WorldWideScience

Sample records for astatine 212

  1. Organic chemistry of astatine

    International Nuclear Information System (INIS)

    The paper surveys the investigations on the chemical behaviour of astatine in organic systems and deals with the preparation and identification of its organic compounds. A discussion is given on some of the physico-chemical properties of these compounds determined by extrapolation techniques as well as by direct measurement. The biomedical importance of 211At-labelled compounds is briefly referred to. (authors)

  2. Bibliography of astatine chemistry and biomedical applications

    International Nuclear Information System (INIS)

    An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)

  3. Astatine-211: production and availability.

    Science.gov (United States)

    Zalutsky, Michael R; Pruszynski, Marek

    2011-07-01

    The 7.2-h half life radiohalogen (211)At offers many potential advantages for targeted α-particle therapy; however, its use for this purpose is constrained by its limited availability. Astatine-211 can be produced in reasonable yield from natural bismuth targets via the (209)Bi(α,2n)(211)At nuclear reaction utilizing straightforward methods. There is some debate as to the best incident α-particle energy for maximizing 211At production while minimizing production of (210)At, which is problematic because of its 138.4-day half life α-particle emitting daughter, (210)Po. The intrinsic cost for producing (211)At is reasonably modest and comparable to that of commercially available (123)I. The major impediment to (211)At availability is attributed to the need for a medium energy α-particle beam for its production. On the other hand, there are about 30 cyclotrons in the world that have the beam characteristics required for (211)At production. PMID:22201707

  4. Recent advances in the organic chemistry of astatine

    International Nuclear Information System (INIS)

    Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211At species, 211At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs

  5. 48 CFR 212.212 - Computer software.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Computer software. 212.212... Acquisition of Commercial Items 212.212 Computer software. (1) Departments and agencies shall identify and... technology development), opportunities for the use of commercial computer software and other...

  6. Dosimetrical considerations in astatine-211 radioimmunotherapy

    International Nuclear Information System (INIS)

    Several dosimetrical quantities have been suggested for use in alpha-particle dosimetry. To evaluate the expected biological effect when using these quantities, a Monte Carlo program was set to register the single-event distribution of both specific energy and alpha-particle track length to a cell nucleus (r=5.6 μm). Distributions were acquired for both 'bound' (simulating the effect of 211At-labelled antibodies bound to antigens on cell surfaces (r=7.0 μm)) as well as 'non-bound' (simulating 211At-labelled antibodies that have not bound to a cell) astatine-211. From these distributions, various theoretical cell survival curves were established for 3 different dosimetrical quantities, i.e. specific energy, number of alpha-particle hits and total track length. The survival curves for all quantities are presented for the corresponding mean absorbed dose in order to facilitate comparisons of the expected effects of using the 3 different quantities for both distributions of 211At decays. The theoretical survival curves presented here could, combined with experiments using 'bound' and 'non-bound' 211At in a single-cell suspension, reveal which dosimetrical quantity is most suitable for 211 At-radioimmunotherapy. (author)

  7. Discovery of the astatine, radon, francium, and radium isotopes

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  8. Extraction of astatine isotopes for development of radiopharmaceuticals using a 211Rn-211At generator

    International Nuclear Information System (INIS)

    In order to utilize a 211At isotope, a promising α-emitter for radionuclide therapy, the chemical properties of astatine isotopes are studied. We have examined wet chemistry methods through the distribution ratios of astatine in liquid-liquid extraction. The astatine isotopes have been found to be well extracted into DIPE and MIBK. We observed that the distribution ratio of astatine isotopes increases with concentrations of HCl greater than 3 M, while it decreases with the HCl concentration less than 2 M. The results will be useful for development of the 211Rn-211At generator. (author)

  9. Astatine-211-Labeled Targeted Radiotherapeutics: An Update

    International Nuclear Information System (INIS)

    The heavy halogen 211At was first proposed for use in α-particle targeted radiotherapy more than 30 years ago and continues to be one of the most promising radionuclides for this purpose. Although its 7.2-h half life is not ideal for intravenously administered whole antibodies, it is compatible with the pharmacokinetics of antibody fragments, peptides, aptamers and organic molecules. Its diverse chemistry allows its incorporation into a wide array of targeting vehicles, relying on its chemical similarity to iodine to provide a useful point of departure. On the other hand, the relatively low carbon-astatine bond strength is challenging. In common with the other α-emitters being discussed at this symposium, lack of reliable availability is one of the biggest hurdles in the use of 211At for targeted radiotherapy. However, in the case of 211At, it is not a question of production cost or availability of target material, because 211At can be produced in reasonable yield from natural bismuth targets. Rather, the difficulty is the lack of cyclotrons equipped with the medium energy α-particle beams required for its production. If the infrastructure for producing 211At is to be improved to the stage where 211At-labeled radiopharmaceuticals can have a meaningful impact, several developments must occur. First, the ability to produce clinically relevant levels of 211At that can be shipped to remote locations in chemically tractable form must be demonstrated. Approaches under consideration include compensating for radiolysis-mediated effects and the consideration of alternative chemistries. Second, strategies for compensating for heterogeneities in dose deposition must be developed, hopefully in a way that is compatible with approval for human use. And third, it is essential that more clinical trials be performed with 211At-labeled therapeutics, particularly in settings of minimum residual disease where the radiobiological advantages of α-particles can be best exploited. Our

  10. Scrutinizing "Invisible" astatine: A challenge for modern density functionals.

    Science.gov (United States)

    Sergentu, Dumitru-Claudiu; David, Grégoire; Montavon, Gilles; Maurice, Rémi; Galland, Nicolas

    2016-06-01

    The main-group 6p elements did not receive much attention in the development of recent density functionals. In many cases it is still difficult to choose among the modern ones a relevant functional for various applications. Here, we illustrate the case of astatine species (At, Z = 85) and we report the first, and quite complete, benchmark study on several properties concerning such species. Insights on geometries, transition energies and thermodynamic properties of a set of 19 astatine species, for which reference experimental or theoretical data has been reported, are obtained with relativistic (two-component) density functional theory calculations. An extensive set of widely used functionals is employed. The hybrid meta-generalized gradient approximation (meta-GGA) PW6B95 functional is overall the best choice. It is worth noting that the range-separated HSE06 functional as well as the old and very popular B3LYP and PBE0 hybrid-GGAs appear to perform quite well too. Moreover, we found that astatine chemistry in solution can accurately be predicted using implicit solvent models, provided that specific parameters are used to build At cavities. © 2016 Wiley Periodicals, Inc. PMID:27059181

  11. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  12. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates.

    Science.gov (United States)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Svedhem, Sofia; Lindegren, Sture

    2016-03-16

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single cancer cells. A promising radioactive nuclide for this type of therapy is astatine-211. Astatine-211 attached to tumor-specific antibodies as carrier molecules is a system currently under investigation for use in targeted alpha therapy. In the common radiolabeling procedure, astatine is coupled to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies. PMID:26791409

  13. Astatine-211: production, injection into monoclonal antibodies radiological effect, possible application to cancer treatment

    International Nuclear Information System (INIS)

    Methods developed in the Laboratory of Nuclear Problems, JINR, for producing astatine-211 and injecting it into monoclonal antibodies are described. The use of its diethylene triamine penta-acetic acid complex is shown to be the most effective method of injecting astatine into a biomolecules. The biological effect of the α-particles emitted from the astatine-211 is investigated using Chinese hamster fibroblasts and Ehrlich carcinoma cells. It is established that the mitotic activity depression, number of degenerating cells, number of cells with chromosome aberrations, and cellular surviving fraction depend on the concentration of the radionuclide in the medium 'in vitro'. The RBE of α-particles in comparison with 60Co γ-rays is 3. Injection of astatine-211 absorbed on tellurium particles into mice with ascitic tumors resulted in prolongation of their life or elimination of the tumors. (author). 39 refs, 7 figs

  14. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    OpenAIRE

    Rothe, S.; A. N. Andreyev; Antalic, S; Borschevsky, A.; Capponi, L.; Cocolios, T.E.; Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the io...

  15. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    Science.gov (United States)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-07-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and physical properties for use in targeted therapies for cancer. Due to the very short range of the emitted α-particles, this therapy is particularly suited to treating occult, disseminated cancers. Astatine is not intrinsically tumour-specific; therefore, it requires an appropriate tumour-specific targeting vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method that combines dry distillation of astatine-211 and a synthesis module for producing radiopharmaceuticals into a process platform. This platform will standardize production of astatinated radiopharmaceuticals, and hence, it will facilitate large clinical studies focused on this promising, but chemically challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies.

  16. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-01-01

    vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method......To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....

  17. Comment: 212 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available Oryzias javanicus Oryzias javanicus Oryzias_javanicus_L.png 212.png Kiyoshi Naruse ...(National Institute for Basic Biology) licensed under CC Attribution2.1 Japan ジャワメダカ (Oryzias javanicus) インド

  18. Study of Astatine (III) reactions with O, S and N ligands in solution

    International Nuclear Information System (INIS)

    Full text of publication follows. Astatine (At, Z=85: [Xe]4f145d106s26p5) belongs to the halogen group and is located below iodine in the periodic table. One of its isotopes (211At) appears promising as a therapeutic agent in nuclear medicine (Ref.1) owing to the energy of the alpha particles emitted during the disintegration of its nucleus and its short physical half-life (7.2 h). Since there are no stable isotopes of astatine, the chemistry of this element remains poorly understood. Generally, At is supposed to behave as a halogen (Ref.2) but it has been shown recently in our group that astatine presents a metallic behaviour in aqueous solution: it notably exists as At+ and AtO+ species under the oxidation states +I and +III (Ref.3). At the present time, the number of studies dealing with the complexation properties of the cationic forms of astatine remains limited (Ref.4), owing to its low availability. In this work, we have investigated the reactions of AtO+ species with different hetero-atomic (N, S, O) model ligands. A combined approach based on experimental and theoretical studies has been used (Ref.5). On account of the difficulties of experimental investigations of astatine species, the reactivity of AtO+ was explored using a competition method founded on astatine distributions between two distinct phases. Furthermore, for each AtO+/ ligand complex, the nature of the species formed and the associated thermodynamic constants were determined by computational modeling (DFT calculations). In this framework, an original computational methodology was developed to take into account the specificities of astatine, notably the associated relativistic effects. The computed equilibrium constants have been confronted with the experimental results. This comparison demonstrates an outstanding coherence between experience and theory. Furthermore, the analysis of the results shows a key role of solvent effects on astatine chemistry. Lastly, a specific reactivity for the

  19. Some aspects of the organic, biological and inorganic chemistry of astatine

    International Nuclear Information System (INIS)

    Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments (209At, 210At, 211At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)

  20. Astatine-211 Pathway from Radiochemistry to Clinical Investigation

    International Nuclear Information System (INIS)

    Particularly in clinical settings where tumour burden is low and cancers are located in close proximity to essential normal tissue structures, α-particle emitting radionuclides can offer significant advantages for targeted radionuclide therapy. One of the first alpha emitters to be evaluated for this purpose is the 7.2-h half-life radiohalogen Astatine-211 (211At). From a commercialization-potential perspective 211At, is less appealing than the longer half-life alpha particle emitters Radium-223, Actinium-225 and Thorium-227, which have become the focus of many laboratories. However, if methods for providing a better supply of 211At could be developed, this alpha emitter would be the radionuclide of choice for many potential therapeutic applications. With regard to the production of 211At, this can be readily be accomplished by bombarding natural bismuth targets with 28−29.5 MeV alpha particles via the 209Bi(α,2n)211At reaction. The goal is to utilize an alpha particle beam energy that provides the required balance for maximizing 211At production while minimizing creation of 210At, which is problematic because of its 138.4-day half life alpha-particle emitting daughter, 210Po. For most intended clinical applications, alpha particle beam energy of about 29 MeV offers the best compromise between maximizing yield and providing 211At with sufficient radionuclidic purity for clinical use. Clinically relevant levels of 211At have been produced at several institutions using both internal and external cyclotron targets

  1. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  2. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    International Nuclear Information System (INIS)

    A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)

  3. Labelling prospects of astatine-211 with immunoglobulins (IgG): some general considerations

    International Nuclear Information System (INIS)

    The tumour therapeutic potential of the short lived alpha emitting radiohalogen 211At has been already been well recognised in the field of radioimmuno therapy. There is no evidence as such to show that astatine itself is a tumour seeking isotope. Therefore it has to be tagged to tumour seeking compound such as a drug or a protein preferably an antibody (IgG). In this communication, the labelling parameters which are required to be investigated for obtaining a stable product which could be useful as radioimmuno therapeutic agent, are described. (author). 6 refs

  4. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron anity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photodetachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral linewidth of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in o-line tests by the clear observation of the photodetachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148 [1].

  5. Extraction of 211At-astatine from hydrochloric acid solutions by means of TOPO, TBP, and triphenylphosphine

    International Nuclear Information System (INIS)

    The extraction behaviour of astatine was studied under defined conditions from hydrochloride acid solutions (cHCl>0.1 M or 1 and 2M). Therefore other effects like adsorption, reduction or hydrolysis can be excluded. The present work describes the extraction with tri- n- octylphosphinoxide (TOPO), tri- n-butylphosphate (TBP) and tri-phenylphosphine in chloroform. (orig.)

  6. No-carrier-added astatination of N-succinimidyl-3-(tri-n-butylstannyl) benzoate (ATE) via electrophilic destannylation

    International Nuclear Information System (INIS)

    The no-carrier-added synthesis of N-succinimidyl 3-[211At]astato-benzoate from N-succinimidyl 3-(tri-n-butylstannyl)benzoate (ATE) is described. The nature of the solvent in which the 211At was isolated from the target was an important factor influencing both the radiochemical yields and the nature of the incorporated astatine activity. (orig.)

  7. 211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    211At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At- to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At- anions, but first of all because of the kinetic inertness of low spin rhodium(III) d6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh3+. The experiments related to optimization of the reaction conditions were performed with the 131I, basing on a chemical similarity of I- to At-. The experiments with 211At were then carried out under the conditions found optimal for I-. The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211At-Rh(16-S4-diol) complex

  8. 25 CFR 212.20 - Leasing procedures.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Leasing procedures. 212.20 Section 212.20 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEASING OF ALLOTTED LANDS FOR MINERAL DEVELOPMENT How To Acquire Leases § 212.20 Leasing procedures. (a) Application for leases shall...

  9. 22 CFR 212.21 - Public records.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Public records. 212.21 Section 212.21 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT PUBLIC INFORMATION Availability of Information for Public Inspection and Copying § 212.21 Public records. In accordance with this subpart, USAID makes the...

  10. 28 CFR 36.212 - Insurance.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Insurance. 36.212 Section 36.212 Judicial... COMMERCIAL FACILITIES General Requirements § 36.212 Insurance. (a) This part shall not be construed to... benefit plan that is not subject to State laws that regulate insurance. (b) Paragraphs (a) (1), (2),...

  11. 12 CFR 741.212 - Share insurance.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Share insurance. 741.212 Section 741.212 Banks... INSURANCE Regulations Codified Elsewhere in NCUA's Regulations as Applying to Federal Credit Unions That Also Apply to Federally Insured State-Chartered Credit Unions § 741.212 Share insurance. (a)...

  12. 32 CFR 212.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 212.5 Section 212.5 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS...) INSTALLATIONS § 212.5 Responsibilities. (a) The Principal Deputy Under Secretary for Personnel and...

  13. 48 CFR 36.212 - Preconstruction orientation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Preconstruction orientation. 36.212 Section 36.212 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION... Contracting for Construction 36.212 Preconstruction orientation. (a) The contracting officer will inform...

  14. Dicty_cDB: SSI212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI212 (Link to dictyBase) - - - Contig-U16354-1 SSI212E (Link... to Original site) - - - - - - SSI212E 608 Show SSI212 Library SS (Link to library) Clone ID SSI212 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSI2-A/SSI212Q.Seq.d/ Representative seq. ID SSI21...2E (Link to Original site) Representative DNA sequence >SSI212 (SSI212Q) /CSM/SS/SSI2-A/SSI212Q.Seq.d/ TTGTT... E Sequences producing significant alignments: (bits) Value SSI212 (SSI212Q) /CSM/SS/SSI2-A/SSI212Q.Seq.d/ 1

  15. 48 CFR 871.212 - Contract clauses.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clauses. 871.212... Rehabilitation and Employment Service 871.212 Contract clauses. Contracting officers must use the following clauses, as appropriate, in solicitations and contracts for vocational rehabilitation and...

  16. 32 CFR 212.4 - Policy.

    Science.gov (United States)

    2010-07-01

    ....4 Policy. It is DoD policy, consistent with 32 CFR part 213, that procedures be established for the... 32 National Defense 2 2010-07-01 2010-07-01 false Policy. 212.4 Section 212.4 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS PROCEDURES...

  17. 31 CFR 800.212 - Foreign entity.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Foreign entity. 800.212 Section 800... TAKEOVERS BY FOREIGN PERSONS Definitions § 800.212 Foreign entity. (a) The term foreign entity means any... corporation, or organization organized under the laws of a foreign state if either its principal place...

  18. 36 CFR 212.3 - Cooperative work.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Cooperative work. 212.3... MANAGEMENT Administration of the Forest Transportation System § 212.3 Cooperative work. (a) Cooperative... for expenditure from the appropriation “Cooperative Work, Forest Service.” If a State, county or...

  19. 36 CFR 2.12 - Audio disturbances.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Audio disturbances. 2.12... RESOURCE PROTECTION, PUBLIC USE AND RECREATION § 2.12 Audio disturbances. (a) The following are prohibited..., motorized toy, or an audio device, such as a radio, television set, tape deck or musical instrument, in...

  20. 40 CFR 86.212-94 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false 86.212-94 Section 86.212-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty...

  1. Dicty_cDB: SSG212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSG212 (Link to dictyBase) - - - Contig-U09907-1 SSG212E (Link to Original site) SS...G212F 593 SSG212Z 678 SSG212P 1271 SSG212E 1008 Show SSG212 Library SS (Link to library) Clone ID SS...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSG2-A/SSG212Q.Seq.d/ Representative seq. ID SS...G212E (Link to Original site) Representative DNA sequence >SSG212 (SSG212Q) /CSM/SS/SSG2-A/SS...qnqpkdyycpmdlinh*yhyqklldhftfltlvfn*lrlq flkl*ihssfvmdlvkklqre*fqnqlkrcfsii*fnhlkkilsqtlfhlwvvplplnil lmlnq*iklmtvact*fkmnklfilihss

  2. Unexpected Behavior of the Heaviest Halogen Astatine in the Nucleophilic Substitution of Aryliodonium Salts.

    Science.gov (United States)

    Guérard, François; Lee, Yong-Sok; Baidoo, Kwamena; Gestin, Jean-François; Brechbiel, Martin W

    2016-08-22

    Aryliodonium salts have become precursors of choice for the synthesis of (18) F-labeled tracers for nuclear imaging. However, little is known on the reactivity of these compounds with heavy halides, that is, radioiodide and astatide, at the radiotracer scale. In the first comparative study of radiohalogenation of aryliodonium salts with (125) I(-) and (211) At(-) , initial experiments on a model compound highlight the higher reactivity of astatide compared to iodide, which could not be anticipated from the trends previously observed within the halogen series. Kinetic studies indicate a significant difference in activation energy (Ea =23.5 and 17.1 kcal mol(-1) with (125) I(-) and (211) At(-) , respectively). Quantum chemical calculations suggest that astatination occurs via the monomeric form of an iodonium complex whereas iodination occurs via a heterodimeric iodonium intermediate. The good to excellent regioselectivity of halogenation and high yields achieved with diversely substituted aryliodonium salts indicate that this class of compounds is a promising alternative to the stannane chemistry currently used for heavy radiohalogen labeling of tracers in nuclear medicine. PMID:27305065

  3. Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

    CERN Document Server

    Andreyev, Andrei

    2013-01-01

    Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

  4. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  5. 48 CFR 12.212 - Computer software.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Computer software. 12.212... software. (a) Commercial computer software or commercial computer software documentation shall be acquired... required to— (1) Furnish technical information related to commercial computer software or...

  6. 48 CFR 212.207 - Contract type.

    Science.gov (United States)

    2010-10-01

    ... OF DEFENSE ACQUISITION PLANNING ACQUISITION OF COMMERCIAL ITEMS Special Requirements for the Acquisition of Commercial Items 212.207 Contract type. b) In accordance with Section 805 of the National... contracts for the acquisition of commercial items is authorized only for the following: (i)...

  7. Development and Testing of a 212Pb/212Bi Peptide for Targeting Metastatic Melanoma

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, Darrell R.

    2012-10-25

    The purpose of this project is to develop a new radiolabeled peptide for imaging and treating metastatic melanoma. The immunoconjugate consists of a receptor-specific peptide that targets melanoma cells. The beta-emitter lead-212 (half-life = 10.4 hours) is linked by coordination chemistry to the peptide. After injection, the peptide targets melanoma receptors on the surfaces of melanoma cells. Lead-212 decays to the alpha-emitter bismuth-212 (half-life = 60 minutes). Alpha-particles that hit melanoma cell nuclei are likely to kill the melanoma cell. For cancer cell imaging, the lead-212 is replaced by lead-203 (half-life = 52 hours). Lead-203 emits 279 keV photons (80.1% abundance) that can be imaged and measured for biodistribution analysis, cancer imaging, and quantitative dosimetry.

  8. Synthesis and evaluation of tetraphosphonates labelled with 212Bi, 212Pb and 165Er

    International Nuclear Information System (INIS)

    The main goal of this work has been to achieve a synthesis of radiolabelled phosphonates for the improvement of diagnostic and therapy of osteoblastic osteosarcoma and sclerotic bone metastases. 212Bi-DOTMP is shown to be an in vivo stable bone seeking radiopharmaceutical with a potential for a α-particle therapy of the above mentioned diseases. It has biodistribution characteristics similar to 153Sm-EDTMP, which is now formally approved in several countries, most recently in the US. 212Pb-DOTMP is also a promising candidate having the advantage of increasing the effective half life of the α-emitter, although loss of some of the in vivo generated 212Bi may be a problem. A generator has been developed for the production of the α-emitting radionuclide 212Bi and its parent nuclide 212Pb. The generator is based on the emanation of 220Rn from (228Th)barium stearate. The decay product of 220Rn, 212Pb deposits on the walls of a polyethylene bottle, and can be wasted off with distilled water. The generator shows no leakage of any long-lived parent nuclides, is easy to operate and has a high degree of radiation safety

  9. 49 CFR 195.212 - Bending of pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Bending of pipe. 195.212 Section 195.212... PIPELINE Construction § 195.212 Bending of pipe. (a) Pipe must not have a wrinkle bend. (b) Each field bend must comply with the following: (1) A bend must not impair the serviceability of the pipe. (2)...

  10. 7 CFR 1400.212 - Growers of hybrid seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Growers of hybrid seed. 1400.212 Section 1400.212... AND SUBSEQUENT CROP, PROGRAM, OR FISCAL YEARS Payment Eligibility § 1400.212 Growers of hybrid seed. The existence of a hybrid seed contract for a person or legal entity will not be taken into...

  11. 46 CFR 179.212 - Watertight bulkheads for subdivision.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Watertight bulkheads for subdivision. 179.212 Section 179.212 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS (UNDER 100 GROSS TONS) SUBDIVISION, DAMAGE STABILITY, AND WATERTIGHT INTEGRITY Subdivision and Damage Stability Requirements § 179.212...

  12. 5 CFR 179.212 - Procedures for salary offset.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Procedures for salary offset. 179.212 Section 179.212 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS Salary Offset § 179.212 Procedures for salary offset. (a) The Director or his or...

  13. 22 CFR 212.11 - Materials to be published.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Materials to be published. 212.11 Section 212... Federal Register § 212.11 Materials to be published. (a) USAID separately states and currently publishes... section. (b) USAID Public Notice No. 1 and the USAID Regulations published in chapter II of Title 22...

  14. 25 CFR 212.56 - Geological and geophysical permits.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Geological and geophysical permits. 212.56 Section 212.56... FOR MINERAL DEVELOPMENT Rents, Royalties, Cancellations, and Appeals § 212.56 Geological and geophysical permits. (a) Permits to conduct geological and geophysical operations on Indian lands which do...

  15. 10 CFR 212.78 - Tertiary incentive crude oil.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Tertiary incentive crude oil. 212.78 Section 212.78 Energy DEPARTMENT OF ENERGY OIL MANDATORY PETROLEUM PRICE REGULATIONS Producers of Crude Oil § 212.78 Tertiary incentive crude oil. Annual prepaid expenses report. By January 31 of each year after 1980, the...

  16. 48 CFR 212.602 - Streamlined evaluation of offers.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Streamlined evaluation of offers. 212.602 Section 212.602 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS... for Evaluation and Solicitation for Commercial Items 212.602 Streamlined evaluation of offers....

  17. 27 CFR 24.212 - High fermentation wine.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false High fermentation wine. 24.212 Section 24.212 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Production of Other Than Standard Wine § 24.212 High fermentation wine. High fermentation wine is wine...

  18. 45 CFR 212.7 - Repayment to the United States.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Repayment to the United States. 212.7 Section 212... UNITED STATES CITIZENS RETURNED FROM FOREIGN COUNTRIES § 212.7 Repayment to the United States. (a) An..., any or all of the cost of such assistance to the United States, except insofar as it is...

  19. 40 CFR 211.212 - Compliance audit testing.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Compliance audit testing. 211.212 Section 211.212 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS PRODUCT NOISE LABELING Hearing Protective Devices § 211.212 Compliance audit testing....

  20. 12 CFR 212.4 - Interlocking relationships permitted by statute.

    Science.gov (United States)

    2010-01-01

    .... 212.4 Section 212.4 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM MANAGEMENT OFFICIAL INTERLOCKS § 212.4 Interlocking relationships permitted by statute. The... subsidiary thereof: (a) A depository organization that has been placed formally in liquidation, or which...

  1. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  2. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  3. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    International Nuclear Information System (INIS)

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  4. The chemical fate of 212Bi-DOTA formed by β- decay of 212Pb(DOTA)2-

    International Nuclear Information System (INIS)

    The increasing use of inert metal complexes in radioimmunotherapy prompted us to explore the potential use of 212Pb chelates. Herein, we report a study of the chemical fate of the 212Bi-DOTA complex formed by β- decay of 212Pb(DOTA)2-(H4DOTA = 1,4,7,10-tetraazacyclododecanetetraacetic acid). To assure that both parent and daughter complexes were thermally stable, kinetic studies were performed with 203Pb(II) and 206Bi(III) which showed that both lead and bismuth complexes with DOTA undergo chemical exchange only very slowly in aqueous solution at pH 4-10. To investigate whether the complex ion which results from decay of 212Pb(DOTA)2- was intact and also stable, solutions initially containing only this ion were analyzed for amounts of DOTA-complexed and uncomplexed 212Bi after attaining transient equilibrium with 212Bi. The fraction of 212Bi radioactivity not complexed to DOTA, vide infra, was found to be 36±2%. This value represents the fraction of breakup of 212Bi(DOTA)- formed from β- decay of the parent complex. By considering the various extranuclear processes responsible for kinetic and electronic excitation of the 212Bi daughter, break-up of the 212Bi-DOTA complex is ascribed to the internal conversion of γ-rays emitted by the excited 212Bi nuclide. (orig.)

  5. 212-Angstrom neonlike zinc laser of LULI

    Science.gov (United States)

    Jamelot, Gerard; Jaegle, Pierre; Rus, Bedrich; Carillon, Antoine; Klisnick, Annie; Nantel, Marc; Sebban, Stephane; Albert, F.; Zeitoun, Philippe; Plankl, E.; Sirgand, A.; Lewis, Ciaran L. S.; MacPhee, Andrew G.; Tallents, Gregory J.; Krishnan, J.; Holden, M.

    1995-09-01

    The main feature of x-ray laser research at LULI is the development of a saturated laser at 212 angstrom with a relatively small pump laser of 0.4 kJ in 600 ps. The laser works with the 3p- 3s J equals O yields 1 transition of neon-like zinc, by using the double-pass of amplified radiation in the active medium. Plasma parameters (temperature, density, homogeneity), and x-ray laser emission properties (intensity, pointing angle, divergence, and coherence) have been studied. Lasing action needs the main laser pulse to be preceded by a ten-prepulse train (contrast ratio less than 103) due to the remnant oscillator. The effect of a single prepulse was investigated as a function of contrast ratio and delay between the prepulse and the main pulse.

  6. 14 CFR 221.212 - Special tariff permission.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Special tariff permission. 221.212 Section... PROCEEDINGS) ECONOMIC REGULATIONS TARIFFS Electronically Filed Tariffs § 221.212 Special tariff permission. (a) When a filer submits an electronic tariff or an amendment to an electronic tariff for which...

  7. 22 CFR 1203.735-212 - Wearing of uniforms.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Wearing of uniforms. 1203.735-212 Section 1203.735-212 Foreign Relations UNITED STATES INTERNATIONAL DEVELOPMENT COOPERATION AGENCY EMPLOYEE... employees are not considered uniforms within the meaning of this section except that, for ICA, MOA VII...

  8. 42 CFR 1002.212 - State agency notifications.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 5 2010-10-01 2010-10-01 false State agency notifications. 1002.212 Section 1002.212 Public Health OFFICE OF INSPECTOR GENERAL-HEALTH CARE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OIG... agency notifications. When the State agency initiates an exclusion under § 1002.210, it must provide...

  9. 33 CFR 160.212 - When to submit an NOA.

    Science.gov (United States)

    2010-07-01

    ...) Vessels carrying break bulk cargo operating under a USCS exemption granted under 19 CFR 4.7(b)(4)(ii) may... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false When to submit an NOA. 160.212... Conditions, and Certain Dangerous Cargos § 160.212 When to submit an NOA. (a) Submission of NOA. (1)...

  10. 48 CFR 212.7003 - Technical data and computer software.

    Science.gov (United States)

    2010-10-01

    ... computer software. 212.7003 Section 212.7003 Federal Acquisition Regulations System DEFENSE ACQUISITION... data and computer software. For purposes of establishing delivery requirements and license rights for technical data under 227.7102 and for computer software under 227.7202, there shall be a...

  11. Stability and in vivo behavior of Rh[16aneS4-diol]211At complex: A potential precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    Introduction: The heavy halogen 211At is of great interest for targeted radiotherapy because it decays by the emission of short-range, high-energy α-particles. However, many astatine compounds that have been synthesized are unstable in vivo, providing motivation for seeking other 211At labeling strategies. One relatively unexplored approach is to utilize prosthetic groups based on astatinated rhodium (III) complex stabilized with a tetrathioether macrocyclic ligand – Rh[16aneS4-diol]211At. The purpose of the current study was to evaluate the in vitro and in vivo stability of this complex in comparison to its iodine analog – Rh[16aneS4-diol]131I. Methods: Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I complexes were synthesized and purified by HPLC. The stability of both complexes was evaluated in vitro by incubation in phosphate-buffered saline (PBS) and human serum at different temperatures. The in vivo behavior of the two radiohalogenated complexes was assessed by a paired-label biodistribution study in normal Balb/c mice. Results: Both complexes were synthesized in high yield and purity. Almost no degradation was observed for Rh[16aneS4-diol]131I in PBS over a 72 h incubation. The astatinated analog exhibited good stability in PBS over 14 h. A slow decline in the percentage of intact complex was observed for both tracers in human serum. In the biodistribution study, retention of 211At in most tissues was higher than that of 131I at all time points, especially in spleen and lungs. Renal clearance of Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I predominated, with 84.1 ± 2.3% and 94.6 ± 0.9% of injected dose excreted via the urine at 4 h. Conclusions: The Rh[16aneS4-diol]211At complex might be useful for constructing prosthetic groups for the astatination of biomolecules and further studies are planned to evaluate this possibility

  12. 14 CFR 212.6 - Operation of gambling junket charters.

    Science.gov (United States)

    2010-01-01

    ... (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS CHARTER RULES FOR U.S. AND FOREIGN DIRECT AIR CARRIERS § 212.6..., hotel, or cruise line or its agents, from requiring prospective passengers to pay nominal...

  13. Dicty_cDB: AFO212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFO212 (Link to dictyBase) - - - Contig-U10734-1 AFO212Z (Link to Original ... RT1 Zarlenga v1 Ascaris suum cDNA 5' similar to SW:ERP 5_CAEEL Q11067 PROBABLE PROTEIN DISULFIDE ISOMERASE ... PROTEIN DISULFIDE ISOMERASE A4 PRECURSOR (PROTEIN ERP -72) (ERP 72), mRNA sequence. 60 4e-05 1 dna update ...

  14. Dicty_cDB: CHR212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR212 (Link to dictyBase) - - - Contig-U10972-1 | Contig-U131... library) Clone ID CHR212 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U109...72-1 | Contig-U13146-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...SVETFACHVYGIHGIQKLLQYLSPDQVESIIASIKGKVIQLSKDNKGNYLIQS FLKQFSPEVNQFVCDATMGNIEEICTHKVGCTVVNRCIDNANPEQLEKLVDKIT...SVETFACHVYGIHGIQKLLQYLSPDQVESIIASIKGKVIQLSKDNKGNYLIQS FLKQFSPEVNQFVCDATMGNIEEICTHKVGCTVVNRCIDNANPEQLEKLVDKIT

  15. Synthesis and evaluation of tetraphosphonates labelled with {sup 212}Bi, {sup 212}Pb and {sup 165}Er

    Energy Technology Data Exchange (ETDEWEB)

    Hassfjell, S.P

    1997-08-01

    The main goal of this work has been to achieve a synthesis of radiolabelled phosphonates for the improvement of diagnostic and therapy of osteoblastic osteosarcoma and sclerotic bone metastases. {sup 212}Bi-DOTMP is shown to be an in vivo stable bone seeking radiopharmaceutical with a potential for a {alpha}-particle therapy of the above mentioned diseases. It has biodistribution characteristics similar to {sup 153}Sm-EDTMP, which is now formally approved in several countries, most recently in the US. {sup 212}Pb-DOTMP is also a promising candidate having the advantage of increasing the effective half life of the {alpha}-emitter, although loss of some of the in vivo generated {sup 212}Bi may be a problem. A generator has been developed for the production of the {alpha}-emitting radionuclide {sup 212}Bi and its parent nuclide {sup 212}Pb. The generator is based on the emanation of {sup 220}Rn from ({sup 228}Th)barium stearate. The decay product of {sup 220}Rn, {sup 212}Pb deposits on the walls of a polyethylene bottle, and can be wasted off with distilled water. The generator shows no leakage of any long-lived parent nuclides, is easy to operate and has a high degree of radiation safety.

  16. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D., Scott

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  17. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    International Nuclear Information System (INIS)

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET α-emitter astatine-211 (211At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 (123I), 340-fold for technetium-99m pertechnetate (99mTcO4-) and 60-fold for 211At. Cellular 211At accumulation was found to be dependent on extracellular Na+ ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and 99mTcO4- uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated 211At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and 211At were rapidly (apparent t1/2 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times (123I), 25 times (99mTcO4-) and 10 times (211At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of 123I and 211At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for 123I, 5.2 h for 211At) and preliminary dosimetric calculations indicate high tumour absorbed doses (3.5 Gy/MBqtumour for 131I and 50.3 Gy/MBqtumour for 211At). In

  18. Atmospheric concentrations of 212Pb and an observation of 212Pb originating from the 2000 eruptive activity of Miyake-jima volcano, at Kawasaki, Japan

    International Nuclear Information System (INIS)

    Atmospheric concentrations of 212Pb were observed with aerosol samples during the period from June, 1999 to December, 2000 at Kawasaki. The atmospheric concentrations of 212Pb ranged from 20 to 130 mBq/m3. Seasonal variations in 212Pb concentration showed the ''one-peak'' variation pattern: high concentrations appeared in winter season. The atmospheric concentration of 212Pb and SO2 after the eruption of Miyake-jima volcano on Aug. 29, 2000 were higher than average value in the season. After the eruption, the variation in the concentration of SO2 correlates with that of 212Pb. The atmospheric concentration of 212Pb showed an unusual and temporal increase in the period from late August to early September, 2000, being inferred to be attributed partly to the 212Pb fallout originating from the 2000 eruption of Miyake jima volcano, Japan. (author)

  19. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    Energy Technology Data Exchange (ETDEWEB)

    Petrich, T.; Helmeke, H.-J.; Meyer, G.J.; Knapp, W.H.; Poetter, E. [Department of Nuclear Medicine, Medizinische Hochschule Hannover (Germany)

    2002-07-01

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET {alpha}-emitter astatine-211 ({sup 211}At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 ({sup 123}I), 340-fold for technetium-99m pertechnetate ({sup 99m}TcO{sub 4}{sup -}) and 60-fold for {sup 211}At. Cellular {sup 211}At accumulation was found to be dependent on extracellular Na{sup +} ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and {sup 99m}TcO{sub 4}{sup -} uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated {sup 211}At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and {sup 211}At were rapidly (apparent t{sub 1/2} 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times ({sup 123}I), 25 times ({sup 99m}TcO{sub 4}{sup -}) and 10 times ({sup 211}At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of {sup 123}I and {sup 211}At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for {sup 123}I, 5.2 h for {sup 211}At) and

  20. 48 CFR 14.212 - Economic purchase quantities (supplies).

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Economic purchase... REGULATION CONTRACTING METHODS AND CONTRACT TYPES SEALED BIDDING Solicitation of Bids 14.212 Economic purchase quantities (supplies). Contracting officers shall comply with the economic purchase...

  1. 26 CFR 1.212-1 - Nontrade or nonbusiness expenses.

    Science.gov (United States)

    2010-04-01

    ... nonbusiness expenses. (a) An expense may be deducted under section 212 only if: (1) It has been paid or... ordinary and necessary expense for any of the purposes stated in subparagraph (1) of this paragraph. (b... at a profit or will otherwise be productive of income and even though the property is held merely...

  2. 34 CFR 668.212 - Loan servicing appeals.

    Science.gov (United States)

    2010-07-01

    ... identifies a sample that is large enough to derive an estimate, acceptable at a 95 percent confidence level... EDUCATION, DEPARTMENT OF EDUCATION STUDENT ASSISTANCE GENERAL PROVISIONS Cohort Default Rates § 668.212 Loan... Program lender or the Direct Loan Servicer, as defined in 34 CFR 685.102, failed to perform one or more...

  3. Dicty_cDB: VHB212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB212 (Link to dictyBase) - - - Contig-U16430-1 - (Link to Original site) ... mRNA f... 84 1e-15 DQ383787_1( DQ383787 |pid:none) Rhodomonas ... salina 82 kDa heat shoc... 83 3e-15 ( P08238 ) Rec ...

  4. 48 CFR 52.212-2 - Evaluation-Commercial Items.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Evaluation-Commercial....212-2 Evaluation—Commercial Items. As prescribed in 12.301(c), the Contracting Officer may insert a provision substantially as follows: Evaluation—Commercial Items (JAN 1999) (a) The Government will award...

  5. 9 CFR 113.212 - Bursal Disease Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Bursal Disease Vaccine, Killed Virus..., DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.212 Bursal Disease Vaccine, Killed Virus. Bursal Disease...

  6. Free radical detection by means of 212Pb mirrors

    International Nuclear Information System (INIS)

    Radicals have been detected at low temperatures (550-700 degree centigrade) in the thermal decomposition of dimethyl and methyl-ethyl-ketone by the Paneth method. the sensitivity of the method has been increased by the use of radioactive mirrors of PB212. They have proved to detect one radical among 2.106 molecules. (Author) 18 refs

  7. 31 CFR 0.212 - Influencing legislation or petitioning Congress.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Influencing legislation or... DEPARTMENT OF THE TREASURY EMPLOYEE RULES OF CONDUCT Rules of Conduct § 0.212 Influencing legislation or... Congress to favor or oppose any legislation. This prohibition does not apply to the official...

  8. Study of in vivo generators Pb-212/Bi--212 and U-230/Th-226 for alpha radioimmunotherapy

    International Nuclear Information System (INIS)

    Alpha-radioimmunotherapy is a promising cancer therapy that uses a-particles vectorized by monoclonal antibody to break down cancerous tumors. The notion of in vivo generator was introduced in 1989 by Leonard Mausner. The concept involves labeling of various molecular carriers (antibodies, peptides, etc) with intermediate half-life generator parents, which after accumulation in the desired tissue generate much shorter half-life daughter radionuclide. This thesis focuses on the study of two in vivo generators potentially interesting for alpha-radioimmunotherapy: Pb-212 / Bi-212 generator and U-230 / Th-226 generator. The first part of this work presents the Pb-212 / Bi-212 generator, two approaches allowing the vectorization. Chelation approach on a protein and an approach by encapsulation in liposomes have been proposed. This last approach appears to be the most interesting. In vitro stability studies have been performed on these labeling. The second part of this work presents the U-230 / Th-226 generator. Studies have first been made to achieve a theoretical model to describe the speciation of Th(IV) in human serum. The efficacy of DTPA as chelating agent for complexation of Th(IV) in human serum could thus be estimated. (author)

  9. Tl-208, Pb-212, Bi-212, Ra-226 and Ac-228 adsorption onto polyhydroxyethylmethacrylate-bentonite composite

    International Nuclear Information System (INIS)

    The adsorption of naturally occurring radionuclides (208Tl+, 212Pb2+, 226Ra2+, 212Bi3+ and 228Ac3+) onto Polyhydroxyethylmethacrylate-bentonite (PHEMA-B) composite was investigated. Experimentally obtained isotherms were evaluated with reference to Langmuir, Freundlich and Dubinin-Radushkevich (DR) models. The adsorption isotherms were L type of Giles classification proving that PHEMA-B had a high affinity adsorbent for the studied radionuclides. The Langmuir adsorption capacities (XL) were in the order of 226Ra (2.8 MBq kg-1)>212Bi (0.4 MBq kg-1)>212Pb (0.3 MBq kg-1)>228Ac and 208Tl (0.2 MBq kg-1). The adsorption process was physical via complex formation after proton exchanger for which the adsorption energies obtained from DR model was evidence. The enthalpy and entropy changes were positive and the negative free enthalpy change was proof for the spontaneity of adsorption. The reusability tests for PHEMA-B for five uses demonstrated that the adsorbent could be reused after complete recovery of the loaded radionuclide ions by 1 M HCl. The chemical structure of the composite did not change after the reuses and storage foregoing.

  10. 5 CFR 875.212 - Is there a minimum application age?

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Is there a minimum application age? 875.212 Section 875.212 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) FEDERAL LONG TERM CARE INSURANCE PROGRAM Eligibility § 875.212 Is there a...

  11. 8 CFR 212.5 - Parole of aliens into the United States.

    Science.gov (United States)

    2010-01-01

    ... or her parole status terminated upon notice, as specified in 8 CFR 212.5(e)(2)(i), if he or she makes... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Parole of aliens into the United States. 212.5 Section 212.5 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION...

  12. 31 CFR 585.212 - Prohibited transactions related to scientific and technical cooperation, cultural exchanges, and...

    Science.gov (United States)

    2010-07-01

    ... scientific and technical cooperation, cultural exchanges, and other official visits. 585.212 Section 585.212... § 585.212 Prohibited transactions related to scientific and technical cooperation, cultural exchanges....S. person related to scientific and technical cooperation and cultural exchanges involving...

  13. 36 CFR 212.7 - Access procurement by the United States.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Access procurement by the United States. 212.7 Section 212.7 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE TRAVEL MANAGEMENT Administration of the Forest Transportation System § 212.7 Access procurement...

  14. 40 CFR 180.212 - S-Ethyl cyclohexylethylthio-carbamate; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false S-Ethyl cyclohexylethylthio-carbamate; tolerances for residues. 180.212 Section 180.212 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Tolerances § 180.212 S-Ethyl cyclohexylethylthio-carbamate; tolerances for residues. (a) General....

  15. 40 CFR 80.212 - What requirements apply to oxygenate blenders?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 16 2010-07-01 2010-07-01 false What requirements apply to oxygenate blenders? 80.212 Section 80.212 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR....212 What requirements apply to oxygenate blenders? Effective January 1, 2004, oxygenate blenders...

  16. (212)Pb as tracer for PM deposition on urban vegetation.

    Science.gov (United States)

    Voltaggio, Mario; Spadoni, Massimo; Carloni, Serena; Guglietta, Daniela

    2016-11-01

    (212)Pb concentration in outdoor air is closely correlated with fine suspended particulate matter in the atmosphere. Thanks to this association, this isotope can be used to trace the sinking processes of particulate matter due to the vegetation, also providing accurate estimations of the deposition velocity on foliar surfaces. This approach is particularly effective in areas with high thoron fluxes and, consequently, high (212)Pb fluxes from soil. The contribution of vegetation to the improvement of air quality (AQImp) in the municipality area (MA) of Rome (Latium, Italy), almost entirely located on Th-enriched volcanic soils, was estimated by studying (212)Pb deposition velocity on the grasses (0.9-2.5mm·s(-1)) and on the most common tree classes, namely conifers (1.5-15mm·s(-1)), evergreen (1-4mm·s(-1)) and deciduous (0.2-1.5mm·s(-1)). (212)Pb activity in outdoor air was determined by gamma spectrometry after air pumping with accumulation on cellulose filters and after collection on artificial electrostatically charged surfaces (ECS). The high (212)Pb activity values obtained from this analysis (0.90±0.6Bqm(-3) and 0.58±0.15Bqm(-3), respectively near and far from the soil) are consistent both with the average regional thoron flux from volcanic soils (2.9·10(4)Bqm(-2)·h(-1)) and with the thoron flux measured in the volcanic soils of the study area. Thoron and (212)Pb fluxes were also measured both in laboratory and in the field under different soil moisture conditions. The total AQImp for the period from September 2014 to September 2015, calculated after the classification of the MA of Rome into six classes of vegetation, provided a value of 0.20 corresponding to 2.3 Tons per day of removed PM10. The role of grasslands in the PM10 removal, the contribution of the vegetation to the improvement of AQImp and the possibility of improving the sinking efficiency of green areas by increasing conifer trees coverage were also highlighted. PMID:27323332

  17. Preparation of radionuclide 212Pb by emanation technique of 232Th

    International Nuclear Information System (INIS)

    The paper is focused on preparation of radionuclide 212Pb for its further application. 212Pb radioisotope has radiogenic origin of a series of 232Th. The given radionuclide 212Pb (10.6 h) was captured from Th-source on niobium emmanator shims by influence of electric field at a voltage of 310 V. 212Pb was then eluted from the shims to dilute solution of HNO3. 212Pb thus prepared in this way was then applied at radioindicator study of adsorption processes of clay rocks - bentonites.

  18. Tribological and mechanical comparison of sintered and hipped PM212: High temperature self-lubricating composites

    Science.gov (United States)

    Dellacorte, Christopher; Sliney, Harold E.; Bogdanski, Michael S.

    1992-01-01

    Selected tribological, mechanical and thermophysical properties of two versions of PM212 (sintered and hot isostatically pressed, HIPped) are compared. PM212, a high temperature self-lubricating composite, contains 70 wt percent metal bonded chromium carbide, 15 wt percent CaF2/BaF2 eutectic and 15 wt percent silver. PM212 in the sintered form is about 80 percent dense and has previously been shown to have good tribological properties from room temperature to 850 C. Tribological results of a fully densified, HIPped version of PM212 are given. They are compared to sintered PM212. In addition, selected mechanical and thermophysical properties of both types of PM212 are discussed and related to the tribological similarities and differences between the two PM212 composites. In general, both composites display similar friction and wear properties. However, the fully dense PM212 HIPped composite exhibits slight lower friction and wear than sintered PM212. This may be attributed to its generally higher strength properties. The sintered version displays stable wear properties over a wide load range indicating its promise for use in a variety of applications. Based upon their properties, both the sintered and HIPped PM212 have potential as bearing and seal materials for advanced high temperature applications.

  19. Quality control of the tribological coating PS212

    Science.gov (United States)

    Sliney, Harold E.; Dellacorte, Christopher; Deadmore, Daniel L.

    1989-01-01

    PS212 is a self-lubricating, composite coating that is applied by the plasma spray process. It is a functional lubricating coating from 25 C (or lower) to 900 C. The coating is prepared from a blend of three different powders with very dissimilar properties. Therefore, the final chemical composition and lubricating effectiveness of the coatings are very sensitive to the process variables used in their preparation. Defined here are the relevant variables. The process and analytical procedures that will result in satisfactory tribological coatings are discussed.

  20. Alpha Decay Width of $^{212}$Po from a quartetting wave function approach

    CERN Document Server

    Xu, Chang; Röpke, G; Schuck, P; Funaki, Y; Horiuchi, H; Tohsaki, A; Yamada, T; Zhou, Bo

    2015-01-01

    A microscopic calculation of $\\alpha$-cluster preformation probability and $\\alpha$ decay width in the typical $\\alpha$ emitter $^{212}$Po is presented. Results are obtained by improving a recent approach to describe $\\alpha$ preformation in $^{212}$Po [Phys. Rev. C 90, 034304 (2014)] implementing four-nucleon correlations (quartetting). Using the actually measured density distribution of the $^{208}$ Pb core, the calculated alpha decay width of $^{212}$Po agrees fairly well with the measured one.

  1. 222Rn and 212Pb exposures at a Brazilian SPA

    International Nuclear Information System (INIS)

    Termas de Araxa spa is located in Araxa, State of Minas Gerais. In this region, several minerals rich in uranium and thorium are found. The mineral waters and mud from Termas de Araxa spa have been used for therapeutic and recreation purposes. In this study, the committed effective dose was evaluated for workers and patients at Araxa spa due to 222Rn and 212Pb inhalation. Radon measurements were carried out through the passive method with solid state nuclear track detectors (Makrofol E) over a period of 21 months, with results varying from 258 ± 20 to 1634 ± 111 Bq m-3. The 212Pb air concentration was assessed through the modified Kusnetz's method, the results varying from 0.3 ± 0.1 to 2.1 ± 0.2 Bq m-3. Doses received by the spa workers are below 20 mSv y-1, suggested by ICRP 60 as an annual effective dose limit for occupational exposure. The radiation doses for the patients are below the mean annual effective dose due to natural sources estimated to be 2.4 mSv.y-1. (authors)

  2. Durable donor engraftment after radioimmunotherapy using α-emitter astatine-211-labeled anti-CD45 antibody for conditioning in allogeneic hematopoietic cell transplantation.

    Science.gov (United States)

    Chen, Yun; Kornblit, Brian; Hamlin, Donald K; Sale, George E; Santos, Erlinda B; Wilbur, D Scott; Storer, Barry E; Storb, Rainer; Sandmaier, Brenda M

    2012-02-01

    To reduce toxicity associated with external γ-beam radiation, we investigated radioimmunotherapy with an anti-CD45 mAb labeled with the α-emitter, astatine-211 ((211)At), as a conditioning regimen in dog leukocyte antigen-identical hematopoietic cell transplantation (HCT). Dose-finding studies in 6 dogs treated with 100 to 618 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) without HCT rescue demonstrated dose-dependent myelosuppression with subsequent autologous recovery, and transient liver toxicity in dogs treated with (211)At doses less than or equal to 405 μCi/kg. Higher doses of (211)At induced clinical liver failure. Subsequently, 8 dogs were conditioned with 155 to 625 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) before HCT with dog leukocyte antigen-identical bone marrow followed by a short course of cyclosporine and mycophenolate mofetil immunosuppression. Neutropenia (1-146 cells/μL), lymphopenia (0-270 cells/μL), and thrombocytopenia (1500-6560 platelets/μL) with prompt recovery was observed. Seven dogs had long-term donor mononuclear cell chimerism (19%-58%), whereas 1 dog treated with the lowest (211)At dose (155 μCi/kg) had low donor mononuclear cell chimerism (5%). At the end of follow-up (18-53 weeks), only transient liver toxicity and no renal toxicity had been observed. In conclusion, conditioning with (211)At-labeled anti-CD45 mAb is safe and efficacious and provides a platform for future clinical trials of nonmyeloablative transplantation with radioimmunotherapy-based conditioning. PMID:22134165

  3. Tracking of activity of major daughter products (212Bi, 212Pb and 228Ac) in Thorium ore with time in a hermetically sealed container

    International Nuclear Information System (INIS)

    During this work activities of 212Bi, 212 Pb and 228Ac were tracked at different time intervals for 30 days in hermetically sealed closed container. IAEA-RGTh-1 reference materials having 2.89% Th with floated silica powder of similar grain size distribution ( 232Th in the composite sample (ore) is 3250 ± 270 Bq kg-1. Gamma measurement was carried on a high-purity p-type germanium (HPGe) detector having a relative efficiency of 50%. Data obtained during this work clearly shows that there is only minor variation in the concentration of 212Bi, 212Pb and 228Ac from the time of sealing to 30th day. Mean concentration of 232Th evaluated using gamma energy line of 228Ac (912 keV) and 212Bi (728 keV) shows a deviation of only 0.05%, and 5.66% respectively from the certified mean value of 232Th, whereas a large negative deviation of 29.9% was observed in the case of 212Pb (239 keV). (author)

  4. 7 CFR 330.212 - Movement of plant pests by baggage.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Movement of plant pests by baggage. 330.212 Section... INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FEDERAL PLANT PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.212 Movement of plant pests by...

  5. 23 CFR 972.212 - Federal lands safety management system (SMS).

    Science.gov (United States)

    2010-04-01

    ... inspection and copying as prescribed at 49 CFR part 7. (c) The FWS shall utilize the SMS to ensure that... 23 Highways 1 2010-04-01 2010-04-01 false Federal lands safety management system (SMS). 972.212....212 Federal lands safety management system (SMS). In addition to the requirements provided in §...

  6. 23 CFR 973.212 - Indian lands safety management system (SMS).

    Science.gov (United States)

    2010-04-01

    ... inspection and copying as prescribed at 49 CFR part 7. (d) The BIA and ITGs shall utilize the SMSs to ensure... 23 Highways 1 2010-04-01 2010-04-01 false Indian lands safety management system (SMS). 973.212... PROGRAM Bureau of Indian Affairs Management Systems § 973.212 Indian lands safety management system...

  7. 25 CFR 212.46 - Inspection of premises, books, and accounts.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Inspection of premises, books, and accounts. 212.46 Section 212.46 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEASING OF... premises, books, and accounts. The provisions of § 211.46 of this subchapter are applicable to leases...

  8. 30 CFR 212.200 - Maintenance of and access to records.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Maintenance of and access to records. 212.200 Section 212.200 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE... prices. (3) Costs of mining, processing, handling, and transportation....

  9. 21 CFR 212.10 - What personnel and resources must I have?

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false What personnel and resources must I have? 212.10 Section 212.10 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... a sufficient number of personnel with the necessary education, background, training, and...

  10. 18 CFR 157.212 - Synthetic and liquefied natural gas facilities.

    Science.gov (United States)

    2010-04-01

    ... natural gas facilities. 157.212 Section 157.212 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT OF ENERGY REGULATIONS UNDER NATURAL GAS ACT APPLICATIONS FOR CERTIFICATES... 7 OF THE NATURAL GAS ACT Interstate Pipeline Blanket Certificates and Authorization Under Section...

  11. 20 CFR 702.212 - Notice; when given; when given for certain occupational diseases.

    Science.gov (United States)

    2010-04-01

    ...). (b) In the case of an occupational disease which does not immediately result in disability or death... employment, the disease and the death or disability. For purposes of these occupational diseases, therefore... occupational diseases. 702.212 Section 702.212 Employees' Benefits EMPLOYMENT STANDARDS...

  12. 49 CFR 180.212 - Repair of seamless DOT 3-series specification cylinders and seamless UN pressure receptacles.

    Science.gov (United States)

    2010-10-01

    ... cylinders and seamless UN pressure receptacles. 180.212 Section 180.212 Transportation Other Regulations... Qualification, Maintenance and Use of Cylinders § 180.212 Repair of seamless DOT 3-series specification cylinders and seamless UN pressure receptacles. (a) General requirements for repair of DOT...

  13. Novel gene PUS3 c.A212G mutation in Ukrainian family with intellectual disability

    Directory of Open Access Journals (Sweden)

    Gulkovskyi R. V.

    2015-04-01

    Full Text Available Aim. To evaluate a possible role of a novel c.A212G substitution in the PUS3 gene at intellectual disability (ID. Methods. The observed group consisted of the ID Ukrainian family members (parents and two affected children and the control group – of 300 healthy individuals from general population of Ukraine. Sanger sequencing of the PUS3 gene exon 1 was performed for the family members. Polymorphic variants of c.A212G were analyzed using ARMS PCR. The homology models of wild type and p.Y71C mutant catalytic domains of human Pus3 were generated using the crystal structure of the human Pus1 catalytic domain (PDB ID: 4NZ6 as a template. Results. It was shown that the father of the affected siblings was the c.A212G substitution heterozygous carrier whereas the mother was a wild type allele homozygote, and the exom sequencing result was confirmed – the affected children are 212G homozygotes. We supposed de novo mutation in the maternal germ line. A low frequency of 212G allele (0.0017 was shown in the population of Ukraine. Homology modelling of the wild type and p.Y71C mutant catalytic domain of human Pus3 revealed that substitution p.Y71C is located in close proximity to its active site. Conclusions. The absence of hypoproteinemia in our patients, homozygous for the 212C allele allows us to assume that the mutation c.A212G PUS3 is rather neutral and cannot be the major cause of ID. However, considering a low frequency of the 212G allele in the population and close localization of p.Y71C substitution to the active site of hPus3 we cannot exclude that the c.A212G mutation in PUS3 may be a modifier for some pathologies including syndromic ID.

  14. The tribology of PS212 coatings and PM212 composites for the lubrication of titanium 6Al-4V components of a Stirling engine space power system

    Science.gov (United States)

    Sliney, Harold E.; Lukaszewicz, Victor; Dellacorte, Christopher

    1994-01-01

    The Stirling space power machine incorporates a linear alternator to generate electrical power. The alternator is a reciprocating device that is driven by a solar or nuclear-powered Stirling engine. The power piston and cylinder are made of titanium 6Al-4V (Ti6-4) alloy, and are designed to be lubricated by a hydrodynamically-generated gas film. Rubbing occurs during starts and stops and there is the possibility of an occasional high speed rub. Since titanium is known to have a severe galling tendency in sliding contacts, a 'back-up', self-lubricating coating on the cylinder and/or the piston is needed. This report describes the results of a research program to study the lubrication of Ti6-4 with the following chromium carbide based materials: plasma-sprayed PS212 coatings and sintered PM212 counterfaces. Program objectives are to achieve adherent coatings on Ti6-4 and to measure the friction and wear characteristics of the following sliding combinations under conditions simulative of the Stirling-driven space power linear alternator: Ti6-4/Ti6-4 baseline, Ti6-4/PS212-coated Ti6-4, and PS212-coated Ti6-4/PM212.

  15. α -decay width of 212Po from a quartetting wave function approach

    Science.gov (United States)

    Xu, Chang; Ren, Zhongzhou; Röpke, G.; Schuck, P.; Funaki, Y.; Horiuchi, H.; Tohsaki, A.; Yamada, T.; Zhou, Bo

    2016-01-01

    A microscopic calculation of α -cluster preformation probability and α -decay width in the typical α emitter 212Po is presented. Results are obtained by improving a recent approach to describe α preformation in 212Po [Phys. Rev. C 90, 034304 (2014), 10.1103/PhysRevC.90.034304] implementing four-nucleon correlations (quartetting). Using the actually measured density distribution of the 208Pb core, the calculated α -decay width of 212Po agrees fairly well with the measured one.

  16. 5 CFR 575.212 - Internal monitoring requirements and revocation or suspension of authority.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Internal monitoring requirements and... MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, RELOCATION, AND RETENTION INCENTIVES; SUPERVISORY DIFFERENTIALS; AND EXTENDED ASSIGNMENT INCENTIVES Relocation Incentives § 575.212 Internal...

  17. Tacrolimus for myasthenia gravis: a clinical study of 212 patients.

    Science.gov (United States)

    Ponseti, José M; Gamez, Josep; Azem, Jamal; López-Cano, Manuel; Vilallonga, Ramón; Armengol, Manuel

    2008-01-01

    Tacrolimus is a macrolide T cell immunomodulator that is used in myasthenia gravis (MG) patients to affect muscle contraction (ryanodine receptor by modulating intracellular calcium-release channels and increasing muscular strength), glucocorticoid receptors (increasing intracellular concentration of steroids and blocking the steroid export mechanism), and an increase in T cell apoptosis. In this study, we report the results of low-dose tacrolimus (0.1 mg/kg/day) treatment in 212 MG patients. There were 110 thymectomized, cyclosporine- and prednisone-dependent patients; 68 thymectomized patients who started tacrolimus early postoperatively (24 h after operation); and 34 patients over 60 years old with nonthymomatous generalized MG or in whom thymectomy was contraindicated. The mean follow-up time was 49.3 +/- 18.1 months. Muscular strength showed an increase of 23% after 1 month of treatment and 29% at the end of the study. The acetylcholine receptor antibodies decreased significantly from a mean of 33.5 nmol/L at base line to 7.8 nmol/L at the final visit. In the thymectomy group with combined prednisone and tacrolimus stratified by histology of the thymus, the mean probability to attain complete stable remission at 5 years was 80.8% in patients with hyperplasia, 48.1% in thymic involution, and 9.3% in patients with thymoma. In 4.9% of patients, tacrolimus was withdrawn because of major adverse effects. Our results suggest that a low dose of tacrolimus is effective for MG and could be included to the armamentarium for this autoimmune disease. The present results should be interpreted considering the limitations of a retrospective clinical study. Confirmation of these results in randomized studies is desirable. PMID:18096852

  18. Spectroscopy of high spin states in sup(211,212,213)Fr

    International Nuclear Information System (INIS)

    The level structures of 211Fr, 212Fr and 213Fr have been observed to high spins, approx. 28(h/2π) (and excitation energies approx. 8 MeV) using a variety of gamma-ray spectroscopic techniques. The structure of these nuclides is discussed in terms of couplings of single particle states through empirical shell model calculations. Good agreement with experiment is obtained. In 212Fr and 213Fr core-excited configurations are required to explain the properties of the highest states. A number of long lived states were observed in each nucleus some of which decay by by enhanced E3 transitions. The E3 transition strengths are discussed

  19. Treatment of cultured glioma cells with the EGFR-TKI gefitinib (''Iressa'', ZD1839) increases the uptake of astatinated EGF despite the absence of gefitinib-mediated growth inhibition

    International Nuclear Information System (INIS)

    The EGFR-TKI (epidermal growth factor receptor tyrosine kinase inhibitor) gefitinib (''Iressa'', ZD1839), a reversible growth inhibitor of EGFR-expressing tumour cells, has been shown to enhance the antitumour effect of ionising radiation, and also to increase the uptake of radioiodinated EGF. Thus, combination of gefitinib treatment and radionuclide targeting is an interesting option for therapy of brain tumours that are difficult to treat with conventional methods. The aim of this study was to evaluate how pre-treatment with gefitinib affects binding of astatinated EGF (211At-EGF) to cultured glioma U343 cells, which express high levels of EGFR. The growth of U343 cells in the presence of gefitinib was investigated, and it was found that gefitinib does not significantly inhibit the growth of these cells. Nevertheless, the uptake of 211At-EGF in U343 cells was markedly increased (up to 3.5 times) in cells pre-treated with gefitinib (1 μM). This indicates that a combination of gefitinib treatment and radionuclide targeting to EGFR might be a useful therapeutic modality, even for patients who do not respond to treatment with gefitinib alone. (orig.)

  20. 22 CFR 212.41 - Exemptions from publication and disclosure requirements of subparts B, C, and D.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Exemptions from publication and disclosure requirements of subparts B, C, and D. 212.41 Section 212.41 Foreign Relations AGENCY FOR INTERNATIONAL... privacy; (4) Could reasonably be expected to disclose the identity of a confidential source, including...

  1. 48 CFR 212.504 - Applicability of certain laws to subcontracts for the acquisition of commercial items.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Applicability of certain laws to subcontracts for the acquisition of commercial items. 212.504 Section 212.504 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE ACQUISITION PLANNING ACQUISITION OF COMMERCIAL...

  2. 48 CFR 212.503 - Applicability of certain laws to executive agency contracts for the acquisition of commercial items.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Applicability of certain laws to executive agency contracts for the acquisition of commercial items. 212.503 Section 212.503 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE ACQUISITION PLANNING ACQUISITION OF...

  3. 48 CFR 212.570 - Applicability of certain laws to contracts and subcontracts for the acquisition of commercially...

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Applicability of certain laws to contracts and subcontracts for the acquisition of commercially available off-the-shelf items. 212.570 Section 212.570 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE ACQUISITION...

  4. 25 CFR 212.42 - Annual rentals and expenditures for development on leases other than oil and gas, and geothermal...

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Annual rentals and expenditures for development on leases other than oil and gas, and geothermal resources. 212.42 Section 212.42 Indians BUREAU OF INDIAN AFFAIRS... other than oil and gas, and geothermal resources. The provisions of § 211.42 of this subchapter...

  5. 20 CFR 30.212 - How does a claimant establish that the employee contracted cancer after beginning employment at a...

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false How does a claimant establish that the employee contracted cancer after beginning employment at a DOE facility, an atomic weapons employer facility or a RECA section 5 facility? 30.212 Section 30.212 Employees' Benefits OFFICE OF WORKERS' COMPENSATION PROGRAMS, DEPARTMENT OF LABOR...

  6. Tribological properties of PM212 - A high temperature, self-lubricating, powder metallurgy composite

    Science.gov (United States)

    Dellacorte, Christopher; Sliney, Harold E.

    1990-01-01

    This paper describes a research program to develop and evaluate a new high temperature, self-lubricating powder metallurgy composite, PM212. PM212 has the same composition as the plasma-sprayed coating, PS212, which contains 70 wt percent metal-bonded chromium carbide, 15 wt percent silver and 15 wt percent barium fluoride/calcium fluoride eutectic. The carbide acts as a wear resistant matrix and the silver and fluorides act as low and high temperature lubricants, respectively. The material is prepared by sequential cold press, cold isostatic pressing and sintering techniques. In this study, hemispherically tipped wear pins of PM212 were prepared and slid against superalloy disks at temperatures from 25 to 850 C in air in a pin-on-disk tribometer. Friction coefficients range from 0.29 to 0.38 and the wear of both the composite pins and superalloy disks was moderate to low in the 10(exp -5) to 10(exp -6) cubic mm/N-m range. Preliminary tests indicate that the material has a compressive strength of at least 130 MPa over the entire temperature range of 25 to 900 C. This material has promise for use as seal inserts, bushings, small inside diameter parts and other applications where plasma-sprayed coatings are impractical or too costly.

  7. Tribological properties of PM212: A high-temperature, self-lubricating, powder metallurgy composite

    Science.gov (United States)

    Dellacorte, Christopher; Sliney, Harold E.

    1989-01-01

    This paper describes a research program to develop and evaluate a new high temperature, self-lubricating powder metallurgy composite, PM212. PM212 has the same composition as the plasma-sprayed coating, PS212, which contains 70 wt percent metal-bonded chromium carbide, 15 wt percent silver and 15 wt percent barium fluoride/calcium fluoride eutectic. The carbide acts as a wear resistant matrix and the silver and fluorides act as low and high temperature lubricants, respectively. The material is prepared by sequential cold press, cold isostatic pressing and sintering techniques. In this study, hemispherically tipped wear pins of PM212 were prepared and slid against superalloy disks at temperatures from 25 to 850 C in air in a pin-on-disk tribometer. Friction coefficients range from 0.29 to 0.38 and the wear of both the composite pins and superalloy disks was moderate to low in the 10(exp -5) to 10(exp -6) cubic mm/N-m range. Preliminary tests indicate that the material has a compressive strength of at least 130 MPa over the entire temperature range of 25 to 900 C. This material has promise for use as seal inserts, bushings, small inside diameter parts and other applications where plasma-sprayed coatings are impractical or too costly.

  8. The sl(2|1)(2) Gaudin magnet with diagonal boundary terms

    International Nuclear Information System (INIS)

    This work is concerned with the quasi-classical limit of the boundary quantum inverse scattering method for the twisted sl(2|1)(2) vertex model with diagonal K-matrices. In this limit Gaudin's Hamiltonians with diagonal boundary terms are presented and diagonalized

  9. 10 CFR 72.212 - Conditions of general license issued under § 72.210.

    Science.gov (United States)

    2010-01-01

    ... INDEPENDENT STORAGE OF SPENT NUCLEAR FUEL, HIGH-LEVEL RADIOACTIVE WASTE, AND REACTOR-RELATED GREATER THAN CLASS C WASTE General License for Storage of Spent Fuel at Power Reactor Sites § 72.212 Conditions of... general license is limited to storage of spent fuel in casks approved under the provisions of this...

  10. 23 CFR 970.212 - Federal lands safety management system (SMS).

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Federal lands safety management system (SMS). 970.212... Federal lands safety management system (SMS). In addition to the requirements provided in § 970.204, the SMS must meet the following requirements: (a) The NPS shall have an SMS for all transportation...

  11. 23 CFR 971.212 - Federal lands safety management system (SMS).

    Science.gov (United States)

    2010-04-01

    ... available for inspection and copying as prescribed at 49 CFR part 7. (c) The tri-party partnership shall... 23 Highways 1 2010-04-01 2010-04-01 false Federal lands safety management system (SMS). 971.212... lands safety management system (SMS). In addition to the requirements provided in § 971.204, the...

  12. 21 CFR 212.2 - What is current good manufacturing practice for PET drugs?

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false What is current good manufacturing practice for... HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR POSITRON EMISSION TOMOGRAPHY DRUGS (Eff. 12-12-2011) General Provisions § 212.2 What is current good manufacturing practice...

  13. 27 CFR 25.212 - Beer returned to brewery from which removed.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Beer returned to brewery... TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS BEER Beer Returned to Brewery § 25.212 Beer returned to brewery from which removed. If beer on which the tax has been determined or paid is returned...

  14. 8 CFR 212.15 - Certificates for foreign health care workers.

    Science.gov (United States)

    2010-01-01

    ... perform labor in the United States as an occupational or physical therapist must obtain the following... language proficiency testing. (3) Physical therapists. An alien physical therapist who has graduated from a... section, if 8 CFR 212.1 requires an alien who is described in paragraph (a) of this section and who...

  15. 19 CFR 212.07 - Rulemaking on maximum rates for attorney fees.

    Science.gov (United States)

    2010-04-01

    ....07 Section 212.07 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION INVESTIGATIONS OF UNFAIR PRACTICES IN IMPORT TRADE IMPLEMENTATION OF THE EQUAL ACCESS TO JUSTICE ACT General Provisions... conduct any rulemaking proceedings for this purpose under the informal rulemaking procedures of...

  16. Half-life of 214Po and 212Po measured with CTF at LNGS

    International Nuclear Information System (INIS)

    Polonium isotopes 214Po and 212Po are part of the 238U and 232Th decay chains, respectively. There exist only a few measurements of these two mean lifetimes with precision better than one or two percent. Since we have been studying decay spectra of 214Bi and 212Bi with the purpose of experimentally constraining anti-neutrino spectral shape important for geoneutrino studies, we have a large statistics of decays of 214Po and 212Po collected with the Counting Test Facility (CTF), which was operational in the underground I.N.F.N. Gran Sasso National Laboratory. The apparatus consisted of an external cylindrical water tank (diameter ∼ 11 m, high ∼ 10 m; ∼ 1000 tons of water) serving as passive shielding for 4.8 m3 of liquid organic scintillator contained in an inner spherical vessel with a diameter of ∼ 2 m. The inner vessel was realized with a nylon membrane (∼ 500 ?m thick), with excellent optical clarity, which allowed the effective transmission of the scintillation light to the 100 phototubes (PMTs) forming the optical read-out, anchored on a 7 m diameter support structure inside the water tank. The high purity and low background in CTF allows a favourable signal to background ratio for these measurements. More specifically the ratio of signal to background of the present measurements is more than three orders of magnitude larger than the best existing measurements. We have studied the decays of 214Po into 210Pb and of 212Po into 208Pb tagged by the coincidence with the previously decays from 214Bi and 212Bi by using 222Rn, 232Th and 220Rn sources sealed inside quartz vials and inserted in the CTF

  17. Microwave sintering of ZrO2-12 mol% CeO2

    International Nuclear Information System (INIS)

    Sintering of ZrO2-12 mol% CeO2 was accelerated by microwave processing at 2.45 GHz as compared with conventional firing. However, the size of the ''microwave effect'' was significantly smaller than that which was previously observed for microwave sintering of ZrO2-8 mol% Y2O3. The difference in the effect that the microwave field had on the two zirconia systems is interpreted in terms of their ionic conductivities

  18. Examination results of the Three Mile Island radiation detector HP-R-212

    International Nuclear Information System (INIS)

    Area radiation detector HP-R-212 was removed from the Three Mile Island containment building on November 13, 1981. The detector apparently started to fail during November 1979 and by the first part of December 1979 the detector readings had degraded from 1 R/hr to 20 mR/hr. This report discusses the cause of failure, detector radiation measurement characteristics, and our estimates of the total gamma radiation dose received by the detector electronics

  19. Metallothionein bioconjugates as delivery vehicles for bismuth-212 alpha particle therapy

    International Nuclear Information System (INIS)

    Metallothioneins (MTHs) are small cysteine-rich polypeptides that binds cationic metals at physiologic pH ranges through noncovalent -SH ligand interactions. Some leucine-rich renal MTHs have a particular avidity for bismuth. The authors have examined the ability of MTHs to selectively incorporate Bi-212, a short-lived high-energy alpha particle emitter currently under exploration as a potential therapeutic radiolabel for use in molecularly targeted cancer therapy. They find that under physiologic conditions, MTH will selectively incorporate Bi-212 after incubation with an equilibrium mixture of its upstream and downstream parents. The MTH moieties may be linked to tumor-binding macromolecules such as antibodies via thiolation reactions using SPDP, and the resultant Bismuth-avid molecules may be used either as primary delivery vehicles for the Bi-212 or as part of a 2-step release-and-catch isotope localization system in which the MTH-antibody conjugate is pre-localized at the tumor site and the radiometal is then administered and chelated in situ. They present the chemistry, dosimetry and potential clinical applications of this system

  20. miR-132 and miR-212 are increased in pancreatic cancer and target the retinoblastoma tumor suppressor

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jong-Kook [College of Pharmacy, Ohio State University, Columbus, OH 43210 (United States); Henry, Jon C. [Department of Surgery, Ohio State University, Columbus, OH 43210 (United States); Jiang, Jinmai [College of Pharmacy, Ohio State University, Columbus, OH 43210 (United States); Esau, Christine [Regulus Therapeutics, Carlsbad, CA (United States); Gusev, Yuriy [Lombardi Cancer Center, Georgetown University, Washington, DC (United States); Lerner, Megan R. [Veterans Affairs Medical Center, Oklahoma City, OK (United States); Postier, Russell G. [Department of Surgery, University of Oklahoma Health Sciences Center, Oklahoma City, OK (United States); Brackett, Daniel J. [Veterans Affairs Medical Center, Oklahoma City, OK (United States); Schmittgen, Thomas D., E-mail: Schmittgen.2@osu.edu [College of Pharmacy, Ohio State University, Columbus, OH 43210 (United States)

    2011-03-25

    Research highlights: {yields} The expression of miR-132 and miR-212 are significantly increased in pancreatic cancer. {yields} miR-132 and miR-212 target the tumor suppressor pRb, resulting in enhanced proliferation. {yields} miR-132 and miR-212 expression is increased by a {beta}2 adrenergic receptor agonist, suggesting a novel mechanism for pancreatic cancer progression. -- Abstract: Numerous microRNAs (miRNAs) are reported as differentially expressed in cancer, however the consequence of miRNA deregulation in cancer is unknown for many miRNAs. We report that two miRNAs located on chromosome 17p13, miR-132 and miR-212, are over-expressed in pancreatic adenocarcinoma (PDAC) tissues. Both miRNAs are predicted to target the retinoblastoma tumor suppressor, Rb1. Validation of this interaction was confirmed by luciferase reporter assay and western blot in a pancreatic cancer cell line transfected with pre-miR-212 and pre-miR-132 oligos. Cell proliferation was enhanced in Panc-1 cells transfected with pre-miR-132/-212 oligos. Conversely, antisense oligos to miR-132/-212 reduced cell proliferation and caused a G{sub 2}/M cell cycle arrest. The mRNA of a number of E2F transcriptional targets were increased in cells over expressing miR-132/-212. Exposing Panc-1 cells to the {beta}2 adrenergic receptor agonist, terbutaline, increased the miR-132 and miR-212 expression by 2- to 4-fold. We report that over-expression of miR-132 and miR-212 result in reduced pRb protein in pancreatic cancer cells and that the increase in cell proliferation from over-expression of these miRNAs is likely due to increased expression of several E2F target genes. The {beta}2 adrenergic pathway may play an important role in this novel mechanism.

  1. miR-132 and miR-212 are increased in pancreatic cancer and target the retinoblastoma tumor suppressor

    International Nuclear Information System (INIS)

    Research highlights: → The expression of miR-132 and miR-212 are significantly increased in pancreatic cancer. → miR-132 and miR-212 target the tumor suppressor pRb, resulting in enhanced proliferation. → miR-132 and miR-212 expression is increased by a β2 adrenergic receptor agonist, suggesting a novel mechanism for pancreatic cancer progression. -- Abstract: Numerous microRNAs (miRNAs) are reported as differentially expressed in cancer, however the consequence of miRNA deregulation in cancer is unknown for many miRNAs. We report that two miRNAs located on chromosome 17p13, miR-132 and miR-212, are over-expressed in pancreatic adenocarcinoma (PDAC) tissues. Both miRNAs are predicted to target the retinoblastoma tumor suppressor, Rb1. Validation of this interaction was confirmed by luciferase reporter assay and western blot in a pancreatic cancer cell line transfected with pre-miR-212 and pre-miR-132 oligos. Cell proliferation was enhanced in Panc-1 cells transfected with pre-miR-132/-212 oligos. Conversely, antisense oligos to miR-132/-212 reduced cell proliferation and caused a G2/M cell cycle arrest. The mRNA of a number of E2F transcriptional targets were increased in cells over expressing miR-132/-212. Exposing Panc-1 cells to the β2 adrenergic receptor agonist, terbutaline, increased the miR-132 and miR-212 expression by 2- to 4-fold. We report that over-expression of miR-132 and miR-212 result in reduced pRb protein in pancreatic cancer cells and that the increase in cell proliferation from over-expression of these miRNAs is likely due to increased expression of several E2F target genes. The β2 adrenergic pathway may play an important role in this novel mechanism.

  2. SU-C-201-05: Imaging 212Pb-TCMC-Trastuzumab for Alpha Radioimmunotherapy for Ovarian Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Shen, S; Meredith, R; Azure, M; Yoder, D [University of Alabama, Birmingham, AL (United States); Torgue, J; Banaga, E [AREVA Med LLC, Bethesda, MD (United States)

    2015-06-15

    Purpose: To support the phase I trial for toxicity, biodistribution and pharmacokinetics of intra-peritoneal (IP) 212Pb-TCMC-trastuzumab in patients with HER-2 expressing malignancy. A whole body gamma camera imaging method was developed for estimating amount of 212Pb-TCMC-trastuzumab left in the peritoneal cavity. Methods: {sup 212}Pb decays to {sup 212}Bi via beta emission. {sup 212}Bi emits an alpha particle at an average of 6.1 MeV. The 238.6 keV gamma ray with a 43.6% yield can be exploited for imaging. Initial phantom was made of saline bags with 212Pb. Images were collected for 238.6 keV with a medium energy general purpose collimator. There are other high energy gamma emissions (e.g. 511keV, 8%; 583 keV, 31%) that penetrate the septae of the collimator and contribute scatter into 238.6 keV. An upper scatter window was used for scatter correction for these high energy gammas. Results: A small source containing 212Pb can be easily visualized. Scatter correction on images of a small 212Pb source resulted in a ∼50% reduction in the full width at tenth maximum (FWTM), while change in full width at half maximum (FWHM) was <10%. For photopeak images, substantial scatter around phantom source extended to > 5 cm outside; scatter correction improved image contrast by removing this scatter around the sources. Patient imaging, in the 1st cohort (n=3) showed little redistribution of 212Pb-TCMC-trastuzumab out of the peritoneal cavity. Compared to the early post-treatment images, the 18-hour post-injection images illustrated the shift to more uniform anterior/posterior abdominal distribution and the loss of intensity due to radioactive decay. Conclusion: Use of medium energy collimator, 15% width of 238.6 keV photopeak, and a 7.5% upper scatter window is adequate for quantification of 212Pb radioactivity inside peritoneal cavity for alpha radioimmunotherapy of ovarian cancer. Research Support: AREVA Med, NIH 1UL1RR025777-01.

  3. The tribology of PS212 coatings and PM212 composites for the lubrication of titanium 6A1-4V components of a Stirling engine space power system

    Science.gov (United States)

    Sliney, Harold E.; Dellacorte, Christopher; Lukaszewicz, Victor

    1995-07-01

    The Stirling space power machine incorporates a linear alternator to generate electrical power. The alternator is a reciprocating device that is driven by a solar or nuclear-powered Stirling engine. The power piston and cylinder are made of titanium 6A1-4V (Ti6-4) alloy, and are designed to be lubricated by a hydrodynamically-generated gas film. Rubbing occurs during starts and stops and there is a possibility of an occasional high speed rub. Since titanium is known to have a severe galling tendency in sliding contacts, a 'backup,' self-lubricating coating on the cylinder and/or the piston is needed. This report describes the results of a research program to study the lubrication of Ti6-4 with the following chromium carbide based materials: plasma-sprayed PS212 coatings and sintered PM212 counterfaces. Program objectives are to achieve adherent coatings on Ti6-4 and to measure the friction and wear characteristics of the following sliding combinations under conditions simulative of the Stirling-driven space power linear alternator: Ti6-4/Ti6-4 baseline, Ti6-4/PS212 coated Ti6-4, and Ps212 coated Ti6-4/PM212

  4. Recombinant protein of heptad-repeat HR212, a stable fusion inhibitor with potent anti-HIV action in vitro

    International Nuclear Information System (INIS)

    HR212, a recombinant protein expressed in Escherichia coli, has been previously reported to inhibit HIV-1 membrane fusion at low nanomolar level. Here we report that HR212 is effective in blocking laboratory strain HIV-1IIIB entry and replication with EC50 values of 3.92 ± 0.62 and 6.59 ± 1.74 nM, respectively, and inhibiting infection by clinic isolate HIV-1KM018 with EC50 values of 44.44 ± 10.20 nM, as well as suppressing HIV-1-induced cytopathic effect with an EC50 value of 3.04 ± 1.20 nM. It also inhibited HIV-2ROD and HIV-2CBL-20 entry and replication in the μM range. Notably, HR212 was highly effective against T20-resistant strains with EC50 values ranging from 5.09 to 7.75 nM. Unlike T20, HR212 showed stability sufficient to inhibit syncytia formation in a time-of-addition assay, and was insensitive to proteinase K digestion. These results suggest that HR212 has great potential to be further developed as novel HIV-1 fusion inhibitor for treatment of HIV/AIDS patients, particularly for those infected by T20-resistant variants

  5. An evaluation of the membership probability of 212 $\\lambda$ Boo stars: I. A Catalogue

    CERN Document Server

    Murphy, Simon J; Gray, Richard O; Cheng, Kwang-Ping; Neff, James E; Koen, Chris; Kuehn, Charles A; Newsome, Ian; Riggs, Quinlin

    2015-01-01

    The literature on the $\\lambda$ Boo stars has grown to become somewhat heterogenous, as different authors have applied different criteria across the UV, optical and infrared regions to determine the membership status of $\\lambda$ Boo candidates. We aim to clear up the confusion by consulting the literature on 212 objects that have been considered as $\\lambda$ Boo candidates, and subsequently evaluating the evidence in favour of their admission to the $\\lambda$ Boo class. We obtained new spectra of $\\sim$90 of these candidates and classified them on the MK system to aid in the membership evaluations. The re-evaluation of the 212 objects resulted in 64 members and 103 non-members of the $\\lambda$ Boo class, with a further 45 stars for which membership status is unclear. We suggest observations for each of the stars in the latter category that will allow them to be confidently included or rejected from the class. Our reclassification facilitates homogenous analysis on group members, and represents the largest co...

  6. Water and acetaldehyde in HH212: The first hot corino in Orion

    CERN Document Server

    Codella, C; Cabrit, S; Podio, L; Bachiller, R; Fontani, F; Gusdorf, A; Lefloch, B; Leurini, S; Tafalla, M

    2016-01-01

    Aims: Using the unprecedented combination of high resolution and sensitivity offered by ALMA, we aim to investigate whether and how hot corinos, circumstellar disks, and ejected gas are related in young solar-mass protostars. Methods: We observed CH$_3$CHO and deuterated water (HDO) high-excitation ($E_{\\rm u}$ up to 335 K) lines towards the Sun-like protostar HH212--MM1. Results: For the first time, we have obtained images of CH$_3$CHO and HDO emission in the inner $\\simeq$ 100 AU of HH212. The multifrequency line analysis allows us to contrain the density ($\\geq$ 10$^{7}$ cm$^{-3}$), temperature ($\\simeq$ 100 K), and CH$_3$CHO abundance ($\\simeq$ 0.2--2 $\\times$ 10$^{-9}$) of the emitting region. The HDO profile is asymmetric at low velocities ($\\leq$ 2 km s$^{-1}$ from $V_{\\rm sys}$). If the HDO line is optically thick, this points to an extremely small ($\\sim$ 20--40 AU) and dense ($\\ge$ 10$^{9}$ cm$^{-3}$) emitting region. Conclusions: We report the first detection of a hot corino in Orion. The HDO asymm...

  7. Water and acetaldehyde in HH212: The first hot corino in Orion

    Science.gov (United States)

    Codella, C.; Ceccarelli, C.; Cabrit, S.; Gueth, F.; Podio, L.; Bachiller, R.; Fontani, F.; Gusdorf, A.; Lefloch, B.; Leurini, S.; Tafalla, M.

    2016-02-01

    Aims: Using the unprecedented combination of high resolution and sensitivity offered by ALMA, we aim to investigate whether and how hot corinos, circumstellar disks, and ejected gas are related in young solar-mass protostars. Methods: We observed CH3CHO and deuterated water (HDO) high-excitation (Eu up to 335 K) lines towards the Sun-like protostar HH212-MM1. Results: For the first time, we have obtained images of CH3CHO and HDO emission in the inner ≃100 AU of HH212. The multifrequency line analysis allows us to contrain the density (≥107 cm-3), temperature (≃100 K), and CH3CHO abundance (≃0.2-2 × 10-9) of the emitting region. The HDO profile is asymmetric at low velocities (≤2 km s-1 from Vsys). If the HDO line is optically thick, this points to an extremely small (~20-40 AU) and dense (≥109 cm-3) emitting region. Conclusions: We report the first detection of a hot corino in Orion. The HDO asymmetric profile indicates a contribution of outflowing gas from the compact central region, possibly associated with a dense disk wind.

  8. Deuterated formaldehyde in HH212: physics and chemistry of a typical protostar

    Science.gov (United States)

    Sahu, Dipen; Chakrabarti, Sandip Kumar; Minh, Young Chol

    2016-07-01

    HH212 is a nearby (400 pc) source in Orion. Recent observation (Codella et al., 2014) with ALMA using 24 no. of 12 m antenna revealed the source with high angular resolution and sensitivity (HPBW=0.65arc × 0.47 arc, σ - 3 to 4 mJy/beam/0.43 km s^-1) than previous SMA observation (Lee et al., 2007). This allows observations of several molecular lines e.g., SO, SO^2, C^{17}O, CO, and SiO. Emissions from these species probe different regions of this young stellar object, e.g., the outflow, the molecular jet, the envelop and the disk. The source might be the Class 0 protostellar system with a Keplerian disc and collimated bipolar SiO jets. Physics and chemistry of this region are very interesting. No deuterated molecule has been reported in this source except the recent report of deuterated water, HDO (Codella et al., 2016). Here, we report the HDCO (deuterated formaldehyde) line observation from ALMA data to probe the inner region of HH212. We compare HDCO line with other molecular lines to explain the possible chemistry and physics of the source, and also discussed the deuterium enrichment of molecular species.

  9. Effective chelators for 90Y and 212Bi radioimmunotherapy of cancer

    International Nuclear Information System (INIS)

    Advances in synthesis and evaluation of monoclonal antibody (mAb)-ligand bioconjugates are required to further use of 90Y, 212Bi labeled mAb in cancer therapy. The authors have used ligand 1B4M-DTPA for preparation of 90Y-mAb-anti-TAC for an ongoing clinical trial of treatment of adult T-cell leukemia. Good results have been obtained in that of 10 evaluable patients, two are in complete remission 1 yr after initiation of therapy and six experienced partial remissions. Radiochemical dose was limited by marrow suppression, leading the authors to suspect that some 90Y was reaching bone. For this reason, they have prepared ultra-pure 88Y and thereafter 88Y-mAb conjugates with bifunctional DOTA and CHX-DTPA ligands which they have measured to be thermodynamically stronger for yttrium than the 1B4M ligand. The CHX ligand has also been useful for 212Bi-leukemia therapy in mice

  10. Multiepoch Radio Observations of the Exciting Sources of HH 212 and HH 119

    Directory of Open Access Journals (Sweden)

    R. Galván Madrid

    2004-01-01

    Full Text Available Presentamos observaciones de alta resolución angular (- 0.``3 hechas con el Very Large Array a 3.5 cm hacia las regiones de las fuentes excitadoras de dos sistemas Herbig-Haro: HH 212 en Orión y HH 119 en B335. Las observaciones fueron hechas durante tres épocas diferentes con el objetivo de medir posibles variaciones temporales rápidas (en la escala de una semana a un mes en las fuentes. En HH 212 detectamos, promediando las observaciones de las tres épocas, una fuente muy débil justo en la posición esperada para la fuente excitadora del sistema HH. La comparación con otras observaciones de radio de esta fuente indica variación temporal considerable en escala de años. En B335 detectamos en cada época al objeto previamente reportado por otros autores y nuestros resultados sugieren que esta fuente, un chorro térmico de radio, es variable en escalas de tiempo de un mes. Discutimos posibles explicaciones para esta rápida variabilidad.

  11. Expression and modulation of nerve growth factor in murine keratinocytes (PAM 212)

    International Nuclear Information System (INIS)

    Nerve growth factor (NGF) is a polypeptide that is required for normal development and maintenance of the sympathetic and sensory nervous systems. Skin has been shown to contain relatively high amounts of NGF, which is in keeping with the finding that the quantity of NGF in a tissue is proportional to the extent of sympathetic innervation of that organ. Since the keratinocyte, a major cellular constituent of the skin, is known to produce other growth factors and cytokines, our experiments were designed to determine whether keratinocytes are a source of NGF. Keratinocyte-conditioned media from the keratinocyte cell line PAM 212 contained NGF-like activity, approximately 2-3 ng/ml, as detected by the neurite outgrowth assay. Freshly isolated BALB/c keratinocytes contained approximately 0.1 ng/ml. Using a cDNA probe directed against NGF, we demonstrated the presence of a 1.3-kb NGF mRNA in both PAM 212 and BALB/c keratinocytes. Since ultraviolet radiation (UV) is a potentially important modulating factor for cytokines in skin, we examined the effect of UV on NGF mRNA expression. Although UV initially inhibited the expression of keratinocyte NGF mRNA (4 h), by 24 h an induction of NGF mRNA was seen. The NGF signal could also be induced by phorbol esters. Thus, keratinocytes synthesize and express NGF, and its expression is modulated by UVB and phorbol esters

  12. Cellular uptake of {sup 212}BiOCl by Ehrlich ascites cells: A dosimetric analysis

    Energy Technology Data Exchange (ETDEWEB)

    Roeske, J.C.; Whitlock, J.L.; Harper, P.V.; Rotmensch, J. [Univ. of Chicago, IL (United States); Stinchcomb, T.G. [DePaul Univ., Chicago, IL (United States). Dept. of Physics; Schwartz, J.L. [Univ. of Washington, Seattle, WA (United States). Dept. of Radiation Oncology; Hines, J.J. [Argonne National Lab., IL (United States). Chemistry Div.

    1999-01-01

    Bi-212 is an alpha-emitting radionuclide being investigated as a therapeutic agent in the intraperitoneal treatment of micrometastatic ovarian carcinoma. In evaluating a new therapeutic modality, cell-survival studies are often used as a means of quantifying the biological effects of radiation. In this analysis, Ehrlich ascites cells were irradiated under conditions similar to therapy in various concentrations of Bi-212. Immediately following irradiation, a cell survival assay was performed in which cells were plated and colonies were counted after 10--14 days. Both a macrodosimetric and a microdosimetric approach were used in analyzing these data. These models used as input the fraction of activity within the cell and in solution, the distribution of cell sizes, and the variation of LET along individual alpha-particle tracks. The results indicate that the energy deposited within the nucleus varies significantly among individual cells. There is a small fraction of cell nuclei which receive no hits, while the remaining cells receive energy depositions which can differ significantly from the mean value. These dosimetric parameters are correlated with measured cell survival and will be a useful predictor of outcome for therapeutic doses.

  13. Mechanical strength and thermophysical properties of PM212: A high temperature self-lubricating powder metallurgy composite

    Science.gov (United States)

    Edwards, Phillip M.; Sliney, Harold E.; Dellacorte, Christopher; Whittenberger, J. Daniel; Martineau, Robert R.

    1990-01-01

    A powder metallurgy composite, PM212, composed of metal bonded chromium carbide and solid lubricants is shown to be self-lubricating to a maximum application temperature of 900 C. The high temperature compressive strength, tensile strength, thermal expansion and thermal conductivity data needed to design PM212 sliding contact bearings and seals are reported for sintered and isostatically pressed (HIPed) versions of PM212. Other properties presented are room temperature density, hardness, and elastic modulus. In general, both versions appear to have adequate strength to be considered as sliding contact bearing materials, but the HIPed version, which is fully dense, is much stronger than the sintered version which contains about 20 percent pore volume. The sintered material is less costly to make, but the HIPed version is better where high compressive strength is important.

  14. Activities of AREVA Med. Extraction and purification of the 212Pb isotope from Thorium for radio-immunotherapy

    International Nuclear Information System (INIS)

    After having recalled the definition of radio-immunotherapy (RIT) and the benefits of alpha RIT for the treatment of some cancers, this document explains the choice of the 212-Pb isotope instead of the 212-Bi isotope (the first one has a longer half-life than the second). The Pb isotope in fact progressively transforms itself into the Bi isotope. The production process is evoked with its important steps. A second part reports the first clinic tests performed in the Alabama Centre for the treatment of different cancer (breast, colon, ovarian, pancreas, stomach). Processes and doses are discussed

  15. Evaluation of PS 212 Coatings Under Boundary Lubrication Conditions with an Ester-based Oil to 300 C

    Science.gov (United States)

    Sliney, Harold E.; Loomis, William R.; Dellacorte, Christopher

    1994-01-01

    High friction and wear of turbine engine components occur during high temperature excursions above the oxidation threshold of the liquid lubricant. This paper reports on research to study the use of a high temperature self lubricating coating, PS 212 for back-up lubrication in the event of failure of the liquid lubricant. Pin on disk tests were performed under dry and boundary-lubricated conditions at disk temperatures up to 300 C. The liquid lubricant was a formulated polyol ester qualified under MIL L-23699. At test temperatures above the oil's thermal degradation level, the use of PS 212 reduced wear, providing a back-up lubricant effect.

  16. The microRNA-132/212 family fine-tunes multiple targets in Angiotensin II signalling in cardiac fibroblasts

    DEFF Research Database (Denmark)

    Eskildsen, Tilde V; Schneider, Mikael; Sandberg, Maria B; Skov, Vibe; Jensen, Hasse Brønnum; Thomassen, Mads; Kruse, Torben A; Andersen, Ditte Caroline; Sheikh, Søren P

    2015-01-01

    INTRODUCTION: MicroRNAs (miRNAs) are emerging as key regulators of cardiovascular development and disease; however, the cardiac miRNA target molecules are not well understood. We and others have described the Angiotensin II (AngII)-induced miR-132/212 family as novel regulators of cardiovascular ...... pathways that fine-tuned by miR-132/212, suggesting a role for this miRNA family as master signalling switches in cardiac fibroblasts. Our data underscore the potential for miRNA tools to manipulate a large array of molecules and thereby control biological function....

  17. (212)Pb-radioimmunotherapy induces G(2) cell-cycle arrest and delays DNA damage repair in tumor xenografts in a model for disseminated intraperitoneal disease.

    Science.gov (United States)

    Yong, Kwon Joong; Milenic, Diane E; Baidoo, Kwamena E; Brechbiel, Martin W

    2012-03-01

    In preclinical studies, targeted radioimmunotherapy using (212)Pb-TCMC-trastuzumab as an in vivo generator of the high-energy α-particle emitting radionuclide (212)Bi is proving an efficacious modality for the treatment of disseminated peritoneal cancers. To elucidate mechanisms associated with this therapy, mice bearing human colon cancer LS-174T intraperitoneal xenografts were treated with (212)Pb-TCMC-trastuzumab and compared with the nonspecific control (212)Pb-TCMC-HuIgG, unlabeled trastuzumab, and HuIgG, as well as untreated controls. (212)Pb-TCMC-trastuzumab treatment induced significantly more apoptosis and DNA double-strand breaks (DSB) at 24 hours. Rad51 protein expression was downregulated, indicating delayed DNA double-strand damage repair compared with (212)Pb-TCMC-HuIgG, the nonspecific control. (212)Pb-TCMC-trastuzumab treatment also caused G(2)-M arrest, depression of the S phase fraction, and depressed DNA synthesis that persisted beyond 120 hours. In contrast, the effects produced by (212)Pb-TCMC-HuIgG seemed to rebound by 120 hours. In addition, (212)Pb-TCMC-trastuzumab treatment delayed open chromatin structure and expression of p21 until 72 hours, suggesting a correlation between induction of p21 protein and modification in chromatin structure of p21 in response to (212)Pb-TCMC-trastuzumab treatment. Taken together, increased DNA DSBs, impaired DNA damage repair, persistent G(2)-M arrest, and chromatin remodeling were associated with (212)Pb-TCMC-trastuzumab treatment and may explain its increased cell killing efficacy in the LS-174T intraperitoneal xenograft model for disseminated intraperitoneal disease. PMID:22238365

  18. El Decreto reglamentario de la Ley N° 18.212 (Usura: su ilegitimidad

    Directory of Open Access Journals (Sweden)

    Roque Molla

    2010-07-01

    Full Text Available En nuestra entrega para el Tomo XXXIX del Anuario de Derecho Civil Uruguay, ratificamos nuestra opinión vertida en La Pluma No. 29 Junio 2008, en el sentido de que el régimen de la ley 18.212 no es aplicable a la cláusula penal pactada en una compraventa para el caso de resolución del contrato por incumplimiento de la obligación de pagar el precio.La cuestión debe resolverse en función de la materia regulada por la ley.En ese orden de ideas, en el trabajo publicado en el ADCU referido, siguiendo a Emilio Betti, manifestamos: "La materia (ratio legis de la ley es la disciplina de la usura civil y penal abarcativa no solamente de los intereses usurarios sino también de los negocios usurarios en las operaciones de crédito"

  19. 76 FR 68301 - Airworthiness Directives; Bell Helicopter Textron, Inc. (Bell), Model 205A-1, 205B, 210, and 212...

    Science.gov (United States)

    2011-11-04

    ... same type designs, this AD supersedes AD 2010-03-03 (75 FR 5681, February 4, 2010), retaining the same... airworthiness directive (AD) for Bell Model 205B and 212 helicopters with certain main rotor blade (blade... of the helicopter. Since issuing AD 2010-03-03 (75 FR 5681, February 4, 2010), we have...

  20. 25 CFR 212.5 - Authority and responsibility of the Office of Surface Mining Reclamation and Enforcement (OSM).

    Science.gov (United States)

    2010-04-01

    ... regulations for surface coal mining and reclamation operations are found in 30 CFR part 750. Those regulations... § 212.5 Authority and responsibility of the Office of Surface Mining Reclamation and Enforcement (OSM). The OSM is the regulatory authority for surface coal mining and reclamation operations on Indian...

  1. Determination of 210Pb and 212Pb in water and their radiological impact to the public via drinking water

    International Nuclear Information System (INIS)

    A sensitive and accurate method for determining ultra low-level 210Pb and 212Pb in water samples through double measurements was developed. Pb was pre-concentrated as hydroxides, separated from alkaline earth elements as PbS precipitate, purified by an anion exchange resin chromatography column, precipitated as PbSO4 for source preparation and counted by a low background β-counter. The procedure was checked with IAEA reference materials, and the results agreed well with the recommended values. The minimum detectable activity was 0.062 mBq·L-1 for 210Pb and 0.053 mBq·L-1 for 212Pb with a 48 L water sample. Seventeen drinking water samples were analyzed,with a Pb recovery of 88.8±5.5%, and the typical activity concentrations were 0.191-15.1 mBq·L-1 for 210Pb and of 1.12-5.77 mBq·L-1 for 212Pb. The estimated committed effective doses to adult members of the public in Italy due to intake of 210Pb and 212Pb in drinking water were 0.096-7.59 μSv·a-1 and 0.005-0.025 μSv·a-1, respectively. (authors)

  2. 40 CFR 262.212 - Making the hazardous waste determination at an on-site interim status or permitted treatment...

    Science.gov (United States)

    2010-07-01

    ....212 Making the hazardous waste determination at an on-site interim status or permitted treatment... hazardous waste permit or interim status as soon as it arrives in the on-site treatment, storage or disposal... permitted treatment, storage or disposal facility. (e) If the unwanted material is a hazardous waste,...

  3. 77 FR 41795 - Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and Nationality Act

    Science.gov (United States)

    2012-07-16

    ... SECURITY Office of the Secretary Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and...(d)(3)(B)(i) of the Immigration and ] Nationality Act (INA), 8 U.S.C. 1182(d)(3)(B)(i), as amended.... Implementation of this determination will be made by U.S. Citizenship and Immigration Services (USCIS),...

  4. 76 FR 14419 - Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and Nationality Act

    Science.gov (United States)

    2011-03-16

    ... SECURITY Office of the Secretary Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and...(d)(3)(B)(i) of the Immigration and Nationality Act (INA), 8 U.S.C. 1182(d)(3)(B)(i), as amended, as.... Citizenship and Immigration Services (USCIS), in consultation with U.S. Immigration and Customs...

  5. 76 FR 14418 - Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and Nationality Act

    Science.gov (United States)

    2011-03-16

    ... SECURITY Office of the Secretary Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and...(d)(3)(B)(i) of the Immigration and Nationality Act (INA), 8 U.S.C. 1182(d)(3)(B)(i), as amended, as... determination will be made by U.S. Citizenship and Immigration Services (USCIS), in consultation with...

  6. 76 FR 2130 - Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and Nationality Act

    Science.gov (United States)

    2011-01-12

    ... SECURITY Office of the Secretary Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and...(d)(3)(B)(i) of the Immigration and Nationality Act (INA), 8 U.S.C. 1182(d)(3)(B)(i), as amended, as... Immigration Services (USCIS), in consultation with U.S. Immigration and Customs Enforcement (ICE), or by...

  7. 76 FR 2131 - Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and Nationality Act

    Science.gov (United States)

    2011-01-12

    ... SECURITY Office of the Secretary Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and...(d)(3)(B)(i) of the Immigration and Nationality Act (INA), 8 U.S.C. 1182(d)(3)(B)(i), as amended, as.... Implementation of this determination will be made by U.S. Citizenship and Immigration Services (USCIS),...

  8. 47 CFR 36.212 - Basic local services revenue-Account 5000 (Class B telephone companies); Basic area revenue...

    Science.gov (United States)

    2010-10-01

    ... Income Accounts Operating Revenues § 36.212 Basic local services revenue—Account 5000 (Class B telephone... 47 Telecommunication 2 2010-10-01 2010-10-01 false Basic local services revenue-Account 5000 (Class B telephone companies); Basic area revenue-Account 5001 (Class A telephone companies)....

  9. Bismuth-212-labeled anti-Tac monoclonal antibody: alpha-particle-emitting radionuclides as modalities for radioimmunotherapy

    International Nuclear Information System (INIS)

    Anti-Tac, a monoclonal antibody directed to the human interleukin 2 (IL-2) receptor, has been successfully conjugated to the alpha-particle-emitting radionuclide bismuth-212 by use of a bifunctional ligand, the isobutylcarboxycarbonic anhydride of diethylenetriaminepentaacetic acid. The physical properties of 212Bi are appropriate for radioimmunotherapy in that it has a short half-life, deposits its high energy over a short distance, and can be obtained in large quantities from a radium generator. Antibody specific activities of 1-40 microCi/microgram (1 Ci = 37 GBq) were achieved. Specificity of the 212Bi-labeled anti-Tac was demonstrated for the IL-2 receptor-positive adult T-cell leukemia line HUT-102B2 by protein synthesis inhibition and clonogenic assays. Activity levels of 0.5 microCi or the equivalent of 12 rad/ml of alpha radiation targeted by anti-Tac eliminated greater than 98% the proliferative capabilities of HUT-102B2 cells with more modest effects on IL-2 receptor-negative cell lines. Specific cytotoxicity was blocked by excess unlabeled anti-Tac but not by human IgG. In addition, an irrelevant control monoclonal antibody of the same isotype labeled with 212Bi was unable to target alpha radiation to cell lines. Therefore, 212Bi-labeled anti-Tac is a potentially effective and specific immunocytotoxic reagent for the elimination of IL-2 receptor-positive cells. These experiments thus provide the scientific basis for use of alpha-particle-emitting radionuclides in immunotherapy

  10. Rice OsRAD21-2 is Expressed in Actively Dividing Tissues and its Ectopic Expression in Yeast Results in Aberrant Cell Division and Growth

    Institute of Scientific and Technical Information of China (English)

    Chunyan Gong; Tang Li; Qi Li; Longfeng Yan; Tai Wang

    2011-01-01

    Rad21 and its meiotic counterpart Rec8,the key components of the cohesin complex,are essential for sister chromatid cohesion and chromosome segregation in mitosis and meiosis,respectively.In contrast to yeast and vertebrates,which have only two RAD21/REC8 genes,the rice genome encodes four Rad21/Rec8 proteins.Here,we report on the cloning and characterization of OsRAD21-2 from rice (Oryza sativa L.).Phylogenetic analysis of the full-length amino acids showed that OsRad21-2 was grouped into the plant-specific Rad21 subfamily.Semi-quantitative reverse transcription-polymerase chain reaction revealed OsRAD21-2 preferentially expressed in premeiotic flowers.Further RNA in situ hybridization analysis and promoter::β-glucuronidase staining indicated that OsRAD21-2 was mainly expressed in actively dividing tissues including premeiotic stamen,stem intercalary meristem,leaf meristem,and root pericycle.Ectopic expression of OsRAD21-2 in fission yeast resulted in cell growth delay and morphological abnormality.Flow cytometric analysis revealed that the OsRAD21-2-expressed cells were arrested in G2 phase.Our results suggest that OsRad21-2 functions in regulation of cell division and growth.

  11. The Effect of Dorsal Hippocampal α2-Adrenegic Receptors on WIN55,212-2 State-Dependent Memory of Passive Avoidance

    Directory of Open Access Journals (Sweden)

    Zarrindast M.R.

    2010-09-01

    Full Text Available Background and Objectives: Cannabinoids are a class of psychoactive compounds that produce a wide array of effects in a large number of species. In the present study, the effects of bilateral intra-CA1 injections of an α2-adrenergic receptor agents, on WIN55,212-2 state-dependent learning were examined in adult male Wistar rats. Methods: The animals were bilaterally implanted with chronic cannulae in the CA1 regions of the dorsal hippocampus, trained in a step-down type inhibitory avoidance task, and tested 24h after training to measure step-down latency.Results: Post-training intra-CA1 injection of WIN55,212-2 (0.25 and 0.5µg/rat induced impairment of memory retention. Amnesia produced by post-training WIN55,212-2 (0.5µg/rat was reversed by pre-test administration of the same dose of WIN55,212-2 that is due to a state-dependent effect. Pre-test intra-CA1 injection of clonidine (0.5 and 0.75µg/rat, intra-CA1 improved post-training WIN55,212-2 (0.5µg/rat, intra-CA1-induced retrieval impairment, while pre-test intra-CA1 injection of yohimbine (1µg/rat, intra-CA1 2min before the administration of WIN55,212-2 (0.5µg/rat, intra-CA1 inhibited WIN55,212-2 state-dependent memory. Conclusion: These results suggest that α2-adrenergic receptors of the dorsal hippocampal CA1 regions may play an important role in Win55,212-2-induced amnesia and WIN55,212-2 state-dependent memory.

  12. Production and in vivo imaging of (203)Pb as a surrogate isotope for in vivo (212)Pb internal absorbed dose studies.

    Science.gov (United States)

    Máthé, Domokos; Szigeti, Krisztián; Hegedűs, Nikolett; Horváth, Ildikó; Veres, Dániel S; Kovács, Béla; Szűcs, Zoltán

    2016-08-01

    (212)Pb is a clinically relevant therapeutic alpha emitter isotope. A surrogate, (203)Pb, if prepared with sufficiently high specific activity could be used to estimate (212)Pb in vivo absorbed doses. An improved production procedure of (203)Pb with a simple, new separation method and high specific radioactivity for imaging is reported. We determined the in-vivo biodistribution of (203)Pb in mice by SPECT/CT. This highlights application possibilities of (203)Pb for further in vivo and clinical uses (radiolabeled (212)Pb-peptide co-injection, dosimetry calculation). PMID:27156049

  13. A 140 GHz pulsed EPR/212 MHz NMR spectrometer for DNP studies

    Science.gov (United States)

    Smith, Albert A.; Corzilius, Björn; Bryant, Jeffrey A.; DeRocher, Ronald; Woskov, Paul P.; Temkin, Richard J.; Griffin, Robert G.

    2012-10-01

    We described a versatile spectrometer designed for the study of dynamic nuclear polarization (DNP) at low temperatures and high fields. The instrument functions both as an NMR spectrometer operating at 212 MHz (1H frequency) with DNP capabilities, and as a pulsed-EPR operating at 140 GHz. A coiled TE011 resonator acts as both an NMR coil and microwave resonator, and a double balanced (1H, 13C) radio frequency circuit greatly stabilizes the NMR performance. A new 140 GHz microwave bridge has also been developed, which utilizes a four-phase network and ELDOR channel at 8.75 GHz, that is then multiplied and mixed to obtain 140 GHz microwave pulses with an output power of 120 mW. Nutation frequencies obtained are as follows: 6 MHz on S = 1/2 electron spins, 100 kHz on 1H, and 50 kHz on 13C. We demonstrate basic EPR, ELDOR, ENDOR, and DNP experiments here. Our solid effect DNP results demonstrate an enhancement of 144 and sensitivity gain of 310 using OX063 trityl at 80 K and an enhancement of 157 and maximum sensitivity gain of 234 using Gd-DOTA at 20 K, which is significantly better performance than previously reported at high fields (⩾3 T).

  14. Production and optimization of curdlan produced by Pseudomonas sp. QL212.

    Science.gov (United States)

    Yang, Min; Zhu, Ying; Li, Yumei; Bao, Jie; Fan, Xiangyu; Qu, Yanhong; Wang, Yiwei; Hu, Zhiheng; Li, Qiang

    2016-08-01

    Curdlan is a polysaccharide that consists of β-1,3-linked glucose residues. A polysaccharide-producing bacterium isolated from soil samples was identified as Pseudomonas sp. QL212. The polysaccharide was purified to homogeneity via sequential ethanol precipitation, deproteinization, CM ion-exchange, and gel chromatography sequentially. Analysis of the purified polysaccharide revealed that it consisted of many glucosyl residues, and its molecular weight was only 6.18×10(5)Da. This low molecular weight endowed it with excellent solubility. Infrared and nuclear magnetic resonance spectral analysis confirmed that the polysaccharide was curdlan. Single-factor and Response surface methodology experiments were used to optimize the culture medium and conditions. The optimal culture conditions consisted of seed culture age of 12h, and an incubation temperature of 30°C, with 10% inoculum and a total fluid volume of 75mL in a 250-mL Erlenmeyer flask. The maximum curdlan yield of about 5.92gL(-1) was achieved with an optimal medium consisting of 30.11gL(-1) of sucrose, 5.94gL(-1) of yeast extract, and an initial pH of 8.03. To our best knowledge, this is the highest reported yield of curdlan produced by Pseudomonas sp., and the curdlan production medium components were much simpler than those in previous reports. PMID:27086290

  15. Fractal structure in the scalar λ(φ2-1)2 theory

    International Nuclear Information System (INIS)

    Head-on collisions of kink and antikink solitons are investigated numerically in the classical one-dimensional λ(φ2-1)2 model. It is shown that whether a kink-antikink interaction settles to a bound state or a two-soliton solution depends ''fractally'' on the impact velocity. We discuss the results using the framework of perturbation theory which helps to clarify the nature of the fractal structure in terms of resonances with the internal shape mode oscillations. We also review the technique of collective coordinates used to reduce the infinite-dimensional system to one with just two degrees of freedom. Although we do not expect exact agreement by using such a simplification, we show that the reduced system bears a striking qualitative resemblance to the full infinite-dimensional system, reproducing the fractal structure. The maximum Lyapunov exponents are computed for the bound-state oscillations and found to be ∼0.3 for both the full and reduced systems, demonstrating the chaotic nature of the bound state

  16. Jet Motion, Internal Working Surfaces, and Nested Shells in the Protostellar System HH 212

    CERN Document Server

    Lee, Chin-Fei; Zhang, Qizhou; Shang, Hsien; Ho, Paul T P; Mizuno, Yosuke

    2015-01-01

    HH 212 is a nearby (400 pc) highly collimated protostellar jet powered by a Class 0 source in Orion. We have mapped the inner 80" (~ 0.16 pc) of the jet in SiO (J=8-7) and CO (J=3-2) simultaneously at ~ 0.5 resolution with the Atacama Millimeter/Submillimeter Array at unprecedented sensitivity. The jet consists of a chain of knots, bow shocks, and sinuous structures in between. As compared to that seen in our previous observations with the Submillimeter Array, it appears to be more continuous, especially in the northern part. Some of the knots are now seen associated with small bow shocks, with their bow wings curving back to the jet axis, as seen in pulsed jet simulations. Two of them are reasonably resolved, showing kinematics consistent with sideways ejection, possibly tracing the internal working surfaces formed by a temporal variation in the jet velocity. In addition, nested shells are seen in CO around the jet axis connecting to the knots and bow shocks, driven by them. The proper motion of the jet is e...

  17. Study on the performance of Nafion 212 membrane in polymeric electrolyte fuel cells operating with air; Estudo do desempenho da membrana de Nafion 212 em celulas a combustivel de eletrolito polimerico operando com ar

    Energy Technology Data Exchange (ETDEWEB)

    Fernandes, Adriano C.; Ticianelli, Edson Antonio [Universidade de Sao Paulo (USP), Sao Carlos, SP (Brazil). Inst. de Quimica]. E-mail: edsont@iqsc.usp.br

    2008-07-01

    The operational characteristics of the Nafion 212 membrane (N212) were investigated and compared to the Nafion 112 membrane (N112), both 50 thick, in polymer electrolyte fuel cell (PEFC). The polarization measurements were performed changing the cell and gases humidification temperature and the gases pressure. The kinetic parameters obtained from the polarization curve proved that the cell with membrane N212 showed better performance than membrane N112, when they operating with air at cathode. The electrochemical impedance studies were carried out to make clear the polarization phenomena due to the resistive and diffusive effects that limit the cell performance. At high frequency region is found an arc, which dimension in depends on the current density, whereas at the mid frequency region we can find two loops with different characteristics and both dependent of current density. This behavior becomes evident that there are polarization components linked to resistive processes at high frequency, as well as charge transference and diffusional at mid and low frequency, respectively. (author)

  18. Astatination of closo-dodecaborate(2-) anion

    Czech Academy of Sciences Publication Activity Database

    Orlova, A.; Lebeda, Ondřej; Tolmachev, V.; Lundquist, H.; Carlsson, J.; Sjöberg, S.

    Cambridge : The Royal Society of Chemistry , 2000 - (Davidson, M.; Hughes, A.; Marder, T.; Wade , K.), s. 144-147 [Conference "Contemporary Boron Chemistry ". Durham (GB), 11.07.1999-15.07.1999] Institutional research plan: CEZ:AV0Z1048901 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  19. Quantum yield of Cl∗ (21/2) production in the gas phase photolysis of CCl4 in the ultraviolet

    Indian Academy of Sciences (India)

    Manish Tak; Manabendra Chandra; Dulal Senapati; Puspendu K Das

    2006-07-01

    In this paper, we have probed the dynamics of chlorine atom production from the gas phase photodissociation of carbon tetrachloride at 222 and 235 nm. The quantum yield, * of Cl∗ (21/2) production has been determined by probing the nascent concentrations of both excited (21/2) and ground state (23/2) chlorine atoms by suitable resonance-enhanced multiphoton ionization (REMPI) detection schemes. Although at the photolysis wavelengths the absorption of carbon tetrachloride is weak, significant amounts of Cl∗ are produced. Surprisingly, the quantum yield of Cl∗ production does not follow the absorption spectrum closely, which gives rise to the possibility of an indirect dissociation mechanism present in CCl4 along with direct dissociation at these ultraviolet wavelengths.

  20. Drug Survival and reasons for discontinuation of intramuscular methotrexate: a study of 212 consecutive patients switching from oral methotrexate

    DEFF Research Database (Denmark)

    Linde, Louise; Hetland, Merete Lund; Østergaard, Mikkel

    2006-01-01

    Drug survival and reasons for discontinuation of intramuscular methotrexate: a study of 212 consecutive patients switching from oral methotrexate.Linde L, Hetland ML, Ostergaard M. Department of Rheumatology, Copenhagen University Hospital, Hvidovre Hospital, Hvidovre, Denmark. louiselinde......@dadlnet.dk OBJECTIVES: To assess the drug survival and reasons for discontinuation of intramuscular methotrexate (imMTX) in rheumatological patients who had switched to imMTX from oral methotrexate (oMTX). METHODS: Data from 212 consecutive patients who switched from oMTX to imMTX therapy at our outpatient clinic...... had stopped oMTX because of adverse events, 22% also withdrew from imMTX because of adverse events. CONCLUSION: Half of the patients benefited from switching from oral to intramuscular methotrexate for at least 6 months, but only a minority adhered to the treatment for years. Lack of efficacy was the...

  1. Nuclear g-factor measurements of the (9/2)- and (21/2)- isomeric states in 173Ta

    International Nuclear Information System (INIS)

    The nuclear g-factors of the one-quasiparticle isomeric state (9/2)- at 165.8 keV and the three-quasiparticle isomeric state (21/2)- at 1713.2 keV in 173Ta nuclei have been measured using the time differential perturbed angular distribution technique. The nuclear reaction 165Ho(12C, 4nγ)173Ta was used to populate these isomeric states, and the recoiling 173Ta nuclei were implanted into a thick tantalum backing in the presence of a 7.04(4) kG external magnetic field. The measured value g((9/2)-) = +0.591(18) shows that the (9/2)- isomeric state is not a pure single-particle state but may have a collective contribution due to the octupole excitation of the core. Based on the measured value g((21/2)-) = + 0.620(15) and multi-quasiparticle calculations, the (21/2)- isomeric state is assigned a mixed configuration: π3((9/2)-[514], (7/2)+[404] (5/2)+[402]) (39%) and π1((7/2)+[404])(multiply-in-circle sign) ν2((7/2)-[514], (7/2)+[633]) (61%)

  2. Oxygen Sensing via the Ethylene Response Transcription Factor RAP2.12 Affects Plant Metabolism and Performance under Both Normoxia and Hypoxia.

    Science.gov (United States)

    Paul, Melanie Verena; Iyer, Srignanakshi; Amerhauser, Carmen; Lehmann, Martin; van Dongen, Joost T; Geigenberger, Peter

    2016-09-01

    Subgroup-VII-ethylene-response-factor (ERF-VII) transcription factors are involved in the regulation of hypoxic gene expression and regulated by proteasome-mediated proteolysis via the oxygen-dependent branch of the N-end-rule pathway. While research into ERF-VII mainly focused on their role to regulate anoxic gene expression, little is known on the impact of this oxygen-sensing system in regulating plant metabolism and growth. By comparing Arabidopsis (Arabidopsis thaliana) plants overexpressing N-end-rule-sensitive and insensitive forms of the ERF-VII-factor RAP2.12, we provide evidence that oxygen-dependent RAP2.12 stability regulates central metabolic processes to sustain growth, development, and anoxic resistance of plants. (1) Under normoxia, overexpression of N-end-rule-insensitive Δ13RAP2.12 led to increased activities of fermentative enzymes and increased accumulation of fermentation products, which were accompanied by decreased adenylate energy states and starch levels, and impaired plant growth and development, indicating a role of oxygen-regulated RAP2.12 degradation to prevent aerobic fermentation. (2) In Δ13RAP2.12-overexpressing plants, decreased carbohydrate reserves also led to a decrease in anoxic resistance, which was prevented by external Suc supply. (3) Overexpression of Δ13RAP2.12 led to decreased respiration rates, changes in the levels of tricarboxylic acid cycle intermediates, and accumulation of a large number of amino acids, including Ala and γ-amino butyric acid, indicating a role of oxygen-regulated RAP2.12 abundance in controlling the flux-modus of the tricarboxylic acid cycle. (4) The increase in amino acids was accompanied by increased levels of immune-regulatory metabolites. These results show that oxygen-sensing, mediating RAP2.12 degradation is indispensable to optimize metabolic performance, plant growth, and development under both normoxic and hypoxic conditions. PMID:27372243

  3. Experimental study of neonlike zinc J=0-1 soft X-ray lasing at 21.2 nm

    Science.gov (United States)

    Rus, B.; Carillon, A.; Dhez, P.; Gauthé, B.; Goedtkindt, P.; Jaeglé, P.; Jamelot, G.; Klisnick, A.; Nantel, M.; Sureau, A.; Zeitoun, P.

    1995-05-01

    Since our first observation of intense J=0-1 lasing in neonlike zinc in early 1993, we have investigated various issues of this X-ray laser. The results of these experiments, performed at Laboratoire pour l'Utilisation des Lasers Intenses (LULI), are briefly reviewed. Gain coefficients of ˜5 cm-1 at 21.2 nm are now routinely obtained with ≊350 J delivered onto a Zn slab in ˜650 ps pulses—the net irradiance is ˜1.4×1013 W cm-2. The 21.2 nm emission appears in a ≊100 ps burst and precedes the lasing on the J=2-1 transitions at 26.2 and 26.7 nm which have a duration ≊350 ps. We have directly measured the gain regions of the J=0-1 line at 21.2 nm and the J=2-1 line at 26.7 nm and confirmed the initial claim that they are located at different distances from the target. We have also measured the refraction angles and divergences of the XRL beams of these two transitions. The beam at 21.2 nm was observed to be remarkably narrow with a divergence of ˜2.6 mrad, peaking ˜7 mrad off-axis. This contrasts to the beam at 26.7 nm which has a divergence of ≊10 mrad and peaks at ˜15 mrad. The most recent finding is that the J=0-1 lasing exists only when the main pump pulse is preceded by a pulse train of mJ level, which is a remnant from the laser oscillator. An important achievement in developing the XRL at 21.2 nm was the demonstration of half-cavity operation: with a gain-length product of ˜16.5, the emission exhibits saturation behavior. The absolute energy measurements indicate ˜400 μJ in the near-saturated beam.

  4. The new version 2.12 of BKG Ntrip Client (BNC)

    Science.gov (United States)

    Stürze, Andrea; Mervart, Leos; Weber, Georg; Rülke, Axel; Wiesensarter, Erwin; Neumaier, Peter

    2016-04-01

    A new version of the BKG Ntrip Client (BNC) has been released. Originally developed in cooperation of the Federal Agency for Cartography and Geodesy (BKG) and the Czech Technical University (CTU) with a focus on multi-stream real-time access to GPS observations, the software has once again been substantially extended. Promoting Open Standards as recommended by the Radio Technical Commission for Maritime Services (RTCM) remains the prime subject. Beside its Graphical User Interface (GUI), the real-time software for Windows, Linux, Mac, and Linux platforms now comes with complete Command Line Interface (CLI) and considerable post processing functionality. RINEX Version 3 file editing & Quality Check (QC) with full support of Galileo, BeiDou, and SBAS - besides GPS and GLONASS - is part of the new features. Comparison of satellite orbit/clock files in SP3 format is another fresh ability of BNC. Simultaneous multi-station Precise Point Positioning (PPP) for real-time displacement-monitoring of entire reference station networks is one more recent addition to BNC. Implemented RTCM messages for PPP (under development) comprise satellite orbit and clock corrections, code and phase observation biases, and the Vertical Total Electron Content (VTEC) of the ionosphere. The well established, mature codebase is mostly written in C++ language. Its publication under GNU GPL is thought to be well-suited for test, validation and demonstration of new approaches in precise real-time satellite navigation when IP streaming is involved. The poster highlights BNC features which are new in version 2.12 and beneficial to IAG institutions and services such as IGS/RT-IGS and to the interested public in general.

  5. A new nonsyndromic X-linked sensorineural hearing impairment linked to Xp21.2

    Energy Technology Data Exchange (ETDEWEB)

    Lalwani, A.K.; Brister, J.R.; Fex, J.; Grundfast, K.M.; Pikus, A.T.; Ploplis, B.; San Agustin, T.; Skarka, H.; Wilcox, E.R. [National Institutes of Health, Bethesda, MD (United States)

    1994-10-01

    X-linked deafness is a rare cause of hereditary hearing impairment. We have identified a family with X-linked dominant sensorineural hearing impairment, characterized by incomplete penetrance and variable expressivity in carrier females, that is linked to the Xp21.2, which contains the Duchenne muscular dystrophy (DMD) locus. The auditory impairment in affected males was congenital, bilateral, profound, sensorineural, affecting all frequencies, and without evidence of radiographic abnormality of the temporal bone. Adult carrier females manifested bilateral, mild-to-moderate high-frequency sensorineural hearing impairment of delayed onset during adulthood. Eighteen commercially available polymorphic markers from the X chromosome, generating a 10-15-cM map, were initially used for identification of a candidate region. DXS997, located within the DMD gene, generated a two-point LOD score of 2.91 at {theta} = 0, with every carrier mother heterozygous at this locus. Recombination events at DXS992 (located within the DMD locus, 3{prime} to exon 50 of the dystrophin gene) and at DXS1068 (5{prime} to the brain promoter of the dystrophin gene) were observed. No recombination events were noted with the following markers within the DMD locus: 5{prime}DYS II, intron 44, DXS997, and intron 50. There was no clinical evidence of Duchenne or Becker muscular dystrophy in any family member. It is likely that this family represents a new locus on the X chromosome, which when mutated results in nonsyndromic sensorineural hearing loss and is distinct from the heterogeneous group of X-linked hearing losses that have been previously described. 57 refs., 6 figs., 1 tab.

  6. FTIR Studies of Internal Water Molecules of Bacteriorhodopsin: Structural Analysis of Halide-bound D85S and D212N Mutants in the Schiff Base Region

    Science.gov (United States)

    Shibata, Mikihiro; Kandori, Hideki

    2007-12-01

    Bacteriorhodopsin (BR), a membrane protein found in Halobacterium salinarum, functions as a light-driven proton pump. The Schiff base region has a quadropolar structure with positive charges located at the protonated Schiff base and Arg82, and counterbalancing negative charges located at Asp85 and Asp212 (Figure 1A). It is known that BR lacks a proton-pumping activity if Asp85 or Asp212 is neutralized by mutation. On the other hand, binding of C1- brings different effects for pumping functions in mutants at D85 and D212 position. While C1--bound D85T and D85S pump C1-, photovoltage measurements suggested that C1--bound D212N pumps protons at low pH. In this study, we measured low-temperature FTIR spectra of D85S and D212N containing various halides to compare the halide binding site of both proteins. In the case of D85S, the N-D stretching vibrations of the Schiff base were halide-dependent. This result suggests that the halide is a hydrogen-bond acceptor of the Schiff base, being consistent with the X-ray crystal structure. On the other hand, no halide dependence was observed for vibrational bands of the retinal skeleton and the Schiff base in the D212N mutant. This result suggests that the halide does not form a hydrogen bond with the Schiff base directly, unlike the mutation at D85 position. Halide-dependent water bands in the Schiff base region also differ between D85S and D212N. From these results, halide binding site of both proteins and role of two negative charges in BR will be discussed.

  7. Temperature dependence of gamma ray induced luminescence of ethanolamine based liquid scintillator between 212 and 273 K

    International Nuclear Information System (INIS)

    The luminescence response of ethanolamine based liquid scintillator (Ethanolamine + 1g/l Butyle PBD + 0.1g/l BBOT) has been investigated as a function of temperature in the range 212-273 K. It has been observed that under gamma excitation the scintillation efficiency increases by a factor of 1.37 with decrease in temperature. The data obtained conforms to Arrhenius relation in which activation energy of rate process (.20 ev) is typical for thermal activated diffusion controlled process. (author)

  8. Density-functional study of structural and electronic properties of AlnN(n=2-12) clusters

    International Nuclear Information System (INIS)

    The lowest energy structures and electronic properties of AlnN(n=2-12) clusters were studied using density-functional theory. The equilibrium geometries of AlnN clusters with up to n=12 were determined from a number of possible structural isomers at each size. The Al7N cluster was found be particularly stable with higher binding energy and larger electronic gap. For all the AlnN clusters studied, we found charge transfers from the Al to N site and co-existence of ionic and covalent bonding characteristics

  9. Ground- state structure and stabilities of Mon (n=2-12) clusters%Mon(n=2-12)团簇的基态结构及其稳定性

    Institute of Scientific and Technical Information of China (English)

    张红美; 孔德国; 王玉梅

    2012-01-01

    从第一性原理出发,对Mon(n=2-12)团簇的最低能量结构和电子性质进行了研究.计算结果表明,Mon的最低能量结构可以看成是在Mon-1的基础上戴帽一个Mo原予生长而成.综合团簇的平均结合能和能隙可知,n=3,6,8,10时团簇的基态稳定性较高.%The geometric configuration and electronic structure of Mo. (n = 2- 12) clusters have been studied by using density functional theory. The results indicated that the lowest energy structure of Mon cluster may be seen as the Mon-1 elustercapping one Mo atom. The calculated results on the averaged binding energy and the HOMO - LUMO gap of the Mon (n=2-12) clusters indicate that the relative stabilities of Mo3 ,Mo6 ,Mo8 and Mo10are stronger than clusters of other sizes.

  10. Determination of 55Mn(n,γ) reaction cross-section at the neutron energies of 1.12 and 2.12 MeV

    International Nuclear Information System (INIS)

    In the present work, we determine the 55Mn(n,γ)56Mn reaction cross-section at the neutron energies of 1.12 and 2.12 MeV by using the off-line γ-ray spectrometric technique. The (n,γ) reaction cross-section 55Mn as a function of neutron energy was also calculated using nuclear reaction modular code TALYS-1.6 and compared with the present experimental data at 1.12 and 2.12 MeV as well as the literature data at other neutron energies

  11. Evaluation of the MICAST #2-12 AI-7wt%Si Sample Directionally Solidified Aboard the International Space Station

    Science.gov (United States)

    Tewari, Surendra N.; Ghods, Masoud; Angart, Samuel G.; Lauer, Mark; Grugel, Richard N.; Poirier, David R.

    2016-01-01

    The US team of the European led "MIcrostructure Formation in CASTing of Technical Alloys under Diffusive and Magnetically Controlled Convective Conditions" (MICAST) program recently received a third Aluminum - 7wt% silicon alloy that was processed in the microgravity environment aboard the International Space Station. The sample, designated MICAST#2-12, was directionally solidified in the Solidification with Quench Furnace (SQF) at a constant rate of 40micometers/s through an imposed temperature gradient of 31K/cm. Procedures taken to evaluate the state of the sample prior to sectioning for metallographic analysis are reviewed and rational for measuring the microstructural constituents, in particular the primary dendrite arm spacing (Lambda (sub1)), is given. The data are presented, put in context with the earlier samples, and evaluated in view of a relevant theoretical model.

  12. Measurement of the Electric Quadrupole Moment of the 9/2- and 21/2- Isomers in 173Ta

    International Nuclear Information System (INIS)

    The electric quadrupole moments of the 9/2- and 21/2- isomeric states of 173Ta at 165.8 keV and 1713.2 keV, respectively, were measured as Q(9/2-)=2.92(15) b and Q(21/2-)=6.23(18) b for the first time using the TDPAD technique. A 66 MeV pulsed 12C ion beam from the 15UD pelletron accelerator facility of the Nuclear Science Centre at New Delhi was used in the reaction 165Ho(12C, 4nγ)173Ta. The experimental values of equilibrium deformations β2(9/2-)=0.251(7) and β2(21/2-)=0.391(7) were extracted

  13. 21 CFR 212.71 - What actions must I take if a batch of PET drug product does not conform to specifications?

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false What actions must I take if a batch of PET drug... Acceptance § 212.71 What actions must I take if a batch of PET drug product does not conform to specifications? (a) Rejection of nonconforming product. You must reject a batch of a PET drug product that...

  14. 8 CFR 1003.44 - Special motion to seek section 212(c) relief for aliens who pleaded guilty or nolo contendere to...

    Science.gov (United States)

    2010-01-01

    ... basis of a crime that is an aggravated felony, except as provided in 8 CFR 1212.3(f)(4). (d) Effect of... or removal, and who are eligible to apply for relief under former section 212(c) of the Act and 8 CFR... adjudicated under the standards of this section and 8 CFR 1212.3. This section is not applicable with...

  15. Polymorphisms in a Putative Enhancer at the 10q21.2 Breast Cancer Risk Locus Regulate NRBF2 Expression

    DEFF Research Database (Denmark)

    Darabi, Hatef; McCue, Karen; Beesley, Jonathan;

    2015-01-01

    Genome-wide association studies have identified SNPs near ZNF365 at 10q21.2 that are associated with both breast cancer risk and mammographic density. To identify the most likely causal SNPs, we fine mapped the association signal by genotyping 428 SNPs across the region in 89,050 European and 12,...

  16. 42 CFR 436.212 - Individuals who would be eligible for cash assistance if the State plan for OAA, AFDC, AB, APTD...

    Science.gov (United States)

    2010-10-01

    ... may provide Medicaid to individuals who would meet the Federal definition of disability, 45 CFR 233.80... assistance if the State plan for OAA, AFDC, AB, APTD, or AABD were as broad as allowed under the Act. 436.212... cash assistance if the State plan for OAA, AFDC, AB, APTD, or AABD were as broad as allowed under...

  17. Observation of atmospheric 210Pb and 212Pb originating from the 2004 eruptive activity of Asama volcano, Japan, and relevant 222Rn releasing from the erupting magma

    International Nuclear Information System (INIS)

    This paper describes a study of observation of atmospheric 210Pb and 212Pb possibly from the volcano (36 deg N, 138 deg E) activity in the title and of measurement of 222Rn releasing efficiency with the ash-fall deposit collected around the period. The aerosol sample was collected from Sep. 1, an eruption day, on a building terrace (10 m high) of Meiji University at Kawasaki, located at 140 km SE of the volcano, every 24 hr on the glass fiber filter using a high volume air sampler. The filter was cut out to 4 disks, which were packed into acrylic canisters with a window of a thin Mylar film for non-destructive γ-ray measurement. 210Pb and 212Pb radioactivities were determined by the 46.5- and 238.6-keV γ-rays with an LEPS (low energy photon spectrometer) and an HPGe spectrometer, respectively. The ash-fall sample from the eruption Sep. 14, was collected at Kanrakumachi, Gunma Pref., 40 km SE of the volcano, and measurement for the growth curve of 222Rn from the fall started 1 week after the eruption. A well-type HPGe spectrometer was used for determination of the 351.9-keV γ-ray of 222Rn from 214Pb in equilibrium, which was normalized by the 911.1-keV 228Ac γ-ray. 210Pb and 212Pb emitted into the atmosphere were suggested to have been transported 140 km within the time of a few times of the 212Pb half life (10.6 hr) on the northerly wind. 210Pb and 212Pb, and 222Rn were suggested to be a possibly useful tool of monitoring magmatic activities. (S.I.)

  18. Estimation of the Arctic aerosols from local and long-range transport using relationships between 210Pb and 212Pb atmospheric activity concentrations

    International Nuclear Information System (INIS)

    In this study, the aerosol activity concentrations of 210Pb at 28 Canadian radiological monitoring stations from 2009 to 2013 were analyzed. The results show that the ratio of 210Pb winter average concentration to summer average concentration increases with increasing latitude. This could be used to evaluate the transport of pollutants to the Arctic region such as the Arctic haze from Eurasia through long-range atmospheric transport during winter. Based on 12 years of monitoring results from the Yellowknife station that includes both 210Pb and 212Pb concentrations, the study confirms that the seasonal distribution of 210Pb to 212Pb activity concentration ratios has a significant peak in winter and a relatively low value in summer, which can be used as an indicator of the air mass flow to the Arctic. The period dominated by long-range aerosol transport and Arctic haze was estimated by fitting a Gaussian distribution function to the peak values of this ratio in winter. A peak width parameter of full width at half maximum (FWHM) allows a year by year estimate of the period of influence by long-range transport of aerosols, and this varied between 67 and 88 days in this study. The fitted Gaussian peak also shows that the season of the continental influenced air mass in Yellowknife usually starts in mid-to-late November and ends in mid-to-late April. Thus, the 210Pb to 212Pb ratio distributions may enable the determination of periods dominated by long-range aerosol transport and the scale of the Arctic haze at different latitudes. - Highlights: • Twelve years 210Pb/212Pb monitoring results from low to high altitude are presented. • The 210Pbwinter/210Pbsummer ratio increases clearly with latitude of monitoring site. • The pollutant transport to the Arctic is estimated by distribution 210Pb/212Pb ratio. • The time scale of long-range transport aerosol bearing 210Pb to Arctic is reported

  19. Involvement of PPAR receptors in the anticonvulsant effects of a cannabinoid agonist, WIN 55,212-2.

    Science.gov (United States)

    Payandemehr, Borna; Ebrahimi, Ali; Gholizadeh, Ramtin; Rahimian, Reza; Varastehmoradi, Bardia; Gooshe, Maziar; Aghaei, Hossein Nayeb; Mousavizadeh, Kazem; Dehpour, Ahmad Reza

    2015-03-01

    Cannabinoid and PPAR receptors show well established interactions in a set of physiological effects. Regarding the seizure-modulating properties of both classes of receptors, the present study aimed to evaluate the roles of the PPAR-gamma, PPAR-alpha and CB1 receptors on the anticonvulsant effects of WIN 55,212-2 (WIN, a non selective cannabinoid agonist). The clonic seizure thresholds after intravenous administration of pentylenetetrazole (PTZ) were assessed in mice weighing 23-30 g. WIN increased the seizure threshold dose dependently. Pretreatment with pioglitazone, as a PPARγ agonist, potentiated the anticonvulsant effects of WIN, while PPARγ antagonist inhibited these anticonvulsant effects partially. On the other hand PPARα antagonist reduced the anticonvulsant effects of WIN significantly. Finally the combination of CB1 antagonist and PPARα antagonist could completely block the anticonvulsant properties of WIN. Taken together, these results show for the first time that a functional interaction exists between cannabinoid and PPAR receptors in the modulation of seizure susceptibility. PMID:25448777

  20. Discovery of Very High Energy gamma-rays from 1ES1011+496 at z=0.212

    CERN Document Server

    Albert, J; Anderhub, H; Antoranz, P; Armada, A; Baixeras, C; Barrio, J A; Bartko, H; Bastieri, D; Becker, J K; Bednarek, W; Berger, K; Bigongiari, C; Biland, A; Böck, R K; Bordas, P; Bosch-Ramon, V; Bretz, T; Britvitch, I; Camara, M; Carmona, E; Chilingarian, A; Coarasa, J A; Commichau, S; Contreras, J L; Cortina, J; Costado, M T; Curtef, V; Danielyan, V; Dazzi, F; De Angelis, A; Delgado, C; De los Reyes, R; De Lotto, B; Domingo-Santamaria, E; Dorner, D; Doro, M; Errando, M; Fagiolini, M; Ferenc, D; Fernández, E; Firpo, R; Flix, J; Fonseca, M V; Font, L; Fuchs, M; Galante, N; Garcia-Lopez, R J; Garczarczyk, M; Gaug, M; Giller, M; Göbel, F; Hakobyan, D; Hayashida, M; Hengstebeck, T; Herrero, A; Höhne, D; Hose, J; Hsu, C C; Jacon, P; Jogler, T; Kosyra, R; Kranich, D; Kritzer, R; Laille, A; Lindfors, E; Lombardi, S; Longo, F; López, J; López, M; Lorenz, E; Majumdar, P; Maneva, G; Mannheim, K; Mansutti, O; Mariotti, M; Mart, M; Mazin, D; Merck, C; Meucci, M; Meyer, M; Miranda, J M; Mirzoyan, R; Mizobuchi, S; Moralejo, A; Nieto, D; Nilsson, K; Ninkovic, J; Ona-Wilhelmi, E; Otte, N; Oya, I; Paneque, D; Panniello, M; Paoletti, R; Paredes, J M; Pasanen, M; Pascoli, D; Pauss, F; Pegna, R; Perlman, E; Persic, M; Peruzzo, L; Piccioli, A; Prandini, E; Puchades, N; Raymers, A; Rhode, W; Rib, M; Rico, J; Rissi, M; Robert, A; Rugamer, S; Saggion, A; Saitô, T; Sánchez, A; Sartori, P; Scalzotto, V; Scapin, V; Schmitt, R; Schweizer, T; Shayduk, M; Shinozaki, K; Shore, S N; Sidro, N; Sillanpa, A; Sobczynska, D; Stamerra, A; Stark, L S; Takalo, L; Tavecchio, F; Temnikov, P; Tescaro, D; Teshima, M; Torres, D F; Turini, N; Vankov, H; Vitale, V; Wagner, R M; Wibig, T; Wittek, W; Zandanel, F; Zanin, R; Zapatero, J

    2007-01-01

    We report on the discovery of Very High Energy (VHE) gamma-ray emission from the BL Lacertae object 1ES1011+496. The observation was triggered by an optical outburst in March 2007 and the source was observed with the MAGIC telescope from March to May 2007. Observing for 18.7 hours we find an excess of 6.2 sigma with an integrated flux above 200GeV of (1.58$\\pm0.32)\\cdot 10^{-11}$ photons cm$^{-2}$ s$^{-1}$. The VHE gamma-ray flux is >40% higher than in March-April 2006 (reported elsewhere), indicating that the VHE emission state may be related to the optical emission state. We have also determined the redshift of 1ES1011+496 based on an optical spectrum that reveals the absorption lines of the host galaxy. The redshift of z=0.212 makes 1ES1011+496 the most distant source observed to emit VHE gamma-rays up to date.

  1. Measurement of {sup 214} Pb, {sup 212} Pb {sup 210} Pb and {sup 7} Be activities in sizes fractionated aerosols in the lower atmosphere at Sacavem (Lisbon)

    Energy Technology Data Exchange (ETDEWEB)

    Reis, Mario J.; Brogueira, Alfredo L.; Bettencourt, Antonio O. [Instituto Tecnologico e Nuclear, Sacavem (Portugal). Dept. de Protecao Radiologica e Seguranca Nuclear; Rosa, Rui N. [Universidade de Evora (Portugal). Dept. de Fisica

    2001-07-01

    Aerodynamic size distribution measurements of {sup 214} Pb, {sup 212} Pb {sup 210} Pb and {sup 7} Be were carried out using a five-stage high-volume cascade impactor with effective cut-off diameters of 0.49, 0.95, 1.5, 3.0, and 7.2 {mu}m. The activity of the samples was measured by {gamma}-ray spectrometry using both coaxial and ultra-low background well-type HPGe detectors. The activity size distribution measurements indicate that all radionuclides were associated with submicron aerosol in the accumulation mode, being {sup 210} Pb and {sup 7} Be attached to slightly larger particles, when compared to short-lived radon and thoron daughters. The mass size distributions show a significant contribution from aerosol particles larger than 7.2 {mu}m to the total mass concentration, which indicates the occurrence of resuspension processes. However, since that in most of the samples no {sup 210} Pb and short-lived {sup 214} Pb and {sup 212} Pb were found in association with larger particles, it seems that those nuclides were mostly originated by the decay of atmospheric radon (or thoron in the case of {sup 212} Pb) instead of soil resuspension. On average it was observed that about 80% of the {sup 214} Pb and {sup 212} Pb activity was associated with aerosol particles with aerodynamic diameters smaller than 0.49 {mu}m and about 90% with particles smaller than 0.95 {mu}m. (author)

  2. The cannabinoid agonist WIN55,212-2 increases intracellular calcium via CB1 receptor coupling to Gq/11 G proteins

    OpenAIRE

    Lauckner, Jane E.; Hille, Bertil; Mackie, Ken

    2005-01-01

    Central nervous system responses to cannabis are primarily mediated by CB1 receptors, which couple preferentially to Gi/o G proteins. Here, we used calcium photometry to monitor the effect of CB1 activation on intracellular calcium concentration. Perfusion with 5 μM CB1 aminoalkylindole agonist, WIN55,212-2 (WIN), increased intracellular calcium by several hundred nanomolar in human embryonic kidney 293 cells stably expressing CB1 and in cultured hippocampal neurons. The increase was blocked ...

  3. Preclinical evaluation of NETA-based bifunctional ligand for radioimmunotherapy applications using 212Bi and 213Bi: Radiolabeling, serum stability, and biodistribution and tumor uptake studies

    International Nuclear Information System (INIS)

    Introduction: Despite the great potential of targeted α-radioimmunotherapy (RIT) as demonstrated by pre-clinical and clinical trials, limited progress has been made on the improvement of chelation chemistry for 212Bi and 213Bi. A new bifunctional ligand 3p-C-NETA was evaluated for targeted α RIT using 212Bi and 213Bi. Methods: Radiolabeling of 3p-C-NETA with 205/6Bi, a surrogate of 212Bi and 213Bi, was evaluated at pH 5.5 and room temperature. In vitro stability of the 205/6Bi-3p-C-NETA-trastuzumab conjugate was evaluated using human serum (pH 7, 37 °C). Immunoreactivity and specific activity of the 205/6Bi-3p-C-NETA-trastuzumab conjugate were measured. An in vivo biodistribution study was performed to evaluate the in vivo stability and tumor targeting properties of the 205/6Bi-3p-C-NETA-trastuzumab conjugate in athymic mice bearing subcutaneous LS174T tumor xenografts. Result: The 3p-C-NETA-trastuzumab conjugate was extremely rapid in complexing with 205/6Bi, and the corresponding 205/6Bi-3p-C-NETA-trastuzumab was stable in human serum. 205/6Bi-3p-C-NETA-trastuzumab was prepared with a high specific activity and retained immunoreactivity. 205/6Bi-3p-C-NETA-trastuzumab conjugate displayed excellent in vivo stability and targeting as evidenced by low normal organ and high tumor uptake. Conclusion: The results of the in vitro and in vivo studies indicate that 3p-C-NETA is a promising chelator for RIT applications using 212Bi and 213Bi. Further detailed in vivo evaluations of 3p-C-NETA for targeted α RIT are warranted

  4. FDG PET/CT imaging in primary osseous and soft tissue sarcomas: a retrospective review of 212 cases

    Energy Technology Data Exchange (ETDEWEB)

    Charest, Mathieu [Lakeshore General Hospital, Service of Nuclear Medicine, Pointe-Claire (Canada); Hickeson, Marc; Lisbona, Robert; Novales-Diaz, Javier A.; Derbekyan, Vilma [McGill University Health Center, Department of Nuclear Medicine, Montreal (Canada); Turcotte, Robert E. [McGill University Health Center, Department of Orthopedic Surgery, Montreal (Canada)

    2009-12-15

    The aims of this study are to evaluate the sensitivity of FDG PET/CT for detection of soft tissue and osseous sarcomas on the basis of FDG avidity. We retrospectively evaluated 212 consecutive patients with known soft tissue or osseous sarcoma who had undergone a FDG PET/CT study for the initial staging or assessment of recurrence of disease. The maximum standardized uptake value (SUV{sub max}) of each primary and/or most intense metastatic lesion was measured and compared with the histological data provided in the final pathological reports. An SUV{sub max} of 2.5 or greater was considered positive for our analysis. Sufficient histopathological data were available for 160 soft tissue sarcomas and 52 osseous sarcomas. FDG PET/CT detected 93.9% of all sarcomas with a sensitivity of 93.7% for soft tissue sarcomas and 94.6% for osseous sarcomas. The sensitivities of the most common sarcoma histologies were 100% for leiomyosarcomas, 94.7% for osteosarcomas, 100% for Ewing's sarcomas, 88.9% for liposarcomas, 80.0% for synovial sarcomas, 100% for gastrointestinal stromal tumors, 87.5% for malignant peripheral nerve sheath tumors, 100% for fibroblastic and myoblastic sarcomas, and 100% for malignant fibrohistiocytic tumors. The receiver-operating characteristic curve revealed an area under the curve of 94% for the discrimination of low-grade and high-grade sarcomas imaged for initial staging by FDG PET/CT. The combined metabolic and morphological information of FDG PET/CT imaging allows high sensitivity for the detection of various sarcomas and accurate discrimination between newly diagnosed low-grade and high-grade sarcomas. (orig.)

  5. FDG PET/CT imaging in primary osseous and soft tissue sarcomas: a retrospective review of 212 cases

    International Nuclear Information System (INIS)

    The aims of this study are to evaluate the sensitivity of FDG PET/CT for detection of soft tissue and osseous sarcomas on the basis of FDG avidity. We retrospectively evaluated 212 consecutive patients with known soft tissue or osseous sarcoma who had undergone a FDG PET/CT study for the initial staging or assessment of recurrence of disease. The maximum standardized uptake value (SUVmax) of each primary and/or most intense metastatic lesion was measured and compared with the histological data provided in the final pathological reports. An SUVmax of 2.5 or greater was considered positive for our analysis. Sufficient histopathological data were available for 160 soft tissue sarcomas and 52 osseous sarcomas. FDG PET/CT detected 93.9% of all sarcomas with a sensitivity of 93.7% for soft tissue sarcomas and 94.6% for osseous sarcomas. The sensitivities of the most common sarcoma histologies were 100% for leiomyosarcomas, 94.7% for osteosarcomas, 100% for Ewing's sarcomas, 88.9% for liposarcomas, 80.0% for synovial sarcomas, 100% for gastrointestinal stromal tumors, 87.5% for malignant peripheral nerve sheath tumors, 100% for fibroblastic and myoblastic sarcomas, and 100% for malignant fibrohistiocytic tumors. The receiver-operating characteristic curve revealed an area under the curve of 94% for the discrimination of low-grade and high-grade sarcomas imaged for initial staging by FDG PET/CT. The combined metabolic and morphological information of FDG PET/CT imaging allows high sensitivity for the detection of various sarcomas and accurate discrimination between newly diagnosed low-grade and high-grade sarcomas. (orig.)

  6. Selective lack of tolerance to delayed gastric emptying after daily administration of WIN 55,212-2 in the rat.

    Science.gov (United States)

    Abalo, R; Cabezos, P A; López-Miranda, V; Vera, G; González, C; Castillo, M; Fernández-Pujol, R; Martín, M I

    2009-09-01

    The use of cannabinoids to treat gastrointestinal (GI) motor disorders has considerable potential. However, it is not clear if tolerance to their actions develops peripherally, as it does centrally. The aim of this study was to examine the chronic effects of the cannabinoid agonist WIN 55,212-2 (WIN) on GI motility, as well as those in the central nervous and cardiovascular systems. WIN was administered for 14 days, at either non-psychoactive or psychoactive doses. Cardiovascular parameters were measured in anaesthetized rats, whereas central effects and alterations in GI motor function were assessed in conscious animals using the cannabinoid tetrad and non-invasive radiographic methods, respectively. Tests were performed after first (acute effects) and last (chronic effects) administration of WIN, and 1 week after discontinuing treatment (residual effects). Food intake and body weight were also recorded throughout treatment. Blood pressure and heart rate remained unchanged after acute or chronic administration of WIN. Central activity and GI motility were acutely depressed at psychoactive doses, whereas non-psychoactive doses only slightly reduced intestinal transit. Most effects were reduced after the last administration. However, delayed gastric emptying was not and could, at least partially, account for a concomitant reduction in food intake and body weight gain. The remaining effects of WIN administration in GI motility were blocked by the CB1 antagonist AM 251, which slightly accelerated motility when administered alone. No residual effects were found 1 week after discontinuing cannabinoid treatment. The different systems show differential sensitivity to cannabinoids and tolerance developed at different rates, with delayed gastric emptying being particularly resistant to attenuation upon chronic treatment. PMID:19413685

  7. 21.2.Schizophrenia

    Institute of Scientific and Technical Information of China (English)

    1993-01-01

    930403 Family therapy of social psycologic in-tervention and rehabilitation of schizophrenia.KANG Ming(亢明),et al.Dept Psychiatr,3rdPeople’s Hosp,Huaiyin,Jiangsu Prov,223001.Chin J Nerv & Ment Dis 1992;18(5):258—260.Family therapy of social psychologic interven-tion(SPI) was used for the rehabilitation of dis-charged patients with schizophrenia.It was indi-cated that family therapy of SPI had significanteffect on the recovery of social function,im-provement of relation between the patients andmembers of the family,and preventing relapse ofschizophrenia etc.The social function of the

  8. The effect of miR-212 inhibitor on the pain behavior of bone cancer mice%鞘内注射miR-212反义锁核酸对骨癌小鼠痛行为的影响

    Institute of Scientific and Technical Information of China (English)

    侯百灵; 刘玥; 夏天娇; 张羽; 孙蓓; 冷鑫; 周瑜; 倪坤; 顾小萍

    2013-01-01

    目的 研究骨癌痛发展和维持过程中小鼠脊髓水平miR-212表达的变化规律及连续鞘内注射miR-212反义锁核酸LNA-anti-miR-212对骨癌痛小鼠痛行为的影响.方法 本实验分为两个部分:(一)骨癌痛小鼠脊髓水平miR-212表达的变化规律:C3H/HeJ雄性小鼠36只,随机分为假手术组(sham组,n=18)和肿瘤组(T组,n=18).sham组小鼠在右侧股骨远端骨髓腔注射不含肿瘤细胞的α-MEM,T组小鼠在右侧股骨远端骨髓腔注射纤维肉瘤细胞NCTC 2472,建立骨癌痛模型.在术前1d,术后4d、7d、10 d、14 d、21 d,sham组和T组各随机取三只小鼠处死,取脊髓腰膨大标本,用Real-time PCR的方法检测脊髓水平miR-212的表达情况.(二)连续鞘内注射LNA-anti-miR-212对骨癌痛小鼠痛行为的影响:C3H/HeJ雄性小鼠24只,随机分为四组:L组(鞘内注射LNA-anti-miR-212,n=6)、L’组(鞘内注射LNA'-negative control,n=6)、C组(鞘内注射溶媒无核酸酶水,n=6)和S组(假手术处理,n=6).L组、L’组和C组小鼠在右侧股骨远端注射纤维肉瘤细胞NCTC 2472,S组小鼠在右侧股骨远端骨髓腔注射不含肿瘤细胞的α-MEM.所有小鼠于术前1d、术后4d、7d、10 d、14 d测小鼠痛行为指标,包括自发抬足次数和机械缩足阈值(PWMT),术后14 d,L组、L’组、C组小鼠分别鞘内注射LNA-anti-miR-212 12 pmol/5μl、LNA '-negative control 12 pmol/5μl和无核酸酶水5μl,连续鞘内注射7d,1次/d,每天测小鼠痛行为指标,至术后第21天.结果 miR-212的表达变化表现为:与基础值相比,sham组和T组小鼠在术后第4天,脊髓水平miR-212明显升高(P<0.05);与基础值和sham组相比,T组小鼠脊髓水平miR-212在术后7d、10 d、14 d、21 d均明显升高(P<0.05).连续鞘内注射LNA-anti-miR-212改善骨癌痛小鼠痛行为:术后19 d至21 d,与L’组和C组相比,L组小鼠PWMT[19 d(1.07 ±0.16)g,20 d(1.13±0.21)g,21 d(1.27±0.21)g)]明显升高(P<0.05),

  9. Damage thresholds of various materials irradiated by 100-ps pulses of 21.2-nm laser radiation

    Science.gov (United States)

    Hájková, V.; Chalupský, J.; Wabnitz, H.; Feldhaus, J.; Störmer, M.; Hecquet, Ch.; Mocek, T.; Kozlová, M.; Polan, J.; Homer, P.; Rus, B.; Juha, L.

    2009-05-01

    Irradiation experiments were conducted at Prague Asterix Laser System (PALS) with the Ne-like zinc soft x-ray laser (SXRL) at 21.2 nm (58.5 eV) delivering up to 4 mJ (~4 x 1014 photons), 100-ps pulses in a narrowly collimated beam. The SXRL beam was focused using a 1 inch diameter off-axis parabolic mirror (f = 253 mm at 14 degrees) with a Mo:Si multilayer coating (R = 30% at 21 nm) placed 2825 mm from the SXRL. The diameter of the SXRL beam incident on the mirror was about 11 mm. Ablation experiments with a gradually attenuated beam were performed to determine the single-shot damage threshold of various materials. In this case, the sample was positioned at the tightest focus of the SXRL whose pulse energy was attenuated by aluminum filters of various thickness to adjust the fluence. Both the focal spot area and single-shot damage threshold were determined from the plot of damaged surface areas as a function of a pulse energy logarithm to dete. For PMMA, the focal spot area and the ablation threshold inferred from the data are Sfoc = (1172+/-230) μm2 and Fth = (1.25+/-0.4) J/cm2, respectively. Inorganic materials have thresholds significantly higher than organic polymers, e.g., amorphous and monocrystalline silicon gave values 2.5 J/cm2 and 4.2 J/cm2, respectively. For prospective SASE FEL optical elements, the SiC coating is of great interest. Its damage threshold is of 20 J/cm2, i.e., slightly lower than that of monocrystalline silicon. The thresholds determined with the 100-ps pulses from plasma-based, quasi-steady state SXRL are significantly higher than the thresholds obtained for 20-fs pulses provided by the SXR freeelectron laser in Hamburg. There is a difference in PMMA thresholds of two orders of magnitude for these two sources.

  10. Multi-millijoule, deeply saturated x-ray laser at 21.2 nm for applications in plasma physics

    International Nuclear Information System (INIS)

    We report on the development of a multi-millijoule, ultra high-brightness Ne-like soft x-ray laser (XRL) at the wavelength of 21.2 nm, recently undertaken at the PALS Centre. The device has been implemented as a routine radiation source delivering about 4 mJ of energy in pulses with a duration of ∼100 ps, in a narrowly collimated beam exhibiting high spatial quality and possessing high spatial coherence. The peak power of about 40 MW, generated by this device, is the largest value attained by an XRL to date. The same holds true for the peak spectral brightness, amounting to 1027 photons s-1 mm-2 mrad-2 0.1%BW-1. The active medium consists of a 3 cm long plasma column, sequentially generated from a slab target by an energy of ∼500 J delivered by the iodine 1.315 μm driving laser. The population inversion is produced by focusing tightly down to the line ∼500 J of energy into a much wider preplasma column, which makes it possible to create a lasing medium with a reduced lateral density gradient and thereby to minimize the lateral refraction of the x-ray beam. The multi-millijoule output is generated in double-pass amplification regime, achieved by a carefully designed half cavity using a flat multilayer Mo : Si mirror positioned a few millimetres near the plasma end. We describe the measured characteristics of the output beam generated by double-pass amplification, and illustrate its spatial beam coherence obtained using a Fresnel wavefront splitting interferometer. Given the available energy, peak power and brightness in a single pulse, the demonstrated XRL constitutes a tool for novel applications in both solid state and plasma physics. Examples of such applications are the generation of high-energy density, low-temperature plasmas relevant to laboratory astrophysics, x-ray interferometry of plasmas and solids with spatial resolution ranging from a micron to a few nanometres according to the specific experimental arrangement, or study of soft x

  11. Multi-millijoule, deeply saturated x-ray laser at 21.2 nm for applications in plasma physics

    Energy Technology Data Exchange (ETDEWEB)

    Rus, B [Gas Lasers Department/PALS Centre, Institute of Physics, Academy of Sciences of the Czech Republic, Na Slovance 2, 18221 Prague (Czech Republic); Mocek, T [Gas Lasers Department/PALS Centre, Institute of Physics, Academy of Sciences of the Czech Republic, Na Slovance 2, 18221 Prague (Czech Republic); Praeg, A R [Gas Lasers Department/PALS Centre, Institute of Physics, Academy of Sciences of the Czech Republic, Na Slovance 2, 18221 Prague (Czech Republic); Kozlova, M [Gas Lasers Department/PALS Centre, Institute of Physics, Academy of Sciences of the Czech Republic, Na Slovance 2, 18221 Prague (Czech Republic); Hudecek, M [Gas Lasers Department/PALS Centre, Institute of Physics, Academy of Sciences of the Czech Republic, Na Slovance 2, 18221 Prague (Czech Republic); Jamelot, G [Laboratoire d' interaction du Rayonnement X avec la Matiere, Batiment 350, Universite Paris-Sud, 91405 Orsay (France); Carillon, A [Laboratoire d' interaction du Rayonnement X avec la Matiere, Batiment 350, Universite Paris-Sud, 91405 Orsay (France); Ros, D [Laboratoire d' interaction du Rayonnement X avec la Matiere, Batiment 350, Universite Paris-Sud, 91405 Orsay (France); Lagron, J-C [Laboratoire d' interaction du Rayonnement X avec la Matiere, Batiment 350, Universite Paris-Sud, 91405 Orsay (France); Joyeux, D [Institut d' Optique Theorique et Appliquee, Laboratoire Charles Fabry, Batiment 503, Universite Paris-Sud, 91403 Orsay (France); Phalippou, D [Institut d' Optique Theorique et Appliquee, Laboratoire Charles Fabry, Batiment 503, Universite Paris-Sud, 91403 Orsay (France)

    2002-12-01

    We report on the development of a multi-millijoule, ultra high-brightness Ne-like soft x-ray laser (XRL) at the wavelength of 21.2 nm, recently undertaken at the PALS Centre. The device has been implemented as a routine radiation source delivering about 4 mJ of energy in pulses with a duration of {approx}100 ps, in a narrowly collimated beam exhibiting high spatial quality and possessing high spatial coherence. The peak power of about 40 MW, generated by this device, is the largest value attained by an XRL to date. The same holds true for the peak spectral brightness, amounting to 10{sup 27} photons s{sup -1} mm{sup -2} mrad{sup -2} 0.1%BW{sup -1}. The active medium consists of a 3 cm long plasma column, sequentially generated from a slab target by an energy of {approx}500 J delivered by the iodine 1.315 {mu}m driving laser. The population inversion is produced by focusing tightly down to the line {approx}500 J of energy into a much wider preplasma column, which makes it possible to create a lasing medium with a reduced lateral density gradient and thereby to minimize the lateral refraction of the x-ray beam. The multi-millijoule output is generated in double-pass amplification regime, achieved by a carefully designed half cavity using a flat multilayer Mo : Si mirror positioned a few millimetres near the plasma end. We describe the measured characteristics of the output beam generated by double-pass amplification, and illustrate its spatial beam coherence obtained using a Fresnel wavefront splitting interferometer. Given the available energy, peak power and brightness in a single pulse, the demonstrated XRL constitutes a tool for novel applications in both solid state and plasma physics. Examples of such applications are the generation of high-energy density, low-temperature plasmas relevant to laboratory astrophysics, x-ray interferometry of plasmas and solids with spatial resolution ranging from a micron to a few nanometres according to the specific experimental

  12. Polymorphisms in a Putative Enhancer at the 10q21.2 Breast Cancer Risk Locus Regulate NRBF2 Expression

    Science.gov (United States)

    Darabi, Hatef; McCue, Karen; Beesley, Jonathan; Michailidou, Kyriaki; Nord, Silje; Kar, Siddhartha; Humphreys, Keith; Thompson, Deborah; Ghoussaini, Maya; Bolla, Manjeet K.; Dennis, Joe; Wang, Qin; Canisius, Sander; Scott, Christopher G.; Apicella, Carmel; Hopper, John L.; Southey, Melissa C.; Stone, Jennifer; Broeks, Annegien; Schmidt, Marjanka K.; Scott, Rodney J.; Lophatananon, Artitaya; Muir, Kenneth; Beckmann, Matthias W.; Ekici, Arif B.; Fasching, Peter A.; Heusinger, Katharina; dos-Santos-Silva, Isabel; Peto, Julian; Tomlinson, Ian; Sawyer, Elinor J.; Burwinkel, Barbara; Marme, Frederik; Guénel, Pascal; Truong, Thérèse; Bojesen, Stig E.; Flyger, Henrik; Benitez, Javier; González-Neira, Anna; Anton-Culver, Hoda; Neuhausen, Susan L.; Arndt, Volker; Brenner, Hermann; Engel, Christoph; Meindl, Alfons; Schmutzler, Rita K.; Arnold, Norbert; Brauch, Hiltrud; Hamann, Ute; Chang-Claude, Jenny; Khan, Sofia; Nevanlinna, Heli; Ito, Hidemi; Matsuo, Keitaro; Bogdanova, Natalia V.; Dörk, Thilo; Lindblom, Annika; Margolin, Sara; Kosma, Veli-Matti; Mannermaa, Arto; Tseng, Chiu-chen; Wu, Anna H.; Floris, Giuseppe; Lambrechts, Diether; Rudolph, Anja; Peterlongo, Paolo; Radice, Paolo; Couch, Fergus J.; Vachon, Celine; Giles, Graham G.; McLean, Catriona; Milne, Roger L.; Dugué, Pierre-Antoine; Haiman, Christopher A.; Maskarinec, Gertraud; Woolcott, Christy; Henderson, Brian E.; Goldberg, Mark S.; Simard, Jacques; Teo, Soo H.; Mariapun, Shivaani; Helland, Åslaug; Haakensen, Vilde; Zheng, Wei; Beeghly-Fadiel, Alicia; Tamimi, Rulla; Jukkola-Vuorinen, Arja; Winqvist, Robert; Andrulis, Irene L.; Knight, Julia A.; Devilee, Peter; Tollenaar, Robert A.E.M.; Figueroa, Jonine; García-Closas, Montserrat; Czene, Kamila; Hooning, Maartje J.; Tilanus-Linthorst, Madeleine; Li, Jingmei; Gao, Yu-Tang; Shu, Xiao-Ou; Cox, Angela; Cross, Simon S.; Luben, Robert; Khaw, Kay-Tee; Choi, Ji-Yeob; Kang, Daehee; Hartman, Mikael; Lim, Wei Yen; Kabisch, Maria; Torres, Diana; Jakubowska, Anna; Lubinski, Jan; McKay, James; Sangrajrang, Suleeporn; Toland, Amanda E.; Yannoukakos, Drakoulis; Shen, Chen-Yang; Yu, Jyh-Cherng; Ziogas, Argyrios; Schoemaker, Minouk J.; Swerdlow, Anthony; Borresen-Dale, Anne-Lise; Kristensen, Vessela; French, Juliet D.; Edwards, Stacey L.; Dunning, Alison M.; Easton, Douglas F.; Hall, Per; Chenevix-Trench, Georgia

    2015-01-01

    Genome-wide association studies have identified SNPs near ZNF365 at 10q21.2 that are associated with both breast cancer risk and mammographic density. To identify the most likely causal SNPs, we fine mapped the association signal by genotyping 428 SNPs across the region in 89,050 European and 12,893 Asian case and control subjects from the Breast Cancer Association Consortium. We identified four independent sets of correlated, highly trait-associated variants (iCHAVs), three of which were located within ZNF365. The most strongly risk-associated SNP, rs10995201 in iCHAV1, showed clear evidence of association with both estrogen receptor (ER)-positive (OR = 0.85 [0.82–0.88]) and ER-negative (OR = 0.87 [0.82–0.91]) disease, and was also the SNP most strongly associated with percent mammographic density. iCHAV2 (lead SNP, chr10: 64,258,684:D) and iCHAV3 (lead SNP, rs7922449) were also associated with ER-positive (OR = 0.93 [0.91–0.95] and OR = 1.06 [1.03–1.09]) and ER-negative (OR = 0.95 [0.91–0.98] and OR = 1.08 [1.04–1.13]) disease. There was weaker evidence for iCHAV4, located 5′ of ADO, associated only with ER-positive breast cancer (OR = 0.93 [0.90–0.96]). We found 12, 17, 18, and 2 candidate causal SNPs for breast cancer in iCHAVs 1–4, respectively. Chromosome conformation capture analysis showed that iCHAV2 interacts with the ZNF365 and NRBF2 (more than 600 kb away) promoters in normal and cancerous breast epithelial cells. Luciferase assays did not identify SNPs that affect transactivation of ZNF365, but identified a protective haplotype in iCHAV2, associated with silencing of the NRBF2 promoter, implicating this gene in the etiology of breast cancer. PMID:26073781

  13. Radioimmunoscintigraphy of colorectal carcinoma using technetium-99m-labeled, totally human monoclonal antibody 88BV59H21-2.

    Science.gov (United States)

    Gulec, S A; Serafini, A N; Moffat, F L; Vargas-Cuba, R D; Sfakianakis, G N; Franceschi, D; Crichton, V Z; Subramanian, R; Klein, J L; De Jager, R L

    1995-12-01

    Radioimmunoscintigraphy (RIS) using human monoclonal antibodies offers the important clinical advantage of repeated imaging over murine monoclonal antibodies by eliminating the cross-species antibody response. This article reports a Phase I-II clinical trial with Tc-99m-labeled, totally human monoclonal antibody 88BV59H21-2 in patients with colorectal carcinoma. The study population consisted of 34 patients with colorectal cancer (20 men and 14 women; age range, 44-81 years). Patients were administered 5-10 mg antibody labeled with 21-41 mCi Tc-99m by the i.v. route and imaged at 3-10 and 16-24 h after infusion using planar and single-photon emission computed tomographic (CT) techniques. Pathological confirmation was obtained in 25 patients who underwent surgery. Human antihuman antibody (HAHA) titers were checked prior to and 1 and 3 months after the infusion. RIS with Tc-99m-labeled 88BV59H21-2 revealed a better detection rate in the abdomen-pelvis region compared with axial CT. The combined use of both modalities increased the sensitivity in both the liver and abdomen-pelvis regions. Ten patients developed mild adverse reactions (chills and fever). No HAHA response was detected in this series. Tc-99m-labeled human monoclonal antibody 88BV59H21-2 RIS shows promise as a useful diagnostic modality in patients with colorectal cancer. RIS alone or in combination with CT is more sensitive than CT in detecting tumor within the abdomen and pelvis. Repeated RIS studies may be possible, due to the lack of a HAHA response. PMID:7493345

  14. Étude des dommages induits dans l'ADN par irradiation laser X-UV à 21.2 nm

    Science.gov (United States)

    Cassou, K.; Ros, D.; Kazamias, S.; Klisnick, A.; Jamelot, G.; Guilbaud, O.; Rus, B.; Kozlová, M.; Polan, J.; Präg, A. R.; Stupka, M.; Eot-Houllier, G.; Sage, E.; Begusová, M.; Stísová, V.; Du Penhoat, M.-A. H.; Touati, A.; Chétioui, A.

    2005-06-01

    We report the preliminary result of the application of the collisional Ne-like soft x-ray laser as radiation source to induce DNA damage. The goal of this experiment was a test bed study of the damage yields induced by soft x-ray radiation in dried plasmid DNA sample. The saturated Ne-like soft x-ray laser available at the PALS facility, delivering several millijoules in a single 100 ps pulse at 21.2 nm was used to irradiate two different plasmids: pSP189 and pBS. The study is centered on the dose effect leading to single and double strand break in DNA.

  15. Cell Killing Mechanisms and Impact on Gene Expression by Gemcitabine and 212Pb-Trastuzumab Treatment in a Disseminated i.p. Tumor Model

    Science.gov (United States)

    Yong, Kwon Joong; Milenic, Diane E.; Baidoo, Kwamena E.; Brechbiel, Martin W.

    2016-01-01

    In pre-clinical studies, combination therapy with gemcitabine and targeted radioimmunotherapy (RIT) using 212Pb-trastuzumab showed tremendous therapeutic potential in the LS-174T tumor xenograft model of disseminated intraperitoneal disease. To better understand the underlying molecular basis for the observed cell killing efficacy, gene expression profiling was performed after a 24 h exposure to 212Pb-trastuzumab upon gemcitabine (Gem) pre-treatment in this model. DNA damage response genes in tumors were quantified using a real time quantitative PCR array (qRT-PCR array) covering 84 genes. The combination of Gem with α-radiation resulted in the differential expression of apoptotic genes (BRCA1, CIDEA, GADD45α, GADD45γ, IP6K3, PCBP4, RAD21, and p73), cell cycle regulatory genes (BRCA1, CHK1, CHK2, FANCG, GADD45α, GTSE1, PCBP4, MAP2K6, NBN, PCBP4, and SESN1), and damaged DNA binding and repair genes (BRCA1, BTG2, DMC1, ERCC1, EXO1, FANCG, FEN1, MSH2, MSH3, NBN, NTHL1, OGG1, PRKDC, RAD18, RAD21, RAD51B, SEMA4G, p73, UNG, XPC, and XRCC2). Of these genes, the expression of CHK1, GTSE1, EXO1, FANCG, RAD18, UNG and XRCC2 were specific to Gem/212Pb-trastuzumab administration. In addition, the present study demonstrates that increased stressful growth arrest conditions induced by Gem/212Pb-trastuzumab could suppress cell proliferation possibly by up-regulating genes involved in apoptosis such as p73, by down-regulating genes involved in cell cycle check point such as CHK1, and in damaged DNA repair such as RAD51 paralogs. These events may be mediated by genes such as BRCA1/MSH2, a member of BARC (BRCA-associated genome surveillance complex). The data suggest that up-regulation of genes involved in apoptosis, perturbation of checkpoint genes, and a failure to correctly perform HR-mediated DSB repair and mismatch-mediated SSB repair may correlate with the previously observed inability to maintain the G2/M arrest, leading to cell death. PMID:27467592

  16. Measuring Progress on the Control of Porcine Reproductive and Respiratory Syndrome (PRRS at a Regional Level: The Minnesota N212 Regional Control Project (Rcp as a Working Example.

    Directory of Open Access Journals (Sweden)

    Pablo Valdes-Donoso

    Full Text Available Due to the highly transmissible nature of porcine reproductive and respiratory syndrome (PRRS, implementation of regional programs to control the disease may be critical. Because PRRS is not reported in the US, numerous voluntary regional control projects (RCPs have been established. However, the effect of RCPs on PRRS control has not been assessed yet. This study aims to quantify the extent to which RCPs contribute to PRRS control by proposing a methodological framework to evaluate the progress of RCPs. Information collected between July 2012 and June 2015 from the Minnesota Voluntary Regional PRRS Elimination Project (RCP-N212 was used. Demography of premises (e.g. composition of farms with sows = SS and without sows = NSS was assessed by a repeated analysis of variance. By using general linear mixed-effects models, active participation of farms enrolled in the RCP-N212, defined as the decision to share (or not to share PRRS status, was evaluated and used as a predictor, along with other variables, to assess the PRRS trend over time. Additionally, spatial and temporal patterns of farmers' participation and the disease dynamics were investigated. The number of farms enrolled in RCP-N212 and its geographical coverage increased, but the proportion of SS and NSS did not vary significantly over time. A significant increasing (p<0.001 trend in farmers' decision to share PRRS status was observed, but with NSS producers less willing to report and a large variability between counties. The incidence of PRRS significantly (p<0.001 decreased, showing a negative correlation between degree of participation and occurrence of PRRS (p<0.001 and a positive correlation with farm density at the county level (p = 0.02. Despite a noted decrease in PRRS, significant spatio-temporal patterns of incidence of the disease over 3-weeks and 3-kms during the entire study period were identified. This study established a systematic approach to quantify the effect of RCPs on

  17. 3种微创手术治疗复杂性输尿管上段结石212例比较%A comparison of three surgical procedures of complicated upper ureteral calculi for 212 cases

    Institute of Scientific and Technical Information of China (English)

    李旭明; 程洪林; 郭闯; 程宗勇; 李锋; 张力; 李元仲

    2011-01-01

    Objective To compare the efficacy of three procedures, ureteroscopic litripsy(URL), minimally invasive percutaneous nephrolithotomy(MPCNL) ,and retroperitoneal laparoscopic ureterolithomy(RLU), for the treatment of complicated upper ureteral calculi. Methods Two hundred and thirteen cases of complicated upper ureteral calculi were treated in this hospital from February 2002 to February 2010,including fifty-two cases of URL, one hundred and seven cases of MPCNL, and fifty-four cases of RLU. Results The stone free rate seven days after operation:URL was 36.5%(19/52),MPCNL was 75.7%(81/107),RLU was 90.6% (48/53); the stone free rate one months after operation: URL was 71. 1% (38/52), MPCNL was 95. 3% (102/107), RLU was 96.2%(51/53); the stone-free rate three months after operation:URL was 82.7%(43/52),MPCNL was 98. 1%(105/107),RLU was 98.1%(52/53). There was significantly difference between URL and MPCNL(P<0.05) ,URL and RLU (P<0.05). There was also significantly difference between MPCNL and RLU in the near future(P<0. 05) ,but had no difference in long term. Conclusion High stone free rate can be obtained with RLU and MPCNL for impacted upper ureteral calculi. The stone-free rate is less satisfactory with URL.%目的 比较输尿管镜碎石(URL)、微创经皮肾镜取石(MPCNL)、后腹腔镜下输尿管切开取石(RLU)治疗复杂性输尿管上段结石的疗效.方法 回顾分析2002年2月至2010年2月复杂性输尿管上段结石212例,其中URL治疗52例,MPCNL治疗107例,RLU治疗54例.比较分析3种手术的治疗效果.结果 术后7 d结石清除率:URL组36.5%(19/52),MPCNL组75.7%(81/107),RLU组90.6%(48/53).术后1个月结石清除率:URL组73.1%(38/52),MPCNL组95.3%(102/107),RLU组96.2%(51/53).术后3个月结石清除率:URL组82.7%(43/52),MPCNL组98.1%(105/107),RLU组98.1%(52/53).URL组分别与MPCNL组、RLU组比较差异有统计学意义(P<0.05),MPCNL、RLU组之间比较近期差异有统计学意义(P<0.05),

  18. Loci on 7p12.2, 10q21.2 and 14q11.2 are associated with risk of childhood acute lymphoblastic leukemia

    Science.gov (United States)

    Papaemmanuil, Elli; Hosking, Fay J; Vijayakrishnan, Jayaram; Price, Amy; Olver, Bianca; Sheridan, Eammon; Kinsey, Sally E; Lightfoot, Tracy; Roman, Eve; Irving, Julie A E; Allan, James M.; Tomlinson, Ian P; Taylor, Malcolm; Greaves, Mel; Houlston, Richard S

    2016-01-01

    To identify risk variants for childhood acute lymphoblastic leukemia (ALL) we conducted a genome-wide association study of 2 case-control series, analyzing the genotypes of 291,423 tagging SNP genotypes in a total of 907 ALL cases and 2,398 controls. We identified risk loci for ALL at 7p12.2 (IKZF1, rs4132601; OR = 1.69, P = 1.20 x 10-19), 10q21.2 (ARIDB5, rs7089424; OR = 1.65, P = 6.69 x 10-19) and 14q11.2 (CEBPE, rs2239633; OR = 1.34, P = 2.88 x 10-7). The 10q21.2 (ARIDB5) risk association appears to be selective for the subset of B-cell precursor ALL with hyperdiploidy. These data show that common low-penetrance susceptibility alleles contribute to the risk of developing childhood ALL and provide novel insight into disease causation of this hematological cancer; notably all 3 risk variants map to genes involved in transcriptional regulation and differentiation of B-cell progenitors. PMID:19684604

  19. 13CO2/12CO2 ratio analysis in exhaled air by lead-salt tunable diode lasers for noninvasive diagnostics in gastroenterology

    Science.gov (United States)

    Stepanov, Eugene V.; Zyrianov, Pavel V.; Miliaev, Valerii A.; Selivanov, Yurii G.; Chizhevskii, Eugene G.; Os'kina, Svetlana; Ivashkin, Vladimir T.; Nikitina, Elena I.

    1999-07-01

    An analyzer of 13CO2/12CO2 ratio in exhaled air based on lead-salt tunable diode lasers is presented. High accuracy of the carbon isotope ratio detection in exhaled carbon dioxide was achieved with help of very simple optical schematics. It was based on the use of MBE laser diodes operating in pulse mode and on recording the resonance CO2 absorption at 4.2 micrometers . Special fast acquisition electronics and software were applied for spectral data collection and processing. Developed laser system was tested in a clinical train aimed to assessment eradication efficiency in therapy of gastritis associated with Helicobacter pylori infection. Data on the 13C-urea breath test used for P.pylori detection and obtained with tunable diode lasers in the course of the trail was compared with the results of Mass-Spectroscopy analysis and histology observations. The analyzer can be used also for 13CO2/12CO2 ratio detection in exhalation to perform gastroenterology breath test based on using other compounds labeled with stable isotopes.

  20. Process for producing astatine-211 for radiopharmaceutical use

    International Nuclear Information System (INIS)

    A one-step chemical manipulation is described in combination with a distillation and collection process for producing At-211 comprising; a. providing a target of irradiated Bismuth coated to a predetermined thickness of a backing member, b. providing a vapor-producing still operably connected with a condenser that has a water cooled condensate collector formed of a dry silica gel mesh maintained at a temperature above the freezing point of water, and providing an effluent gas filter that is operably connected to receive effluent gas from the condenser, c. heating the target in the still at a temperature in the range of about 6300-6800C for a time period in the range of 50 to 80 minutes, to evole At-211 vapor from the target, c. providing a dry carrier gas having an oxygen concentration that is sufficient to form Bi/sub 2/O/sub 3/ thereby to essentially preclude vaporization of Bi metal, passing the carrier gas through the still to carry the At-211 vapor to the condenser, and to carry effluent from the condenser to the effluent gas filter, e. eluting At-211 from the condensate collector of the condenser with a controlled volume of eluent containing predetermined solvents that are compatible with a given desired radiopharmaceutical procedure, and f. collecting the At-211 in the controlled volume of eluent for use in the given radiopharmaceutical procedure

  1. Inherited Tandem Duplication of the X Chromosome: Dup(X(q13.2-q21.2 in a Family.

    Directory of Open Access Journals (Sweden)

    Jia-Woei Hou

    2004-09-01

    Full Text Available A 2-year-old boy who was failing to thrive and who had multiple anomalies was found tohave a maternally derived tandem duplication of the long arm of the X chromosome:dup(X(q13.2-q21.2. The karyotyping interpretation was further confirmed by fluorescencein situ hybridization studies in which a double gene dosage of the X-inactivation-specifictranscript (gene locus on Xq13.2 and a whole chromosome X painting on the abnormal Xwere noted. He suffered from hypotonia, gastroesophageal reflux, laryngomalacia, recurrentinfections, immunodeficiency (IgG4 deficiency, dysgenesis of the corpus callosum, proximalrenal tubular acidosis, and nephrolithiasis. His mother and elder sister also had the samerearrangement, the dup(X, on one of their X chromosomes. However, the mother was ingood health, but the sister suffered from nephrolithiasis. The clinical variability in this familywith the Xq duplication is reported and discussed.

  2. Differential effects of repeated low dose treatment with the cannabinoid agonist WIN 55,212-2 in experimental models of bone cancer pain and neuropathic pain

    DEFF Research Database (Denmark)

    Hald, Andreas; Ding, Ming; Egerod, Kristoffer Lihme;

    2008-01-01

    Pain due to bone malignancies is one of the most difficult types of cancer pain to fully control and may further decrease the patients' quality of life. Animal models of chronic pain conditions resulting from peripheral inflammatory reactions or nerve injuries are responsive to treatment with....... Furthermore, this treatment strategy was not found to induce measurable CNS related side effects or tolerance. Cancer cell viability assays and bone volume fraction assessed by micro computed tomography (microCT) demonstrated that these effects were not due to changes in cancer progression. The difference in...... cannabinoid agonists. However, the use of cannabinoid agonists in humans may be hampered by CNS related side effects and development of tolerance. In the present study, we investigated the effect of repeated low dose administration of the synthetic cannabinoid agonist WIN 55,212-2 on bone cancer pain and...

  3. A Deep X-ray look at a very massive star: HETGS spectroscopy of the blue hypergiant Cyg OB2-12 (HIP 101364)

    Science.gov (United States)

    Huenemoerder, David; Oskinova, Lidia; Ignace, Richard; Hamann, Wolf-Rainer; Schulz, Norbert S.; neilson, hilding; Shenar, Tomer

    2016-04-01

    We have obtained a Chandra/HETGS spectrum of one of the most massive and luminous stars in the Galaxy: the blue hypergiant Cyg OB2-12 (HIP 101364, spectral type B3 Ia+). This is the first measurement at high resolution of X-ray spectral lines in a blue hypergiant and allows comparison of X-ray properties between massive stars at different but related evolutionary stages: O-type supergiants, luminous blue variables, Wolf-Rayet stars, and blue hypergiants stars. The new data provide a look at how the most massive stars shed mass during their pre-supernova evolution. We find that In Cyg OB2-12 the resolved Si and Mg lines are broadened by about 1000 km/s (FWHM). The lines, however, do not show appreciable centroid shifts (<100 km/s), which would be much larger for canonical moderately thick winds (~500 km/s). The He-like Mg XI lines show evidence of photo-excitation, implying a wind origin close to the UV-bright photosphere. The spectrum also indicates relatively high temperature plasma, up to 22 MK (1.9 keV), showing significant continuum and emission lines below 5A (above 2.5 keV). Hence, at first glance, the spectrum resembles neither an O-star thick wind, nor a magnetically confined (narrow-line) plasma. We will present more detailed wind models using both X-ray and UV spectra to constrain fundamental physical parameters of this star.

  4. Treatment of Advanced Non Small Cell Lung Cancer in Routine Care: A Retrospective Analysis of 212 Consecutive Patients Treated in a Community Based Oncology Group Practice

    Directory of Open Access Journals (Sweden)

    Hubert Koeppler

    2009-01-01

    Full Text Available Treatment outcome data generated in prospective trials are intrinsically biased due to necessary selection criteria. Therefore the results obtained may not reflect the actual impact of current treatment options for an unselected general population. We analysed the treatment modalities and the outcome in 212 consecutive patients with non small cell lung cancer stages IIIB and IV who were seen in a community based oncology group practice between 6/1995 and 6/2006. 93 presented with stage IIIB and 119 with stage IV. Chemotherapy was given to 194/212 patients (92%, 114 patients (54% received palliative radiation at one point during treatment. Treatment consisted of chemotherapy only in 86 patients (40% and radiation only in 6 patients. 12 patients received best supportive care only. Patients with stage IIIB have survival rates at 12, 24 and 36 months of 64%, 27% and 21% respectively and for patients with stage IV the survival rates at 12, 24 and 36 months are 40%, 19% and 11% respectively. The median survival for stages IIIB and IV is 16 and 11 months respectively. In a multivariate analysis incorporating the factors stage (IIIB vs. IV, age (70 vs. 70 years and performance status (WHO 0/1 vs. 2/3 only stage and performance status were independent factors for survival. These retrospective data concerning analysis of survival , response rates and toxicity in a community setting confirm published results of phase II-III studies and indicate that results generated in prospective trials can be transferred into routine care.

  5. A specific Ce oxidation process during sorption of rare earth elements on biogenic Mn oxide produced by Acremonium sp. strain KR21-2

    Science.gov (United States)

    Tanaka, Kazuya; Tani, Yukinori; Takahashi, Yoshio; Tanimizu, Masaharu; Suzuki, Yoshinori; Kozai, Naofumi; Ohnuki, Toshihiko

    2010-10-01

    Sorption of rare earth elements (REEs) and Ce oxidation on natural and synthetic Mn oxides have been investigated by many researchers. Although Mn(II)-oxidizing microorganisms are thought to play an important role in the formation of Mn oxides in most natural environments, Ce oxidation by biogenic Mn oxide and the relevance of microorganisms to the Ce oxidation process have not been well understood. Therefore, in this study, we conducted sorption experiments of REEs on biogenic Mn oxide produced by Acremonium sp. strain KR21-2. The distribution coefficients, Kd(REE), between biogenic Mn oxide (plus hyphae) and 10 mmol/L NaCl solution showed a large positive Ce anomaly and convex tetrad effect variations at pH 3.8, which was consistent with previous works using synthetic Mn oxide. The positive Ce anomaly was caused by oxidation of Ce(III) to Ce(IV) by the biogenic Mn oxide, which was confirmed by analysis of the Ce L III-edge XANES spectra. With increasing pH, the positive Ce anomaly and convex tetrad effects became less pronounced. Furthermore, negative Ce anomalies were observed at a pH of more than 6.5, suggesting that Ce(IV) was stabilized in the solution (HPLC-ICP-MS showed that some fractions of REEs in the filtrates (<0.2 μm) after sorption experiments were bound to organic molecules (40 and <670 kDa fractions), which were possibly released from hyphae. A line of our data indicates that the negative Ce anomalies under circumneutral pH conditions arose from Ce(III) oxidation on the biogenic Mn oxide and subsequent complexation of Ce(IV) with organic ligands. The suppression of tetrad effects is also explained by the complexation of REEs with organic ligands. The results of this study demonstrate that the coexistence of the biogenic Mn oxide and hyphae of strain KR21-2 produces a specific redox chemistry which cannot be explained by inorganic species.

  6. The jet and the disk of the HH 212 low-mass protostar imaged by ALMA: SO and SO2 emission

    Science.gov (United States)

    Podio, L.; Codella, C.; Gueth, F.; Cabrit, S.; Bachiller, R.; Gusdorf, A.; Lee, C.-F.; Lefloch, B.; Leurini, S.; Nisini, B.; Tafalla, M.

    2015-09-01

    Context. The investigation of the disk formation and jet launching mechanism in protostars is crucial to understanding the earliest stages of star and planet formation. Aims: We aim to constrain the physical and dynamical properties of the molecular jet and disk of the HH 212 protostellar system at unprecedented angular scales, exploiting the capabilities of the Atacama Large Millimeter Array (ALMA). Methods: The ALMA observations of HH 212 in emission lines from sulfur-bearing molecules, SO 98-87, SO 1011-1010, SO282,6-71,7, are compared with simultaneous CO 3-2, SiO 8-7 data. The molecules column density and abundance are estimated using simple radiative transfer models. Results: SO 98-87 and SO282,6-71,7 show broad velocity profiles. At systemic velocity, they probe the circumstellar gas and the cavity walls. Going from low to high blue- and red-shifted velocities the emission traces the wide-angle outflow and the fast (~100-200 km s-1), collimated (~90 AU) molecular jet revealing the inner knots with timescales ≤50 yr. The jet transports a mass-loss rate ≥ 0.2-2 × 10-6 M⊙ yr-1, implying high ejection efficiency (≥ 0.03-0.3). The SO and SO2 abundances in the jet are ~ 10-7-10-6. SO 1011-1010 emission is compact and shows small-scale velocity gradients, indicating that it originates partly from the rotating disk previously seen in HCO+ and C17O, and partly from the base of the jet. The disk mass is ≥ 0.002-0.013 M⊙ and the SO abundance in the disk is ~ 10-8-10-7. Conclusions: SO and SO2 are effective tracers of the molecular jet in the inner few hundreds AU from the protostar. Their abundances indicate that 1-40% of sulfur is in SO and SO2 due to shocks in the jet/outflow and/or to ambipolar diffusion at the wind base. The SO abundance in the disk is 3-4 orders of magnitude larger than in evolved protoplanetary disks. This may be due to an SO enhancement in the accretion shock at the envelope-disk interface or in spiral shocks if the disk is partly

  7. The enhancement of 21.2%-power conversion efficiency in polymer photovoltaic cells by using mixed Au nanoparticles with a wide absorption spectrum of 400 nm-1000 nm

    Institute of Scientific and Technical Information of China (English)

    郝敬昱; 徐颖; 张玉佩; 陈淑芬; 李兴鳌; 汪联辉; 黄维

    2015-01-01

    Au nanoparticles (NPs) mixed with a majority of bone-like, rod, and cube shapes and a minority of irregu-lar spheres, which can generate a wide absorption spectrum of 400 nm–1000 nm and three localized surface plas-mon resonance peaks, respectively, at 525, 575, and 775 nm, are introduced into the hole extraction layer poly(3,4-ethylenedioxythiophene):poly(4-styrenesulfonate) (PEDOT:PSS) to improve optical-to-electrical conversion performances in polymer photovoltaic cells. With the doping concentration of Au NPs optimized, the cell performance is significantly improved: the short-circuit current density and power conversion efficiency of the poly(3-hexylthiophene): [6,6]-phenyl-C60-butyric acid methyl ester cell are increased by 20.54%and 21.2%, reaching 11.15 mA·cm−2 and 4.23%. The variations of optical, electrical, and morphology with the incorporation of Au NPs in the cells are analyzed in detail, and our results demonstrate that the cell performance improvement can be attributed to a synergistic reaction, including:1) both the local-ized surface plasmon resonance-and scattering-induced absorption enhancement of the active layer, 2) Au doping-induced hole transport/extraction ability enhancement, and 3) large interface roughness-induced efficient exciton dissociation and hole collection.

  8. Comprehensive study on the structure of the BSA from extended-to aged form in wide (2-12) pH range.

    Science.gov (United States)

    Varga, N; Hornok, V; Sebők, D; Dékány, I

    2016-07-01

    In this work we studied the structure of the bovine serum albumin (BSA) and the protein-ligand interactions since researchers prefer to use them as carriers in drug delivery systems. Systematic study (between pH 2-12, in double distilled water and physiological salt solution) was carried out to determine the changes in the secondary and the tertiary structures of the BSA, the apparent molecular weight (Mw), the size (dLS) and the electrokinetic potential (ζ). At pH 7, the BSA has higher stability in the absence (ζ=-69mV, dLS=2.2nm, A2=1.4×10(-3)mlmol/g(2)) than in the presence of salt solution (ζ=-2.4mV, dLS=5.3nm, A2=-3.2×10(-4)mlmol/g(2)). The Mw strongly depends on the pH and the ionic strength (at pH 3 in the absence of salt, the Mw is 54.6kDa while in the presence of salt is 114kDa) which determines the geometry of the protein. The protein-ligand interactions were characterized by fluorescence (FL) and isothermal microcalorimetry (ITC) methods; these independent techniques provided similar thermodynamic parameters such as the binding constant (K) and the Gibbs free energy (ΔG). PMID:26995614

  9. Family paracentric inversion of the short arm of chromosome X (Xp21.2p11.23 and connection with autism spectrum disorders

    Directory of Open Access Journals (Sweden)

    Pejović-Milovančević Milica

    2012-01-01

    Full Text Available Introduction. Autism spectrum disorders (ASDs are a group of complex pervasive developmental disorders characterized by impairments in communication, social interaction and behavior. In most cases autism is caused by a combination of genetic factors and environmental risk factors. In 10% to 20% of cases it has been shown that the cause of ASD is genetic. Case Outline. We are describing a 2-year-old boy who was referred to genetic counseling because of speech delay and certain autism-like behavior. By cytogenetic analysis the karyotype 46, inv(X,Y was obtained. The boy was a carrier of a paracentric inversion of the short arm of the chromosome X. After cytogenetic analysis of parental blood, it was detected that mother was a carrier of identical aberration, but had no clinical signs. The method of fluorescent in situ hybridization (FISH yielded the precise breakpoint in the region (p21.2p11.23. Mother and son were carriers of identical X chromosome. Conclusion. Breakpoints are located in the regions that have already been linked to autism, which indicates that the positional effect of the gene could have been a possible cause of the patient’s genotype. In addition to positional effects, in order to better understand the etiology of autism other genetic and environmental factors should be always taken into consideration. [Projekat Ministarstva nauke Republike Srbije, br. ON175013

  10. Oxidation behaviour of ferritic stainless steel grade Crofer 22 APU at 700 °C in flowing Ar-75%CO2-12%H2O

    Science.gov (United States)

    Shariff, Nurul Atikah; Othman, Norinsan Kamil; Jalar, Azman

    2013-11-01

    The oxidation of Ferritic Stainless Steel (FSS) grade Crofer 22 APU has been investigated. FSS alloys were exposed to isothermal conditions in a horizontal tube furnace at a 700 °C in flowing Ar-75%CO2-12%H2O at a pressure of approximately 1 atm. The results showed that the growth of non protective Fe2O3 and spinel was observed after 50 h exposure in the presence of 12% H2O. The weight was increased significantly with time of exposure. The formation of different oxides is presented on the interface of the specimen such as MnCr2O4, Fe3O4 and Fe2O3 were revealed by X-ray diffraction and supported by EDAX analysis. FSS did not form a protective Cr2O3 layer due to water vapour accelerates the kinetics oxidation. Data of microstructure observation is presented and discussed in this paper in term of water vapour effects.

  11. The jet and the disk of the HH 212 low-mass protostar imaged by ALMA: SO and SO2 emission

    CERN Document Server

    Podio, L; Gueth, F; Cabrit, S; Bachiller, R; Gusdorf, A; Lee, C -F; Lefloch, B; Leurini, S; Nisini, B; Tafalla, M

    2015-01-01

    To investigate the disk formation and jet launch in protostars is crucial to comprehend the earliest stages of star and planet formation. We aim to constrain the properties of the molecular jet and the disk of the HH 212 protostellar system at unprecedented angular scales through ALMA observations of sulfur-bearing molecules, SO 9(8)-8(7), SO 10(11)-10(10), SO2 8(2,6)-7(1,7). SO 9(8)-8(7) and SO2 8(2,6)-7(1,7) show broad velocity profiles. At systemic velocity they probe the circumstellar gas and the cavity walls. Going from low to high blue-/red-shifted velocities the emission traces the wide-angle outflow and the fast (~100-200 km/s) and collimated (~90 AU) molecular jet revealing the inner knots with timescales 0.2-2e-6 Msun/yr, implying high ejection efficiency (>0.03-0.3). The SO and SO2 abundances in the jet are ~1e-7-1e-6. SO 10(11)-10(10) emission is compact and shows small-scale velocity gradients indicating that it originates partly from the rotating disk previously seen in HCO+ and C17O, and partly...

  12. Decontamination and decommissioning of 61 plutonium gloveboxes in D-Wing, Building 212 Argonne National Laboratory-East: Final project report

    International Nuclear Information System (INIS)

    Argonne National Laboratory-East (ANL-E) is a government-owned, contractor operated, multipurpose research facility located 25 miles southwest of downtown Chicago on 689 hectares (1,700 acres) in DuPage County, Illinois, as shown in Figure 1.1. Building 212 is located in the central area of ANL-E, as shown in Figure 1.2. The purpose of this project was to eliminate the risk of radioactive material release from the contaminated glovebox systems and to make the laboratories available for unrestricted use. The following work objectives were established: (1) Identify and remove radioactive materials for return to ANL-E Special Materials control. (2) Remove and package the radioactively contaminated materials and equipment from the gloveboxes. (3) Decontaminate the gloveboxes to nontransuranic (non-TRU) levels. (4) Size-reduce and package the gloveboxes and support systems. (5) Document and dispose of the radioactive and mixed waste. (6) Decontaminate, survey, and release the nine laboratories and corridor areas for unrestricted use

  13. Charge-state dependence of M-shell x-ray production in 67Ho by 2--12-MeV carbon ions

    International Nuclear Information System (INIS)

    Charge-state dependence of M-shell x-ray production cross sections of 67Ho bombarded by 2--12-MeV carbon ions, with and without K-shell vacancies, were measured using a windowless Si(Li) x-ray detector with a full-width-at-half-maximum resolution of 135 eV at 5.9 keV. Carbon ions of different charge states were produced using a postacceleration, nitrogen gas stripping cell. The carbon ions were then magnetically analyzed to select the desired charge state and energy before entering the target chamber. The total M-shell and Mζ, Mα,β, and Mγ x-ray cross sections were measured. The electron-capture (EC) contributions as well as the direct-ionization (DI) contributions can be determined by making a comprehensive study of the projectile-charge-state dependence of the target x-ray production cross sections for targets in which the single-collision realm is maintained. In this paper, both EC and DI contributions and the total M-shell x-ray production cross sections are compared to both the first Born theory and to the perturbed-stationary-state theory with energy-loss, Coulomb-deflection, and relativistic corrections

  14. Ruling out unresolved binaries in five transitional disks VLT/NACO: deep 2.12 and 1.75 {\\mu}m narrow-band imaging

    CERN Document Server

    Vicente, Silvia; Hartung, Markus; Bouy, Herve; Huelamo, Nuria; Artigau, Etienne; Augereau, Jean-Charles; van Dishoeck, Ewine; Olofsson, Johan; Oliveira, Isa; Prusti, Timo

    2011-01-01

    Aims. We aim at detecting the presence of companions inside the inner hole/gap region of a sample of five well known transitional disks using spatially-resolved imaging in the near-IR with the VLT/NACO/S13 camera, which probes projected distances from the primary of typically 0.1 to 7 arcsec. The sample includes the stars DoAr 21, HD 135344B (SAO 206462), HR 4796A, T Cha, and TW Hya, spanning ages of less than 1 to 10 Myr, spectral types of A0 to K7, and hole/gap outer radii of 4 to 100 AU. Methods. In order to enhance the contrast and to avoid saturation at the core of the point-spread function (PSF), we use narrow-band filters at 1.75 and 2.12 {\\mu}m. The "locally optimized combination of images" (LOCI) algorithm is applied for an optimal speckle noise removal and PSF subtraction, providing an increase of 0.5-1.5 mag in contrast over the classic method. Results. With the proviso that we could have missed companions owing to unfavorable projections, the VLT/NACO observations rule out the presence of unresolv...

  15. Systemic radioimmunotherapy using a monoclonal antibody, anti-Tac directed toward the alpha subunit of the IL-2 receptor armed with the {alpha}-emitting radionuclides {sup 212}Bi or {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Wesley, Jon N.; McGee, Edwin C.; Garmestani, Kayhan; Brechbiel, Martin W.; Yordanov, Alexander T.; Wu Chuanchu; Gansow, Otto A.; Eckelman, William C.; Bacher, John D.; Flynn, Michael; Goldman, Carolyn K.; MacLin, Melvin; Schwartz, Uwe P.; Jackson-White, Terri; Phillip, Celeste M.; Decker, Jean; Waldmann, Thomas A. E-mail: tawald@helix.nih.gov

    2004-04-01

    To exploit the fact that IL-2 receptors are expressed by T-cells responding to foreign antigens but not by resting T-cells, humanized anti-Tac (HAT) armed with alpha-emitting radionuclides {sup 212}Bi and {sup 211}At was evaluated in a cynomolgus cardiac allograft model. Control graft survival was 8.2{+-} 0.5 days compared with 14.0{+-}1.3 days (p<0.01) survival for monkeys treated with {sup 212}Bi labeled HAT and 26.7{+-}2.4 days survival (p<0.001 versus controls) with {sup 211}At labeled HAT. Thus, {sup 211}At labeled HAT may have application in organ transplantation and in treatment of IL-2 receptor expressing T-cell leukemia.

  16. Remaining Sites Verification Package for the 100-B-21:2 Subsite (100-B/C Discovery Pipeline DS-100BC-002), Waste Site Reclassification Form 2008-003

    Energy Technology Data Exchange (ETDEWEB)

    J. M. Capron

    2008-06-16

    The 100-B-21:2 waste site consists of the immediate area of the DS-100BC-02 pipeline. In accordance with this evaluation, the confirmatory and verification sampling results support a reclassification of this site to Interim Closed Out. The results of verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River.

  17. Remaining Sites Verification Package for the 100-B-21:2 Subsite (100-B/C Discovery Pipeline DS-100BC-002). Attachment Waste Site Reclassification Form 2008-003

    International Nuclear Information System (INIS)

    The 100-B-21:2 waste site consists of the immediate area of the DS-100BC-02 pipeline. In accordance with this evaluation, the confirmatory and verification sampling results support a reclassification of this site to Interim Closed Out. The results of verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River

  18. Involvement of TRPV1 channels in the activity of the cannabinoid WIN 55,212-2 in an acute rat model of temporal lobe epilepsy.

    Science.gov (United States)

    Carletti, Fabio; Gambino, Giuditta; Rizzo, Valerio; Ferraro, Giuseppe; Sardo, Pierangelo

    2016-05-01

    The exogenous cannabinoid agonist WIN 55,212-2, (R)-(+)-[2,3-dihydro-5-methyl-3-(4-morpholinylmethyl) pyrrolo[1,2,3-de]-1,4-benzoxazin-6-Yl]-1-naphthalenylmethanone (WIN), has revealed to play a role on modulating the hyperexcitability phenomena in the hippocampus. Cannabinoid-mediated mechanisms of neuroprotection have recently been found to imply the modulation of transient receptor potential vanilloid 1 (TRPV1), a cationic channel subfamily that regulate synaptic excitation. In our study, we assessed the influence of pharmacological manipulation of TRPV1 function, alone and on WIN antiepileptic activity, in the Maximal Dentate Activation (MDA) acute model of temporal lobe epilepsy. Our results showed that the TRPV1 agonist, capsaicin, increased epileptic outcomes; whilst antagonizing TRPV1 with capsazepine exerts a protective role on paroxysmal discharge. When capsaicin is co-administered with WIN effective dose of 10mg/kg is able to reduce its antiepileptic strength, especially on the triggering of MDA response. Accordingly, capsazepine at the protective dose of 2mg/kg managed to potentiate WIN antiepileptic effects, when co-treated. Moreover, WIN subeffective dose of 5mg/kg was turned into effective when capsazepine comes into play. This evidence suggests that systemic administration of TRPV1-active drugs influences electrically induced epilepsy, with a noticeable protective activity for capsazepine. Furthermore, results from the pharmacological interaction with WIN support an interplay between cannabinoid and TRPV1 signaling that could represent a promising approach for a future pharmacological strategy to challenge hyperexcitability-based diseases. PMID:26970948

  19. Enhanced self-administration of the CB1 receptor agonist WIN55,212-2 in olfactory bulbectomized rats: evaluation of possible serotonergic and dopaminergic underlying mechanisms

    Directory of Open Access Journals (Sweden)

    Petra eAmchova

    2014-03-01

    Full Text Available Depression has been associated with drug consumption, including heavy or problematic cannabis use. According to an animal model of depression and substance use disorder comorbidity, we combined the olfactory bulbectomy model of depression with intravenous drug self-administration procedure to verify whether depressive-like rats displayed higher voluntary intake of the CB1 receptor agonist WIN55,212-2 (WIN, 12.5 µg/kg/infusion. To this aim, olfactory-bulbectomized (OBX and sham-operated (SHAM Lister Hooded rats were allowed to self-administer WIN by lever-pressing under a continuous (FR-1 schedule of reinforcement in 2h daily sessions. Data showed that both OBX and SHAM rats developed stable WIN intake; yet, responses in OBX were constantly higher than in SHAM rats soon after the first week of training. In addition, OBX rats took significantly longer to extinguish the drug-seeking behaviour after vehicle substitution. Acute pre-treatment with serotonin 5HT1B receptor agonist, CGS-12066B (2.5-10 mg/kg, did not significantly modify WIN intake in OBX and SHAM Lister Hooded rats. Furthermore, acute pre-treatment with CGS-12066B (10 and 15 mg/kg did not alter responses in parallel groups of OBX and SHAM Sprague Dawley rats self-administering methamphetamine under higher (FR-2 reinforcement schedule with nose-poking as operandum. Finally, dopamine levels in the nucleus accumbens of OBX rats did not increase in response to a WIN challenge, as in SHAM rats, indicating a dopaminergic dysfunction in bulbectomized rats. Altogether, our findings suggest that a depressive state may alter cannabinoid CB1 receptor agonist-induced brain reward function and that a dopaminergic rather than a 5-HT1B mechanism is likely to underlie enhanced WIN self-administration in OBX rats.

  20. ALMA results of the pseudodisk, rotating disk, and jet in the continuum and HCO{sup +} in the protostellar system HH 212

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Chin-Fei; Hirano, Naomi; Shang, Hsien; Ho, Paul T. P.; Krasnopolsky, Ruben [Academia Sinica Institute of Astronomy and Astrophysics, P.O. Box 23-141, Taipei 106, Taiwan (China); Zhang, Qizhou, E-mail: cflee@asiaa.sinica.edu.tw [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States)

    2014-05-10

    HH 212 is a nearby (400 pc) Class 0 protostellar system showing several components that can be compared with theoretical models of core collapse. We have mapped it in the 350 GHz continuum and HCO{sup +} J = 4-3 emission with ALMA at up to ∼0.''4 resolution. A flattened envelope and a compact disk are seen in the continuum around the central source, as seen before. The HCO{sup +} kinematics shows that the flattened envelope is infalling with small rotation (i.e., spiraling) into the central source, and thus can be identified as a pseudodisk in the models of magnetized core collapse. Also, the HCO{sup +} kinematics shows that the disk is rotating and can be rotationally supported. In addition, to account for the missing HCO{sup +} emission at low-redshifted velocity, an extended infalling envelope is required, with its material flowing roughly parallel to the jet axis toward the pseudodisk. This is expected if it is magnetized with an hourglass B-field morphology. We have modeled the continuum and HCO{sup +} emission of the flattened envelope and disk simultaneously. We find that a jump in density is required across the interface between the pseudodisk and the disk. A jet is seen in HCO{sup +} extending out to ∼500 AU away from the central source, with the peaks upstream of those seen before in SiO. The broad velocity range and high HCO{sup +} abundance indicate that the HCO{sup +} emission traces internal shocks in the jet.

  1. Health and exercise-related medical issues among 1,212 ultramarathon runners: baseline findings from the Ultrarunners Longitudinal TRAcking (ULTRA) Study.

    Science.gov (United States)

    Hoffman, Martin D; Krishnan, Eswar

    2014-01-01

    Regular exercise is associated with substantial health benefits; however, little is known about the health impact of extreme levels of exercise. This study examined the prevalence of chronic diseases, health-care utilization, and risk factors for exercise-related injuries among ultramarathon runners. Retrospective, self-reported enrollment data from an ongoing longitudinal observational study of 1,212 active ultramarathon runners were analyzed. The most prevalent chronic medical conditions were allergies/hay fever (25.1%) and exercise-induced asthma (13.0%), but there was a low prevalence of serious medical issues including cancers (4.5%), coronary artery disease (0.7%), seizure disorders (0.7%), diabetes (0.7%), and human immunodeficiency virus (HIV) infection (0.2%). In the year preceding enrollment, most (64.6%) reported an exercise-related injury that resulted in lost training days (median of 14 days), but little nonattendance of work or school due to illness, injury, or exercise-related medical conditions (medians of 0 days for each). The knee was the most common area of exercise-related injury. Prior year incidence of stress fractures was 5.5% with most (44.5%) involving the foot. Ultramarathon runners who sustained exercise-related injuries were younger (pasthma and allergies than the general population, and the prevalence of serious medical issues was nontrivial and should be recognized by those providing medical care to these individuals. Ultramarathon runners, compared with shorter distance runners, have a similar annual incidence of exercise-related injuries but higher proportion of stress fractures involving the foot, and it is the younger and less experienced ultramarathoners who appear most at risk for injury. PMID:24416176

  2. Paracentric inversion of chromosome 7 (46,XX,inv(7)(q21.2q22)) in a newborn with hypoplastic left heart syndrome

    Energy Technology Data Exchange (ETDEWEB)

    Kuforjii, T.A.; Pillers, D.M.; Silberbach, M. [Oregon Health Sciences Univ., Portland, OR (United States)] [and others

    1994-09-01

    Hypoplastic left heart syndrome (HLHS) is a severe congenital heart disease that is uniformly fatal without surgical intervention. Fetal echocardiography allows prenatal diagnosis, but this condition may not become apparent until after the mid-second trimester. We report a term baby with severe HLHS who had an 18 week fetal ultrasound that reportedly demonstrated a normal heart. There was no family history of congenital heart disease. She was phenotypically female with no dysmorphic features. Physical examination was otherwise normal. She expired at 48 hours of age. The autopsy was noncontributory. The karyotype was 46,XX, but there was an apparently balanced paracentric inversion of the long arm of chromosome 7 (46,XX,inv(7)(q21.2q22)). The mother`s chromosome study was normal without any inversion, and the father was not available for study. Hypoplastic left heart syndrome has been associated with extracardiac anomalies and chromosomal abnormalities including 45,XO,11q-, and trisomy 18. It has also been reported in 5 members spanning 3 generations of a family with a spectrum of left heart defects suggesting an autosomal dominant pattern with high penetrance. First-degree relatives of infants with HLHS have a thirteen percent incidence of related cardiovascular malformations, a frequency higher than predicted by a multifactorial model of inheritance, suggesting that at least a portion of HLHS have a genetic basis. Karyotype analysis, including high resolution banding, may help define the etiology of this condition. Chromosome 7 has not been implicated in HLHS. This case emphasizes the need for genetic analysis, including a pedigree, of affected families. It also underscores the importance of screening by karyotype analysis to determine whether defects of the long arm of chromosome 7 are important in the pathogenesis of hypoplastic left heart syndrome.

  3. The enhancement of 21.2%-power conversion efficiency in polymer photovoltaic cells by using mixed Au nanoparticles with a wide absorption spectrum of 400 nm-1000 nm

    Science.gov (United States)

    Hao, Jing-Yu; Xu, Ying; Zhang, Yu-Pei; Chen, Shu-Fen; Li, Xing-Ao; Wang, Lian-Hui; Huang, Wei

    2015-04-01

    Au nanoparticles (NPs) mixed with a majority of bone-like, rod, and cube shapes and a minority of irregular spheres, which can generate a wide absorption spectrum of 400 nm-1000 nm and three localized surface plasmon resonance peaks, respectively, at 525, 575, and 775 nm, are introduced into the hole extraction layer poly(3,4-ethylenedioxythiophene):poly(4-styrenesulfonate) (PEDOT:PSS) to improve optical-to-electrical conversion performances in polymer photovoltaic cells. With the doping concentration of Au NPs optimized, the cell performance is significantly improved: the short-circuit current density and power conversion efficiency of the poly(3-hexylthiophene): [6,6]-phenyl-C60-butyric acid methyl ester cell are increased by 20.54% and 21.2%, reaching 11.15 mA·cm-2 and 4.23%. The variations of optical, electrical, and morphology with the incorporation of Au NPs in the cells are analyzed in detail, and our results demonstrate that the cell performance improvement can be attributed to a synergistic reaction, including: 1) both the localized surface plasmon resonance- and scattering-induced absorption enhancement of the active layer, 2) Au doping-induced hole transport/extraction ability enhancement, and 3) large interface roughness-induced efficient exciton dissociation and hole collection. Project supported by the National Basic Research Program of China (Grant Nos. 2015CB932202 and 2012CB933301), the National Natural Science Foundation of China (Grant Nos. 61274065, 51173081, 61136003, BZ2010043, 51372119, and 51172110), the Science Fund from the Ministry of Education of China (Grant No. IRT1148), the Specialized Research Fund for the Doctoral Program of Higher Education of China (Grant No. 20113223110005), the Priority Academic Program Development of Jiangsu Provincial Higher Education Institutions (Grant No. YX03001), and the National Synergistic Innovation Center for Advanced Materials and the Synergetic Innovation Center for Organic Electronics and

  4. Isotopic generator for 212Pb and 212Bi

    International Nuclear Information System (INIS)

    A large potential exists for the use of short lived alpha emitting isotopes for therapeutic purposes. Most prior research has been performed with isotopes such as 211At which require a cyclotron for production. It obviously would be more convenient to use a long lived isotopic generator system. For this reason, we have undertaken a study of the properties of several such generators, one of which, 228Th, is described here

  5. Local Tumor Control, Visual Acuity, and Survival After Hypofractionated Stereotactic Photon Radiotherapy of Choroidal Melanoma in 212 Patients Treated Between 1997 and 2007

    International Nuclear Information System (INIS)

    Purpose: To evaluate long-term local tumor control, visual acuity, and survival after hypofractionated linear accelerator-based stereotactic photon radiotherapy in patients with choroidal melanoma. Methods and Materials: Between 1997 and 2007, 212 patients with choroidal melanoma unsuitable for ruthenium-106 brachytherapy or local resection were treated stereotactically at a linear accelerator with 6-MV photon beams at the Medical University of Vienna in five fractions over 7 days. Twenty-four patients received a total dose of 70 Gy (five fractions of 14 Gy), 158 a total dose of 60 Gy (five fractions of 12 Gy) and 30 patients a total dose of 50 Gy (five fractions of 10 Gy) applied on the 80% isodose. Ophthalmologic examinations were performed at baseline and every 3 months in the first 2 years, every 6 months until 5 years, and once a year thereafter until 10 years after radiotherapy. Assessment of visual acuity, routine ophthalmologic examinations, and measurement of tumor base dimension and height using standardized A-scan and B-scan echography were done at each visit. Funduscopy and fluorescein angiography were done when necessary to document tumor response. Results: Median tumor height and volume decreased from 4.8 mm and 270.7 mm3 at baseline to 2.6 mm and 86.6 mm3 at the last individual follow-up, respectively (p < 0.001, p < 0.001). Median visual acuity decreased from 0.55 at baseline to hand motion at the last individual follow-up (p < 0.001). Local tumor control was 95.9% after 5 years and 92.6% after 10 years. Thirty-two patients developed metastatic disease, and 22 of these patients died during the follow-up period. Conclusion: Hypofractionated stereotactic photon radiotherapy with 70 to 50 Gy delivered in five fractions in 7 days is sufficient to achieve excellent local tumor control in patients with malignant melanoma of the choroid. Disease outcome and vision are comparable to those achieved with proton beam radiotherapy. Decreasing the total dose

  6. Health and exercise-related medical issues among 1,212 ultramarathon runners: baseline findings from the Ultrarunners Longitudinal TRAcking (ULTRA Study.

    Directory of Open Access Journals (Sweden)

    Martin D Hoffman

    Full Text Available Regular exercise is associated with substantial health benefits; however, little is known about the health impact of extreme levels of exercise. This study examined the prevalence of chronic diseases, health-care utilization, and risk factors for exercise-related injuries among ultramarathon runners. Retrospective, self-reported enrollment data from an ongoing longitudinal observational study of 1,212 active ultramarathon runners were analyzed. The most prevalent chronic medical conditions were allergies/hay fever (25.1% and exercise-induced asthma (13.0%, but there was a low prevalence of serious medical issues including cancers (4.5%, coronary artery disease (0.7%, seizure disorders (0.7%, diabetes (0.7%, and human immunodeficiency virus (HIV infection (0.2%. In the year preceding enrollment, most (64.6% reported an exercise-related injury that resulted in lost training days (median of 14 days, but little nonattendance of work or school due to illness, injury, or exercise-related medical conditions (medians of 0 days for each. The knee was the most common area of exercise-related injury. Prior year incidence of stress fractures was 5.5% with most (44.5% involving the foot. Ultramarathon runners who sustained exercise-related injuries were younger (p<0.001 and less experienced (p<0.01 than those without injury. Stress fractures were more common (p<0.01 among women than men. We conclude that, compared with the general population, ultramarathon runners appear healthier and report fewer missed work or school days due to illness or injury. Ultramarathon runners have a higher prevalence of asthma and allergies than the general population, and the prevalence of serious medical issues was nontrivial and should be recognized by those providing medical care to these individuals. Ultramarathon runners, compared with shorter distance runners, have a similar annual incidence of exercise-related injuries but higher proportion of stress fractures involving

  7. 3′-hydroxy-3,4,5,4′-tetramethoxystilbene, the metabolite of resveratrol analogue DMU-212, inhibits ovarian cancer cell growth in vitro and in a mice xenograft model

    Science.gov (United States)

    Piotrowska-Kempisty, Hanna; Ruciński, Marcin; Borys, Sylwia; Kucińska, Małgorzata; Kaczmarek, Mariusz; Zawierucha, Piotr; Wierzchowski, Marcin; Łażewski, Dawid; Murias, Marek; Jodynis-Liebert, Jadwiga

    2016-01-01

    In screening studies, the cytotoxic activity of four metabolites of resveratrol analogue 3,4,5,4′-tetramethoxystilbene (DMU-212) against A-2780 and SKOV-3 ovarian cancer cells was investigated. The most active metabolite, 3′-hydroxy-3,4,5,4′-tetramethoxystilbene (DMU-214), was chosen for further studies. The cytotoxicity of DMU-214 was shown to be higher than that of the parent compound, DMU-212, in both cell lines tested. Since DMU-212 was supposed to undergo metabolic activation through its conversion to DMU-214, an attempt was made to elucidate the mechanism of its anti-proliferative activity. We found that in SKOV-3 cells lacking p53, DMU-214 induced receptor-mediated apoptosis. In A-2780 cell line with expression of wild-type p53, DMU-214 modulated the expression pattern of p53-target genes driving intrinsic and extrinsic apoptosis pathways, as well as DNA repair and damage prevention. Regardless of the up-regulation of p48, p53R2, sestrins and Gaad45 genes involved in cancer cell DNA repair, we demonstrated the stronger anti-proliferative and pro-apoptotic effects of DMU-214 in A-2780 cells when compared to those in SKOV-3. Hence we verified DMU-214 activity in the xenograft model using SCID mice injected with A-2780 cells. The strong anti-proliferative activity of DMU-214 in the in vivo model allowed to suggest the tested compound as a potential therapeutic in ovarian cancer treatment. PMID:27585955

  8. Effects of WIN 55,212-2 (a non-selective cannabinoid CB1 and CB2 receptor agonist) on the protective action of various classical antiepileptic drugs in the mouse 6 Hz psychomotor seizure model

    OpenAIRE

    Florek-Luszczki, Magdalena; Wlaz, Aleksandra; Kondrat-Wrobel, Maria W.; Tutka, Piotr; Jarogniew J Luszczki

    2014-01-01

    The aim of this study was to characterize the influence of WIN 55,212-2 (WIN—a non-selective cannabinoid CB1 and CB2 receptor agonist) on the anticonvulsant effects of various classical antiepileptic drugs (clobazam, clonazepam, phenobarbital and valproate) in the mouse 6 Hz-induced psychomotor seizure model. Limbic (psychomotor) seizure activity was evoked in albino Swiss mice by a current (32 mA, 6 Hz, 3 s stimulus duration) delivered via ocular electrodes. Drug-related adverse effects were...

  9. A randomized, multicentre study of directed daylight exposure times of 11/2 vs. 21/2 h in daylight-mediated photodynamic therapy with methyl aminolaevulinate in patients with multiple thin actinic keratoses of the face and scalp

    DEFF Research Database (Denmark)

    Wiegell, S.R.; Fabricius, S.; Philipsen, P.A.;

    2011-01-01

    Background: Actinic keratoses (AKs) are common dysplastic skin lesions that may differentiate into invasive squamous cell carcinomas. Although a superior cosmetic outcome of photodynamic therapy (PDT) is advantageous compared with equally effective treatments such as cryotherapy and curettage, the...... entire treatment area. Immediately after, patients left the clinic and exposed themselves to daylight according to the randomization. Daylight exposure was monitored with a wristwatch dosimeter and patients scored their pain sensation during treatment. Results: The mean lesion response rate at 3 months...... was 77% in the 11/2-h group and 75% in the 21/2-h group (P = 0·57). The mean duration of daylight exposure was 131 and 187 min in the two groups. The mean overall effective light dose was 9·4 J cm (range 0·2-28·3). Response rate was not associated with effective daylight dose, exposure duration...

  10. Chronic co-administration of the cannabinoid receptor agonist WIN55,212-2 during puberty or adulthood reverses 3,4 methylenedioxymetamphetamine (MDMA)-induced deficits in recognition memory but not in effort-based decision making.

    Science.gov (United States)

    Schulz, Sybille; Becker, Thorsten; Nagel, Ulrich; von Ameln-Mayerhofer, Andreas; Koch, Michael

    2013-05-01

    Cannabis and 3,4 methylenedioxymetamphetamine (MDMA, "ecstasy") are the most frequently combined illegal drugs among young adults in western societies. This study examined the effects of chronic co-administration of the cannabinoid receptor agonist WIN55,212-2 (WIN) and MDMA on working memory and effort-based decision making in rats. Treatment consisted of MDMA (7.5 mg/kg), WIN (1.2 mg/kg), a combination of these substances (MDMA+WIN) or vehicle over a period of 25 days during puberty (PD40-65) or adulthood (PD80-105). Ten days after the last treatment, WIN reversed MDMA-induced working memory deficits in the object recognition test in animals treated during adulthood or puberty, but had no influence on impairment of adult rats in the effort-based T-maze task. No differences were observed between groups of pubertally treated rats in the decision making task. During a subsequent acute drug challenge MDMA and MDMA+WIN decreased high reward choices in both age groups, indicating MDMA-induced cost-aversive choice. Differential long-term interactions on the neuronal level in the hippocampus and MDMA-induced disturbances in cortico-limbic connections are suggested. PMID:23541493

  11. Evaluation of a Wet Chemistry Method for Isolation of Cyclotron Produced [211At]Astatine

    Directory of Open Access Journals (Sweden)

    Shigeki Watanabe

    2013-09-01

    Full Text Available A “wet chemistry” approach for isolation of 211At from an irradiated bismuth target is described. The approach involves five steps: (1 dissolution of bismuth target in conc. HNO3; (2 removal of the HNO3 by distillation; (3 dissolution of residue in 8 M HCl; (4 extraction of 211At from 8 M HCl into DIPE; and (5 extraction of 211At from DIPE into NaOH. Results from 55 “optimized” 211At isolation runs gave recovery yields of approximately 78% after decay and attenuation corrections. An attenuation-corrected average of 26 ± 3 mCi in the target provided isolated (actual yields of 16 ± 3 mCi of 211At. A sixth step, used for purification of 211At from trace metals, was evaluated in seven runs. In those runs, isolated 211At was distilled under reductive conditions to provide an average 71 ± 8% recovery. RadioHPLC analyses of the isolated 211At solutions, both initial and after distillation, were obtained to examine the 211At species present. The primary species of 211At present was astatide, but astatate and unidentified species were also observed. Studies to determine the effect of bismuth attenuation on 211At were conducted to estimate an attenuation factor (~1.33 for adjustment of 211At readings in the bismuth target.

  12. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  13. Astatination of nanoparticles containing silver as possible carriers of 211At

    Czech Academy of Sciences Publication Activity Database

    Lebeda, Ondřej; Kučka, Jan; Hrubý, Martin; Koňák, Čestmír; Kozempel, Ján

    2006-01-01

    Roč. 64, - (2006), s. 201-206. ISSN 0969-8043 R&D Projects: GA AV ČR KJB4048302; GA AV ČR KJB4050408 Institutional research plan: CEZ:AV0Z1048901 Keywords : nanoparticles * 211AT * Atalpha particle therapy Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.924, year: 2006

  14. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  15. Measurement of the 115In(n,γ)116 m In reaction cross-section at the neutron energies of 1.12, 2.12, 3.12 and 4.12 MeV

    Science.gov (United States)

    Lawriniang, Bioletty Mary; Badwar, Sylvia; Ghosh, Reetuparna; Jyrwa, Betylda; Vansola, Vibha; Naik, Haladhara; Goswami, Ashok; Naik, Yeshwant; Datrik, Chandra Shekhar; Gupta, Amit Kumar; Singh, Vijay Pal; Pol, Sudir Shibaji; Subramanyam, Nagaraju Balabenkata; Agarwal, Arun; Singh, Pitambar

    2015-08-01

    The 115In(n,γ)116 m In reaction cross section at neutron energies of 1.12, 2.12, 3.12 and 4.12 MeV was determined by using an activation and off-line γ-ray spectrometric technique. The monoenergetic neutron energies of 1.12 - 4.12 MeV were generated from the 7Li(p,n) reaction by using proton beam with energies of 3 and 4 MeV from the folded tandem ion beam accelerator (FOTIA) at Bhabha Atomic Research Centre (BARC) and with energies of 5 and 6 MeV from the Pelletron facility at Tata Institute of Fundamental Research (TIFR), Mumbai. The 197Au(n,γ)198Au reaction cross-section was used as the neutron flux monitor.The 115In(n,γ)116 m In reaction cross section at neutron energies of 1.12, 2.12, 3.12 and 4.12 MeV was determined by using an activation and off-line γ-ray spectrometric technique. The monoenergetic neutron energies of 1.12 - 4.12 MeV were generated from the 7Li(p,n) reaction by using proton beam with energies of 3 and 4 MeV from the folded tandem ion beam accelerator (FOTIA) at Bhabha Atomic Research Centre (BARC) and with energies of 5 and 6 MeV from the Pelletron facility at Tata Institute of Fundamental Research (TIFR), Mumbai. The 197Au(n,γ)198 Au reaction cross-section was used as the neutron flux monitor. The 115In(n,γ)116 m In reaction cross-sections at neutron energies of 1.12 - 4.12 MeV were compared with the literature data and were found to be in good agreement with one set of data, but not with others. The 115In(n,γ)116 m In cross-section was also calculated theoretically by using the computer code TALYS 1.6 and was found to be slightly lower than the experimental data from the present work and the literature.)198Au reaction cross-section was used as the neutron flux monitor. The 115In(n,γ)116 m In reaction cross-sections at neutron energies of 1.12 - 4.12 MeV were compared with the literature data and were found to be in good agreement with one set of data, but not with others. The 115In(n,γ)116 m In cross-section was also calculated

  16. 42 CFR 2.12 - Applicability.

    Science.gov (United States)

    2010-10-01

    ... abuse and neglect. The restrictions on disclosure and use in these regulations do not apply to the reporting under State law of incidents of suspected child abuse and neglect to the appropriate State or... proceedings which may arise out of the report of suspected child abuse and neglect. (d) Applicability...

  17. Calidad de Imagen del Telescopio UNAM212

    Science.gov (United States)

    Cobos, F. J.; Teiada de Vargas, C.

    1987-05-01

    El telescopio UNAM2l2, del Observatorio Astronómico Nacional, situado en la Sierra de San Pedro Mártir (Baja California, México), cumplira en un futuro muy cercano siete años de uso para fines de investigación astronómica. Aunque en este tiempo no se ha efectuado un estudio sistemático acerca de su comportamiento óptico y de los factores que influyen en la calidad de las imágenes, se han realizado pruebas diversas, estudios parciales y reuniones especificas, cuyos resultados no siempre se han difundido ampliamente y generalmente no se han presentado por escrito. Es por ello que hemos creido necesario intentar una recopilación de la información existente para poder con ella establecer un diagnóstjco que, aunque no sea definitivo, sirva de base para futuros trabajos tendientes a optimizar el comportamiento óptico del telescopio. Es evidente que un buen número de las conclusiones que se presentan son resultado del trabajo de muchas personas ó de esfuerzos colectivos. Asimismo, hemos tratado de localizar información bibliográfica que pueda ser de utilidad. Nuestro objetivo primordial ha consistido en centrarnos en la óptica del telescopio y su calidad, pero también se han considerado otros aspectos que puedan afectar las imágenes obtenidas tales como: celda del primario, `seeing' local y externo, flexiones posibles en la estructura mecánica del telescopio, etc.

  18. 19 CFR 10.212 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... free of duty and free of any quantitative limitations as provided in 19 U.S.C. 3721. Wholly assembled... machines. “Wholly formed on seamless knitting machines,” when used to describe apparel articles, has... machine to result in that article. When taken from the knitting machine, an apparel article created...

  19. 42 CFR 412.212 - National rate.

    Science.gov (United States)

    2010-10-01

    ... discharge classified within a DRG, the national rate equals the product of— (1) The national average... under § 412.60(b)) for that DRG. (d) Adjusting for different area wage levels. CMS adjusts...

  20. 49 CFR 212.217 - Car inspector.

    Science.gov (United States)

    2010-10-01

    ... (ii) The Freight Car Safety Standards (49 CFR part 215), Safety Glazing Standards (49 CFR part 223), Safety Appliance Standards (49 CFR part 231) and Power Brake Standards (49 CFR part 232); (3) The... Safety Standards (49 CFR part 215), Safety Glazing Standards (49 CFR part 223), Safety...

  1. 40 CFR 21.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ....S.C. 1151, et seq. (f) Pollutant means dredged spoil, solid waste, incinerator residue, sewage..., wrecked or discarded equipment, rock, sand, cellar dirt and industrial, municipal, and agricultural waste... CFR part 121, and regulations of the Small Business Administration promulgated thereunder. (b)...

  2. ACCT 212 Course Tutorial/TutorialRank

    OpenAIRE

    loovi

    2015-01-01

    For more course tutorials visit www.tutorialrank.com Tutorial Purchased: 3 Times, Rating: A (TCO 1) The Accounting Equation is used to develop the organizations financial reports. (1) Describe what owners' equity values would be if Assets are $100,000 and Liabilities are $27,000 by showing the Accounting Equation (10 points) and (2) provide an explanation of what accounts could be found in owners' equity. (10 points)  (TCO 1) The financial statements present a compan...

  3. 43 CFR 17.212 - Employment criteria.

    Science.gov (United States)

    2010-10-01

    ..., manual, or speaking skills the test results accurately reflect the applicant's or employee's job skills... shown to be job-related for the position in question, and (2) alternative job-related tests or criteria... test purports to measure). (c) All job qualifications must be shown to be directly related to the...

  4. 42 CFR 59.212 - Grantee accountability.

    Science.gov (United States)

    2010-10-01

    ... due pursuant to subparts F, M, and O of 45 CFR part 74. Such total sum shall constitute a debt owed by... Intergovernmental Cooperation Act of 1968 (42 U.S.C. 4213), a State will not be held accountable for interest earned... the Intergovernmental Cooperation Act, means any one of the several States, the District of...

  5. 5 CFR 842.212 - Deferred retirement.

    Science.gov (United States)

    2010-01-01

    ... this section, an employee or Member who has not attained the minimum retirement age, and who, after... following the date on which the individual attains the minimum retirement age or, if later, (ii) A date the... retirement age, and is reemployed before filing an application for retirement based on that separation,...

  6. PSYCHIATRIC DISORDER21.2.Schizophrenia

    Institute of Scientific and Technical Information of China (English)

    1995-01-01

    950421 A study on therapeutic efficacy,side effectsand correlation between plasma concentration andtherapeutic effect of haloperridol decanoate on treat-ment of schizophrenia.ZHANG Hongyan(张鸿燕),etal.Ment Health Instit,Beijing Med Univ,Beijing,100083.Chin J Neurol & Psychiat 1994;27(5):283-285.Haloperidol decanoate (HD) was conducted in treat-ing 83 schizophrenics in nine hospitals for 24 weeks,meanwhile plasma drug concentration was measured.The results show that therapeutic effectiveness of HDis saticfactory in more than 50%;the static plasmaconcentration in recovery and obviously improved pa-

  7. 21.PSYCHIATRIC DISORDER 21.2.Schizophrenia

    Institute of Scientific and Technical Information of China (English)

    1992-01-01

    920198 Kinetic observation of serum thyr-onormone level in schizophrenics.WANGXueyi (王学义),et al.Psychiatr Hosp,KailuanCoal Mining Administration,Tangshan,063001.Chin J Neurol & Psychiat 1991; 24 (5): 268-271.Measurements of serum T3,T4,RUR and FT4I

  8. 27 CFR 28.212 - Persons authorized.

    Science.gov (United States)

    2010-04-01

    ... plants, bonded wine cellars, or taxpaid wine bottling houses, and persons who are wholesale liquor... OF THE TREASURY LIQUORS EXPORTATION OF ALCOHOL Exportation of Wine With Benefit of Drawback §...

  9. 45 CFR 212.3 - Eligible person.

    Science.gov (United States)

    2010-10-01

    ... because of war, threat of war, invasion, or similar crisis. Such statement shall, if possible, incorporate... war, threat of war, invasion, or similar crisis, a determination by the Department of State that such... his return to, or entry into the United States; and (c) He is without resources immediately...

  10. 32 CFR 212.6 - Procedures.

    Science.gov (United States)

    2010-07-01

    .... (i) No person because of race, color, creed, sex, age, disability, or national origin shall be... and salaries as employees of the non-Federal entity or as award recognition for services rendered to... be self-sustaining, primarily through dues, contributions, service charges, fees, or...

  11. 36 CFR 212.1 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... purchase unit, a land utilization project, Columbia River Gorge National Scenic Area, Land Between the..., measuring, and accepting completed work. Designated road, trail, or area. A National Forest System road, a...), as amended; 49 U.S.C. 1105(b)(3). Forest road and trail funds. Funds authorized or appropriated...

  12. 31 CFR 538.212 - Exempt transactions.

    Science.gov (United States)

    2010-07-01

    ... authorize transactions incident to the exportation of software subject to the Export Administration Regulations, 15 CFR parts 730-774, or to the exportation of goods, technology or software for use in the... agricultural commodities listed in appendix A to this part 538), medicine, and medical devices. Note to §...

  13. 24 CFR 1710.212 - Financial information.

    Science.gov (United States)

    2010-04-01

    ... statements shall be prepared in accordance with generally accepted accounting principles as prescribed by the Financial Accounting Standards Board and generally accepted auditing standards as prescribed by the American... URBAN DEVELOPMENT (INTERSTATE LAND SALES REGISTRATION PROGRAM) LAND REGISTRATION Reporting...

  14. The biokinetics of alpha-particle emitting radiopharmaceuticals

    International Nuclear Information System (INIS)

    The past two decades have seen wide interest in the application of alpha-particle emitting radionuclides for targeted endoradiotherapy and a large number of compounds labeled with 211At (T1/2 7.21 h), 212Bi (T1/2 1 h) or 213Bi (T1/2 0.78 h) have been studied. Knowledge of the biokinetic behaviour of such agents is important both for their optimal clinical exploitation and for general radiological protection purposes. Animal studies of the distribution and retention of 211At compounds, including ionic astatide, substituted aromatic compounds and labelled monoclonal antibodies, have provided new information on the biochemistry of astatine. With respect the thyroid gland the uptake of the astatide ion has been shown to be very much lower than that of the iodide ion. Less information is available for 212Bi-labelled radiopharmaceuticals. The available data for both 211At and 212Bi radiopharmaceuticals are reviewed. Cautious generic biokinetic models for inorganic and simple organic compounds of 211At and 212Bi; for [211At]-, and [212Bi]-biphosphonates and for [211At]-, and [212Bi]-monoclonal antibodies, are proposed for use in general radiological protection when compound-specific data are not available. (orig.)

  15. The biokinetics of alpha-particle emitting radiopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    Taylor, D.M. [School of Chemistry, Cardiff Univ., Cardiff (United Kingdom); Duffield, J.R. [Faculty of Applied Sciences, Univ. of the West of England, Bristol (United Kingdom)

    2005-07-01

    The past two decades have seen wide interest in the application of alpha-particle emitting radionuclides for targeted endoradiotherapy and a large number of compounds labeled with {sup 211}At (T{sup 1}/{sub 2} 7.21 h), {sup 212}Bi (T{sup 1}/{sub 2} 1 h) or {sup 213}Bi (T{sup 1}/{sub 2} 0.78 h) have been studied. Knowledge of the biokinetic behaviour of such agents is important both for their optimal clinical exploitation and for general radiological protection purposes. Animal studies of the distribution and retention of {sup 211}At compounds, including ionic astatide, substituted aromatic compounds and labelled monoclonal antibodies, have provided new information on the biochemistry of astatine. With respect the thyroid gland the uptake of the astatide ion has been shown to be very much lower than that of the iodide ion. Less information is available for {sup 212}Bi-labelled radiopharmaceuticals. The available data for both {sup 211}At and {sup 212}Bi radiopharmaceuticals are reviewed. Cautious generic biokinetic models for inorganic and simple organic compounds of {sup 211}At and {sup 212}Bi; for [{sup 211}At]-, and [{sup 212}Bi]-biphosphonates and for [{sup 211}At]-, and [{sup 212}Bi]-monoclonal antibodies, are proposed for use in general radiological protection when compound-specific data are not available. (orig.)

  16. Coordination chemistry of the sup 212 Pb/ sup 212 Bi nuclear transformation: Alpha-emitting radiopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    Parks, N.J.; Harris, W.R.; Keen, C.L.; Cooper, S.R.

    1992-07-01

    Subdivisions of this project are: (a) the synthesis of prototypical thiolate and dithiocarbamate based hexacoordinate complexes, (b) radiochemical engineering for generation of no-carrier-added lead and bismuth radioelements, (c) the first isolation of bismuth-binding proteins from in vivo studies with cyclotron produced {sup 205/206}Bi tracer, and (d) initial development of transport mechanisms for the intracellular radiobiological study of alpha emitting bismuth, and (e) the initiation of chemical equilibrium studies and biochemical pathways with cyclotron-produced, no-carrier-added, {sup 203}Pb (T{sub 1/2} = 51 hr).

  17. Coordination chemistry of the 212Pb/212Bi nuclear transformation: Alpha-emitting radiopharmaceuticals

    International Nuclear Information System (INIS)

    Subdivisions of this project are: (a) the synthesis of prototypical thiolate and dithiocarbamate based hexacoordinate complexes, (b) radiochemical engineering for generation of no-carrier-added lead and bismuth radioelements, (c) the first isolation of bismuth-binding proteins from in vivo studies with cyclotron produced 205/206Bi tracer, and (d) initial development of transport mechanisms for the intracellular radiobiological study of alpha emitting bismuth, and (e) the initiation of chemical equilibrium studies and biochemical pathways with cyclotron-produced, no-carrier-added, 203Pb (T1/2 = 51 hr)

  18. Density functional theory studies of (TiO2)12 quantum ring and its electronic properties when doped with transition metal compounds%(TiO2)12量子环及过渡金属化合物掺杂对其电子性质影响的密度泛函理论研究

    Institute of Scientific and Technical Information of China (English)

    杨振清; 白晓慧; 邵长金

    2015-01-01

    In this paper, we have designed a new (TiO2)12 quantum ring structure and studied its geometry, average binding energy, and the electron density distributions using the generalized gradient approximation (GGA), which is based on the density functional theory (DFT) with the first-principles calculations. This new quantum ring structure is doped with transition metal compounds MoS2, MoSe2, MoTe2, WS2, WSe2 and WTe2 respectively, to modify its properties. Thus we can calculate and analyze their geometrics and electronic properties (such as average binding energies, energy levels, electronic density of states and the HOMO-LUMO electron density distributionsatc). We find that the (TiO2)12 quantum ring with a diameter of 1.059 nm seems to be of a two-dimensional structure with a center symmety which ensurs it a stable structure. In addition, the HOMO-LUMO orbital electron density in the quantum ring distributes evenly, and its energy gap is 3.17 eV which is very close to the experimental value of TiO2 semiconductor materials (3.2 eV). The energy gaps decrease substantially after introducing the transition metal compounds into the quantum ring. Among these results, the ring doped with WTe2 has the smallest energy gap (0.61 eV), and that with MoTe2 has the biggest energy gap (1.16 eV), but it is still smaller by about 2 eV than that of the (TiO2)12 quantum ring. Furthermore, other doping results have energy gap variation around 1 eV. The TiO2 clusters with this energy gap could make use most of the solar energy and so expand applications of TiO2.%本文采用第一性原理中基于密度泛函理论(DFT)的广义梯度近似(GGA)方法,设计了一种新的(TiO2)12量子环结构,研究了它的几何结构、平均结合能及电子云分布等属性.在此新型结构的基础上,分别采用过渡金属化合物MoS2, MoSe2, MoTe2, WS2, WSe2和WTe2进行掺杂,并分析了掺杂后体系的几何结构及电子属性(如平均结合能、能级结构、HOMO-LUMO轨道

  19. Quinoxaline–3-aminophenol–water (2/1/2

    Directory of Open Access Journals (Sweden)

    Maria Gdaniec

    2008-05-01

    Full Text Available The asymmetric unit of the title compound, 2C8H6N2·C6H7NO·2H2O, contains two quinoxaline molecules, one molecule of 3-aminophenol and two water molecules which are hydrogen bonded to form a two-dimensional polymeric structure. Each of the symmetry-independent quinoxaline molecules forms separate stacks of different symmetry. In one set of stacks, the molecules are related by a screw axis and are slightly tilted [dihedral angle = 7.12 (1°]. In the second set of stacks, adjacent molecules are parallel and related by an inversion center [interplanar distances = 3.376 (4 and 3.473 (4 Å].

  20. Dicty_cDB: SSJ212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ATTCATAAATAAATAAAAAACAATAATAAA sequence update 1998.12.21 Translated Amino Acid sequence tkkkkkkke*naisstlff*il*r*i*iqtcnftir...c*vanyinkgyli*n ns*inkkq** Frame B: tkkkkkkke*naisstlff*il*r*i*iqtcnftirniipypkrc

  1. Dicty_cDB: SHG212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available XPXKA Translated Amino Acid sequence (All Frames) Frame A: ---GXAVGXAXGGAXAXGXFXFGGKKXXXYWKXXQGXSKXPXKA Frame B: ---gxxlxxlxxgxxxxgx...2002. 9.10 Translated Amino Acid sequence ---GXAVGXAXGGAXAXGXFXFGGKKXXXYWKXXQGXSK...lxlvxkxxxxtgxxxkxxxrxxxk Frame C: ---gcxwxcxwxgxcxwgfxfwwxkxxxllexxxrxfxgpxks Homolo

  2. 8 CFR 212.1 - Documentary requirements for nonimmigrants.

    Science.gov (United States)

    2010-01-01

    ... Free Trade Agreement (NAFTA) pursuant to section 101(a)(15)(E) of the Act, shall be in possession of a... with the treaty concluded on February 3, 1944, between the United States and Mexico regarding the... classes: (a) Citizens of Canada or Bermuda, Bahamian nationals or British subjects resident in...

  3. 31 CFR 31.212 - Personal conflicts of interest.

    Science.gov (United States)

    2010-07-01

    ... from each of them in writing about their personal, business, and financial relationships, as well as..., valuation, management, or disposition of troubled assets, the information shall be no less extensive than.... (d) Initial Certification. No later than ten business days after the effective date of...

  4. 释疑解惑第212

    Institute of Scientific and Technical Information of China (English)

    薄冰; 司树森

    2010-01-01

    问[931]joycesue17(joycesue17@sina.com)在阅读中我不止一次见到这样的句子:The situation is, if anything, worsening rather than improving.我不知道if anything是什么意思,又其用法如何?请解释一下,谢谢!

  5. 40 CFR 156.212 - Personal protective equipment statements.

    Science.gov (United States)

    2010-07-01

    ... type of equipment other than the product container may be used to mix, load, or apply the product, and....” (2) If the application of the product may result in overhead exposure to any handler (for example... Personal protective equipment statements. (a) Requirement. Each product shall bear the personal...

  6. 2-{1-[(2-Nitrobenzenesulfonamidomethyl]cyclohexyl}acetic acid

    Directory of Open Access Journals (Sweden)

    Nosheen Kanwal

    2012-01-01

    Full Text Available In the title compound, C15H20N2O6S, the C—SO2—NH—C torsion angle is 64.54 (14°. In the molecule, there is a bifurcated N—H...(O,O hydrogen bond, forming S(7 rings. In the crystal, inversion dimers are formed via O—H...O hydrogen bonds involving the carboxyl group, so forming R22(8 rings. These dimers are further linked via pairs of C—H...O hydrogen bonds, forming a C(6 chain propagating along the c-axis direction.

  7. 2-{1-[(2-Nitrobenzenesulfonamido)methyl]cyclohexyl}acetic acid

    OpenAIRE

    Nosheen Kanwal; Erum Akbar Hussain; Onur Şahin; Orhan Büyükgüngör

    2012-01-01

    In the title compound, C15H20N2O6S, the C—SO2—NH—C torsion angle is 64.54 (14)°. In the molecule, there is a bifurcated N—H...(O,O) hydrogen bond, forming S(7) rings. In the crystal, inversion dimers are formed via O—H...O hydrogen bonds involving the carboxyl group, so forming R22(8) rings. These dimers are further linked via pairs of C—H...O hydrogen bonds, forming a C(6) chain propagating along the c-axis direct...

  8. Dicty_cDB: SFI212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available equence (All Frames) Frame A: tvgllxkhnk*frfgiiikllffkksnisiiylfiiyinqq*rkmnfreldtsngvkaae ssfrtkvvlareipwngfassnsitseqynlis...ts) Value EF677695_1( EF677695 |pid:none) Picea sitchensis clone WS02773_D06... 168 3e-40 AY225129_1( AY225129 |pid:none) Suaeda mari...kyftsiixlis*ysiii*nylcnlvinl**rycsslfrnwfsckfsstrqncs qgkdc*iiii...krlldyhyqp*eif*tmvrvtkk*simvsfvc*if*ilkngvmmifqlilkf*lmvllk ilii*vhliniklklfqvn*nghqfinqrdsgkris...21 AL844507 |AL844507.1 Plasmodium falciparum chromosome 8. 42 2e-09 26 AC116986 |AC116986.2 Dictyostelium dis

  9. Subtask 2.12 - Air Quality Assessment and Control

    Energy Technology Data Exchange (ETDEWEB)

    Laura Raymond

    2007-07-30

    Past particulate matter (PM) research projects conducted at the Energy & Environmental Research Center included data on PM size, morphology, and chemistry. The objective of this project was to improve automated analysis capabilities of the scanning electron microscope (SEM) equipped with an energy-dispersive spectrometer. The SEM is now able to perform particle-by-particle analysis on the desired number of particles and provide size, morphology, and chemistry information for each particle. A new x-ray and image analysis system was purchased and implemented for improvements to data acquisition and analysis. This new analysis system is equipped with a digital-pulse processor, allowing for the determination of pixel-by-pixel chemistry, which significantly enhances our ability to characterize PM and other materials. In addition, this system is personal computer-based, which allows programming of the SEM to perform the automated image analysis along with detailed chemical information. This permits the incorporation of particle classification algorithms within the same computer system as the analysis is conducted. Additionally, the new Spirit software can now integrate full SEM control with imaging, elemental identification, and electron backscatter diffraction (EBSD) operation. The EBSD system has also allowed for phase identification within the SEM. Reexamination of previous samples collected on a polycarbonate filter for ambient-air PM2.5 analysis has shown that crystalline identification of individual particles can be done without further sample preparation or modification of the sample and/or sampling substrate.

  10. Dicty_cDB: CHC212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce nqqr*innklrc*hsnn*kkpkkisllmkinselhqamkp*wklsri*kprttefqslkm klml*iyy*mesqkvlkscalavvplmksvsrkfisvmilhsst...c*hsnn*kkpkkisllmkinselhqamkp*wklsri*kprttefqslkm klml*iyy*mesqkvlkscalavvplmksvsrkfisvmilhsstfikrf*lyqlinkl...**itrxk elnnsvyhv--- ---tnkgk*iin*dvniqtikrnrkrfhc**k*iqsctkq*nl*wklsri*kprttefqs lkmklml*iyy*mesqkvlkscalav

  11. 50 CFR 660.212 - Fixed gear fishery-prohibitions.

    Science.gov (United States)

    2010-10-01

    ... vessel subject to subparts C and E a set net, trap or pot, longline, or commercial vertical hook-and-line... by Annex V of the International Convention for the Prevention of Pollution From Ships, 1973 (Annex V... permit with a longline or trap (pot) endorsement and longline and/or trap gear onboard in an...

  12. 42 CFR 495.212 - Limitation on review.

    Science.gov (United States)

    2010-10-01

    ... methodology and standards for determining payment amounts and payment adjustments under the MA EHR EP... EHR user, including the means of demonstrating meaningful use and the selection of measures. (b) There... methodology and standards for determining payment amounts and payment adjustments under the MA EHR...

  13. 36 CFR 212.5 - Road system management.

    Science.gov (United States)

    2010-07-01

    ... rules. Rules set forth under 36 CFR part 261 and this section shall apply to all National Forest System... resource and other management objectives adopted in the relevant land and resource management plan (36 CFR... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Road system management....

  14. Breastfeeding Strategy for Northern Ireland (PDF 212 KB)

    OpenAIRE

    Department of Health; Social Services and Public Safety

    2000-01-01

    Northern Ireland has one of the lowest breastfeeding rates in the world. Low breastfeeding rates are associated with considerable morbidity, some mortality and increased health service costs for women and children. In Northern Ireland, several factors make the initiation and maintenance of breastfeeding particularly difficult; these include cultural attitudes, commercial promotion of artificial milks and obstacles for the working mother. The aim of the Strategy is to promote and support br...

  15. Dicty_cDB: AFG212 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ielielpeyvlsllfgsvmfvfififiiiayrfkeidqsvldelngdt pmtddnananskeldvvtqkdlssssnpiinn...nnnnnnstlgns Frame C: kkennyyykkwr*kknhqilvyqhqlii*ghqlmervhlkvnkviwkvlimkflfmegmk iifhhqlnilwvmkfvkgihtml*e

  16. Coordination chemistry of the {sup 212}Pb/{sup 212}Bi nuclear transformation: Alpha-emitting radiopharmaceuticals. Final technical report

    Energy Technology Data Exchange (ETDEWEB)

    Parks, N.J.; Harris, W.R.; Keen, C.L.; Cooper, S.R.

    1992-07-01

    Subdivisions of this project are: (a) the synthesis of prototypical thiolate and dithiocarbamate based hexacoordinate complexes, (b) radiochemical engineering for generation of no-carrier-added lead and bismuth radioelements, (c) the first isolation of bismuth-binding proteins from in vivo studies with cyclotron produced {sup 205/206}Bi tracer, and (d) initial development of transport mechanisms for the intracellular radiobiological study of alpha emitting bismuth, and (e) the initiation of chemical equilibrium studies and biochemical pathways with cyclotron-produced, no-carrier-added, {sup 203}Pb (T{sub 1/2} = 51 hr).

  17. 8 CFR 212.9 - Applicability of section 212(a)(32) to certain derivative third and sixth preference and...

    Science.gov (United States)

    2010-01-01

    ... visa or for adjustment of status under section 245 of the Act, whether or not such derivative immigrant... is the spouse or child of a qualified third or sixth preference or nonpreference immigrant and who is... medical profession. Therefore, a derivative third or sixth preference or nonpreference immigrant...

  18. Alpha particle emitters in medicine

    International Nuclear Information System (INIS)

    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 (211At) and natural bismuth-212 (212Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 (223Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs

  19. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  20. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE,CERN

    OpenAIRE

    Rothe, Sebastian

    2012-01-01

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spec...

  1. Inactivation of human osteosarcoma cells in vitro by {sup 211}At-TP-3 monoclonal antibody: Comparison with astatine-211 and external-beam X rays

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, R.H. [Univ. of Oslo (Norway)]|[Institute for Cancer Research, Oslo (Norway); Bruland, O.S. [Institute for Cancer Research, Oslo (Norway); Hoff, P.; Alstad, J. [Univ. of Oslo (Norway); Lindmo, T. [Institute for Cancer Research, Oslo (Norway); Rofstad, E.K. [Norwegian Institute of Technology, Trondheim (Norway)

    1994-08-01

    The potential usefulness of {alpha}-particle radioimmunotherapy in the treatment of osteosarcoma was studied in vitro by using the monoclonal antibody TP-3 and cells of three human osteosarcoma cell lines (OHS, SAOS and KPDX) differing in antigen expression. Cell survival curves were established after treatment with (a) {sup 211}At-TP-3 of different specific activities, (b) {sup 211}At-labeled bovine serum albumin (BSA), (c) free {sup 211}At and (d) external-beam X rays. The three osteosarcoma cell lines showed similar survival curves, whether treated with external-beam X rays, {sup 211}At-BSA or free {sup 211}At. The D{sub o}`s were lower for free {sup 211}At than for {sup 211}At-BSA. The survival curves for {sup 211}At-TP-3 treatment, on the other hand, differed significantly among the cell lines, suggesting that sensitivity to {sup 211}At-TP-3 treatment was governed by cellular properties other than sensitivity to external-beam X rays. The cellular property most important for sensitivity to {sup 211}At-TP-3 treatment was the antigen expression. Cell inactivation after {sup 211}At-TP-3 treatment increased substantially with increasing specific activity of the {sup 211}At-TP-3. At high specific activities, the cytotoxic effect of {sup 211}At-TP-3 was significantly higher than that of {sup 211}At-BSA. In conclusion, {sup 211}At-TP-3 has the potential to give clinically favorable therapeutic ratios in the treatment of osteosarcoma. 39 refs., 5 figs., 2 tabs.

  2. Immuno-vectorization of radioelements emitters of alpha particles: a new therapy in cancerology

    International Nuclear Information System (INIS)

    The radio-immunotherapy is an anti cancerous therapy which consists in vectorising with immuno-specific agents very radio toxic radioelements on tumors or in their environment to destroy them. The first part of this report presents the different characteristics of antibodies as well as their means of production under monoclonal shapes specifically steered against a tumoral antigen of interest. The second part of this report replaces the importance of the immunological vectors in the context of the nuclear medicine. It is notably described that the different methods which allow to radio-label the vector, as well as the different ways of optimization which were envisaged to improve the targeting of radioelements on a tumor. These different developments allow to define the potential place of the alpha radio-immunotherapy in treatments and so re-place the interest of the experimental part. If the radio-immunotherapy, using beta emitters isotopes as the 131iodine or the90yttrium, is today current in anti cancerous therapy, it finds limits because of the disintegration characteristics of the isotopes it uses. Indeed, compared with alpha particles, the beta particles deposit less energy by unit of length in the crossed material.The experimental part of this report aims at studying the feasibility of the coupling between an immunological vector and an alpha emitter isotope.The different tests led on the bismuth 213, the bismuth 212, the lead 212 and the astatine 211 demonstrated that the fixation of these radionuclides was possible. This research theme is strengthened by the construction in Nantes of a cyclotron with high energy ( A.R.R.O.N.A.X.) and the optimization of the obtained promising results should allow a therapeutic use in oncology of the alpha radio-immunotherapy. (N.C.)

  3. Yeast Interacting Proteins Database: YDL167C, YBR212W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ; localizes to stress granules induced by glucose deprivation; predicted to be involved in ribosome biogenesi... induced by glucose deprivation; predicted to be involved in ribosome biogenesis Rows with this bait...ial porin (POR1) mRNA and enhances its degradation; overexpression impairs mitochondrial function; expressed in station...; overexpression impairs mitochondrial function; expressed in stationary phase Rows with this prey as pre...sed by (YPD) - Not affected by(YPD) - Interologs - Expression similarit

  4. 21 CFR 212.50 - What production and process controls must I have?

    Science.gov (United States)

    2010-04-01

    ..., the name and radioactivity or other measurement of each active pharmaceutical ingredient and each... active pharmaceutical ingredient and each inactive ingredient per batch or per unit of radioactivity...

  5. 36 CFR 212.51 - Designation of roads, trails, and areas.

    Science.gov (United States)

    2010-07-01

    ... administrative use by the Forest Service; (5) Use of any fire, military, emergency, or law enforcement vehicle for emergency purposes; (6) Authorized use of any combat or combat support vehicle for...

  6. AB212. Clinical study on the treatment of lifelong premature ejaculation with Paroxetine hydrochloride and tamsulosin

    Science.gov (United States)

    Li, Yan-Feng; Zhang, Chao; Li, Bo-Jun

    2016-01-01

    Objective There are quite a few researches about SSRIs and alpha-receptor blockers on the treatment of premature ejaculation (PE), but few researches focus on the combination use of them. In this study, we evaluate the efficacy and safety of combine and alone use of paroxetine hydrochloride and tamsulosin on the treatment of lifelong PE. Methods 352 cases of men with 18–65 years of age, a history of lifelong PE and an intra-vaginal ejaculation latency time (IELT) premature ejaculation profile (PEP), the adverse events (AEs) and vital sign measurements were recorded at each visit. All the data were statistically analyzed. Results The reliable data from 322 patients were achieved. The geometric mean IELT in group A was significantly increased from 1.15 to 8.13 min after treatment (Pejaculation, satisfaction with sexual intercourse, ejaculation-related personal distress, and ejaculation-related interpersonal difficulty were significantly improved in all groups after treatment (P<0.001). The mean PEP scores in group C have more significant improvements than that in group A and B (P<0.01). The prevalence of AEs in group A, B, C were 9.26% (10 cases), 3.81% (4 cases) and 8.26% (9 cases), respectively. Conclusions Paroxetine hydrochloride combined with tamsulosin produce more better therapeutic effects than use them separately. It could be a priority for the treatment of lifelong PE.

  7. Tank 241-AX-103, cores 212 and 214 analytical results for the final report

    International Nuclear Information System (INIS)

    This document is the analytical laboratory report for tank 241-AX-103 push mode core segments collected between July 30, 1997 and August 11, 1997. The segments were subsampled and analyzed in accordance with the Tank 241-AX-103 Push Mode Core Sampling and Analysis Plan (TSAP) (Comer, 1997), the Safety Screening Data Quality Objective (DQO) (Dukelow, et al., 1995) and the Data Quality Objective to Support Resolution of the Organic Complexant Safety Issue (Organic DQO) (Turner, et al., 1995). The analytical results are included in the data summary table (Table 1). None of the samples submitted for Differential Scanning Calorimetry (DSC), Total Alpha Activity (AT), plutonium 239 (Pu239), and Total Organic Carbon (TOC) exceeded notification limits as stated in the TSAP (Conner, 1997). The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group in accordance with the Memorandum of Understanding (Schreiber, 1997) and not considered in this report

  8. Assessment of Gastroesophageal Reflux in Children(2-12 Month) Based on Clinical Findings and Ultrasonography

    OpenAIRE

    F Jassemi Zergani; R Farahi Rostami; F Hakim; Z Jannat Alipour; Karimi, K.; Z Fotokian

    2012-01-01

    Introduction: Gastroesophageal reflux is a common gastrointestinal disorder among infants, which can cause complications, such as esophagitis and Barrett's esophagus if its diagnosis and treatment are delayed. On the other hand, similarity of Gastro esophageal Reflux symptoms with symptoms of other childhood diseases makes its diagnosis and treatment difficult. So a proper tool for early screening and diagnostic test is essential. Methods: This study was conducted on 221 infants(2 to 12 month...

  9. Differential Regulation of Behavioral Tolerance to WIN55,212-2 by GASP1

    OpenAIRE

    Martini, Lene; Thompson, Dawn; Kharazia, Viktor; Whistler, Jennifer L.

    2010-01-01

    Cannabinoid agonists have shown some promise clinically as analgesics, in particular for cancer pain, in which they have the additional benefit of decreasing nausea. However, as for most other drugs, the long-term use of cannabinoids is limited by the development of tolerance. Several molecular mechanisms have been proposed to explain drug tolerance, including receptor downregulation. The cannabinoid 1 (CB1) receptors can be downregulated in vitro through an interaction with the G-protein-cou...

  10. From a music therapists' diary 3/12 1996 - 2/12 1997

    DEFF Research Database (Denmark)

    Bergstrøm-Nielsen, Carl

    2009-01-01

    Graphic sketches made within a period of one year. They were made right after the sessions. Purpose was to investigate possibilities in graphic representation and to let various observarions and thoughts about the therapy become graspable. Around one third of the total quantity has been selected ...

  11. 48 CFR 52.212-4 - Contract Terms and Conditions-Commercial Items.

    Science.gov (United States)

    2010-10-01

    ... at 5 CFR part 1315. (3) Electronic Funds Transfer (EFT). If the Government makes payment by EFT, see...) and Office of Management and Budget (OMB) prompt payment regulations at 5 CFR part 1315. (h) Patent... accordance with the Prompt Payment Act (31 U.S.C. 3903) and prompt payment regulations at 5 CFR part 1315....

  12. 49 CFR 212.213 - Motive power and equipment (MP&E) inspector.

    Science.gov (United States)

    2010-10-01

    ... of determining compliance with all sections of the Freight Car Safety Standards (49 CFR part 215), Safety Glazing Standards (49 CFR part 223), Locomotive Safety Standards (49 CFR part 229), Safety Appliance Standards (49 CFR part 231), and Power Brake Standards (49 CFR part 232), to make reports of...

  13. DELIVERABLE 2.1.2 PRODUCTION ANALYSIS: CHEROKEE AND BUG FIELDS, SAN JUAN COUNTY, UTAH

    International Nuclear Information System (INIS)

    Over 400 million barrels (64 million m3) of oil have been produced from the shallow-shelf carbonate reservoirs in the Pennsylvanian (Desmoinesian) Paradox Formation in the Paradox Basin, Utah and Colorado. With the exception of the giant Greater Aneth field, the other 100 plus oil fields in the basin typically contain 2 to 10 million barrels (0.3-1.6 million m3) of original oil in place. Most of these fields are characterized by high initial production rates followed by a very short productive life (primary), and hence premature abandonment. Only 15 to 25 percent of the original oil in place is recoverable during primary production from conventional vertical wells. An extensive and successful horizontal drilling program has been conducted in the giant Greater Aneth field. However, to date, only two horizontal wells have been drilled in small Ismay and Desert Creek fields. The results from these wells were disappointing due to poor understanding of the carbonate facies and diagenetic fabrics that create reservoir heterogeneity. These small fields, and similar fields in the basin, are at high risk of premature abandonment. At least 200 million barrels (31.8 million m3) of oil will be left behind in these small fields because current development practices leave compartments of the heterogeneous reservoirs undrained. Through proper geological evaluation of the reservoirs, production may be increased by 20 to 50 percent through the drilling of low-cost single or multilateral horizontal legs from existing vertical development wells. In addition, horizontal drilling from existing wells minimizes surface disturbances and costs for field development, particularly in the environmentally sensitive areas of southeastern Utah and southwestern Colorado

  14. Assessment of Gastroesophageal Reflux in Children(2-12 Month Based on Clinical Findings and Ultrasonography

    Directory of Open Access Journals (Sweden)

    F Jassemi Zergani

    2012-07-01

    Full Text Available Introduction: Gastroesophageal reflux is a common gastrointestinal disorder among infants, which can cause complications, such as esophagitis and Barrett's esophagus if its diagnosis and treatment are delayed. On the other hand, similarity of Gastro esophageal Reflux symptoms with symptoms of other childhood diseases makes its diagnosis and treatment difficult. So a proper tool for early screening and diagnostic test is essential. Methods: This study was conducted on 221 infants(2 to 12 months with initial symptoms of gastro esophageal reflux(frequent vomiting, restlessness after feeding, no weight gain, coughing repeatedly and refusing to eat that referred to pediatric Clinic of Rajai Hospital in Tonekabon. Data was collected with demographic and infant gastro esophageal reflux questionnaire by use of the information in records and interview with parents. Then the samples were examined via sonography for gastroesophagial reflux. Results: After initial screening based on infants gastro esophageal reflux tool, gastro esophageal reflux by ultrasound was positive in 63/3% of infants. The mean esophageal diameter was (20/73±2/54mm in infants with gastro esophageal reflux and (23/71±2/35mm in infants without gastro esophageal reflux. Conclusion: Due to the similarity of gastro esophageal Reflux symptoms with clinical symptoms of other childhood diseases, use of an initial screening measurement for early assessment of gastro esophageal reflux in infants is necessary. Moreover, appropriate, available and low costs diagnostic method with little complication seems essential such as ultrasonography for confirm diagnosis and early treatment.

  15. 38 CFR 21.212 - General policy in furnishing supplies during periods of rehabilitation.

    Science.gov (United States)

    2010-07-01

    ... placed at a distinct disadvantage in pursuing the course. (e) Supplies for special projects and theses. The amount of supplies that VA may authorize for special projects, including theses, may not exceed the amount generally needed by similarly circumstanced nonveterans in meeting course or...

  16. 36 CFR 212.81 - Use by over-snow vehicles.

    Science.gov (United States)

    2010-07-01

    ..., emergency, or law enforcement vehicle for emergency purposes; (3) Authorized use of any combat or combat support vehicle for national defense purposes; (4) Law enforcement response to violations of law... authorization issued under Federal law or regulations. (c) Establishment of restrictions and prohibitions....

  17. Case 212: chronic lymphocytic inflammation with pontine perivascular enhancement responsive to steroids.

    Science.gov (United States)

    Bag, Asim K; Davenport, Jake J; Hackney, James R; Roy, Rasmoni; Fathallah-Shaykh, Hassan M

    2014-12-01

    History A previously healthy 23-year-old white man presented to the emergency department of our hospital with a 2-month history of dysarthria, progressively worsening vertigo, and difficulty walking. A diagnosis of retinitis pigementosa was made in this patient's childhood. He did not have any history of congenital syphilis. He did not have a history of nausea or vomiting, fever, weight loss, headache, photophobia, seizure, extremity weakness, or sensory disturbance. Physical examination revealed dysarthria, dysmetria, and ataxia. Kernig and Brudzinski signs were absent, and pathergy test results were negative. Laboratory evaluation revealed normal complete and differential blood counts and normal serum chemistry, including a normal serum angiotensin-converting enzyme level. Analysis of his serum was negative for antinuclear antibody (or ANA), cytoplasmic antineutrophil cvtoplasmic antibody (or cANCA), Sjögren syndrome antigens A and B (SS-A and SS-B, respectively), antitissue transglutaminase and antiendomysial antibodies, and paraneoplastic profile. Serum analysis was also negative for human immunodeficiency virus type 1 and type 2 RNA, Venereal Disease Research Laboratory (VDRL) test, rapid plasma regain (RPR), and fluorescent treponemal antibody absorption. Cerebrospinal fluid (CSF) analysis revealed clear fluid, a normal glucose level (64 mg/dL [3.6 mmol/L]; normal range, 40-70 mg/dL [2.2-3.9 mmol/L]), an elevated protein level (97 mg/dL; normal range, 12-60 mg/dL), and an elevated white blood cell count (7/mm(3) [0.007 ×10(9)/L] in tube 1 and 17/mm(3) [0.017 × 10(9)/L] in tube 2) with 84% lymphocytes. CSF immunoglobulin G level was elevated (30.1 mg/dL; normal, RPR test results for CSF were negative. CSF did not grow any bacteria, fungus, or acid-fast bacillus at culture. CSF flow cytometry did not reveal a monoclonal lymphoid population. Initial imaging included brain magnetic resonance (MR) imaging. Computed tomography (CT) images of the chest, abdomen, and pelvis were normal (not shown). The patient's clinical symptoms and imaging findings responded to treatment with a high dose of oral steroids. However, the patient's symptoms exhibited clinical and radiologic progression after several attempts to taper the steroid dose. PMID:25420171

  18. Stage Movement with Scripts and More Work with Scenes. TAP (Theatre Arts Package) 211 and 212.

    Science.gov (United States)

    Engelsman, Alan; Thalden, Irene

    The purpose of these lessons is to provide learning experiences which facilitate junior high and senior high school actors' mastery of stage movements when working with scripts. Suggested exercises include practice in finding motivation for actors' stage movements, acting a scene (from "West Side Story"), and interpreting and acting scenes of…

  19. 48 CFR 252.212-7000 - Offeror representations and certifications-Commercial items.

    Science.gov (United States)

    2010-10-01

    ... regulations of the President. (b) Certification. By submitting this offer, the Offeror, if a foreign person, company or entity, certifies that it— (1) Does not comply with the Secondary Arab Boycott of Israel;...

  20. 36 CFR 212.10 - Maximum economy National Forest System roads.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Maximum economy National... economy National Forest System roads. The Chief may acquire, construct, reconstruct, improve, and maintain... Forest Service in locations and according to specifications which will permit maximum economy...

  1. 20 CFR 725.212 - Conditions of entitlement; surviving spouse or surviving divorced spouse.

    Science.gov (United States)

    2010-04-01

    ... due to pneumoconiosis at the time of death or to have died due to pneumoconiosis. A surviving spouse... establish that the deceased miner's death was due to pneumoconiosis in order to establish entitlement...

  2. 48 CFR 52.212-3 - Offeror Representations and Certifications-Commercial Items.

    Science.gov (United States)

    2010-10-01

    ...); □ Foreign government; □ International organization per 26 CFR 1.6049-4; □ Other _____. (5) Common parent... force or humanitarian organization; (5) Consist of providing goods or services that are used only to.... Restricted business operations means business operations in Sudan that include power production...

  3. Sensitivity and uncertainty analysis for the mixed-oxide thermal lattice U-L212

    International Nuclear Information System (INIS)

    The sensitivities of a mixed oxide (2Wt%PuO2 - 8% 240Pu) fueled, light water moderated critical lattice experiment carried out at Battelle Northwest Laboratories under EPRI sponsorship have been determined. A two-dimensional diffusion theory analysis was performed and the sensitivity of the eigenvalue (k) and four reaction rate ratios to changes in nuclear data have been determined. The sensitivity analysis capability was extended to include upscattering and multi-dimension ability. A covariance matrix has been developed for 239Pu, and the uncertainty associated with calculated performance parameters due to uncertainties in nuclear data has been obtained

  4. (2-Acetylphenolato(2-{1-[2-(morpholin-4-ylethylimino]ethyl}phenolato(thiocyanato-κNcobalt(III

    Directory of Open Access Journals (Sweden)

    Chen-Yi Wang

    2011-07-01

    Full Text Available The title mononuclear cobalt(III complex, [Co(C14H19N2O2(C8H7O2(NCS], was obtained by the reaction of 2-acetylphenol, 2-(morpholin-4-ylethylamine, ammonium thiocyanate and cobalt nitrate in methanol. The CoIII atom is coordinated by one phenolate O, one imine N, and one amine N atom of the tridentate Schiff base ligand, two O atoms of the 2-acetylphenolate anion and one thiocyanate N atom. This results in a fairly regular fac-CoN3O3 octahedral coordination geometry for the metal ion. The dihedral angle between the two benzene rings is 88.3 (3°.

  5. 49 CFR 212.231 - Highway-rail grade crossing inspector.

    Science.gov (United States)

    2010-10-01

    ... Grade Crossing Signal System Safety Rules (49 CFR part 234); (3) Knowledge of operating practices and... the Grade Crossing Signal System Safety Rules (49 CFR part 234), including the remedial action... determining compliance with Grade Crossing Signal System Safety Rules (49 CFR part 234), to make reports...

  6. 36 CFR 212.9 - Principles for sharing use of roads.

    Science.gov (United States)

    2010-07-01

    ... and economically serve the contemplated use, unless the Chief determines that the safety and economy... Service and intermingled and adjacent private and public lands and for the use and development of the... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Principles for sharing use...

  7. AB212. Clinical study on the treatment of lifelong premature ejaculation with Paroxetine hydrochloride and tamsulosin

    OpenAIRE

    Li, Yan-Feng; Zhang, Chao; Li, Bo-jun

    2016-01-01

    Objective There are quite a few researches about SSRIs and alpha-receptor blockers on the treatment of premature ejaculation (PE), but few researches focus on the combination use of them. In this study, we evaluate the efficacy and safety of combine and alone use of paroxetine hydrochloride and tamsulosin on the treatment of lifelong PE. Methods 352 cases of men with 18–65 years of age, a history of lifelong PE and an intra-vaginal ejaculation latency time (IELT)

  8. Design of a multi-band RF front-end between 2-12 GHz.

    OpenAIRE

    Yu, Sang

    2006-01-01

    The state-of-the-art standard for short range wireless data transmission is the Ultra Wide Band radio (UWB) standard. UWB provides the maximum data rate of 480 Mbit/s. However, for some data transmission applications this is far from sufficient. Since there already are a lot of research and development activities in wireless technology, the demands on even higher data rates is considered as necessary. The research group of Communication Electronics at ITN has a new concept to design a radio f...

  9. Aviation Structural Mechanic, First Class, 2-12. Military Curriculum Materials for Vocational and Technical Education.

    Science.gov (United States)

    Ohio State Univ., Columbus. National Center for Research in Vocational Education.

    This self-paced, individualized course, adapted from military curriculum materials for use in vocational and technical education, teaches students the skills needed to become aviation structural mechanics (first class). The course materials consist of three pamphlets. The first pamphlet covers aircraft maintenance management, records, and reports…

  10. Alpha particle emitters in cancer therapy: establishing the rationale and overcoming the difficulties

    International Nuclear Information System (INIS)

    Full text: Once a tumor has metastasized, the possibility of cure is significantly diminished, if not excluded. Since metastatic spread arises due to the release of single tumor cells or tumor cell clusters, treatment regimens following an overt metastasis must include agents that eradicate individual tumor cells and cell clusters or that prevent their dissemination. Alpha particles may be highly effective in eradicating rapidly accessible disease. The effectiveness of alpha particles arises because the amount of energy deposited per unit distance traveled (linear energy transfer or LET) is approximately 400 times greater than that of beta particles (80 keV/μm vs. 0.2 keV/μm). Each traversal of an alpha particle through a cell nucleus results in a very highly ionizing track. Cell survival studies have shown that alpha-particle killing is independent of oxygenation state or cell-cycle during irradiation and that as few as 1 to 6 tracks across the nucleus may result in cell death. Most studies with alpha-particle emitting radionuclides for therapy have examined either bismuth-212 or astatine-211. Both radionuclides are short-lived with 61 minute and 7.2 hour half-lives, respectively, yielding intermediates with 3-minute and 32 year half-lives, respectively. Both emit alpha particles whose range is 40 to 80 μm. Alpha-particle emitting radionuclides have been attached to antibodies against tumor cell associated antigen. Antibodies have been the most widely used vehicle for delivery of alpha particles due to their specificity. Bismuth-212 has demonstrated a significant curative potential with minimal toxicity. In an ascites tumor mouse model, specific targeting and 80% cure following injection of Bi-212-labeled antibody has been observed (Macklis RM et al, Science, 240:1024-1026, 1988). It is important to define the realm of applicability for alpha particle emitting radionuclides. The short half-life of most currently available radionuclides, limits their use to

  11. Shelf-Life of ɛ-Lysyl-3-(Trimethylstannyl)Benzamide Immunoconjugates, Precursors for 211At Labeling of Antibodies

    OpenAIRE

    Aneheim, Emma; Halleröd, Jenny; Albertsson, Per; Jensen, Holger; Holgersson, Stellan; Lindegren, Sture

    2015-01-01

    Astatine-211 is possibly the most promising radionuclide for targeted α-particle therapy when it comes to the treatment of occult disseminated cancer. Preclinical research has proven effective, and patient studies have been initiated based on these results. However, a lack of production capacity and the complex radiochemistry of 211At are major obstacles for research and prospective clinical applications. In the present study, astatination of immunoconjugates, already prepared well in advance...

  12. 50 CFR 226.212 - Critical habitat for 13 Evolutionarily Significant Units (ESUs) of salmon and steelhead...

    Science.gov (United States)

    2010-10-01

    ... as defined by the ordinary high-water line (33 CFR 319.11). In areas where ordinary high-water line...-ways. In areas within Navy security zones identified at 33 CFR 334 that are outside the areas described...); McCarty Creek (48.7275, -122.2188); Plumbago Creek (48.6088, -122.0949); Pond Creek (48.6958,...

  13. CALiPER Report 21.2. Linear (T8) LED Lamp Performance in Five Types of Recessed Troffers

    Energy Technology Data Exchange (ETDEWEB)

    None

    2014-05-01

    Although lensed troffers are numerous, there are many other types of optical systems as well. This report looks at the performance of three linear (T8) LED lamps—chosen primarily based on their luminous intensity distributions (narrow, medium, and wide beam angles)—as well as a benchmark fluorescent lamp in five different troffer types. Also included are the results of a subjective evaluation. Results show that linear (T8) LED lamps can improve luminaire efficiency in K12-lensed and parabolic-louvered troffers, effect little change in volumetric and high-performance diffuse-lensed type luminaires, but reduce efficiency in recessed indirect troffers. These changes can be accompanied by visual appearance and visual comfort consequences, especially when LED lamps with clear lenses and narrow distributions are installed. Linear (T8) LED lamps with diffuse apertures exhibited wider beam angles, performed more similarly to fluorescent lamps, and received better ratings from observers. Guidance is provided on which luminaires are the best candidates for retrofitting with linear (T8) LED lamps.

  14. 21 CFR 212.1 - What are the meanings of the technical terms used in these regulations?

    Science.gov (United States)

    2010-04-01

    ... active pharmaceutical ingredient. In-process material means any material fabricated, compounded, blended... the Federal Food, Drug, and Cosmetic Act, as amended (21 U.S.C. 321 et seq.). Active pharmaceutical... pharmaceutical ingredient, analytical supplies, and other components, including container-closure systems and...

  15. Radiogenic Side Effects After Hypofractionated Stereotactic Photon Radiotherapy of Choroidal Melanoma in 212 Patients Treated Between 1997 and 2007

    Energy Technology Data Exchange (ETDEWEB)

    Dunavoelgyi, Roman [Department of Ophthalmology, Medical University of Vienna, Vienna (Austria); Dieckmann, Karin [Department of Radiology, Medical University of Vienna, Vienna (Austria); Gleiss, Andreas [Section of Clinical Biometrics, Medical University of Vienna, Vienna (Austria); Sacu, Stefan; Kircher, Karl; Georgopoulos, Michael [Department of Ophthalmology, Medical University of Vienna, Vienna (Austria); Georg, Dietmar [Department of Radiology, Medical University of Vienna, Vienna (Austria); Zehetmayer, Martin, E-mail: martin.zehetmayer@meduniwien.ac.at [Department of Ophthalmology, Medical University of Vienna, Vienna (Austria); Poetter, Richard [Department of Radiology, Medical University of Vienna, Vienna (Austria)

    2012-05-01

    Purpose: To evaluate side effects of hypofractionated stereotactic photon radiotherapy for patients with choroidal melanoma. Patients and Methods: Two hundred and twelve patients with choroidal melanoma unsuitable for ruthenium-106 brachytherapy or local resection were treated stereotactically at the Medical University of Vienna between 1997 and 2007 with a Linac with 6-MV photon beams in five fractions with 10, 12, or 14 Gy per fraction. Examinations for radiogenic side effects were performed at baseline and every 3 months in the first 2 years, then every 6 months until 5 years and then once a year thereafter until 10 years after radiotherapy. Adverse side effects were assessed using slit-lamp examination, funduscopy, gonioscopy, tonometry, and, if necessary, fundus photography and fluorescein angiography. Evaluations of incidence of side effects are based on an actuarial analysis. Results: One hundred and eighty-nine (89.2%) and 168 (79.2%) of the tumors were within 3 mm of the macula and the optic disc, respectively. The five most common radiotherapy side effects were retinopathy and optic neuropathy (114 cases and 107 cases, respectively), cataract development (87 cases), neovascular glaucoma (46 cases), and corneal epithelium defects (41 cases). In total, 33.6%, 38.5%, 51.2%, 75.5%, and 77.6% of the patients were free of any radiation retinopathy, optic neuropathy, cataract, neovascular glaucoma, or corneal epithelium defects 5 years after radiotherapy, respectively. Conclusion: In centrally located choroidal melanoma hypofractionated stereotactic photon radiotherapy shows a low to moderate rate of adverse long-term side effects comparable with those after proton beam radiotherapy. Future fractionation schemes should seek to further reduce adverse side effects rate while maintaining excellent local tumor control.

  16. Damage thresholds of various materials irradiated by 100-ps pulses of 21.2-nm laser radiation

    Czech Academy of Sciences Publication Activity Database

    Hájková, Věra; Chalupský, Jaromír; Wabnitz, H.; Feldhaus, J.; Störmer, M.; Hecquet, Ch.; Mocek, Tomáš; Kozlová, Michaela; Polan, Jiří; Homer, Pavel; Rus, Bedřich; Juha, Libor

    Bellingham: SPIE, 2009 - (Juha, L.; Bajt, S.; Sobierajski, R.), 736110/1-736110/6. (Proceedings of SPIE. 7361). ISBN 9780819476357. ISSN 0277-786x. [Damage to VUV, EUV, and X-Ray Optics II. Prague (CZ), 21.04.2009-23.04.2009] R&D Projects: GA AV ČR KAN300100702; GA MŠk LC510; GA MŠk(CZ) LC528; GA MŠk LA08024; GA AV ČR IAA400100701 Grant ostatní: LASERLAB-EUROPE(XE) RII3-CT-2003-506350 Institutional research plan: CEZ:AV0Z10100523 Keywords : soft x-ray laser * damage to x-ray optics * laser ablation * damage thresholds * single- shot damage Subject RIV: BH - Optics, Masers, Lasers http://dx.doi.org/10.1117/12.822950

  17. Study of damages induced in DNA by X-UV laser irradiation at 21.2 nm

    Czech Academy of Sciences Publication Activity Database

    Cassou, K.; Ros, D.; Kazamias, S.; Klisnick, A.; Jamelot, G.; Guilbaud, O.; Rus, Bedřich; Kozlová, Michaela; Polan, Jiří; Präg R., Ansgar; Stupka, Michal; Eot-Houllier, G.; Sage, E.; Běgusová, Marie; Štísová, Viktorie; du Penhoat, M.A.H.; Touati, A.; Chétioui, A.

    2005-01-01

    Roč. 127, - (2005), s. 177-180. ISSN 1155-4339. [Colloque sur les Sources cohérentes et incohérentes UV, VUV et X - Applications et développements récents /7./. Saint-Etienne, 07.06.04-11.06.04] R&D Projects: GA MŠk(CZ) LN00A100; GA AV ČR(CZ) IAA1010014 Grant ostatní: EU(XE) HPRI-00108 Institutional research plan: CEZ:AV0Z10100523 Keywords : radiation biology * X-ray laser * DNA plasmid Subject RIV: BH - Optics, Masers, Lasers Impact factor: 0.389, year: 2005

  18. 国外新批准上市的药物新制剂新剂型(212

    Institute of Scientific and Technical Information of China (English)

    2015-01-01

    1欧盟批准复方英帕罗青(empagliflozin)/盐酸二甲双胍薄膜包衣片上市欧盟批准勃林格殷格翰姆公司与礼来公司联合开发的产品(商品名:Synjardy)上市,

  19. 9,10-Bis{2-[1-(2-pyridylmethylimidazolium-3-yl]ethoxy}anthracene bis(hexafluoridophosphate

    Directory of Open Access Journals (Sweden)

    Li-Hui Guo

    2008-01-01

    Full Text Available The cation of the title compound, C36H34N6O22+·2PF6−, lies across a crystallographic inversion centre. The imidazole and pyridine rings form dihedral angles of 82.28 (5° and 11.87 (7°, respectively, with the anthracene ring system. The crystal packing is stabilized by π–π interactions between the pyridine ring and the central ring of anthracene, with a ring centroid–centroid distance of 3.684 (3 Å. The PF6− anion is disordered over three different positions with occupancies of 0.284 (6, 0.354 (8 and 0.362 (9.

  20. Is asthma in 2-12 year-old children associated with physician-attended recurrent upper respiratory tract infections?

    NARCIS (Netherlands)

    Hak, Eelko; Rovers, Maroeska M; Sachs, Alfred P E; Stalman, Wim A B; Verheij, Theo J M

    2003-01-01

    In a prevalence study, we evaluated whether recurrent physician-attended URTI episodes are more common in asthmatic children as compared to age- and gender-matched controls. URTI proneness, defined as > or = 5 episodes of rhinitis/pharyngitis, sinusitis, laryngitis/tracheitis or otitis media in a 24

  1. Background information and biorefinery status, potential and Sustainability: Task 2.1.2 Market and Consumers; Carbohydrates

    OpenAIRE

    Bos, H.L.; Harmsen, P.F.H.; Annevelink, E.

    2010-01-01

    This report was produced to give an overview of present and future market for biorefinery products based on carbohydrates. Various studies show that there is a wealth of possible molecules and products that can be produced from carbohydrates. Carbohydrates already find significant application in starch products and cellulose plastics and fibres. However, for a biorefinery to operate in an economically sustainable way, applications for (preferably all) biomass ingredients need to be found. Pre...

  2. SU-E-T-212: Influence of the Modulation Index On Daily Quality Assurance in Rapid Arc Treatments

    International Nuclear Information System (INIS)

    Purpose: At our Institute some measured parameters for daily quality assurance (DQA) of dynamic arc therapy plans showed an unexpected behavior, therefore an investigation of the influence of the magnitude of modulation was conducted. Methods: In our clinical practice all DQAs of dynamic arc therapy plans are measured and analyzed prior to treatments using commercial software. For this study these plans were additionally exported to our in-house software written in MATLAB.The developed software extracted the leaf position, gantry angle, cumulative meterset weight of each control point (CP) and the total number of Monitor Units (MU) of each arc. Based on this information we calculated the leaf travel distance, irradiated segment area, number of MUs and dose rate for each CP. These data allowed us to calculate the modulation indexes (MI) of the plans, applying five different definitions of MI. The results were then correlated to the results of our DQA measurements.To validate the software, additional plans of known MIs were created and analyzed. For confirmation, the calculated parameters were compared to the segmented treatment table (STT) coming from the treatment planning system. Results: All calculated CP-parameters matched the STT by 99% or better. For linac 1, the comparison of the MI evaluation and the DQA results showed a slight tendency: 91.3% failed DQA plans had a MI lower than the average value. For this definition we consider that the lower the MI the higher the modulation. The results of the linac 2 present no significant relevance due to the low sample sizes for each DQA software. Conclusion: Available data and given definitions of the modulation index do not bring conclusive results; one cannot find a clear and distinct correlation with the failure of the DQA. The ongoing analysis with an increased sample size might lead to another conclusion

  3. Performance and application of a very high-speed 2-12 μm ultraspectral FTIR imager

    Science.gov (United States)

    Dombrowski, Mark; Szczesniak, Martin; Lorenz, Jim; Beecroft, Mike; Ferguson, Jamie; Catanzaro, Brian

    2006-05-01

    As an offshoot of hyperspectral imaging, which typically acquires tens to slightly more than 100 spectral bands, ultraspectral imaging, with typically more than 1000 bands, provides the ability to use molecular or atomic lines to identify surface or airborne contaminants. Surface Optics Corporation has developed a very high-speed Fourier Transform Infrared (FTIR) imaging system. This system operates from 2 μm to 12 μm, collecting 128 ×128 images at up to 10,000 frames-per-second. The high-speed infrared imager is able to synchronize to almost any FTIR that provides at least mirror direction and laser clock signals. FTIRs rarely produce a constant scan speed, due to the need to physically move a mirror or other optical device to introduce an optical path difference between two beams. The imager is able to track scan speed jitter, as well as changes in position of the zero path difference (ZPD) position, and perform real-time averaging if desired. Total acquisition time is dependent on the return stroke speed of the FTIR, but 16 cm -1 (1024 point) spectral imagery can be generated in less than 1/5 second , with 2 cm -1 (8192 point) spectral imagery taking proportionately longer. The imager is currently configured with X-Y position stages to investigate surface chemistry of varied objects. Details of the optical design, focal plane array, and electronics that allow this high-speed FTIR imager to function are presented. Results of using the imager for several applications are also presented.

  4. 2-{1-[(2-Nitro­benzene­sulfonamido)­meth­yl]cyclo­hexyl}acetic acid

    OpenAIRE

    Kanwal, Nosheen; Akbar Hussain, Erum; Şahin, Onur; Büyükgüngör, Orhan

    2011-01-01

    In the title compound, C15H20N2O6S, the C—SO2—NH—C torsion angle is 64.54 (14)°. In the mol­ecule, there is a bifurcated N—H⋯(O,O) hydrogen bond, forming S(7) rings. In the crystal, inversion dimers are formed via O—H⋯O hydrogen bonds involving the carboxyl group, so forming R 2 2(8) rings. These dimers are further linked via pairs of C—H⋯O hydrogen bonds, forming a C(6) chain propagating along the c-axis direction.

  5. Radiogenic Side Effects After Hypofractionated Stereotactic Photon Radiotherapy of Choroidal Melanoma in 212 Patients Treated Between 1997 and 2007

    International Nuclear Information System (INIS)

    Purpose: To evaluate side effects of hypofractionated stereotactic photon radiotherapy for patients with choroidal melanoma. Patients and Methods: Two hundred and twelve patients with choroidal melanoma unsuitable for ruthenium-106 brachytherapy or local resection were treated stereotactically at the Medical University of Vienna between 1997 and 2007 with a Linac with 6-MV photon beams in five fractions with 10, 12, or 14 Gy per fraction. Examinations for radiogenic side effects were performed at baseline and every 3 months in the first 2 years, then every 6 months until 5 years and then once a year thereafter until 10 years after radiotherapy. Adverse side effects were assessed using slit-lamp examination, funduscopy, gonioscopy, tonometry, and, if necessary, fundus photography and fluorescein angiography. Evaluations of incidence of side effects are based on an actuarial analysis. Results: One hundred and eighty-nine (89.2%) and 168 (79.2%) of the tumors were within 3 mm of the macula and the optic disc, respectively. The five most common radiotherapy side effects were retinopathy and optic neuropathy (114 cases and 107 cases, respectively), cataract development (87 cases), neovascular glaucoma (46 cases), and corneal epithelium defects (41 cases). In total, 33.6%, 38.5%, 51.2%, 75.5%, and 77.6% of the patients were free of any radiation retinopathy, optic neuropathy, cataract, neovascular glaucoma, or corneal epithelium defects 5 years after radiotherapy, respectively. Conclusion: In centrally located choroidal melanoma hypofractionated stereotactic photon radiotherapy shows a low to moderate rate of adverse long-term side effects comparable with those after proton beam radiotherapy. Future fractionation schemes should seek to further reduce adverse side effects rate while maintaining excellent local tumor control.

  6. Time intervals from first symptom to treatment of cancer: a cohort study of 2,212 newly diagnosed cancer patients

    DEFF Research Database (Denmark)

    Hansen, Rikke P; Vedsted, Peter; Sokolowski, Ineta; Søndergaard, Jens; Olesen, Frede

    Delay in diagnosis of cancer may worsen prognosis. The aim of this study is to explore patient-, general practitioner (GP)- and system-related delay in the interval from first cancer symptom to diagnosis and treatment, and to analyse the extent to which delays differ by cancer type....

  7. (2E-1-Phenyl-2-[1-(2-phenylprop-2-en-1-ylpyrrolidin-2-ylidene]ethanone

    Directory of Open Access Journals (Sweden)

    Lee G. Madeley

    2012-12-01

    Full Text Available The title compound, C21H21NO, is a vinylogous amide (enaminone produced by reaction of 1-(2-phenylprop-2-en-1-ylpyrrolidine-2-thione with phenacyl bromide. In the molecule, the phenyl rings are twisted from the mean plane of the pyrrolidine ring by 11.2 (1 and 67.3 (1°. In the crystal, weak C—H...O hydrogen bonds link the molecules related by translation along the b axis into chains.

  8. 8 CFR 1212.9 - Applicability of section 212(a)(32) to certain derivative third and sixth preference and...

    Science.gov (United States)

    2010-01-01

    ... nonpreference immigrant under section 203(a)(8) of the Act, who is also a graduate of a medical school, is eligible for an immigrant visa or for adjustment of status under section 245 of the Act, whether or not... nonpreference immigrant and who is also a graduate of a medical school as defined by section 101(a)(41) of...

  9. Optical method for the measurement of the isotope ratio 13CO2/12CO2 for medical applications

    International Nuclear Information System (INIS)

    Currently, stable isotope measurements in breath tests using 13C-labeled substrates become more and more desirable, but their usage in medical applications is still limited by the very expensive and complex technique of mass spectrometry. A special light source is used to build a new non dispersive isotope-selective infrared spectrometer (ndirs) with a good isotope selectivity. The accuracy of the ndirs is 6,5 %o and is quite good. We present first results for a stabilized light source that give rise to get an accuracy better than ±1,5 %o. (author)

  10. Evaluating calibration strategies for isotope ratio infrared spectroscopy for atmospheric 13CO2/12CO2 measurement

    Directory of Open Access Journals (Sweden)

    X. Lee

    2013-01-01

    Full Text Available Isotope ratio infrared spectroscopy (IRIS provides an in-situ technique for measuring δ13C in atmospheric CO2. A number of methods have been proposed for calibrating the IRIS measurements, but few studies have systematically evaluated their accuracy for atmospheric applications. In this study, we carried out laboratory and ambient measurements with two commercial IRIS analyzers and compared the accuracy of four calibration strategies. We found that calibration based on the 12C and 13C mixing ratios (Bowling et al., 2003 and that based on linear interpolation of the measured delta using the mixing ratio of the major isotopologue (Lee et al., 2005 yielded accuracy better than 0.06‰. Over a 7-day atmospheric measurement in Beijing, the two analyzers differed by 9.44 ± 1.65‰ (mean ± 1 standard deviation of hourly values before calibration and agreed to within −0.02 ± 0.18‰ after properly calibration. However, even after calibration the difference between the two analyzers showed a slight correlation with concentration, and this concentration dependence propagated through the Keeling analysis resulting in a much larger difference of 2.44‰ for the Keeling intercept. The high sensitivity of the Keeling analysis to the concentration dependence underscores the challenge of IRIS for atmospheric research.

  11. 2.1.2. A Novel Lead(II MOF Constructed Through 2-Fold Non-linear FDA as Linker

    Directory of Open Access Journals (Sweden)

    Ya-feng Li*, Yan Liu, Wen-yuan Gao, Jing-jing Lu

    2014-04-01

    Full Text Available A unique three-dimensional metal-organic framework —— Pb(FDA (FDA = furan-2,5-dicarboxylic acid has been hydrothermally synthesized and structurally determined by single-crystal X-ray analysis. The crystal is of tetragonal system, space group I41/a, C6H2O5Pb, Mr = 361.27, a = 13.863(2 Å, b = 13.863(2 Å, c = 13.998(3 Å, V = 2690.0(8 Å3, Z = 16, Dc = 3.568 g/cm3, F(000 = 2560, ?(MuK? = 25.060 mm-1, Rint = 7.32%, R1 = 2.59% and wR1 = 5.88% for 1543 observed reflections with I > 2?(I. Pb cation is six-coordinated by oxygens of FDA, showing the hemi directed geometry. Pb cations are connected into zigzag chain along b direction in bc planar by FDA, which is furthermore linked to three-dimensional framework with very tiny aperture by bridged carboxyl oxygens of FDA. The elemental analyses, PXRD, FTIR spectra and the thermal stability have been structurally characterized.

  12. VEGFR3 Inhibition Chemosensitizes Ovarian Cancer Stemlike Cells through Down-Regulation of BRCA1 and BRCA212

    Science.gov (United States)

    Lim, Jaeyoung; Yang, Kun; Taylor-Harding, Barbie; Wiedemeyer, W. Ruprecht; Buckanovich, Ronald J.

    2014-01-01

    In ovarian cancer, loss of BRCA gene expression in tumors is associated with improved response to chemotherapy and increased survival. A means to pharmacologically downregulate BRCA gene expression could improve the outcomes of patients with BRCA wild-type tumors. We report that vascular endothelial growth factor receptor 3 (VEGFR3) inhibition in ovarian cancer cells is associated with decreased levels of both BRCA1 and BRCA2. Inhibition of VEGFR3 in ovarian tumor cells was associated with growth arrest. CD133+ ovarian cancer stemlike cells were preferentially susceptible to VEGFR3-mediated growth inhibition. VEGFR3 inhibition–mediated down-regulation of BRCA gene expression reversed chemotherapy resistance and restored chemosensitivity in resistant cell lines in which a BRCA2 mutation had reverted to wild type. Finally, we demonstrate that tumor-associated macrophages are a primary source of VEGF-C in the tumor microenvironment. Our studies suggest that VEGFR3 inhibition may be a pharmacologic means to downregulate BRCA genes and improve the outcomes of patients with BRCA wild-type tumors. PMID:24862760

  13. Assistive Technology for Infants, Toddlers, and Young Children with Disabilities. PACER Center ACTion Information Sheets: PHP-c212

    Science.gov (United States)

    PACER Center, 2014

    2014-01-01

    Research shows that assistive technology (AT) can help young children with disabilities to learn developmental skills. Its use may help infants and toddlers to improve in many areas such as: (1) social skills including sharing and taking turns; (2) communication skills; (3) attention span; (4) fine and gross motor skills; and (5) self confidence…

  14. Skeletal muscle ACC2 S212 phosphorylation is not required for the control of fatty acid oxidation during exercise

    OpenAIRE

    O’Neill, Hayley M.; Lally, James S.; Galic, Sandra; Pulinilkunnil, Thomas; Ford, Rebecca J; Dyck, Jason R.B.; van Denderen, Bryce J.; Kemp, Bruce E.; Steinberg, Gregory R

    2015-01-01

    During submaximal exercise fatty acids are a predominant energy source for muscle contractions. An important regulator of fatty acid oxidation is acetyl-CoA carboxylase (ACC), which exists as two isoforms (ACC1 and ACC2) with ACC2 predominating in skeletal muscle. Both ACC isoforms regulate malonyl-CoA production, an allosteric inhibitor of carnitine palmitoyltransferase 1 (CPT-1); the primary enzyme controlling fatty acyl-CoA flux into mitochondria for oxidation. AMP-activated protein kinase...

  15. Oahu Hyperspectral Imagery 2000 (212-0612-272217) - Visual Interpretation from Remote Sensing Imagery Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...

  16. 2-(1,2-Dihydro-2-oxopyridin-3-yl-1,3-benzothiazol-3-ium bromide monohydrate

    Directory of Open Access Journals (Sweden)

    Kim Potgieter

    2011-07-01

    Full Text Available The title hydrated molecular salt, C12H9N2OS+·Br−·H2O, the aza-substituted six-membered ring is present as its keto tautomer instead of its aromatic tautomer. The dihedral angle between the fused ring system and the pyridinone ring in the cation is 6.91 (6°. In the crystal, bifurcated N—H...(O,Br and O—H...Br hydrogen bonds and S...O contacts [S...O = 3.0526 (10 Å] connect the components into a three-dimensional network. The closest centroid–centroid distance between two π-systems is 3.7420 (7 Å between two benzene rings.

  17. 48 CFR 52.212-5 - Contract Terms and Conditions Required To Implement Statutes or Executive Orders-Commercial Items.

    Science.gov (United States)

    2010-10-01

    ...). ___(2) 52.203-13, Contractor Code of Business Ethics and Conduct (APR 2010)(Pub. L. 110-252, Title VI... required by the clause— (i) 52.203-13, Contractor Code of Business Ethics and Conduct (APR 2010) (Pub. L... Business Ethics and Conduct (APR 2010) (Pub. L. 110-252, Title VI, Chapter 1 (41 U.S.C. 251 note)). (B)...

  18. The role of alpha therapy for local and systemic treatment of cancer

    International Nuclear Information System (INIS)

    Major problems in the management of cancer relate to the inability to control some primary lesions, e.g. glioblastoma multiforme (GBM), and the inability to deal with metastatic cancer arising from malignant cancers such as melanoma, breast and other cancers. Binary alpha therapy using neutron capture in boron-10 offers the potential for improved prognosis for high grade brain tumours such as GBM and melanoma metastases to the brain. Metastatic cancer proceeds through a number of quite separate stages in the development of lethal disease, i e. cells in transit, preangiogenic lesions, subclinical and clinical lesions. Early stages offer the potential for control if targeted alpha therapy is applied. However, the dose must be localised to the cancer cell and this requirement rules out beta-emitting radionuclides, which are more suited for clinical lesions. Alpha-emitting radionuclides are the most appropriate toxins, as their efficacy depends on the linear energy transfer (LET) and range of the alpha particles. After matching the cancer stage, radiolabel and carrier, we find that 149Tb is the radionuclide of choice for systemic therapy in all aspects except production. The production of 149Tb in μCi (kBq) quantities has been achieved using the heavy ion reaction at the ANU tandem accelerator at Canberra and in multi-mCi (MBq) quantities using the spallation reaction in combination with on-line isotope separation technology of ISOLDE at CERN. Terbium is ideally suited for chelation to monoclonal antibodies to produce stable radio-immunoconjugates (RIC). Astatine-211 is a halide and has potential for the elimination of early stage melanoma metastases as At-MTB. However, the availability of the alpha generators 228Th-212Bi and 225Ac-213Bi facilitates the use of Bi-RIC in clinical trials for acute myeloid leukaemia and cystic glioma. Alpha therapy has the potential to control refractory cancers when treated at the minimum residual disease stage. Pre-clinical and

  19. DOE CALiPER Program, Report 21.2: Linear (T8) LED Lamp Performance in Five Types of Recessed Troffers

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Naomi J.; Perrin, Tess E.; Royer, Michael P.; Wilkerson, Andrea M.; Beeson, Tracy A.

    2014-05-20

    Although lensed troffers are numerous, there are many other types of optical systems as well. This report looked at the performance of three linear (T8) LED lamps chosen primarily based on their luminous intensity distributions (narrow, medium, and wide beam angles) as well as a benchmark fluorescent lamp in five different troffer types. Also included are the results of a subjective evaluation. Results show that linear (T8) LED lamps can improve luminaire efficiency in K12-lensed and parabolic-louvered troffers, effect little change in volumetric and high-performance diffuse-lensed type luminaires, but reduce efficiency in recessed indirect troffers. These changes can be accompanied by visual appearance and visual comfort consequences, especially when LED lamps with clear lenses and narrow distributions are installed. Linear (T8) LED lamps with diffuse apertures exhibited wider beam angles, performed more similarly to fluorescent lamps, and received better ratings from observers. Guidance is provided on which luminaires are the best candidates for retrofitting with linear (T8) LED lamps.

  20. SU-E-J-212: MR Diffusion Tensor Imaging for Assessment of Tumor and Normal Brain Tissue Responses of Juvenile Pilocytic Astrocytoma Treated by Proton Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Hou, P; Park, P; Li, H; Zhu, X; Mahajan, A; Grosshans, D [M.D. Anderson Cancer Center, Houston, TX (United States)

    2015-06-15

    Purpose: Diffusion tensor imaging (DTI) can measure molecular mobility at the cellular level, quantified by the apparent diffusion coefficient (ADC). DTI may also reveal axonal fiber directional information in the white matter, quantified by the fractional anisotropy (FA). Juvenile pilocytic astrocytoma (JPA) is a rare brain tumor that occurs in children and young adults. Proton therapy (PT) is increasingly used in the treatment of pediatric brain tumors including JPA. However, the response of both tumors and normal tissues to PT is currently under investigation. We report tumor and normal brain tissue responses for a pediatric case of JPA treated with PT assessed using DTI. Methods: A ten year old male with JPA of the left thalamus received passive scattered PT to a dose of 50.4 Gy (RBE) in 28 fractions. Post PT, the patient has been followed up in seven years. At each follow up, MRI imaging including DTI was performed to assess response. MR images were registered to the treatment planning CT and the GTV mapped onto each MRI. The GTV contour was then mirrored to the right side of brain through the patient’s middle line to represent normal brain tissue. ADC and FA were measured within the ROIs. Results: Proton therapy can completely spare contra lateral brain while the target volume received full prescribed dose. From a series of MRI ADC images before and after PT at different follow ups, the enhancement corresponding to GTV had nearly disappeared more than 2 years after PT. Both ADC and FA demonstrate that contralateral normal brain tissue were not affect by PT and the tumor volume reverted to normal ADC and FA values. Conclusion: DTI allowed quantitative evaluation of tumor and normal brain tissue responses to PT. Further study in a larger cohort is warranted.

  1. Evolution of the passive and active microwave signatures of a large sea ice feature during its 212-year drift through the Arctic Ocean

    Science.gov (United States)

    Gohin, Francis; Cavanié, Alain; Ezraty, Robert

    1998-04-01

    Although estimation of the total ice concentration from special sensor microwave imagers (SSM/I) has proven to be successful, none of the various algorithms developed to discriminate new and older ice provide satisfying results. While the strong contrast between the emissivity of sea ice and that of open water can be utilized to provide reliable estimators of the total ice concentration, passive microwave characteristics of second-year and multiyear ice may locally evolve in different ways, even during the cold season. Scatterometers, as the active microwave instrument in wind mode (AMI-wind) on board the European Remote Sensing Satellites (ERS), provide backscatter data which have a higher sensitivity to the surface topography of ice and a better stability in time, at a resolution compatible with the SSM/I measurements. Here we present the evolutions of the microwave properties of an ice feature appearing along the shores of Novosibirskiye Ostrova (New Siberian Islands) at the end of July 1992 as the ice ages during its 3-year drift toward the Fram Strait. The track of this well-defined ice surface is easily followed on the maps of the backscatter coefficient provided by the AMI-wind during the cold season. In summer, because of melting, the ice undergoes critical changes which alter its microwave signatures and hamper automatic tracking. Moreover, on approaching the Fram Strait the resolution of the scatterometer is not sufficient to capture the complex and rapid transformations of the ice cover. To compensate for this, buoy data obtained from the International Arctic Buoy Program are used, alone during summers or together with satellite data, to build basin-wide ice displacement fields. These displacement fields, successively applied to each pixel of the ice feature selected, provide a series of Lagrangian observations. During the drift, which ends in May 1995, the active and passive signatures evolve coherently, except for the cold season 1992-1993 when unrealistic multiyear ice concentrations are deduced from the brightness temperatures, which, at that time, are much less stable than the backscatter coefficient over the ice surface tracked, identified as second-year ice.

  2. Federal Education Tax Benefits: Who Receives Them and to What Extent Do They Shape the Price of College Attendance? Stats in Brief. NCES 2012-212

    Science.gov (United States)

    Radford, Alexandria Walton; Berkner, Lutz

    2011-01-01

    This Statistics in Brief applies IRS rules and data to a nationally representative sample of 2007-08 undergraduates to estimate who received education tax benefits and looks at the extent to which these benefits shaped their price of college attendance. Key findings include: (1) Nearly one-half of all 2007-08 undergraduates were estimated to have…

  3. SU-E-J-212: MR Diffusion Tensor Imaging for Assessment of Tumor and Normal Brain Tissue Responses of Juvenile Pilocytic Astrocytoma Treated by Proton Therapy

    International Nuclear Information System (INIS)

    Purpose: Diffusion tensor imaging (DTI) can measure molecular mobility at the cellular level, quantified by the apparent diffusion coefficient (ADC). DTI may also reveal axonal fiber directional information in the white matter, quantified by the fractional anisotropy (FA). Juvenile pilocytic astrocytoma (JPA) is a rare brain tumor that occurs in children and young adults. Proton therapy (PT) is increasingly used in the treatment of pediatric brain tumors including JPA. However, the response of both tumors and normal tissues to PT is currently under investigation. We report tumor and normal brain tissue responses for a pediatric case of JPA treated with PT assessed using DTI. Methods: A ten year old male with JPA of the left thalamus received passive scattered PT to a dose of 50.4 Gy (RBE) in 28 fractions. Post PT, the patient has been followed up in seven years. At each follow up, MRI imaging including DTI was performed to assess response. MR images were registered to the treatment planning CT and the GTV mapped onto each MRI. The GTV contour was then mirrored to the right side of brain through the patient’s middle line to represent normal brain tissue. ADC and FA were measured within the ROIs. Results: Proton therapy can completely spare contra lateral brain while the target volume received full prescribed dose. From a series of MRI ADC images before and after PT at different follow ups, the enhancement corresponding to GTV had nearly disappeared more than 2 years after PT. Both ADC and FA demonstrate that contralateral normal brain tissue were not affect by PT and the tumor volume reverted to normal ADC and FA values. Conclusion: DTI allowed quantitative evaluation of tumor and normal brain tissue responses to PT. Further study in a larger cohort is warranted

  4. 77 FR 67557 - Special Conditions: ATR-GIE Avions de Transport Regional, Models ATR42-500 and ATR72-212A...

    Science.gov (United States)

    2012-11-13

    ... Privacy Act Statement can be found in the Federal Register published on April 11, 2000 (65 FR 19477-19478... electronic form of all comments received into any FAA docket, including the name of the individual sending... configuration may allow the exploitation of network security vulnerabilities resulting in intentional...

  5. « A Bactrian Deed of Manumission ». Silk Road Art and Archaeology, 5, (1997-8), pp. 191-212

    OpenAIRE

    La Vaissière, Étienne de

    2010-01-01

    L’A. présente un contrat bactrien de libération d’esclave, désormais conservé au Japon, mais provenant sans doute du Tokharestan (il est rédigé dans la cité de Lan que les sources chinoises situent dans cette région). Il date probablement de 479. L’A. en donne une édition, une traduction, un commentaire philologique et historique, des photos, ainsi qu’un glossaire. Parmi les points les plus intéressants historiquement, mentionnons l’existence d’un βαγοβανδαγο bactrien, ce qui peut conduire à ...

  6. Report on current state of the art and major knowledge gaps to characterize water stress in different sectors. Aquastress D2.1.2 - Final report

    OpenAIRE

    Manez, M.; Inman, D.; S. Schmidt; Tarnacki, K.; Preziosi, E.; Koundouri, P.; S. Loubier; Sullivan, C.; Panebianco, S.; Van den Wyngaert, I.; Bauer, M.; Moors, E.; Olsthoorn, A.

    2006-01-01

    With this report we have tried to rise the awareness within the project on the still existing knowledge gaps in the different sectors of the water consumers: domestic sector, agricultural sector, environmental sector and industrial sector (including tourism). Our internal experts have dedicated an extra chapter to every sector. This report summarizes the state of the art of water stress in the sectors and represents the basis for the development of the test-site reports delivered by WP 2.2

  7. 25 CFR 1000.212 - What is the role of the Tribe/Consortium when a bureau initiates a public meeting?

    Science.gov (United States)

    2010-04-01

    ... AFFAIRS, DEPARTMENT OF THE INTERIOR ANNUAL FUNDING AGREEMENTS UNDER THE TRIBAL SELF-GOVERNMENT ACT.../Consortium should meet to plan and discuss the conduct of the meeting, meeting protocols, and general... 25 Indians 2 2010-04-01 2010-04-01 false What is the role of the Tribe/Consortium when a...

  8. QCL - Optical-Feedback Cavity Enhanced Absorption Spectroscopy For The Analysis Of Atmospheric 13CO2/12CO2 In Ice-Core Gas Bubbles

    Science.gov (United States)

    Gorrotxategi Carbajo, Paula; Romanini, Daniele; Maisons, Gregory; Carras, Mathieu; Chappellaz, Jerome; Kerstel, Erik

    2013-04-01

    In the context of a globally warming climate it is crucial to study the climate variability in the past and to understand the underlying mechanisms. The composition of gas stored in bubbles in polar ice presents a paleo-climate archive that provides a powerful means to study the exact mechanisms involved in the ~40% increase in the atmospheric CO2 concentration between glacial and interglacial climates. It is particularly important to understand such natural coupling between climate and the carbon cycle, as it will partly determine what natural feedback can be expected on the atmospheric CO2 concentration in a future warmer world. The source of the CO2 released into the atmosphere during previous deglaciations can be constrained from isotopic measurements by the fact that the different CO2 reservoirs (terrestrial biosphere, oceans) and associated mechanisms (biological or physical) have different isotopic signatures. Unfortunately, such isotope studies have been seriously hampered by the experimental difficulty of extracting the CO2 without contamination or fractionation, and measuring the isotope signal off-line on an isotope ratio mass spectrometer (IRMS). Here we present an alternative method that leverages the extreme sensitivity afforded by Optical Feedback Cavity Enhanced Absorption Spectroscopy (OF-CEAS) in the Mid-Infrared [1]. This region of the spectrum is accessed by a custom-developed Quantum Cascade Laser operating near 4.35 µm. The feedback to the laser of light that has been spectrally filtered by a high-finesse, V-shaped enhancement cavity has the effect of spectrally narrowing the laser emission and to auto-lock the laser frequency to one of the cavity's longitudinal modes, with clear advantages in terms of acquisition time and signal-to-noise ratio of the measurement. The line strengths in this region are about 5 orders of magnitude higher than in the more easily accessible NIR region near 1.6 µm and about 1000 times higher than at 2 µm. The instrument is temperature stabilization at the mK-level. Together with a small cavity volume of ~20 mL, this enables the analysis of nmol-sized samples with high precision (spectroscopy with a quantum cascade laser, Opt. Lett., 35, 3607, 2010. [2] Morville J., Kassi S., Chenevier M., and Romanini D.: Fast, low-noise, mode-by-mode, cavity-enhanced absorption spectroscopy by diode-laser self-locking, Appl. Phys., B 80, 1027-1038, 2005.

  9. Measurement of 13CO2/12CO2 abundance by nondispersive infrared heterodyne ratiometry as an alternative to gas isotope ratio mass spectrometry

    International Nuclear Information System (INIS)

    The authors report the performance of a prototype nondispersive infrared heterodyne ratiometer in the analysis of seven reference gas samples containing 3.0% CO2 in air, and isotopic enrichments from -85 to +329 δ per thousand vs. PDB as measured by gas isotope ratio mass spectrometry. The instrument response in volts-1 (V-1) varied from -0.51 to 1.22 over the range of -85 to +329 per thousand. A mean instrument response with a 0.0015 standard deviation (0.375 per thousand) required 110 s of signal averaging at a 1-s sampling rate. The calibration curve of instrument response vs. δ per thousand was linear over the entire range and had a slope of 0.003 89 +/- 0.000 03 (SD), an intercept of -0.168 +/- 0.005, and a standard error of 0.009. With this curve, 45 s of data acquisition at a mean instrument response of -0.280 V-1 attained a standard deviation of +/- 1.3 per thousand at -28.7 per thousand. Nondispersive infrared heterodyne ratiometry can analyze the 13C content of respiratory gas samples with acceptable accuracy and sensitivity for clinical studies

  10. The safety obligation of result. A new application to radiation protection. Orleans Court of social security affairs. Judgement of the 27 of August 2013 (nr 0123/212)

    International Nuclear Information System (INIS)

    After having recalled the French legal framework related to radiation protection, the author reports and discusses a case which illustrates what is at stake for an employer in terms of radiation protection; and also the importance of the concept of safety obligation of result which appeared for the compensation of victims of asbestos. Here, the case concerns a man who has been working in a base nuclear installation operated by EDF, and who developed a cancer which has been acknowledged as a professional disease. The author outlines some aspects of the case which could make one think of a non-responsibility of the company. He analyses the decision taken by the Court, discusses the consequences for companies of the nuclear sector, and outlines the important role of the expert in radiation protection

  11. Regiospecific Indentification of 2-(12-Ricinoleoylricinoleoyl)-1,3-diricinoleoyl-glycerol in Castor Oil by Mass Spectrometry and sn-1,3 Specific Lipase

    Science.gov (United States)

    (12-Ricinoleoylricinoleoyl)diricinoleoylglycerol (RRRR), a tetraacylglycerol, was identified earlier in castor oil. Using ESI-MS4, 95% of the 12-ricinoleoylricinoleoyl chain was identified at the sn-2 position on the glycerol backbone of RRRR. Regiospecific location of the 12-ricinoleoylricinoleoyl ...

  12. 76 FR 61558 - Airworthiness Directives; Dowty Propellers Type R212/4-30-4/22 and R251/4-30-4/49 Propeller...

    Science.gov (United States)

    2011-10-05

    ... published in the Federal Register on May 11, 2011 (76 FR 27281). That NPRM proposed to correct an unsafe... Register on May 11, 2011 (76 FR 27281) or on the determination of the cost to the public. Since we published the NPRM in the Federal Register on May 11, 2011 (76 FR 27281), we changed the AD Docket No....

  13. 76 FR 27281 - Airworthiness Directives; Dowty Propellers Type R212/4-30-4/22 and R251/4-30-4/49 Propeller...

    Science.gov (United States)

    2011-05-11

    ... Statement in the Federal Register published on April 11, 2000 (65 FR 19477-78). Discussion The European... Policies and Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant...

  14. Shelf-life of ɛ-lysyl-3-(trimethylstannyl)benzamide immunoconjugates, precursors for 211At labeling of antibodies

    DEFF Research Database (Denmark)

    Aneheim, Emma; Halleröd, Jenny; Albertsson, Per;

    2015-01-01

    Astatine-211 is possibly the most promising radionuclide for targeted α-particle therapy when it comes to the treatment of occult disseminated cancer. Preclinical research has proven effective, and patient studies have been initiated based on these results. However, a lack of production capacity ...

  15. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  16. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    International Nuclear Information System (INIS)

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons

  17. Separation of 211At from irradiated bismuth target and labelling of a model protein

    International Nuclear Information System (INIS)

    Astatine-211 is a promising radionuclide for therapeutic use in nuclear medicine. An efficient method (70%) for radiochemical separation from the irradiated Bi-target has been described. The level of Bi contamination in the purified 2'11At-solution was estimated. Finally labelling of a model protein has been tried. (author). 14 refs

  18. Hurdles for a Broader Use of 211At and for the Synthesis of 211At-Labelled Radiopharmaceuticals at High Activities for Clinical Use

    International Nuclear Information System (INIS)

    One of the key impediments to the use of 211At is the very well known deleterious effect of high radiation fields caused by its alpha particles on the synthesis of 211At-labelled radiopharmaceuticals. This is problematic because radiolysis-mediated effects can produce diminishing efficiency of electrophilic astatination reactions due to increasing deposition of radiation dose with increasing activities and with the passage of the time. Astatine-211 has chemical properties that permit complex labelling strategies and a longer half-life than 213Bi that makes it more suitable when the targeting molecule does not gain immediate access to the tumour cells. The first clinical evaluation was published in 2001 [2] in patients with brain tumour. Although this study circumvents many of the challenges to entering clinical studies with 211At and many obstacles had to be surmounted before clinical studies could be initiated, several problems were encountered in maintaining efficient labelling with escalating radiation dose of α-particle even with fresh 211At elution [3]. Astatine-211 also has an additional hurdle to overcome before to its clinical application in labelled radiopharmaceuticals related with its production and distribution. Among the potential group of promising α- emitter it is the only one produced by cyclotrons, but due to the scarcity of cyclotrons equipped with 25−30 MeV α-particle beams, it will of necessity be utilized in distant locations from the site of production. It presents a major chemical challenge because the diminishing efficiency of electrophilic astatination reactions with the passage of the time is well known, a problem likely related to the radiolysis produced by the high LET (linear energy transfer) meaning that large amounts of energy are deposited in a highly localized manner. This problem has been most comprehensively investigated to understand and evaluate the role of the radiolysis effects of astatine alpha particles in the synthesis

  19. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  20. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita

    2011-01-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  1. NCBI nr-aa BLAST: CBRC-TTRU-01-1130 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1130 ref|ZP_02091246.1| hypothetical protein FAEPRAM212_01517 [Faecali...bacterium prausnitzii M21/2] gb|EDP21696.1| hypothetical protein FAEPRAM212_01517 [Faecalibacterium prausnitzii M21/2] ZP_02091246.1 0.008 28% ...

  2. Design, construction, operation, and evaluation of solar systems for industrial process-heat applications in the intermediate-temperature range (212/sup 0/F to 550/sup 0/F). Environmental assessment

    Energy Technology Data Exchange (ETDEWEB)

    None

    1982-01-01

    The environmental impacts are assessed for a proposed 50,000 square foot field of single axis tracking, concentrating solar collectors along the Ohio River in southern Ohio. The facility is planned to produce process steam for use in the production of polystyrene. Absorbed solar energy would heat an aliphatic hydrocarbon synthetic heat transfer fluid to a maximum temperature of 500/sup 0/F. The existing environment is briefly described, particularly regarding air quality. The potential environmental impacts of the solar process heat system on the air, water, soil, endangered species and archaeological and historical resources are examined, including risks due to flood and glare and a comparison of alternatives. Also included are a Consent Judgment relating to two coal-fired boilers in violation of EPA regulations, property data of Gulf Synfluid 4CS (a candidate heat transfer fluid), piping and instrumentation diagrams and schematics, site grade and drainage plan, geological survey map, subsurface soil investigation, Ohio endangered species list, Ohio Archaeological Counsel certification list, and a study of heat transfer fluids and their properties. (LEW)

  3. Band mapping of the weakly off-stoichiometric Heusler alloy Ni.sub.49.7./sub.Mn.sub.29.1./sub.Ga.sub.21.2./sub. in the austenitic phase

    Czech Academy of Sciences Publication Activity Database

    Polyak, Yaroslav; Drchal, Václav; Kudrnovský, Josef; Heczko, Oleg; Honolka, Jan; Cháb, Vladimír; Kopeček, Jaromír; Lančok, Ján

    2015-01-01

    Roč. 91, č. 16 (2015), "165115-1"-"165115-11". ISSN 1098-0121 R&D Projects: GA ČR GA13-30397S; GA MŠk(CZ) LM2011026 Institutional support: RVO:68378271 Keywords : Ni 2 MnGa * transitions Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.736, year: 2014

  4. Women in Iran. Gender Politics in the Islamic Republic. Westport - Connecticut - London, Greenwood Press, 2002, 303 p.Women in Iran. Emerging Voices in the Women’s Movement. Westport - Connecticut - London, Greenwood Press, 2002, 212 p.

    OpenAIRE

    LADIER-FOULADI, Marie

    2005-01-01

    Dans ces deux volumes, l’A. examine la question du genre et plus précisément l’articulation des politiques et du genre avant et après la révolution en Iran. Dans le chapitre introductif du premier volume, après avoir établi le fondement théorique de son analyse, l’A. se propose d’explorer le patriarcat en tant que système approprié influant sur les réclamations des femmes et sur l’articulation des exigences et des objectifs de leurs mouvements. Tout en précisant que genre et patriarcat ne son...

  5. The "RA" Expeditions: The Archaeological and Anthropological Background. The "RA" Expeditions: The Coriolis Effect. The "RA" Expeditions: The Papyrus Reed. Learning Experiences for Coastal and Oceanic Awareness Studies, Nos. 211, 212, 213. [Project COAST].

    Science.gov (United States)

    Delaware Univ., Newark. Coll. of Education.

    Included are three units related to coastal and oceanic awareness. These are: (1) The "RA" Expeditions: The Archaeological and Anthropological Background; (2) The "RA" Expeditions: The Coriolis Effect; and (3) The "RA" Expeditions: The Papyrus Reed. Each of the three units are designed for students in grades 6-12. Each unit contains teacher…

  6. Sequenciamento gênico: prelúdio para o entendimento da diversidade do gênero "Tetragonisca" (HYMENOPTERA, APIDAE. DOI: 10.7902/ecb.v3i2.12

    Directory of Open Access Journals (Sweden)

    Bárbara Silva Siqueira Maurício

    2012-10-01

    Full Text Available As abelhas do gênero Tetragonisca (Hymenoptera, Apidae, conhecidas por “Jataís”, apresentam problemas no que diz respeito ao status taxonômico de suas espécies (T. angustula e T. fiebrigi e ao caráter utilizado para tal classificação. Com o objetivo de estabelecer as relações filogenéticas das espécies envolvidas, o presente trabalho tem por objetivo padronizar o processo de amplificação de DNA (via PCR para sequenciamento. Um teste de gradiente envolvendo os genes selecionados (COI, CytB e EF1a foi realizado. Após a análise dos produtos de PCR nas 4 temperaturas testadas, foram escolhidas as temperaturas de 52°C para a amplificação de COI e 51°C para os genes CytB e EF1a. O fragmento CytB se mostrou mais variável e com mais autapomorfias quando comparado aos demais. O fragmento de EF1a mesmo sendo o maior fragmento sequenciado, apresentou-se menos variável.

  7. Synthesis, crystal structure, and magnetic properties of the coordination polymer [Fe(NCS)2(1,2-bis(4-pyridyl)-ethylene)]n showing a two step metamagnetic transition.

    Science.gov (United States)

    Wöhlert, Susanne; Wriedt, Mario; Fic, Tomasz; Tomkowicz, Zbigniew; Haase, Wolfgang; Näther, Christian

    2013-01-18

    Reaction of iron(II) thiocyanate with an excess of trans-1,2-bis(4-pyridyl)-ethylene (bpe) in acetonitrile at room temperature leads to the formation of [Fe(NCS)(2)(bpe)(2)·(bpe)] (1), which is isotypic to its Co(II) analogue. Using slightly different reaction conditions the literature known compound [Fe(NCS)(2)(bpe)(2)(H(2)O)(2)] (2) was obtained as a phase pure material. Simultaneous differential thermoanalysis and thermogravimetry prove that the hydrate 2 transforms into the anhydrate [Fe(NCS)(2)(bpe)(2)] (3), that decomposes on further heating into the new ligand-deficient 1:1 compound of composition [Fe(NCS)(2)(bpe)](n) (4), which can also be obtained directly by thermal decomposition of 1. Further investigations reveal that 4 can also be prepared under solvothermal conditions, and single crystal structure analysis shows that the iron(II) cations are linked via μ-1,3 bridging thiocyanato anions into chains, that are further connected into layers by the bpe ligands. Magnetic measurements, performed on powder samples, prove that 1 and 2 show only Curie-Weiss behavior, whereas in 4 antiferromagnetic ordering with a Néel temperature of 5.0 K is observed. At T < 4.0 K a two-step metamagnetic transition occurs at applied magnetic fields of 1300 and 1775 Oe. The magnetic properties are discussed and compared with those of related compounds. PMID:23276282

  8. Synthesis of N-[2-3H] acetyl-D-muramyl-L-alanyl-D-iso-glutaminyl-L-alanyl-2-(1',2'-dipalmitoyl-sn-glycero-3'-phosphoryl) ethylamide of high specific radioactivity

    International Nuclear Information System (INIS)

    The title compound (MTP-cephalin) was synthesised with specific activity of 22 Ci mmol-1 and with radiochemical purity of 96-98% by a direct radiochemical synthesis using [3H] muramyl dipeptide. Several unsuccessful approaches to the target compound are documented. (author)

  9. Radiopharmaceutical Chemistry of Targeted Radiopharmaceutics. Synthesis of 211At-Labeled Radiopharmaceuticals at High Activities for Clinical Use

    International Nuclear Information System (INIS)

    Targeted α-particle radiotherapy is an appealing approach to cancer treatment because of the potential for delivering curative doses of radiation to tumor with minimal damage to normal tissue due to a range equivalent to only a few cell diameters. Compared with β-emitters they have significant advantages from a radiobiological perspective. The LET of 211At α-particles is more than 400 times higher than the β-particles emitted by 90Y, in addition the distance between ionizing events is almost the same as that between the two strands of DNA, yielding a high probability of creating non-repairable DNA damage. It gives the ability to kill cancer cells not compromised by hypoxia, dose rate effects or cell cycle position, enhancing their attractiveness for targeted radiotherapy. However, translation of the concept to the clinic has been slow, many obstacles had to be surmounted before clinical studies could be initiated, the first clinical evaluation of a 211At- labeled mAb was made in 2001. This study circumvents many of the challenges to entering clinical studies with 211At. But several problems were encountered in maintaining efficient labeling with escalating radiation dose of alpha-particle likely related to radiolysis. The impact of the radiolysis produced by the α-particle over the labeling chemistry is much higher in comparison with typical β-emitters due to a deposition of energy in the solvent in a highly localized manner two orders of magnitude per unit volume higher than 90Y or 131I. Due to these difficulties a comprehensive basic science study about the radiolytic effects of astatine alpha-particles over the synthesis of 211At-labeled radiopharmaceuticals was carried out. Its main goal was overcoming the problem of the synthesis of 211At-labeled radiopharmaceuticals at the high activities necessaries for therapy and also to extend the shelf life of astatine elutions. Briefly this study held several steps, the first one was to study the role of solvent

  10. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    International Nuclear Information System (INIS)

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on 211At and 124I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[211At]astato-2'-deoxyuridine (AUdR) and N-succinimidyl-4-[211At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [124I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[124I]iodo-2'-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for radioiodination of macromolecules

  11. 211At production and recovery: first results of a new start

    International Nuclear Information System (INIS)

    Full text: 211At is the only alpha-emitting isotope which can be introduced into organic molecular structures by covalent chemical binding and possesses superior decay characteristics for therapeutic applications when compared with other alpha emitters. However, its production requires a minimum of 27,5 MeV alpha-particles, which are relatively rarely available. In view of the revival of alpha-therapy approaches a production of 211At has been set up at the MHH cyclotron (MC-35). The first aim of this project was to establish a target- and work-up-system for the reliable production of several ten MBq-quantities of 211At for animal- and cell-research. An aluminum-target-system holds a 1.3 cm diameter Bi-disc of 0.25 mm thickness. The disk is pressed onto a the aluminum backing with 2 tons/cm2. The front is covered with a 125 μm Al foil, cooled by a He jet which is separated from the vacuum by a 250 μm Ti foil. Starting with 27.5 MeV alpha-particles the resulting target-energy is 25 MeV. This relatively low energy is chosen to avoid any contamination with 210At and 210Po in the first experimental period. A beam current of 10 μA for 15 min (9 mCoulomb) yields 16.4 MBq 211At theoretically. Astatine is recovered from the target by a dry distillation technique, using various gases as a transport support-medium. The small all-quartz distillation-apparatus is heated up to 900 oC. Astatine is recovered in a small cool able vessel containing various trapping media. Distillation and trapping can be monitored with small radioactivity monitors. The whole system fits in a cubical 0.5 m glove box. Continuous monitoring of the distillation process allowed to optimize the heating rate, the transport support-medium and its flow-rate. Various trapping solutions were tested for their efficiency. Different beam dispersion in the target seems to influence the release and distillation of astatine from the molten bismuth-target. Two different release patterns were observed. The first

  12. Measurement of protein synthesis: In vitro comparison of Sc-44-DOTA-Puromycin vs. [H-3-Methyl]-Methionine and S-35-Methionine

    Czech Academy of Sciences Publication Activity Database

    Eigner, Sebastian; Beckford, Denis R.; Fellner, M.; Loktionova, N.; Piel, M.; Roesch, F.; Machulla, H.J.; Melichar, František; Eigner-Henke, Kateřina

    2011-01-01

    Roč. 54, Suppl. 1 (2011), S212-S212. ISSN 0362-4803 Institutional research plan: CEZ:AV0Z10480505 Keywords : Biochemistry & Molecular Biology * Pharmacology & Pharmacy * Chemistry Subject RIV: CE - Biochemistry

  13. 12 CFR 560.120 - Letters of credit and other independent undertakings to pay against documents.

    Science.gov (United States)

    2010-01-01

    ... (International Chamber of Commerce (ICC) Publication No. 500) (available from ICC Publishing, Inc., 212/206-1150... Credits (ICC Publication No. 525) (available from ICC Publishing, Inc., 212/206-1150). (b) Safety...

  14. NCBI nr-aa BLAST: CBRC-XTRO-01-2615 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-2615 ref|XP_710348.1| CTA212 antisense protein [Candida albicans SC531...4] ref|XP_710331.1| CTA212 antisense protein [Candida albicans SC5314] gb|EAK91068.1| CTA212 antisense prote...in [Candida albicans SC5314] gb|EAK91085.1| CTA212 antisense protein [Candida albicans SC5314] XP_710348.1 0.20 29% ...

  15. Dicty_cDB: Contig-U11652-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kkwklnhqii*tmekivnllqtfnl*k***ktn Frame B: ps*svsl*scvvsvleslisfchhtlmcifd*tyfssr*ghmfgaciirplrirsvlhnf rdlreca...t 838 |||||| Sbjct: 833 gttcat 838 Score = 420 bits (212), Expect = e-117 Identities = 212/212 (100%) Str...||||||||||||||||||||||||||| Sbjct: 181 cagagatttacgagagtgcgcctcacaaaatt 212 Score = 224 bits (113), Expec...tctgctgatg 618 |||||||||||||||||||| Sbjct: 367 acatgcctcatctgctgatg 386 Score = 210 bits (106), Expec...Seq.d (1223 letters) Database: CSM 6905 sequences; 5,674,871 total letters Score E Sequences producing significa

  16. Inclusive measurement of (p,πsup(-)xn) double charge exchange reactions on bismuth from threshold to 800 MeV

    International Nuclear Information System (INIS)

    The energy dependence of the total angle-integrated cross section for the production of astatine isotopes from (p,πsup(-)xn) double charge exchange reactions on bismuth (sup(209)Bi) was measured from 120 to 800 MeV using activation and radiochemical techniques. Chemical yields were estimated by direct radioassaying of sup(211)At activity in thin (approximately 1 mg/cmsup(2)), irradiated bismuth targets. Calculations of the contributions of secondary (2-step) reactions to these measured astatine yields were performed, based partially upon the observed sup(211)At activity although even at the highest energies, the contribution to products lighter than sup(207)At was negligible. These data for products with as many as 7 neutrons removed from the doubly coherent product (sup(210)At) display nearby gaussian shapes for the mass distributions of the astatine residues with the maximum occurring for about sup(204)At. The most probable momentum transfer deduced from these distributions for the initial πsup(-) production step was 335 MeV/c. The observed excitation functions display a behaviour similar to that observed for the yield of sup(210)Po from a (p,πsup(O)) reaction on sup(209)Bi, but radically different from that observed for inclusive πsup(-) reactions on a heavy nucleus. These data are discussed in terms of recent theoretical approaches to negative pion production from bismuth. In addition, a simple, schematic model is developed to treat the rapidly decreasing percentage of the total inclusive πsup(-) emission which is observed for this double charge exchange reaction. This model reflects the capacity of a nucleus to a source of internal energetic protons

  17. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    OpenAIRE

    BAYRAM, Ali

    1998-01-01

    In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 1...

  18. Human radiation studies: Remembering the early years: Oral history of Dr. Patricia Wallace Durbin, Ph.D., conducted November 11, 1994

    International Nuclear Information System (INIS)

    This report is a transcript of an interview of Dr. Patricia Wallace Durbin by representatives of the US DOE Office of Human Radiation Research. Dr. Durbin was selected for this interview because of her knowledge of the human plutonium injections and her recollections of key figures, especially Joseph Hamilton. After a brief biographical sketch Dr. Durbin discusses her loss of research funding from DOE, her recollections concerning research into strontium metabolism as part of Project Sunshine, her recollections relating to the rationale for studies of human metabolism of radionuclides, her remembrances of Dr. Hamilton's Astatine and Plutonium research, and her experiences in gathering archival records concerning these researches

  19. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC212 (Link to dictyBase) - - - Contig-U16455-1 VFC212P (Link... to Original site) VFC212F 260 VFC212Z 343 VFC212P 603 - - Show VFC212 Library VF (Link to library) Clone ID VFC212 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16455-1 Original site URL http://dict...actor 1 alpha. 394 0.0 3 X55972 |X55972.1 D. discoideum EF1-II gene for elongation factor 1 alpha. 347 0.0 3...4.0 %: vesicles of secretory system 4.0 %: endoplasmic reticulum >> prediction fo

  20. Secondary School Teachers Don’t Have Time to Engage in the Most Important Aspects of Information Literacy Due to Curricular Pressures. A Review of: Williams, D. and C. Wavell. “Secondary School Teachers’ Conceptions of Student Information Literacy.” Journal of Librarianship and Information Science 39.4 (2007: 199-212.

    Directory of Open Access Journals (Sweden)

    Lotta Haglund

    2009-03-01

    Full Text Available Objective – To examine school teachers’ understanding of student information literacy and to look at the implications of the findings for developing information literacy in students.Design – Qualitative research design (group discussions; verbal and written reflections.Setting – Secondary schools in the United Kingdom.Subjects – Secondary school teachers with various subject specializations.Methods – The study initially involved 31 secondary school teachers; 24 from seven schools in Scotland and seven from two schools in England. Participant teachers were self-selecting. The study took a phenomenographic approach. Teachers’ perceptions of their students’ abilities and their experiences and perceptions of their role in developing these abilities were examined through data collection in three stages. During the first stage, group discussions established the teacher’s initial conceptions of information literacy. Participants also filled out an information task grid which, together with focus questions, ensured that discussions were kept in the realm of practice. During the second stage of data collection, teachers observed and reflected on their students’ use of information in classroom activities. This was accompanied by informal site visits during which 26 of the participants were introduced to information literacy frameworks and definitions in order to contextualize reflections and discussions. Field notes were used to record these informal meetings. Six participants provided written feedback on reflections. In the third and final stage, a summary of themes from the first two stages was sent to 23 of the participants prior to a second group discussion in order to try to stimulate further reflection. Discussions were audio recorded and transcribed. The transcribed data were analyzed for the dimensions of variation of teachers’ conceptions of student information literacy and key elements associated with each category of description were determined.Main Results – The data revealed six main conceptions of student information literacy among the teachers: “finding information,” “linguistic understanding,” “makingmeaning,” “skills,” “critical awareness ofsources,” and “independent learning.” There was no particular hierarchy in their conceptualization, although independent learning seemed to be the ultimate goal. Teachers’ conceptions in the beginning ofthe study focused on the ability to find information, whereas after a period of reflection and further discussions, a broader and more complex understanding of information literacy appeared. Table 1 simplifies some of the data from the table in the article and shows conceptualizations as well as some of the contextual elements. Teachers felt that they had at least some control over the development of student ability to find information, develop skills, and critically appraise sources, even though these were not the highest learning priority outcomes. However, in the three areas of ability which the teachers regarded as of high learning priority (linguistic understanding, making meaning and independent learning, they felt that they had little control over the development of these abilities in the students.Conclusion – The teachers’ conceptions of student information literacy overlapped with the ideas in existing models and frameworks for information literacy. However, some areas of information literacy were not addressed by the teachers, i.e., ethical issues in the use of information. In the categories of description of high learning priority, the main reason for the low sense of control by the teachers seemed to be curricular pressures – “our content is prescribed and time allocated doing each of these things is prescribed so we have got limited room for maneuvering” (206. The teachers tended to regard information literacy as process and skills-orientated, with little connection to learning. The authors note that other research also suggests that school librarians also have difficulty relating information finding to learning in specific subject disciplines. There is a clear gap here as the authors point out that “there is a danger that students will not understand the significance of learning with information for academic achievement or for independent learning” (209.The authors suggest that the way forward for further development of information literacy in the classroom and library is through dialogue and that “librarian-teacher collaborations needs to be founded on shared understanding of the complex inter-relationship between information and learning” (209.

  1. 8 CFR 245.23 - Adjustment of aliens in T nonimmigrant classification.

    Science.gov (United States)

    2010-01-01

    ... pursuant to 8 CFR 214.11(s); (2) The alien is described in sections 212(a)(3), 212(a)(10)(C), or 212(a)(10...-entered using an advance parole document issued under 8 CFR 245.2(a)(4)(ii)(B), the date that the alien...) Inapplicability of 8 CFR 245.1 and 245.2. Sections 245.1 and 245.2 of this chapter do not apply to aliens...

  2. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    Directory of Open Access Journals (Sweden)

    Ali BAYRAM

    1998-03-01

    Full Text Available In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 10, 50 and 259 mm/min. Strength properties of dual-phase steels were investigated depending on annealing temperature, ratio of martensite and loading rate.

  3. A route for polonium 210 production from alpha-particle irradiated bismuth-209 target

    International Nuclear Information System (INIS)

    A method is proposed for production of polonium-210 via the 209Bi(α,3n)210 At nuclear reaction. Bombardment of a bismuth-209 target was performed with a 37 MeV alpha-particle beam that leads to the production of astatine-210 (T1/2 = 8.1 h), which decays to polonium-210. It is purified from the bismuth target matrix by employing liquid-liquid extraction using tributyl phosphate (TBP) in para-xylene from 7 M hydrochloric acid. Back extraction of polonium-210 was performed by 9 M nitric acid. This method allows to purify a tracer amount of Po-210 (2.6 x 10-13 mol) from macroscopic amount of Bi (2.8 x 10-2 mol).

  4. Effective bond orders from two-step spin–orbit coupling approaches: The I{sub 2}, At{sub 2}, IO{sup +}, and AtO{sup +} case studies

    Energy Technology Data Exchange (ETDEWEB)

    Maurice, Rémi, E-mail: remi.maurice@subatech.in2p3.fr; Montavon, Gilles [SUBATECH, CNRS UMR 6457, IN2P3/EMN Nantes/Université de Nantes, 4 rue Alfred Kastler, BP 20722, 44307 Nantes Cedex 3 (France); Réal, Florent; Gomes, André Severo Pereira; Vallet, Valérie [Laboratoire PhLAM, CNRS UMR 8523, Université de Lille, 59655 Villeneuve d’Ascq Cedex (France); Galland, Nicolas [CEISAM, UMR CNRS 6230, Université de Nantes, 2 rue de la Houssinière, BP 92208, 44322 Nantes Cedex 3 (France)

    2015-03-07

    The nature of chemical bonds in heavy main-group diatomics is discussed from the viewpoint of effective bond orders, which are computed from spin–orbit wave functions resulting from spin–orbit configuration interaction calculations. The reliability of the relativistic correlated wave functions obtained in such two-step spin–orbit coupling frameworks is assessed by benchmark studies of the spectroscopic constants with respect to either experimental data, or state-of-the-art fully relativistic correlated calculations. The I{sub 2}, At{sub 2}, IO{sup +}, and AtO{sup +} species are considered, and differences and similarities between the astatine and iodine elements are highlighted. In particular, we demonstrate that spin–orbit coupling weakens the covalent character of the bond in At{sub 2} even more than electron correlation, making the consideration of spin–orbit coupling compulsory for discussing chemical bonding in heavy (6p) main group element systems.

  5. Effective bond orders from two-step spin–orbit coupling approaches: The I2, At2, IO+, and AtO+ case studies

    International Nuclear Information System (INIS)

    The nature of chemical bonds in heavy main-group diatomics is discussed from the viewpoint of effective bond orders, which are computed from spin–orbit wave functions resulting from spin–orbit configuration interaction calculations. The reliability of the relativistic correlated wave functions obtained in such two-step spin–orbit coupling frameworks is assessed by benchmark studies of the spectroscopic constants with respect to either experimental data, or state-of-the-art fully relativistic correlated calculations. The I2, At2, IO+, and AtO+ species are considered, and differences and similarities between the astatine and iodine elements are highlighted. In particular, we demonstrate that spin–orbit coupling weakens the covalent character of the bond in At2 even more than electron correlation, making the consideration of spin–orbit coupling compulsory for discussing chemical bonding in heavy (6p) main group element systems

  6. Different ways to improve the clinical effectiveness of radioimmunotherapy in solid tumors

    Directory of Open Access Journals (Sweden)

    Chatal Jean-Francois

    2009-09-01

    Full Text Available Radioimmunotherapy (RIT has been proven effective in the treatment of radiosensitive non-Hodgkin lymphoma but, for radioresistant solid tumors, new approaches are necessary to improve the clinical effectiveness. A real improvement has been the introduction of the pretargeting technology which appeared to be able to significantly increase tumor-to-normal organ uptake ratios.Another very promising approach consists in associating RIT with other treatment modalities. Finally the use of alpha particle-emitting radionuclides such as astatin-211 or bismuth-213 (alpha-RIT should allow to efficiently eradicate disseminated microscopic clusters of tumor cells or isolated tumor cells which fit well with the short path length of alpha particles.

  7. Sequential radioimmunotherapy with 177Lu- and 211At-labeled monoclonal antibody BR96 in a syngeneic rat colon carcinoma model

    DEFF Research Database (Denmark)

    Eriksson, Sophie E; Elgström, Erika; Bäck, Tom;

    2014-01-01

    UNLABELLED: Alpha-particle emitters, such as astatine-211 (211At), are generally considered suitable for the treatment of small cell clusters due to their short path length, while beta-particle emitters, for example, Lutetium-177 (177Lu), have a longer path length and are considered better for...... small, established tumors. A combination of such radionuclides may be successful in regimens of radioimmunotherapy. In this study, rats were treated by sequential administration of first a 177Lu-labeled antibody, followed by a 211At-labeled antibody 25 days later. METHODS: Rats bearing solid colon...... carcinoma tumors were treated with 400 MBq/kg body weight 177Lu-BR96. After 25 days, three groups of animals were given either 5 or 10 MBq/kg body weight of 211At-BR96 simultaneously with or without a blocking agent reducing halogen uptake in normal tissues. Control animals were not given any 211At-BR96...

  8. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  9. Development of 211At Chemistry for Labelling Biomolecules

    International Nuclear Information System (INIS)

    Our studies have demonstrated that high recovery of 211At can be obtained using a “wet chemistry” approach to isolation from the bismuth target. We have also demonstrated that direct labelling of antibody-B10 conjugates with 211At can be performed in high yields, and that the astatinated antibodies are stable to in vivo deastatination. While these results will allow us to enter clinical studies with 211At-labelled antibodies, the chemistry associated with 211At is not fully understood. Therefore, it is important that many more basic studies to be conducted with 211At, so the optimal labelling reagent for each type of disease-targeting agent becomes apparent

  10. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena;

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... levels of γH2AX decreased during the first 24h in both cycling and stationary cultures and complete repair was seen in all cultures but cycling cells exposed to (211)At. Compared to stationary cells alpha particles were more harmful for cycling cultures, an effect also seen at the pChk2 levels...... cultures at a modest level of damage, clearly demonstrating that cell cycle status influences the relative effectiveness of alpha particles....

  11. 22 CFR 40.53 - Uncertified foreign health-care workers.

    Science.gov (United States)

    2010-04-01

    ....S.C. 1182(r), respectively, and the regulations found at 8 CFR 212.15. (b) Paragraph (a) of this... a non-clinical health care occupation as described in 8 CFR 212.15(b)(1); or (2) Who is the immigrant or nonimmigrant spouse or child of a foreign health care worker and who is seeking to accompany...

  12. 77 FR 59339 - Acquisition of Commercial Items

    Science.gov (United States)

    2012-09-27

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF DEFENSE Defense Acquisition Regulations System 48 CFR Part 212 Acquisition of Commercial Items CFR Correction 212.504 In Title 48 of the Code of Federal Regulations, Chapter 2 (Parts 201--299), revised as of...

  13. 7 CFR 330.100 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... which are not genetically engineered as defined in 7 CFR 340.1 which can directly or indirectly injure... 330.212, “plant pest” means any living stage of any insects, mites, nematodes, slugs, snails, protozoa....212, plant pest means any living stage of insects, mites, nematodes, slugs, snails, protozoa, or...

  14. Susceptibility of irradiated steels to hydrogen embrittlement

    Science.gov (United States)

    Rossin, A. D.

    1968-01-01

    Investigation determined whether irradiated pressure-vessel steels 4340 and 212-B are susceptible to hydrogen embrittlement and to catastrophic failure. Hydrogen-charging conditions which completely embrittled 4340 steel had negligible effect on 212-B steel in tensile and delayed-failure tests.

  15. 27 CFR 27.41 - Computation of effective tax rate.

    Science.gov (United States)

    2010-04-01

    ... distilled spirits derived from eligible flavors exceed 21/2% of the total proof gallons in the batch (100.9 − (21/2%) × 3.371.8 = 16.6). Batch Record Distilled spirits 2249.1 proof gallons. Eligible wine...

  16. Chameleons out of disguise: sex chromosomes revealed

    Czech Academy of Sciences Publication Activity Database

    Rovatsos, M.; Johnson Pokorná, Martina; Altmanová, M.; Kratochvíl, L.

    Brno: Ústav biologie obratlovců AV ČR, 2015 - (Bryja, J.; Řehák, Z.; Zukal, J.). s. 212-212 ISBN 978-80-87189-18-4. [Zoologické dny. 12.02.2015-13.02.2015, Brno] Institutional support: RVO:67985904 Keywords : sex chromosomes Subject RIV: EG - Zoology

  17. 77 FR 20314 - 2-Propenoic Acid, 2-Methyl-, 2-Ethylhexyl Ester, Telomer With 1-Dodecanethiol, Ethenylbenzene and...

    Science.gov (United States)

    2012-04-04

    ... a number average molecular weight (MW) greater than or equal to 10,000 daltons. Additionally, the... salt, 2, 2'-(1,2- diazenediyl)bis -initiated, minimum number average molecular weight (in amu), 1,200... polymer's number average MW of 1,212 is greater than 1,000 and less than 10,000 daltons. The...

  18. Inleiding

    NARCIS (Netherlands)

    Koper, Rob

    2005-01-01

    Koper, R. (2004). Inleiding. In: Van Geloven, M., Koper, R. & Van der Veen, J., E-learning trends (pp. 6-7). Utrecht, Stichting Digitale Universiteit.
    Ook beschikbaar in dspace: 212">http://hdl.handle.net/1820/212

  19. Migration distance and the effect of North Atlantic Oscillation on the spring arrival of birds in Central Europe

    Czech Academy of Sciences Publication Activity Database

    Hubálek, Zdeněk; Čapek, Miroslav

    2008-01-01

    Roč. 57, č. 3 (2008), s. 212-220. ISSN 0139-7893 Institutional research plan: CEZ:AV0Z60930519 Keywords : climate * NAO * phenology * temperature * weather * migration of birds * wintering area Subject RIV: EH - Ecology, Behaviour Impact factor: 0.522, year: 2008 http://www.ivb.cz/folia/57/3/212_220.pdf

  20. A text in Romani from 1622

    DEFF Research Database (Denmark)

    Bakker, Peter

    this is a reprint of a 2012 article: A new old text in Romani: Lord's Prayer, 1622. International Journal of Romani Language and Culture 2 (2011): 193-212.......this is a reprint of a 2012 article: A new old text in Romani: Lord's Prayer, 1622. International Journal of Romani Language and Culture 2 (2011): 193-212....

  1. 78 FR 56817 - Paper and Paper-Based Packaging Promotion, Research and Information Order; Referendum Procedures

    Science.gov (United States)

    2013-09-16

    ... Federal Register on January 2, 2013. One rule pertained to the proposed Order (78 FR 188) and a second rule pertained to proposed referendum procedures (78 FR 212). Both rules provided for 60-day comment... Register on January 2, 2013 (78 FR 212). Copies of the rule were mailed by USDA to all known...

  2. News from the Biological Stain Commission No. 14

    DEFF Research Database (Denmark)

    Lyon, Hans O

    2013-01-01

    In the 14(th) issue of News from the Biological Stain Commission (BSC) the BSC's International Affairs Committee presents information from the meetings of ISO/TC 212/WG 3, In vitro diagnostic products, and from the final plenary meeting of ISO/TC 212, Clinical laboratory testing and in vitro...

  3. An improved synthesis of an 125I and 211At labelled benzamide for melanoma imaging

    International Nuclear Information System (INIS)

    Recent studies have indicated that benzamides can exhibit affinity for malignant melanoma and may be exploited diagnostically in the treatment of this cancer. Radioiodinated N-(2-diethylaminoethyl)-3-[123I/131I]iodo-4-methoxybenzamide (*I-IMBA) is a benzamide with promising diagnostic properties. A new synthesis procedure was developed to obtain 125I-IMBA suitable for use in vivo. The assets of the procedure include the use of less toxic reagents and better reproducible results when radiolabelling the precursor. The procedure also facilitates the synthesis of the astatinated N-(2-diethylaminoethyl)-3-[211At]astatine-4-methoxybenzamide (211At-AMBA), a new benzamide with a therapeutic potential. The regiospecific no-carrier-added 125I- and 211At-labeling of the benzamide is performed by demetalation of an organotin precursor. Using tributylstannyl as a leaving group, the radiochemical yield obtained after 15 minutes of reaction was 70 %-90 % for both 125I-IMBA and 211At-AMBA. The labelling was performed in a solution of MeOH:AcOH with NCS as the oxidising agent. The organotin precursor N-(2-diethylaminoethyl)-3-(tri-n-butylstannyl)-4-methoxy-benzamide was synthesized from 3-bromo-4-methoxybenzoic acid, with n-BuLi (2 eq) and Bu3SnCl (1 eq) in THF, giving 3-(tri-n-butylstannyl)-4-methoxybenzoic acid. The amide function was introduced by converting the acid group into an active N-succinimidyl-ester, a good leaving group in the reaction with 2-(diethylamino)ethylamine. The overall yield of the organotin precursor was 65 %

  4. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    Energy Technology Data Exchange (ETDEWEB)

    Marsh, B.A., E-mail: bruce.marsh@cern.ch [CERN, CH-1211 Geneva (Switzerland); Andel, B. [Comenius University, Bratislava (Slovakia); Andreyev, A.N. [University of York, Department of Physics, York YO10 5DD (United Kingdom); Antalic, S. [Comenius University, Bratislava (Slovakia); Atanasov, D. [Max-Planck-Institut für Kernphysik, Saupfercheckweg 1, 69117 Heidelberg (Germany); Barzakh, A.E. [Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, 188300 Gatchina (Russian Federation); Bastin, B. [Grand Accérateur National d’Ions Lourds (GANIL), Bd Henri Becquerel, F-14076 Caen (France); Borgmann, Ch. [Max-Planck-Institut für Kernphysik, Saupfercheckweg 1, 69117 Heidelberg (Germany); Capponi, L. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Cocolios, T.E.; Day Goodacre, T. [CERN, CH-1211 Geneva (Switzerland); University of Manchester, Manchester (United Kingdom); Dehairs, M. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Derkx, X. [University of the West of Scotland, School of Engineering, Paisley PA1 2BE (United Kingdom); De Witte, H. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fedorov, D.V. [Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, 188300 Gatchina (Russian Federation); Fedosseev, V.N.; Focker, G.J. [CERN, CH-1211 Geneva (Switzerland); Fink, D.A. [Ruprecht-Karls Universität, Seminarstr. 2, 69117 Heidelberg (Germany); CERN, CH-1211 Geneva (Switzerland); Flanagan, K.T. [University of Manchester, Manchester (United Kingdom); Franchoo, S. [CSNSM-IN2P3-CNRS, Université Paris-Sud, 91406 Orsay (France); and others

    2013-12-15

    Highlights: • Upgrade of the lasers, detectors and data acquisition for in-source resonance ionization spectroscopy at ISOLDE. • First use of the ISOLTRAP MR-ToF MS in combination with laser spectroscopy at ISOLDE. • Resonance ionization of astatine for the study of its nuclear structure. -- Abstract: At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar free ionization using the Laser Ion Source Trap, LIST (Po); isobar selective particle identification using the multi-reflection time-of-flight mass separator (MR-ToF MS) of ISOLTRAP (Au, At). These are summarized as part of an overview of the current status of the in-source resonance ionization spectroscopy setup at ISOLDE.

  5. Bis[μ-N,N′-bis(2,6-diisopropylphenylethene-1,2-diamido]-1,4(η2;1:2κ4N:N;3:4κ4N:N-bis(diethyl ether-1κO,4κO-di-μ-hydrido-2:3κ4H:H-2,3-dichromium(II-1,4-dilithium(I pentane hemisolvate

    Directory of Open Access Journals (Sweden)

    Uwe Rosenthal

    2010-03-01

    Full Text Available The title compound, [Cr2Li2(C26H36N22(μ-H2(C4H10O2]·0.5C5H12, is a binuclear chromium complex bridged by two hydrogen atoms. Each chromium atom is coordinated in a distorted square-planar geometry by one chelating bis(2,6-diisopropylphenylethene-1,2-diamido ligand via its two N atoms. Additionally, two diametrically opposed lithium ether adducts coordinate in an η4 mode on the backbone of the ligands. There is a crystallographic inversion center in the middle of the Cr2H2 ring. One of the isopropyl groups is disordered over two positions in a 0.567 (7:0.433 (7 ratio. Disorder is also observed in the pentane hemisolvate molecule.

  6. Resveratrol analogue 3,4,4′,5-tetramethoxystilbene inhibits growth, arrests cell cycle and induces apoptosis in ovarian SKOV‐3 and A-2780 cancer cells

    International Nuclear Information System (INIS)

    In the screening studies, cytotoxicity of 12 methylated resveratrol analogues on 11 human cancer cell lines was examined. The most active compound 3,4,4′5-tetramethoxystilbene (DMU-212) and two ovarian cancer cell lines A-2780 (IC50 = 0.71 μM) and SKOV-3 (IC50 = 11.51 μM) were selected for further investigation. To determine the mechanism of DMU-212 cytotoxicity, its ability to induce apoptosis was examined. DMU-212 arrested cell cycle in the G2/M or G0/G1 phase which resulted in apoptosis of both cell lines. The expression level of 84 apoptosis-related genes was investigated. In SKOV-3 cells DMU-212 caused up-regulation of pro-apoptotic Bax, Apaf-1 and p53 genes, specific to intrinsic pathway of apoptosis, and a decrease in Bcl-2 and Bcl 2110 mRNA expressions. Conversely, in A-2780 cells an increased expression of pro-apoptotic genes Fas, FasL, TNF, TNFRSF10A, TNFRSF21, TNFRSF16 specific to extracellular mechanism of apoptosis was observed. There are no data published so far regarding the receptor mediated apoptosis induced by DMU-212. The activation of caspase-3/7 was correlated with decreased TRAF-1 and BIRC-2 expression level in A-2780 cells exposed to DMU-212. DMU-212 caused a decrease in CYP1A1 and CYP1B1 mRNA levels in A-2780 by 50% and 75%, and in SKOV-3 cells by 15% and 45%, respectively. The protein expression was also reduced in both cell lines. It is noteworthy that the expression of CYP1B1 protein was entirely inhibited in A-2780 cells treated with DMU-212. It can be suggested that different CYP1B1 expression patterns in either ovarian cell line may affect their sensitivity to cytotoxic activity of DMU-212. -- Highlights: ► DMU-212 was the most cytotoxic among 12 O-methylated resveratrol analogues. ► DMU-212 arrested cell cycle at G2/M and G0/G1phase ► DMU-212 triggered mitochondria- and receptor‐mediated apoptosis. ► DMU-212 entirely inhibited CYP1B1 protein expression in A-2780 cells.

  7. Resveratrol analogue 3,4,4′,5-tetramethoxystilbene inhibits growth, arrests cell cycle and induces apoptosis in ovarian SKOV‐3 and A-2780 cancer cells

    Energy Technology Data Exchange (ETDEWEB)

    Piotrowska, Hanna; Myszkowski, Krzysztof; Ziółkowska, Alicja [Department of Toxicology, Poznan University of Medical Sciences, Poznan (Poland); Kulcenty, Katarzyna [Chair of Medical Biotechnology, Poznan University of Medical Sciences, Poznan (Poland); Wierzchowski, Marcin [Department of Chemical Technology of Drugs, Poznan University of Medical Sciences, Poznan (Poland); Kaczmarek, Mariusz [Department of Clinical Immunology, Poznan University of Medical Sciences, Poznan (Poland); Murias, Marek [Department of Toxicology, Poznan University of Medical Sciences, Poznan (Poland); Kwiatkowska-Borowczyk, Eliza [Chair of Medical Biotechnology, Poznan University of Medical Sciences, Poznan (Poland); Department of Cancer Diagnostics and Immunology, Greater Poland Cancer Centre, Poznan (Poland); Jodynis-Liebert, Jadwiga, E-mail: liebert@ump.edu.pl [Department of Toxicology, Poznan University of Medical Sciences, Poznan (Poland)

    2012-08-15

    In the screening studies, cytotoxicity of 12 methylated resveratrol analogues on 11 human cancer cell lines was examined. The most active compound 3,4,4′5-tetramethoxystilbene (DMU-212) and two ovarian cancer cell lines A-2780 (IC{sub 50} = 0.71 μM) and SKOV-3 (IC{sub 50} = 11.51 μM) were selected for further investigation. To determine the mechanism of DMU-212 cytotoxicity, its ability to induce apoptosis was examined. DMU-212 arrested cell cycle in the G2/M or G0/G1 phase which resulted in apoptosis of both cell lines. The expression level of 84 apoptosis-related genes was investigated. In SKOV-3 cells DMU-212 caused up-regulation of pro-apoptotic Bax, Apaf-1 and p53 genes, specific to intrinsic pathway of apoptosis, and a decrease in Bcl-2 and Bcl 2110 mRNA expressions. Conversely, in A-2780 cells an increased expression of pro-apoptotic genes Fas, FasL, TNF, TNFRSF10A, TNFRSF21, TNFRSF16 specific to extracellular mechanism of apoptosis was observed. There are no data published so far regarding the receptor mediated apoptosis induced by DMU-212. The activation of caspase-3/7 was correlated with decreased TRAF-1 and BIRC-2 expression level in A-2780 cells exposed to DMU-212. DMU-212 caused a decrease in CYP1A1 and CYP1B1 mRNA levels in A-2780 by 50% and 75%, and in SKOV-3 cells by 15% and 45%, respectively. The protein expression was also reduced in both cell lines. It is noteworthy that the expression of CYP1B1 protein was entirely inhibited in A-2780 cells treated with DMU-212. It can be suggested that different CYP1B1 expression patterns in either ovarian cell line may affect their sensitivity to cytotoxic activity of DMU-212. -- Highlights: ► DMU-212 was the most cytotoxic among 12 O-methylated resveratrol analogues. ► DMU-212 arrested cell cycle at G2/M and G0/G1phase ► DMU-212 triggered mitochondria- and receptor‐mediated apoptosis. ► DMU-212 entirely inhibited CYP1B1 protein expression in A-2780 cells.

  8. Anisotropic Cell Expansion Is Affected through the Bidirectional Mobility of Cellulose Synthase Complexes and Phosphorylation at Two Critical Residues on CESA31[OPEN

    Science.gov (United States)

    Liu, Yanmei; Bauer, Stefan

    2016-01-01

    Here we report that phosphorylation status of S211 and T212 of the CESA3 component of Arabidopsis (Arabidopsis thaliana) cellulose synthase impacts the regulation of anisotropic cell expansion as well as cellulose synthesis and deposition and microtubule-dependent bidirectional mobility of CESA complexes. Mutation of S211 to Ala caused a significant decrease in the length of etiolated hypocotyls and primary roots, while root hairs were not significantly affected. By contrast, the S211E mutation stunted the growth of root hairs, but primary roots were not significantly affected. Similarly, T212E caused a decrease in the length of root hairs but not root length. However, T212E stunted the growth of etiolated hypocotyls. Live-cell imaging of fluorescently labeled CESA showed that the rate of movement of CESA particles was directionally asymmetric in etiolated hypocotyls of S211A and T212E mutants, while similar bidirectional velocities were observed with the wild-type control and S211E and T212A mutant lines. Analysis of cell wall composition and the innermost layer of cell wall suggests a role for phosphorylation of CESA3 S211 and T212 in cellulose aggregation into fibrillar bundles. These results suggest that microtubule-guided bidirectional mobility of CESA complexes is fine-tuned by phosphorylation of CESA3 S211 and T212, which may, in turn, modulate cellulose synthesis and organization, resulting in or contributing to the observed defects of anisotropic cell expansion. PMID:26969722

  9. MicroRNAs and drug addiction

    Directory of Open Access Journals (Sweden)

    Paul J Kenny

    2013-05-01

    Full Text Available Drug addiction is considered a disorder of neuroplasticity in brain reward and cognition systems resulting from aberrant activation of gene expression programs in response to prolonged drug consumption. Noncoding RNAs are key regulators of almost all aspects of cellular physiology. MicroRNAs (miRNAs are small (~21–23 nucleotides noncoding RNA transcripts that regulate gene expression at the post-transcriptional level. Recently, microRNAs were shown to play key roles in the drug-induced remodeling of brain reward systems that likely drives the emergence of addiction. Here, we review evidence suggesting that one particular miRNA, miR-212, plays a particularly prominent role in vulnerability to cocaine addiction. We review evidence showing that miR-212 expression is increased in the dorsal striatum of rats that show compulsive-like cocaine-taking behaviors. Increases in miR-212 expression appear to protect against cocaine addiction, as virus-mediated striatal miR-212 over-expression decreases cocaine consumption in rats. Conversely, disruption of striatal miR-212 signaling using an antisense oligonucleotide increases cocaine intake. We also review data that identify two mechanisms by which miR-212 may regulate cocaine intake. First, miR-212 has been shown to amplify striatal CREB signaling through a mechanism involving activation of Raf1 kinase. Second, miR-212 was also shown to regulate cocaine intake by repressing striatal expression of methyl CpG binding protein 2 (MeCP2, consequently decreasing protein levels of brain-derived neurotrophic factor (BDNF. The concerted actions of miR-212 on striatal CREB and MeCP2/BDNF activity greatly attenuate the motivational effects of cocaine. These findings highlight the unique role for miRNAs in simultaneously controlling multiple signaling cascades implicated in addiction.

  10. AcEST: DK962130 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0013_A16 654 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_A16. 5' end seq ... 6 GRSRRKKK-RTQNPLQSEGETEKFPRSFVIARGKLPPLLRKLHQDLRKLMLP HTALHLKE 212 GRSR +K+ R Q L++ P SFV RG+ +R+L D+R++M ... 6 GRSRRKKK-RTQNPLQSEGETEKFPRSFVIARGKLPPLLRKLHQDLRKLMLP HTALHLKE 212 GRSR +K+ R Q L++ P SFV RG +R+L D+R++M ... 6 GRSRRKKK-RTQNPLQSEGETEKFPRSFVIARGKLPPLLRKLHQDLRKLMLP HTALHLKE 212 GRSR +K+ R Q L++ P SFV RG +R+L D+R++M ... ery: 54 KKRTQNPLQSE-GETEKFPRSFVIARGKLPPLLRKLHQDLRKLMLP HTALHLKEKKSNSM 230 K RT SE E + P SFVI RG P + L D R+ ...

  11. The Use of Patient-Specific Intra-Operative Guides for Total Knee Arthroplasty (TKA

    Directory of Open Access Journals (Sweden)

    Hendrik P. Delport

    2012-08-01

    Conclusions: We conclude that this novel technique hereby described has major benefits: less operative time and proper implant positioning, but more prospective studies are mandatory. [Arch Clin Exp Surg 2012; 1(4.000: 206-212

  12. Fiber Intake and Childhood Appendicitis.

    Science.gov (United States)

    Brender, Jean D.; And Others

    1985-01-01

    Parents of 135 children with appendicitis and of 212 comparison children were interviewed about their children's diet. Results suggest that a liberal intake of whole-grain breads and cereals may decrease the risk of appendicitis during childhood. (KH)

  13. Drainage Basins Used for Assessing Trends in Concentration of Pesticides in Streams of the United States, 1992-2010

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This dataset consists of drainage basin boundaries for 212 U.S. Geological Survey (USGS) stream sites sampled in the National Water-Quality Assessment (NAWQA)...

  14. Uuring : Eesti autostumisel on Lääne-Euroopaga võrreldes palju arenguruumi

    Index Scriptorium Estoniae

    2007-01-01

    Autostumisest Eestis ja Euroopa Liidu liikmesriikides, Euroopa Komisjoni poolt tellitud Eurobaromeetri uuringu tulemustest. Lisa: 2006. aastal esmaregistreeriti Eestis kokku 74 212 sõiduautot, aasta varem 60 626 sõiduautot.

  15. Radionuclide diffusion into undisturbed and altered crystalline rocks

    Czech Academy of Sciences Publication Activity Database

    Havlová, V.; Večerník, P.; Najser, J.; Sosna, K.; Breiter, Karel

    2012-01-01

    Roč. 76, Dec. 2012 (2012), s. 3191-3201. ISSN 0026-461X Institutional support: RVO:67985831 Keywords : disposal * granite * radionuclide diffus * ion * sampling protocols Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.212, year: 2012

  16. Report on the geoarchaeological survey in the area of Sabaloka, the sixth Nile cataract, Sudan=Zpráva o geoarcheologickém průzkumu v oblasti Sabaloky, šestého nilského kataraktu, v Súdánu

    Czech Academy of Sciences Publication Activity Database

    Suková, L.; Cílek, Václav; Lisá, Lenka; Lisý, Pavel; Bushara, M.

    2010-01-01

    Roč. 4, č. 3 (2010), s. 40-53. ISSN 1802-212X Institutional research plan: CEZ:AV0Z30130516 Keywords : Nile * Holocene * sedimentology * archaeology * landscape * rock art Subject RIV: DB - Geology ; Mineralogy

  17. USGS Oil and Gas Assessment Database

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — The U.S. Geological Survey (USGS) has assessed undiscovered oil and natural gas potential for 212 geological provinces throughout the world as part of the US Oil...

  18. Chapter Leadership Profiles among Citizen Activists in the Drunk Driving Movement.

    Science.gov (United States)

    Ungerleider, Steven; Bloch, Steven

    1987-01-01

    Study of Mothers Against Drunk Drivers (MADD) analyzed the chapter emphasis, levels of satisfaction and relationship to national office on several measures. Surveying 212 chapters, MADD leadership provided profile of independent, autonomous activists in the drunk driving countermeasure movement. (Author)

  19. EDLnet D2.5 Europeana Outline Functional Specification For development of an operational European Digital Library

    OpenAIRE

    Dekkers, Makx; Gradmann, Stefan; Meghini, Carlo

    2008-01-01

    1 INTRODUCTION .....................................................................................5 2 FUNCTIONAL SPECIFICATION PRINCIPLES & METHODOLOGY BACKGROUND AND CONTEXT.......................................................................5 2.1 Methodology 5 2.1.1 Use Case Analysis........................................................................................................................5 2.1.2 Use Case Management ...............................................

  20. Aerial Photography and Imagery, Ortho-Corrected - 2008 Digital Orthophotos - Lee County

    Data.gov (United States)

    NSGIC GIS Inventory (aka Ramona) — The RGB one-foot orthophotos to be mapped consists of 2,212 cells (approximately 2000 square miles) flown with a Z/I Intergraph DMC airborne digital sensor. The...

  1. 27 CFR 19.34 - Computation of effective tax rate.

    Science.gov (United States)

    2010-04-01

    ... added. (c) The following is an example of the use of the formula. BATCH RECORD Distilled spirits 2249.1... distilled spirits derived from eligible flavors exceed 21/2%) of the total proof gallons in the batch...

  2. 77 FR 17085 - Agency Information Collection Activities: Form I-612; Extension of an Existing Information...

    Science.gov (United States)

    2012-03-23

    ... Collection Under Review; Form I- 612, Application for Waiver of the Foreign Residence Requirement of Section...: Application for Waiver of the Foreign Residence Requirement of Section 212(e) of the Immigration...

  3. 75 FR 11898 - Agency Information Collection Activities: Form I-612, Extension of a Currently Approved...

    Science.gov (United States)

    2010-03-12

    ... Information Collection Under Review: Form I- 612, Application for Waiver of the Foreign Residence Requirement... for Waiver of the Foreign Residence Requirement of Section 212(e) of the Immigration and...

  4. Waiting for the existential revolution in Europe

    Czech Academy of Sciences Publication Activity Database

    Komárek, Jan

    2014-01-01

    Roč. 12, č. 1 (2014), s. 190-212. ISSN 1474-2640 Institutional support: RVO:68378122 Keywords : European Union * post-communism countries * European integration Subject RIV: AG - Legal Sciences Impact factor: 0.628, year: 2014

  5. 30 CFR 207.5 - Contract and sales agreement retention.

    Science.gov (United States)

    2010-07-01

    ... production are to be maintained by the lessee and made available upon request during normal working hours to authorized MMS, State or Indian representatives, other MMS or BLM officials, auditors of the General... with 30 CFR part 212....

  6. Poetika mlčení

    Czech Academy of Sciences Publication Activity Database

    Lahoda, Vojtěch

    Řevnice: Arbor vitae, 2012 - (Srp, K.), s. 212-233 ISBN 978-80-7467-021-3 Institutional support: RVO:68378033 Keywords : loneliness * wakeful sleep * melancholy * sadness Subject RIV: AL - Art, Architecture, Cultural Heritage

  7. 75 FR 52768 - Withdrawal of Approval of New Animal Drug Applications; Dichlorophene and Toluene Capsules

    Science.gov (United States)

    2010-08-27

    ... INFORMATION CONTACT: John Bartkowiak, Center for Veterinary Medicine (HFV-212), Food and Drug Administration... Veterinary Medicine, and in accordance with Sec. 514.116 Notice of withdrawal of approval of application (21... Veterinary Medicine. BILLING CODE 4160-01-S...

  8. 77 FR 55413 - New Animal Drugs; Chorionic Gonadotropin; Naloxone; Oxymorphone; Oxytocin

    Science.gov (United States)

    2012-09-10

    ... FURTHER INFORMATION CONTACT: David Alterman, Center for Veterinary Medicine (HFV-212), Food and Drug... Drugs and redelegated to the Center for Veterinary Medicine, 21 CFR parts 510 and 522 are amended as... Veterinary Medicine. BILLING CODE 4160-01-P...

  9. 4 CFR 21.5 - Protest issues not for consideration.

    Science.gov (United States)

    2010-01-01

    ... time limits set forth in § 21.2. (f) Protests which lack a detailed statement of the legal and factual... business size standards and North American Industry Classification System (NAICS) standards. Challenges...

  10. Successful Use of Hydroxocobalamin and Sodium Thiosulfate in Acute Cyanide Poisoning: A Case Report with Follow-up

    Czech Academy of Sciences Publication Activity Database

    Zakharov, S.; Vaněčková, M.; Seidl, Z.; Diblik, P.; Kuthan, P.; Urban, P.; Navrátil, Tomáš; Pelclová, D.

    2015-01-01

    Roč. 117, č. 3 (2015), s. 209-212. ISSN 1742-7835 Institutional support: RVO:61388955 Keywords : glycosylated hemoglobin * hydroxocobalamin * lactic acid Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.377, year: 2014

  11. K ústní zkoušce z češtiny (Máj Karla Hynka Máchy)

    Czech Academy of Sciences Publication Activity Database

    Ibrahim, Robert

    2014-01-01

    Roč. 64, č. 5 (2014), s. 209-212. ISSN 0009-0786 Institutional support: RVO:68378068 Keywords : Czech secondary school-leaving examination * text edition * theory of verse Subject RIV: AJ - Letters, Mass-media, Audiovision

  12. Surface functionalization of mesoporous antimony doped tin oxide by metalorganic reaction

    Czech Academy of Sciences Publication Activity Database

    Müller, V.; Haase, F.; Rathouský, Jiří; Fattakhova-Rohlfing, D.

    2012-01-01

    Roč. 137, č. 1 (2012), s. 207-212. ISSN 0254-0584 Institutional support: RVO:61388955 Keywords : oxides * organometallic compounds * chemical synthesis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.072, year: 2012

  13. Altitudinal and seasonal differences of tick communities in dogs from pastoralist tribes of Northern Kenya

    Czech Academy of Sciences Publication Activity Database

    D'Amico, G.; Dumitrache, M.O.; Široký, P.; Albrechtová, K.; Sloboda, M.; Domsa, C.; Sándor, A.D.; Balázsi, R.; Kanyari, P. W. N.; Modrý, David; Mihalca, A. D.

    2015-01-01

    Roč. 212, 3-4 (2015), s. 318-323. ISSN 0304-4017 Institutional support: RVO:60077344 Keywords : Altitudinal distribution * Rhipicephalus sanguineus * Rhipicephalus pulchellus * Rhipicephalus armatus Subject RIV: CE - Biochemistry Impact factor: 2.460, year: 2014

  14. AcEST: BP914438 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ibosome biogenesis protein BOP1 OS=Homo sa... 105 1e-22 sp|O74399|YOCD_SCHPO Unch... WR V D ++ LT ++ ++ + G++ Sbjct: 166 RDELDQFLDKMDDPDYWRTVQDPMTGRDLRLTDEQVALVRRLQSGQF 212 >sp|O74399|YOCD_SCH

  15. Neuromuscular paralysis induced in insect larvae by the proteinic venom of a parasitic wasp

    Czech Academy of Sciences Publication Activity Database

    Sláma, Karel

    New York: Nova Science Publishers, 2012 - (Berhardt, L.), s. 195-212 ISBN 978-1-62100-889-7 Institutional research plan: CEZ:AV0Z50070508 Keywords : neuromuscular paralysis Subject RIV: ED - Physiology

  16. Yeast effects on Pinot noir wine phenolics, color, and tannin composition.

    Science.gov (United States)

    Carew, Anna L; Smith, Paul; Close, Dugald C; Curtin, Chris; Dambergs, Robert G

    2013-10-16

    Extraction and stabilization of wine phenolics can be challenging for wine makers. This study examined how yeast choice affected phenolic outcomes in Pinot noir wine. Five yeast treatments were applied in replicated microvinification, and wines were analyzed by UV-visible spectrophotometry. At bottling, yeast treatment Saccharomyces cerevisiae RC212 wine had significantly higher concentrations of total pigment, free anthocyanin, nonbleachable pigment, and total tannin and showed high color density. Some phenolic effects were retained at 6 months' bottle age, and RC212 and S. cerevisae EC1118 wines showed increased mean nonbleachable pigment concentrations. Wine tannin composition analysis showed three treatments were associated with a higher percentage of trihydroxylated subunits (skin tannin indicator). A high degree of tannin polymerization was observed in wines made with RC212 and Torulaspora delbruekii , whereas tannin size by gel permeation chromatography was higher only in the RC212 wines. The results emphasize the importance of yeast strain choice for optimizing Pinot noir wine phenolics. PMID:24011384

  17. Evidence for Amazonian highly viscous lavas in the southern highlands on Mars

    Czech Academy of Sciences Publication Activity Database

    Brož, Petr; Hauber, E.; Platz, T.; Balme, M.

    2015-01-01

    Roč. 415, 1 April (2015), s. 200-212. ISSN 0012-821X Institutional support: RVO:67985530 Keywords : Mars surface * volcanology * lava dome Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 4.734, year: 2014

  18. Je nutné studovat možná rizika nanomateriálů pro lidské zdraví?

    Czech Academy of Sciences Publication Activity Database

    Topinka, Jan

    2011-01-01

    Roč. 90, č. 4 (2011), s. 212-213. E-ISSN 1214-4029 Institutional research plan: CEZ:AV0Z50390703 Keywords : nanomaterials * nanosafety * nanotoxicology Subject RIV: DN - Health Impact of the Environment Quality

  19. Thoron (220Rn)-concentration in homes: first results of a pilot project

    International Nuclear Information System (INIS)

    First measurements of thoron gas concentrations in homes show that the indoor thoron concentration is less influenced by the thoron content in soil or by convective entry processes. The indoor concentration is dominated by thoron concentrations of building materials and by the surface layer of walls and floors. Measurements in typical indoor air without additional aerosol sources yield 212Pb size distributions with a media diameter of the accumulation mode of about 200 nm. An average fraction of 13% of the activity is associated with particles of the nuclei mode with diameters d between 10 - 100 nm and about 5% of the activity was determined to be unattached (d 212Pb)/C(220Rn) of 0.05 and C(212Bi)/C(212Pb) of 0.4. (orig.)

  20. 77 FR 19177 - Beaverhead-Deerlodge National Forest, Jefferson Ranger District, Montana, Boulder River Salvage...

    Science.gov (United States)

    2012-03-30

    ...-commercially thin Douglas-fir and burn slash on 8,212 acres within 102 units. Approximately 210 miles of...; ] DEPARTMENT OF AGRICULTURE Forest Service Beaverhead-Deerlodge National Forest, Jefferson Ranger...

  1. O symetrii tokamaku

    Czech Academy of Sciences Publication Activity Database

    Mlynář, Jan

    2009-01-01

    Roč. 59, č. 4 (2009), s. 207-212. ISSN 0009-0700 Institutional research plan: CEZ:AV0Z20430508 Keywords : Tokamak * symmetry * drifts * transport * H-mode Subject RIV: BL - Plasma and Gas Discharge Physics

  2. Rem Koolhaas. Utopie ve sférách globálního trhu

    Czech Academy of Sciences Publication Activity Database

    Hnídková, Vendula

    -, Č. 19-20 (2006), s. 212-214. ISSN 1210-6887 Institutional research plan: CEZ:AV0Z80330511 Keywords : Rem Koolhaas * contemporary architecture * utopia of architectural production Subject RIV: AL - Art , Architecture, Cultural Heritage

  3. High-Precision Instrumentation for CO2 Isotope Ratio Measurements Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Knowing atmospheric 13CO2/12CO2 ratios precisely is important to understanding biogenic and anthroprogenic sources and sinks for carbon. Currently available field...

  4. The abundance of a farmland specialist bird, the skylark, in three European regions with contrasting agricultural management

    Czech Academy of Sciences Publication Activity Database

    Koleček, Jaroslav; Reif, J.; Weidinger, K.

    2015-01-01

    Roč. 212, December (2015), s. 30-37. ISSN 0167-8809 Institutional support: RVO:68081766 Keywords : Crops * Extensive farming * Landscape mosaic * Seasonal change Subject RIV: EH - Ecology, Behaviour Impact factor: 3.402, year: 2014

  5. Hatchling sex ratio and female mating status in the great reed warbler, Acrocephalus arundinaceus (Aves, Passeriformes): further evidence for offspring sex ratio manipulation

    Czech Academy of Sciences Publication Activity Database

    Trnka, A.; Prokop, P.; Kašová, M.; Sobeková, Karolina; Kocian, Ľ.

    2012-01-01

    Roč. 79, č. 2 (2012), s. 212-217. ISSN 1125-0003 Institutional support: RVO:68081766 Keywords : Great reed warbler * sex ratio * social polygyny Subject RIV: EG - Zoology Impact factor: 0.890, year: 2012

  6. Determination of 232U daughter products released from HTGR fuel during refabrication. Part 2

    International Nuclear Information System (INIS)

    During the heat treatment step of High Temperature Gas-Cooled Reactor (HTGR) fuel beads, the 233U-loaded fuel beads are exposed to temperatures as high as 17000C. Since 233U fuel beads unavoidably contain a small percentage of 232U, decay products of 232U might be released during the heat treatment step. To avoid shielding requirements, experiments were conducted using 232Th-loaded fuel beads rather than 232U-loaded fuel beads. Decay products of 232U and 232Th are the same after 228Th. Experimental data were obtained by monitoring the 583 and 2614 keV gamma emissions of 208Tl. Computer simulations of the decay process and experimental data were used to infer what relative amount of the daughter products was removed. The carbonization step (300 to 5000C) has an effect on the loss of daughter products in the conversion step. Using uncarbonized fuel beads, approximately 50 percent of 220Rn was removed at 3000C and approximately 20 percent of 220Rn was removed at 2000C. At most, 5 percent of 220Rn was removed from uncarbonized beads at 250C. Marginal 220Rn loss was detected at 1000C using pre-carbonized beads. At 14000C, 92 percent 212Pb, 70 to 90 percent 212Bi, and 0 percent 224Ra losses were observed. At 16000C, 100 percent 212Pb, 80 to 100 percent 212Bi, and 3 to 7 percent 224Ra losses were observed. At 17500C, 100 percent 212Pb, 80 to 100 percent 212Bi, and 62 percent 224Ra losses were observed. At 18000C, 100 percent 212Pb, 80 to 100 percent 212Bi, and 86 percent 224Ra losses were observed

  7. Monitoramento da população de Phytophthora infestans na região da Zona da Mata de Minas Gerais de 1998 a 2000 Monitoring Phytophthora infestans population in the Zona da Mata region of Minas Gerais, Brazil, from 1998 to 2000

    OpenAIRE

    AILTON REIS; Nelson D. Suassuna; Alfenas, Acelino C; EDUARDO S. G. MIZUBUTI

    2002-01-01

    Foram caracterizados 212 isolados de Phytophthora infestans obtidos de 51 lavouras de tomate (Lycopersicon esculentum)e batata (Solanum tuberosum), em sete municípios da Zona da Mata, MG. Todos os isolados tiveram o grupo de compatibilidade determinado; 96 isolados foram caracterizados para a isoenzima glucose 6-fosfato-isomerase (Gpi); 71 isolados foram analisados quanto à resistência ao metalaxyl; e determinou-se o espectro de virulência de 46 isolados. Todos os 212 isolados testados foram ...

  8. Monitoramento da população de Phytophthora infestans na região da Zona da Mata de Minas Gerais de 1998 a 2000

    OpenAIRE

    REIS AILTON; SUASSUNA NELSON D.; ALFENAS ACELINO C.; MIZUBUTI EDUARDO S. G.

    2002-01-01

    Foram caracterizados 212 isolados de Phytophthora infestans obtidos de 51 lavouras de tomate (Lycopersicon esculentum)e batata (Solanum tuberosum), em sete municípios da Zona da Mata, MG. Todos os isolados tiveram o grupo de compatibilidade determinado; 96 isolados foram caracterizados para a isoenzima glucose 6-fosfato-isomerase (Gpi); 71 isolados foram analisados quanto à resistência ao metalaxyl; e determinou-se o espectro de virulência de 46 isolados. Todos os 212 isolados testados foram ...

  9. A quantitative radiochemical method for the determination of the major sources of natural radioactivity in ores and minerals

    Science.gov (United States)

    Rosholt, John Nicholas, Jr.

    1953-01-01

    The determination of Th232, Rn222, and Pb210 by isolation and subsequent activity analysis of some of their short-lived daughter products is described. The sulfides of bismuth and polonium are precipitated out of solutions of thorium or uranium ores, and the alpha particle activity of PO214. PO212 and PO210 is determined by scintillation counting techniques. PO214 activity is used to determine Rn222, PO212 activity for Th232, and PO210 for Pb210.

  10. AcEST: DK960524 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0007_K11 608 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0007_K11. 5' end seq ... Query: 212 ARNPELMREMMRNTDRAMSNIEASPEGFNMLRRMYETVEEPF ... 337 RNPELMREMMRNTDRAMSNIE+SPEGFNMLRRMYETV+EPF ... Sbjc ... t: 214 VRNPELMREMMRNTDRAMSNIESSPEGFNMLRRMYETVQEPF ... 255 Score = 43.9 bits (102), Expect = 0.007 Identi ... Query: 212 ARNPELMREMMRNTDRAMSNIEASPEGFNMLRRMYETVEEPF ... 337 ARNPELMREMMRNTDRAMSNIE+SPEGFNMLRRMYETV+EPF ... Sbj ... ct: 203 ARNPELMREMMRNTDRAMSNIESSPEGFNMLRRMYETVQEPF ... 244 Score = 50.8 bits (120), Expect = 6e-05 Identi ...

  11. Draft genome sequence of Coxiella burnetii Dog Utad, a strain isolated from a dog-related outbreak of Q fever

    Directory of Open Access Journals (Sweden)

    F. D’amato

    2014-07-01

    Full Text Available Coxiella burnetii Dog Utad, with a 2 008 938 bp genome is a strain isolated from a parturient dog responsible for a human familial outbreak of acute Q fever in Nova Scotia, Canada. Its genotype, determined by multispacer typing, is 21; the only one found in Canada that includes Q212, which causes endocarditis. Only 107 single nucleotide polymorphisms and 16 INDELs differed from Q212, suggesting a recent clonal radiation.

  12. Neutralization og negative charges in F-loop of nicotinic acetylcholine alfa3beta4 receptors impairs the action of agonists and slows receptor desensitization

    Czech Academy of Sciences Publication Activity Database

    Lindovský, Jiří; Kaniaková, Martina; Krůšek, Jan; Vyskočil, František

    Geneva : Swiss Society for Neuroscience, 2008. s. 212-212. ISBN 92-990014-3-X. [FENS. Forum of European Neuroscience /6./. 12.07.2008-16.07.2008, Geneva] R&D Projects: GA MŠk(CZ) LC554; GA AV ČR(CZ) IAA100110501; GA AV ČR(CZ) IAA5011411 Institutional research plan: CEZ:AV0Z50110509 Keywords : spo2 * acetylcholine * nicotine Subject RIV: ED - Physiology

  13. Simultaneous Estimation of Metformin HCl and Gliclazide by Q- Analysis Method

    Directory of Open Access Journals (Sweden)

    Jyotsna R. Chopade

    2013-08-01

    Full Text Available Q- Analysis method for simultaneous estimation of Metformin HCl and Gliclazide in tablet dosage form have been developed. The method was simple, precise, accurate, reproducible and economical. Linearity was observed in the concentration range of 2-12 μg/ml for GLZ and 2-12 μg/ml for MET. The result of analysis have been validated as per ICH Guidelines.

  14. Simultaneous Estimation of Metformin HCl and Gliclazide by Q- Analysis Method

    OpenAIRE

    Jyotsna R. Chopade; SANJEEV V. DESHPANDE; Sandesh Shah

    2013-01-01

    Q- Analysis method for simultaneous estimation of Metformin HCl and Gliclazide in tablet dosage form have been developed. The method was simple, precise, accurate, reproducible and economical. Linearity was observed in the concentration range of 2-12 μg/ml for GLZ and 2-12 μg/ml for MET. The result of analysis have been validated as per ICH Guidelines.

  15. 22 CFR 41.21 - Foreign Officials-General.

    Science.gov (United States)

    2010-04-01

    ...)(15)(A)(iii), 101(a)(15)(G)(v), and 212(d)(8), and in the definition of the NATO-7 visa symbol, means... the NATO-1 through NATO-5 visa symbols, means the spouse and unmarried sons and daughters, whether by...(a)(15)(A)(iii), 101(a)(15)(G)(v), and 212(d)(8), and in classification under the NATO-7 visa...

  16. EST Table: FS806218 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS806218 E_FL_fmgV_20B08_F_0 10/09/28 74 %/212 aa ref|XP_970542.1| PREDICTED: similar to brix...B12626-PA 10/09/10 74 %/212 aa gi|91090402|ref|XP_970542.1| PREDICTED: similar to brix domain-containing protein 2 [Tribolium castaneum] FS911686 fmgV ...

  17. It is more than personal: Development and validation of a multidimensional privacy orientation scale

    OpenAIRE

    Baruh, Lemi; Cemalcılar, Zeynep

    2014-01-01

    Running Head: MULTIDIMENSIONAL PRIVACY ORIENTATION SCALE 1 It's More than Personal: Development and Validation of a Multidimensional Privacy Orientation Scale Lemi Baruh Department of Media and Visual Arts College of Social Sciences and Humanities Koç University Turkey E-Mail: Phone: +90 212 338 1133 Fax: +90 212 338 3760 Zeynep Cemalcılar Department of Psychology College of Social Sciences and Humanities Koç University Turkey ...

  18. Spawning migration of brown trout, Salmo trutta in the Morávka reservoir

    Czech Academy of Sciences Publication Activity Database

    Piecuch, J.; Lojkásek, B.; Lusk, Stanislav; Marek, T.

    2007-01-01

    Roč. 56, č. 2 (2007), s. 201-212. ISSN 0139-7893 R&D Projects: GA AV ČR IAA6093105; GA AV ČR 1QS500450513 Institutional research plan: CEZ:AV0Z60930519 Keywords : reproductive migration * tributary * trap * diel activity * environmental factors Subject RIV: EH - Ecology, Behaviour Impact factor: 0.376, year: 2007 http://www.ivb.cz/folia/56/2/201-212_MS1292.pdf

  19. Mechanism of the Ca2+-induced enhancement of the intrinsic factor VIIa activity

    DEFF Research Database (Denmark)

    Bjelke, Jais R; Olsen, Ole H; Fodje, Michel; Svensson, L Anders; Bang, Susanne; Bolt, Gert; Kragelund, Birthe B; Persson, Egon

    2008-01-01

    between the Ca(2+)-binding loop and the N-terminal tail. Crystal structures of tissue factor-bound FVIIa(D212N) and FVIIa(V158D/E296V/M298Q) revealed altered hydrogen bond networks, resembling those in factor Xa and thrombin, after introduction of the D212N and E296V mutations plausibly responsible for...

  20. Preliminary radiological safety assessment for decommissioning of thoria dissolver of the ²³³U pilot plant, Trombay.

    Science.gov (United States)

    Priya, S; Srinivasan, P; Gopalakrishnan, R K

    2012-01-01

    The thoria dissolver, used for separation of (233)U from reactor-irradiated thorium metal and thorium oxide rods, is no longer operational. It was decided to carry out assessment of the radiological status of the dissolver cell for planning of the future decommissioning/dismantling operations. The dissolver interiors are expected to be contaminated with the dissolution remains of irradiated thorium oxide rods in addition to some of the partially dissolved thoria pellets. Hence, (220)Rn, a daughter product of (228)Th is of major radiological concern. Airborne activity of thoron daughters (212)Pb (Th-B) and (212)Bi (Th-C) was estimated by air sampling followed by high-resolution gamma spectrometry of filter papers. By measuring the full-energy peaks counts in the energy windows of (212)Pb, (212)Bi and (208)Tl, concentrations of thoron progeny in the sampled air were estimated by applying the respective intrinsic peak efficiency factors and suitable correction factors for the equilibration effects of (212)Pb and (212)Bi in the filter paper during the delay between sampling and counting. Then the thoron working level (TWL) was evaluated using the International Commission on Radiological Protection (ICRP) methodology. Finally, the potential effective dose to the workers, due to inhalation of thoron and its progeny during dismantling operations was assessed by using dose conversion factors recommended by ICRP. Analysis of filter papers showed a maximum airborne thoron progeny concentration of 30 TWLs inside the dissolver. PMID:21447504

  1. Synthesis of functionalized cobaltacarboranes based on the closo-[(1,2-C2B9H11)(2)-3,3 '-Co](-) ion bearing polydentate ligands for separation of M3+ cations from nuclear waste solutions. Electrochemical and liquid-liquid extraction study of selective transfer of M3+ metal cations to an organic phase. Molecular structure of the closo-[(8-(2-CH3O-C5H4-O)-(CH2CH2O)(2)-1,2-C2B9H10)-(1 ',2 '-C2B9H11)-3,3 '-Co]Na determined by X-ray diffraction analysis

    Czech Academy of Sciences Publication Activity Database

    Plešek, Jaromír; Grüner, Bohumír; Heřmánek, Stanislav; Báča, Jiří; Mareček, Vladimír; Jänchenová, Hana; Lhotský, Alexandr; Holub, Karel; Selucký, P.; Rais, J.; Císařová, I.; Čáslavský, Josef

    2002-01-01

    Roč. 21, 9-10 (2002), s. 975-986. ISSN 0277-5387 R&D Projects: GA MŠk LN00A028; GA MŠk LB98233; GA ČR GA104/01/0142; GA ČR GA203/99/M037; GA ČR GA104/99/1096 Institutional research plan: CEZ:AV0Z4032918 Keywords : carboranes * carba metallaboranes * dicarbollides Subject RIV: CA - Inorganic Chemistry Impact factor: 1.414, year: 2002

  2. Variation of the ground-level air concentration of the thoron decay products - Munic-Neuherberg 1989-2000

    International Nuclear Information System (INIS)

    Seasonal and long-term variation of the ground-level air concentration of the thoron decay product 212Pb (10.6 h), representative of the equilibrium equivalent thoron concentration (EECRn-220), was investigated from 1989 through 2000 at Munich-Neuherberg. For this, 212Pb and 212Bi filter activities were determined gamma-spectrometrically during aerosol collection, and daily mean 212Pb concentrations (or EECRn220) were calculated. The resulting time series were analysed. The measurements yielded a long-term average concentration of 0.0835 Bq m-3. Daily mean concentrations varied from ≤0.01 to 0.34 Bq m-3, monthly mean concentrations from 0,032 to 0,16 Bq m-3, and annual mean concentrations ranged from 0.075 to 0.090 Bq m-3. An average annual effective dose of 1.5 μSv due to outdoor thoron progeny concentration was estimated, which corresponds to about 2% of the dose due to the average short-lived radon progeny concentration (EECRn-222) of 8.4 Bq m-3 measured at Munich-Neuherberg in the same period. The seasonal pattern of 212Pb activity concentration in the atmosphere is characterised by two maxima each year: the first in May and the second in September. Low concentrations are observed from November through February. The most probably reason for this seasonal behaviour is the extremely reduced flux of thoron gas from the ground during the winter months and the enhanced flux in the summer months. Due to strong rain showers from June to July, airborne 212Pb is distinctly washed out from the atmosphere in these months. This overcompensates the enhanced production of thoron decay products due to the enhanced flux in the warm summer months and yields the concentration minimum between May and September. For June, a statistical significant relationship (R2=0.58, p212Pb air concentration and precipitation by regression analysis. (orig.)

  3. The radiolabeled monoclonal antibodies in immunoscintigraphy and radioimmunotherapy: current state and perspectives

    International Nuclear Information System (INIS)

    The antibodies can be satisfactorily labelled with technitium-99 m or indium-111 for tumor immunoscintigraphy. The immunoscintigraphy is not useful for the primary tumor diagnosis. It can be useful for the diagnosis of the some cancer extension and for recurrent tumor visualization. The immunoscintigraphy is widely competed with Positron Emission Tomography (PET) which gives accurate results. In the future the immunoscintigraphy, in pre-therapeutic stage, contribute to the estimation of the dose delivered to the tumor and to normal organs for adopting or not a radioimmunotherapy. The antibodies can also be labeled with Iodine-131 for an application in radioimmunotherapy (RIT). The RIT is efficient in the non-Hodgkin's lymphoma treatment because of their great radiosensitivity. Until now the results have been very modest in solid tumor treatment but methodological and biotechnological progresses have to improve the efficiency especially for the small tumors. In the future iodine-131 which requires the confinement (very expensive) of patients will be substituted by yttrium-90 beta emitter, more energetic than iodine-131 and can be injected in walking case. In the long term, the alpha emitter radionuclides (astatine-211 or bismuth-213) can be used for hematologic cancer treatment. In conclusion the future of radiolabeled monoclonal antibodies is essentially therapeutic. The radioimmunotherapy associated to the chemotherapy give promising perspectives for the radiosensitive cancer treatment and in general small solid tumor treatment (F.M.)

  4. Biological toxicity of intracellular radionuclide decay. Part of a coordinated programme on radiation biology of Auger emitters and their therapeutic applications

    International Nuclear Information System (INIS)

    Internal radiotherapy should be performed with short-lived radionuclides which emit high LET radiation and short ranged radiation, and accumulated within cancers. Based on these considerations, several radionuclides (tritium, copper-64, gallium-67, iodine-123, iodine 125, iodine-131 and astatine-211) were chosen and their toxicity was assessed using cell division in mammalian cultured cells as a criterion. It was apparent that the toxic effects obtained with 125I greatly exceeded those observed in cells treated with any other radionuclides. The possible hypotheses to explain the excessive radiosensitivity of 125I were discussed in relation to microdosimetry calculation. It was also found that the division delay induced by radionuclide decay is primarily due to damage to the cell nucleus but not to the plasma membrane. The key problem remains the development of agents which can serve as carriers for radionuclide accumulation within tumors. Although several promising approaches (Synkavit, tamoxifen, iododeoxyuridine, antibodies, liposomes) were investigated, only 125I-labelled Synkavit would be desirable for clinical application

  5. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  6. Effect of cetuximab in combination with alpha-radioimmunotherapy in cultured squamous cell carcinomas

    International Nuclear Information System (INIS)

    Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 (211At-cMAb U36). Effects on 211At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with 211At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced 211At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.

  7. Tumor immunotargeting using innovative radionuclides.

    Science.gov (United States)

    Kraeber-Bodéré, Françoise; Rousseau, Caroline; Bodet-Milin, Caroline; Mathieu, Cédric; Guérard, François; Frampas, Eric; Carlier, Thomas; Chouin, Nicolas; Haddad, Ferid; Chatal, Jean-François; Faivre-Chauvet, Alain; Chérel, Michel; Barbet, Jacques

    2015-01-01

    This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality. PMID:25679452

  8. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  9. Proceedings of transuranium elements

    International Nuclear Information System (INIS)

    The identification of the first synthetic elements was established by chemical evidence. Conclusive proof of the synthesis of the first artificial element, technetium, was published in 1937 by Perrier and Segre. An essential aspect of their achievement was the prediction of the chemical properties of element 43, which had been missing from the periodic table and which was expected to have properties similar to those of manganese and rhenium. The discovery of other artificial elements, astatine and francium, was facilitated in 1939-1940 by the prediction of their chemical properties. A little more than 50 years ago, in the spring of 1940, Edwin McMillan and Philip Abelson synthesized element 93, neptunium, and confirmed its uniqueness by chemical means. On August 30, 1940, Glenn Seaborg, Arthur Wahl, and the late Joseph Kennedy began their neutron irradiations of uranium nitrate hexahydrate. A few months later they synthesized element 94, later named plutonium, by observing the alpha particles emitted from uranium oxide targets that had been bombarded with deuterons. Shortly thereafter they proved that is was the second transuranium element by establishing its unique oxidation-reduction behavior. The symposium honored the scientists and engineers whose vision and dedication led to the discovery of the transuranium elements and to the understanding of the influence of 5f electrons on their electronic structure and bonding. This volume represents a record of papers presented at the symposium

  10. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  11. Development and radiotherapeutic application of 211At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    International Nuclear Information System (INIS)

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of 131I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, 211At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of 211At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated

  12. Nuclear and chemical data for life sciences

    International Nuclear Information System (INIS)

    Use of reactor produced radionuclides is popular in life sciences. However, cyclotron production of proton rich radionuclides are being more focused in recent times. These radionuclides have already gained attention in various fields, including life sciences, provided they are obtained in pure form. This article is a representative brief of our contributions in generating nuclear data for the production of proton rich radionuclides of terbium, astatine, technetium, ruthenium, cadmium, niobium, zirconium, rhenium, etc., which may have application in clinical, biological, agriculture studies or in basic research. The chemical data required to separate the product isotopes from the corresponding target matrix have been presented along with a few propositions of radiopharmaceuticals. It also emphasizes on the development of simple empirical technique, based on the nuclear reaction model analysis, to generate reliable nuclear data for the estimation of yield and angular distribution of emitted neutrons and light charged particles from light as well as heavy ion induced reactions on thick stopping targets. These data bear utmost important in radiation dosimetry. (author)

  13. Studies of Stable Octupole Deformations in the Radium Region

    CERN Multimedia

    2002-01-01

    The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

  14. Effect of cetuximab in combination with alpha-radioimmunotherapy in cultured squamous cell carcinomas

    Energy Technology Data Exchange (ETDEWEB)

    Nestor, Marika, E-mail: marika.nestor@bms.uu.s [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden); Sundstroem, Magnus [Unit of Molecular Pathology, Department of Genetics and Pathology, Uppsala University (Sweden); Anniko, Matti [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden)

    2011-01-15

    Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ({sup 211}At-cMAb U36). Effects on {sup 211}At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with {sup 211}At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced {sup 211}At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.

  15. Preparation of 211At-labeled humanized anti-Tac using 211At produced in disposable internal and external bismuth targets

    International Nuclear Information System (INIS)

    These studies describe the production and purification of 211At as well as the procedure for labeling humanized anti-Tac, the antibody to the α-chain of the IL-2 receptor (IL-2Rα), which has been shown to be a useful target for immunotherapy. The optimized protocol combines the advantages of the two-stage dry distillation procedure with the astatination of trialkylstannyl substances as labeling compounds for proteins. The 211At was produced by bombarding either an external or a recently developed disposable internal bismuth target with α-particles from a Cyclotron Corporation CS-30 cyclotron. The 211At was found to contain less than 0.01% 210At. The production rate for the external target was 0.15 mCi ± 0.056 μA-1 h-1 (n = 9) (5.55 MBq μA-1 h-1). The production rate for the internal target was 0.44 ± 0.14 mCi μA-1 h-1 (n = 16) (16.28 MBq μA-1 h-1)

  16. Synthesis, crystal structure and thermal behavior of two hydrated forms of lanthanide phthalates Ln2(O2+C6H4-CO2)3(H2O) (Ln=Ce, Nd) and Nd2(O2C-C6H4-CO2)3(H2O)3

    International Nuclear Information System (INIS)

    New hydrated lanthanide phthalates have been hydrothermally prepared with cerium and neodymium in different reaction media involving water or mixed water-ethanol solvent. The monohydrated Ln2(1,2-bdc)3(H2O) (Ln=Ce or Nd) and dihydrated Nd2(1,2-bdc)3(H2O)2 forms have been characterized by single-crystal analysis. Their structures consist of infinite inorganic chains of lanthanide-centered polyhedra linked to each other through the phthalate ligands in order to generate mixed organic-inorganic layered structure. The two hydrated structures differ by the number of terminal water species attached to the lanthanide cations, which induce symmetry change from a triclinic (Nd2(1,2-bdc)3(H2O)2) to an orthorhombic (Nd2(1,2-bdc)3(H2O)2) cell for neodymium whereas the cerium-based phase only exists in the monohydrated form, with two distinct symmetries (orthorhombic or triclinic). Structural comparisons with the other members of the lanthanide phthalate series with identical chemical formula are also discussed. Thermal X-ray diffraction experiment indicates that the transformation from dihydrate form into the monohydrated form does not occur during a heating process. - Graphical abstract: New members of the chain-like structures of neodymium phthalates with different hydration states Nd2(1,2-bdc)3(H2O)x (x=1 or 2, 1-2bdc=phthalate group) and comparison with cerium-based analogs.

  17. PB2 Segment Promotes High-pathogenicity Of H5N1 Avian Influenza Viruses In Mice

    Directory of Open Access Journals (Sweden)

    Hailiang eSun

    2015-02-01

    Full Text Available H5N1 influenza viruses with high lethality are a continuing threat to humans and poultry. Recently, H5N1 high-pathogenicity avian influenza virus (HPAIV has been shown to transmit through aerosols between ferrets in lab experiments by acquiring some mutation. This is another deeply aggravated threat of H5N1 HPAIV to humans. To further explore the molecular determinant of H5N1 HPAIV virulence in a mammalian model, we compared the virulence of A/Duck/Guangdong/212/2004 (DK212 and A/Quail/Guangdong/90/2004 (QL90. Though they were genetically similar, they had different pathogenicity in mice, as well as their 16 reassortants. The results indicated that a swap of the PB2 gene could dramatically decrease the virulence of rgDK212 in mice (1896-fold but increase the virulence of rgQL90 in mice (60-fold. Furthermore, the polymerase activity assays showed that swapping PB2 genes between these two viruses significantly changed the activity of polymerase complexes in 293T cells. The mutation Ser715Asn in PB2 sharply attenuated the virulence of rgDK212 in mice (2710-fold. PB2 segment promotes high-pathogenicity of H5N1 avian influenza viruses in mice and 715 Ser in PB2 plays an important role in determing high virulence of DK212 in mice.

  18. Solar energy in California industry - Applications, characteristics and potential

    Science.gov (United States)

    Barbieri, R. H.; Pivirotto, D. S.

    1978-01-01

    Results of a survey to determine the potential applicability of solar thermal energy to industrial processes in California are presented. It is found that if the heat for all industrial processes at temperatures below 212 F were supplied by solar energy, total state energy consumption could be reduced by 100 trillion Btus (2%), while the use of solar energy in processes between 212 and 350 F could displace 500 trillion Btus. The issues and problems with which solar energy must contend are illustrated by a description of fluid milk processing operations. Solar energy application is found to be technically feasible for processes with thermal energy requirements below 212 F, with design, and degree of technical, economic and management feasibility being site specific. It is recommended that the state provide support for federal and industrial research, development and demonstration programs in order to stimulate acceptance of solar process heat application by industry.

  19. Potential variability of trans-lysozyme gene rice under ecological conditions of Yunnan Province, China

    Institute of Scientific and Technical Information of China (English)

    Chunxin YAO; Minghui XU; Wenzhong TIAN; Zuoshun TANG

    2008-01-01

    Using trans-lysozyme gene rice line D2-1-2 and its restorer Zhonghua No.9 as test materials, we studied their agronomic characters and grain qualities under two ecological conditions of Yunnan Province. The results show that there were no significant differences in the agro-nomic characters between D2-1-2 and Zhonghua No.9, but the seed setting rate and plant height of D2-1-2 were significantly lower, while the protein, amino acid and min-eral element (Ca, Fe and Zn in particular) contents in its crude grain were higher than those of Zhonghua No.9. It is suggested that there could be some potential genetic variances in the transgenic plant and the possibly induced environmental risk should be evaluated in multi-plots for several years.

  20. Identification and Mapping of Two New Genes Conferring Resistance to Powdery Mildew from Aegilops tauschii (Coss.) Schmal

    Institute of Scientific and Technical Information of China (English)

    Xiao-Li Sun; Di Liu; Hai-Quan Zhang; Na-Xin Huo; Rong-Hua Zhou; Ji-Zeng Jia

    2006-01-01

    Two powdery mildew resistance genes were Identified from Aegilops tauschii accessions Y201 and Y212and mapped using two different F2 populations derived from the crosses between susceptible accession Y2272 and Y201, and susceptible accession Y2263 and Y212. Genetic analysis of resistance to powdery mildew indicated that the resistance of Y201 was controlled by a single dominant gene, whereas the resistance of Y212 was controlled by a single recessive gene. We have temporarily designated these genes as PmY201 and PmY212, respectively. By bulk segregation analysis, six microsatellite markers including Xgwm174, cfd26, cfd57, cfd102, Xgwm583 and Xgwm639 were found to be linked to PmY201 with genetic distances of 5.2, 7.7, 9.6, 12.5, 20.2 and 22.1 cM, respectively. Five SSR markers, including cfd57, Xgwm182,cfd7, cfd102, and cfd12, were found to be linked to PmY212 with distances of 5.6, 7.2, 11.5, 14.7, and 18.5 cM,respectively. According to the locations of the linked markers, the two resistance genes were located in the 5DL region. Based on the chromosomal locations and the resistance patterns of the two genes, we propose that PmY201 and PmY212 are two novel powdery mildew resistance genes, and are suitable for marker-assisted selection.