSES: Submit comments... Parts 211, 212, and 232 Government procurement. Manuel Quinones, Editor, Defense Acquisition Regulations...

  20. Complications following spinal cord injury: occurrence and risk factors in a longitudinal study during and after inpatient rehabilitation

    NARCIS (Netherlands)

    Haisma, H.J.; van der Woude, L.H.V.; Stam, H.J.; Bergen, M.P.; Sluis, T.A.; Post, M.W.; Bussmann, J.B.

    2007-01-01

    Objective: To assess the occurrence and risk factors for complications following spinal cord injury during and after inpatient rehabilitation. Design: Multicentre longitudinal study. Subjects: A total of 212 persons with a spinal cord injury admitted to specialized rehabilitation centres. Methods: