WorldWideScience

Sample records for astatine 211

  1. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  2. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  3. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  4. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven

  5. An automated flow system incorporating in-line acid dissolution of bismuth metal from a cyclotron irradiated target assembly for use in the isolation of astatine-211

    Energy Technology Data Exchange (ETDEWEB)

    O’Hara, Matthew J.; Krzysko, Anthony J.; Niver, Cynthia M.; Morrison, Samuel S.; Owsley, Stanley L.; Hamlin, Donald K.; Dorman, Eric F.; Scott Wilbur, D.

    2017-04-01

    Astatine-211 (211At) is a promising cyclotron-produced radionuclide being investigated for use in targeted alpha therapy of blood borne and metastatic cancers, as well as treatment of tumor remnants after surgical resections. The isolation of trace quantities of 211At, produced within several grams of a Bi metal cyclotron target, involves a complex, multi-step procedure: (1) Bi metal dissolution in strong HNO3, (2) distillation of the HNO3 to yield Bi salts containing 211At, (3) dissolution of the salts in strong HCl, (4) solvent extraction of 211At from bismuth salts with diisopropyl ether (DIPE), and (5) back-extraction of 211At from DIPE into NaOH, leading to a purified 211At product. Step (1) has been addressed first to begin the process of automating the onerous 211At isolation process. A computer-controlled Bi target dissolution system has been designed. The system performs in-line dissolution of Bi metal from the target assembly using an enclosed target dissolution block, routing the resulting solubilized 211At/Bi mixture to the subsequent process step. The primary parameters involved in Bi metal solubilization (HNO3 concentration and influent flow rate) were optimized prior to evaluation of the system performance on replicate cyclotron irradiated targets. The results indicate that the system performs reproducibly, having nearly quantitative release of 211At from irradiated targets, with cumulative 211At recoveries that follow a sigmoidal function. The predictable nature of the 211At release profile allows the user to tune the system to meet target processing requirements.

  6. Radiochemistry of astatine

    Energy Technology Data Exchange (ETDEWEB)

    Ruth, T J; Dombsky, M; D' Auria, J M; Ward, T E

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs. (DLC)

  7. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the

  8. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  9. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...

  10. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  11. Discovery of the astatine, radon, francium, and radium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-09-15

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  12. Discovery of the astatine, radon, francium, and radium isotopes

    CERN Document Server

    Fry, C

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  13. Discovery of the astatine, radon, francium, and radium isotopes

    Science.gov (United States)

    Fry, C.; Thoennessen, M.

    2013-09-01

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  14. Reagents for astatination of biomolecules. 2. Conjugation of anionic boron cage pendant groups to a protein provides a method for direct labeling that is stable to in vivo deastatination.

    Science.gov (United States)

    Wilbur, D Scott; Chyan, Ming-Kuan; Hamlin, Donald K; Vessella, Robert L; Wedge, Timothy J; Hawthorne, M Frederick

    2007-01-01

    Cancer-targeting biomolecules labeled with 211At must be stable to in vivo deastatination, as control of the 211At distribution is critical due to the highly toxic nature of alpha-particle emission. Unfortunately, no astatinated aryl conjugates have shown in vivo stability toward deastatination when (relatively) rapidly metabolized proteins, such as monoclonal antibody Fab' fragments, are labeled. As a means of increasing the in vivo stability of 211At-labeled proteins, we have been investigating antibody conjugates of boron cage moieties. In this investigation, protein-reactive derivatives containing a nido-carborane (2), a bis-nido-carborane derivative (Venus Flytrap Complex, 3), and four 2-nonahydro-closo-decaborate(2-) derivatives (4-7) were prepared and conjugated with an antibody Fab' fragment such that subsequent astatination and in vivo tissue distributions could be obtained. To aid in determination of stability toward in vivo deastatination, the Fab'-borane conjugates were also labeled with 125I, and that material was coinjected with the 211At-labeled Fab'. For comparison, direct labeling of the Fab' with 125I and 211At was conducted. Direct labeling with Na[125I]I and Chloramine-T gave an 89% radiochemical yield. However, direct labeling of the Fab' with Na[211At]At and Chloramine-T resulted in a yield of Studies to optimize the closo-decaborate(2-) conjugates for protein labeling are underway.

  15. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Energy Technology Data Exchange (ETDEWEB)

    Uusitalo, J.; Jakobsson, U. [Department of Physics, University of Jyvaeskylae (Finland); Collaboration: RITU-Gamma Gollaboration

    2011-11-30

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  16. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Science.gov (United States)

    Uusitalo, J.; Jakobsson, U.

    2011-11-01

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  17. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  18. Measurement of the first ionization potential of astatine by laser ionization spectroscopy.

    Science.gov (United States)

    Rothe, S; Andreyev, A N; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yuri; Köster, U; Lane, J F W; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt, K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine.

  19. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Jakobsson, U., E-mail: ulrjak@kth.se; Cederwall, B. [KTH, The Division of Nuclear Physics, AlbaNova University Center, SE-10691 Stockholm (Sweden); Uusitalo, J.; Auranen, K.; Badran, H.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; Herzáň, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J. [University of Jyvaskyla, Department of Physics, P.O. Box 35, FI-40014 University of Jyvaskyla (Finland); and others

    2015-10-15

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2{sup +} state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2{sup +} state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2{sup +} state and the spherical 9/2{sup −} ground state in {sup 203}Fr and {sup 205}Fr.

  20. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Science.gov (United States)

    Jakobsson, U.; Uusitalo, J.; Auranen, K.; Badran, H.; Cederwall, B.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; HerzáÅ, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J.; Scholey, C.; Sorri, J.; Stolze, S.

    2015-10-01

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2+ state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2+ state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2+ state and the spherical 9/2- ground state in 203Fr and 205Fr.

  1. Radiopharmaceutical chemistry of targeted radiotherapeutics, part 4: Strategies for211At labeling at high activities and radiation doses of211At α-particles.

    Science.gov (United States)

    Pozzi, Oscar R; Zalutsky, Michael R

    2017-03-01

    Alpha particles are radiation of high energy and short range, properties that can lead to radiolysis-mediated complications in labeling chemistry at the high radioactivity levels required for clinical application. In previous papers in this series, we have shown that radiation dose has a profound effect on the astatine species that are present in the labeling reaction and their suitability for the synthesis of N-succinimidyl 3-[ 211 At]astatobenzoate. The purpose of this study was to evaluate the effects of adding N-chlorosuccinimide (NCS) to the methanol solution used for initial isolation of 211 At after distillation, a process referred to as 211 At stabilization, on 211 At chemistry after exposure to high radiation doses. High performance liquid chromatography was used to evaluate the distribution of 211 At species present in methanol in the 500-65,000Gy radiation dose range and the synthesis of SAB from N-succinimidyl 3-(tri-n-butylstannyl)benzoate in the 500-120,000Gy radiation dose range using different 211 At timeactivity combinations under conditions with/without 211 At stabilization. In the absence of NCS stabilization, a reduced form of astatine, At(2), increased with increasing radiation dose, accounting for about half the total activity by about 15,000Gy, while with stabilization, At(2) accounted for 60,000Gy. SAB yields without stabilization rapidly declined with increasing dose, falling to ~20% at about 5000Gy while with stabilization, yields >80% were obtained with 211 At solutions stored for more than 23h and receiving radiation doses >100,000Gy. Adding NCS to the methanol solution used for initial isolation of 211 At is a promising strategy for countering the deleterious effects of radiolysis on 211 At chemistry. This strategy could facilitate the ability to perform 211 At labeling at sites remote from its production and at the high activity levels required for clinical applications. Copyright © 2016 Elsevier Inc. All rights reserved.

  2. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    NARCIS (Netherlands)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Koester, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjoedin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical

  3. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even sing...... of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies....

  4. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  5. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  6. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  7. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  8. Adsorption of the astatine species on a gold surface: A relativistic density functional theory study

    Science.gov (United States)

    Demidov, Yuriy; Zaitsevskii, Andréi

    2018-01-01

    We report first-principle based studies of the adsorption interaction of astatine species on a gold surface. These studies are aimed primarily at the support and interpretation of gas chromatographic experiments with superheavy elements, tennessine (Ts, Z = 117), a heavier homologue of At, and possibly its pseudo-homologue nihonium (Nh, Z = 113). We use gold clusters with up to 69 atoms to simulate the adsorption sites and estimate the desorption energies of At & AtOH from a stable gold (1 1 1) surface. To describe the electronic structure of At -Aun and AtOH -Aun complexes, we combine accurate shape-consistent relativistic pseudopotentials and non-collinear two-component relativistic density functional theory. The predicted desorption energies of At and AtOH on gold are 130 ± 10 kJ/mol and 90 ± 10 kJ/mol, respectively. These results confirm the validity of the estimates derived from chromatographic data (147 ± 15 kJ/mol for At, and 100-10+20 kJ/mol for AtOH).

  9. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  10. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  11. Development and radiotherapeutic application of /sup 211/At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    Energy Technology Data Exchange (ETDEWEB)

    Adelstein, S.J.; Zalutsky, M.; Bloomer, W.

    1981-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.

  12. Nuclear Data Sheets for A = 211

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Balraj; Abriola, Daniel; Baglin, Coral; Demetriou, Vivian; Johnson, Timothy; McCutchan, Elizabeth; Mukherjee, Gopal; Singh, Sukhjeet; Sonzogni, Alejandro; Tuli, Jagdish

    2013-06-15

    The evaluated spectroscopic data are presented for 11 known nuclides of mass 211 (Hg, Tl, Pb, Bi, Po, At, Rn, Fr, Ra, Ac, Th). The {sup 211}Pa nuclide is included here but its identification remains uncertain. For {sup 211}Hg, {sup 211}Tl, {sup 211}Ac and {sup 211}Th nuclei, only the ground–state information is available. Their decay characteristics are mostly unknown. {sup 211}Fr is suggested to decay partially through ε decay mode, but its decay scheme remains poorly known. While high–spin excitations, including several isomers, are well studied in {sup 211}Pb, {sup 211}Bi, {sup 211}Po, {sup 211}At, {sup 211}Rn and {sup 211}Fr, the particle–transfer data are available for only {sup 211}Po and {sup 211}Bi. This evaluation was carried out as part of joint IAEA–ICTP workshop for Nuclear Structure and Decay Data, organized and hosted by the IAEA, Vienna and ICTP, Trieste, August 6–17, 2012. This work supersedes previous A=211 evaluation (2004Br45) published by E. Browne which covered literature before January 2003.

  13. 33 CFR 211.81 - Reservoir areas.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Reservoir areas. 211.81 Section... Lands in Reservoir Areas Under Jurisdiction of Department of the Army for Cottage Site Development and Use § 211.81 Reservoir areas. Delegations, rules and regulations in §§ 211.71 to 211.80 are applicable...

  14. 40 CFR 211.104 - Label content.

    Science.gov (United States)

    2010-07-01

    ... Required by U.S. EPA regulation 40 CFR part 211, subpart ___.” EC01FE92.055 ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Label content. 211.104 Section 211.104... LABELING General Provisions § 211.104 Label content. The following data and information must be on the...

  15. 48 CFR 211.275-1 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... Documents 211.275-1 Definitions. Bulk commodities, case, palletized unit load, passive RFID tag, and radio frequency identification are defined in the clause at 252.211-7006, Radio Frequency Identification. ...

  16. 49 CFR 399.211 - Maintenance.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Maintenance. 399.211 Section 399.211 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL MOTOR CARRIER SAFETY... STANDARDS Step, Handhold, and Deck Requirements for Commercial Motor Vehicles § 399.211 Maintenance. All...

  17. 7 CFR 3565.211 - Interest credit.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Interest credit. 3565.211 Section 3565.211... AGRICULTURE GUARANTEED RURAL RENTAL HOUSING PROGRAM Loan Requirements § 3565.211 Interest credit. (a... assistance in the form of interest credit, to the extent necessary to reduce the agreed-upon rate of interest...

  18. 47 CFR 53.211 - Audit planning.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 3 2010-10-01 2010-10-01 false Audit planning. 53.211 Section 53.211 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES (CONTINUED) SPECIAL PROVISIONS CONCERNING BELL OPERATING COMPANIES Separate Affiliate; Safeguards § 53.211 Audit planning. (a...

  19. 21 CFR 211.72 - Filters.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Filters. 211.72 Section 211.72 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Equipment § 211.72 Filters. Filters for liquid...

  20. 21 CFR 211.194 - Laboratory records.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Laboratory records. 211.194 Section 211.194 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Records and Reports § 211.194...

  1. 21 CFR 211.48 - Plumbing.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Plumbing. 211.48 Section 211.48 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Buildings and Facilities § 211.48...

  2. 21 CFR 211.34 - Consultants.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Consultants. 211.34 Section 211.34 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Organization and Personnel § 211.34...

  3. 21 CFR 211.170 - Reserve samples.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Reserve samples. 211.170 Section 211.170 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Laboratory Controls § 211.170 Reserve...

  4. 21 CFR 211.198 - Complaint files.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Complaint files. 211.198 Section 211.198 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Records and Reports § 211.198 Complaint...

  5. 21 CFR 211.180 - General requirements.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false General requirements. 211.180 Section 211.180 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Records and Reports § 211.180...

  6. 21 CFR 211.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Definitions. 211.3 Section 211.3 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS General Provisions § 211.3 Definitions...

  7. 21 CFR 211.160 - General requirements.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false General requirements. 211.160 Section 211.160 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Laboratory Controls § 211.160...

  8. 21 CFR 211.115 - Reprocessing.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Reprocessing. 211.115 Section 211.115 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Production and Process Controls § 211.115...

  9. 21 CFR 211.196 - Distribution records.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Distribution records. 211.196 Section 211.196 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Records and Reports § 211.196...

  10. 49 CFR 372.211 - Pittsburgh, PA.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Pittsburgh, PA. 372.211 Section 372.211... ZONES, AND TERMINAL AREAS Commercial Zones § 372.211 Pittsburgh, PA. The zone adjacent to, and commercially a part of Pittsburgh within which transportation by motor vehicle in interstate or foreign...

  11. 21 CFR 211.58 - Maintenance.

    Science.gov (United States)

    2010-04-01

    ... CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Buildings and Facilities § 211.58 Maintenance. Any building used in the manufacture, processing, packing, or holding of a drug product shall be... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Maintenance. 211.58 Section 211.58 Food and Drugs...

  12. 20 CFR 211.4 - Vacation pay.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Vacation pay. 211.4 Section 211.4 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT CREDITABLE RAILROAD COMPENSATION § 211.4 Vacation pay. Payments made to an employee with respect to vacation or holidays shall be...

  13. 20 CFR 211.11 - Miscellaneous pay.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Miscellaneous pay. 211.11 Section 211.11 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT CREDITABLE RAILROAD COMPENSATION § 211.11 Miscellaneous pay. Any payment made to an employee by an employer which is...

  14. 22 CFR 211.2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 211.2 Section 211.2 Foreign..., ECONOMIC DEVELOPMENT AND OTHER ASSISTANCE § 211.2 Definitions. (a) A.I.D. means the Agency for... for charitable or welfare purposes where needy persons reside and receive meals including, but not...

  15. 33 CFR 211.14 - Definition.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Definition. 211.14 Section 211.14 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE REAL ESTATE ACTIVITIES OF THE CORPS OF ENGINEERS IN CONNECTION WITH CIVIL WORKS PROJECTS Real Estate Claims § 211.14...

  16. 49 CFR 211.5 - Regulatory docket.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Regulatory docket. 211.5 Section 211.5 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RULES OF PRACTICE General § 211.5 Regulatory docket. (a)(1) Records of the...

  17. 14 CFR 417.211 - Debris analysis.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Debris analysis. 417.211 Section 417.211... TRANSPORTATION LICENSING LAUNCH SAFETY Flight Safety Analysis § 417.211 Debris analysis. (a) General. A flight safety analysis must include a debris analysis. For an orbital or suborbital launch, a debris analysis...

  18. 40 CFR 21.1 - Scope.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Scope. 21.1 Section 21.1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL SMALL BUSINESS § 21.1 Scope. This part establishes procedures for the issuance by EPA of the statements, referred to in section 7(g) of the Small Business Act...

  19. 40 CFR 211.210 - Requirements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Requirements. 211.210 Section 211.210 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS PRODUCT NOISE LABELING Hearing Protective Devices § 211.210 Requirements. ...

  20. 25 CFR 211.7 - Environmental studies.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Environmental studies. 211.7 Section 211.7 Indians BUREAU... DEVELOPMENT General § 211.7 Environmental studies. (a) The Secretary shall ensure that all environmental studies are prepared as required by the National Environmental Policy Act of 1969 (NEPA) and the...

  1. 20 CFR 211.9 - Dismissal allowance.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Dismissal allowance. 211.9 Section 211.9 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT CREDITABLE RAILROAD COMPENSATION § 211.9 Dismissal allowance. Dismissal allowances paid to an employee under a...

  2. 20 CFR 211.8 - Displacement allowance.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Displacement allowance. 211.8 Section 211.8 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT CREDITABLE RAILROAD COMPENSATION § 211.8 Displacement allowance. An allowance paid to an employee because he has been...

  3. 8 CFR 211.5 - Alien commuters.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Alien commuters. 211.5 Section 211.5 Aliens...: IMMIGRANTS; WAIVERS § 211.5 Alien commuters. (a) General. An alien lawfully admitted for permanent residence.... An alien commuter engaged in seasonal work will be presumed to have taken up residence in the United...

  4. 12 CFR 741.211 - Advertising.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Advertising. 741.211 Section 741.211 Banks and Banking NATIONAL CREDIT UNION ADMINISTRATION REGULATIONS AFFECTING CREDIT UNIONS REQUIREMENTS FOR... Also Apply to Federally Insured State-Chartered Credit Unions § 741.211 Advertising. Any credit union...

  5. 48 CFR 212.211 - Technical data.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Technical data. 212.211 Section 212.211 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT... Acquisition of Commercial Items 212.211 Technical data. The DoD policy for acquiring technical data for...

  6. Dicty_cDB: VHB211 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB211 (Link to dictyBase) - - - Contig-U14188-1 - (Link to Original site) - - VHB...211Z 538 - - - - Show VHB211 Library VH (Link to library) Clone ID VHB211 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHB2-A/VHB211Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHB211 (VHB211Q) /CSM/VH/VHB2-A/VHB211Q.Seq.d/ XXXXXXXXXXATTAATG...Score E Sequences producing significant alignments: (bits) Value VHB211 (VHB211Q) /CSM/VH/VHB2-A/VHB

  7. 211th ACS national meeting

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-10-01

    This document contains abstracts of papers which were presented at the 211th National Meeting of the American Chemical Society. Topics include: agriculture and food chemistry, agrochemicals, analytical chemistry, biochemical technology, business, carbohydrates, cellulose, paper, and textile, chemical education,health and safety, chemical information, chemical technitians, law, colloids and surface chemistry, computers in chemistry, environmental chemistry, fluorine chemistry, fuels, geochemistry, history of chemistry, industrial and engineering, inorganic chemistry, medicinal chemistry, nuclear chemistry, organic chemistry, petroleum, physical chemistry, polymers, polymeric materials, professional relations, small chemical business, biotechnology secretariat, catalysis and surface science secretariat, committee on science, society committee on education, task force on laboratory waste management, and younger chemists committee. Individual papers have been processed separately for the United States Department of Energy databases.

  8. 21 CFR 211.142 - Warehousing procedures.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Warehousing procedures. 211.142 Section 211.142 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS....142 Warehousing procedures. Written procedures describing the warehousing of drug products shall be...

  9. 12 CFR 211.9 - Investment procedures.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Investment procedures. 211.9 Section 211.9... Investment procedures. (a) General provisions. 5 Direct and indirect investments shall be made in accordance... investments in excess of the limitations therein based on capital and surplus. (1) Minimum capital adequacy...

  10. 21 CFR 211.166 - Stability testing.

    Science.gov (United States)

    2010-04-01

    ... shelf life studies, there must be stability studies conducted, including drug product testing at... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Stability testing. 211.166 Section 211.166 Food... Stability testing. (a) There shall be a written testing program designed to assess the stability...

  11. 21 CFR 211.44 - Lighting.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Lighting. 211.44 Section 211.44 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL... Lighting. Adequate lighting shall be provided in all areas. ...

  12. 21 CFR 211.137 - Expiration dating.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Expiration dating. 211.137 Section 211.137 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Packaging and Labeling Control...

  13. 21 CFR 211.125 - Labeling issuance.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Labeling issuance. 211.125 Section 211.125 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Packaging and Labeling Control...

  14. 21 CFR 211.173 - Laboratory animals.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Laboratory animals. 211.173 Section 211.173 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS... Laboratory animals. Animals used in testing components, in-process materials, or drug products for compliance...

  15. 21 CFR 211.176 - Penicillin contamination.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Penicillin contamination. 211.176 Section 211.176... Penicillin contamination. If a reasonable possibility exists that a non-penicillin drug product has been exposed to cross-contamination with penicillin, the non-penicillin drug product shall be tested for the...

  16. 5 CFR 9701.211 - Occupational clusters.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Occupational clusters. 9701.211 Section... RESOURCES MANAGEMENT SYSTEM Classification Classification Structure § 9701.211 Occupational clusters. For... clusters based on factors such as mission or function; nature of work; qualifications or competencies...

  17. 47 CFR 1.211 - Service.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false Service. 1.211 Section 1.211 Telecommunication... Service. Except as otherwise expressly provided in this chapter, all pleadings filed in a hearing... counsel, then upon such party. All such papers shall be accompanied by proof of service. For provisions...

  18. 33 CFR 211.142 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Definitions. 211.142 Section 211.142 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE REAL ESTATE ACTIVITIES OF THE CORPS OF ENGINEERS IN CONNECTION WITH CIVIL WORKS PROJECTS Conveyances...

  19. 33 CFR 211.72 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Definitions. 211.72 Section 211.72 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE REAL ESTATE ACTIVITIES OF THE CORPS OF ENGINEERS IN CONNECTION WITH CIVIL WORKS PROJECTS Sale of Lands...

  20. 49 CFR 1542.211 - Identification systems.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 9 2010-10-01 2010-10-01 false Identification systems. 1542.211 Section 1542.211... systems. (a) Personnel identification system. The personnel identification system under §§ 1542.201(b)(3... identification media stock and supplies. (iv) Auditing the system at a minimum of once a year or sooner, as...

  1. 38 CFR 3.211 - Death.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Death. 3.211 Section 3..., Compensation, and Dependency and Indemnity Compensation Evidence Requirements § 3.211 Death. Death should be... community where death occurred. (2) A copy of a coroner's report of death or a verdict of a coroner's jury...

  2. 31 CFR 211.3 - Exceptions.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Exceptions. 211.3 Section 211.3 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE DELIVERY OF CHECKS AND WARRANTS TO ADDRESSES OUTSIDE THE...

  3. 31 CFR 211.4 - Implementing instructions.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Implementing instructions. 211.4 Section 211.4 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL.... Implementing instructions will be issued in Part IV, “Disbursing,” of the Treasury Fiscal Requirements Manual...

  4. 27 CFR 20.211 - General.

    Science.gov (United States)

    2010-04-01

    ... alcohol, shall not be required to obtain a permit under this part. (b) For a determination as to whether... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false General. 20.211 Section 20.211 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE...

  5. 21 CFR 211.65 - Equipment construction.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Equipment construction. 211.65 Section 211.65 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS... construction. (a) Equipment shall be constructed so that surfaces that contact components, in-process materials...

  6. 33 CFR 211.143 - Delegations.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Delegations. 211.143 Section 211.143 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE... will serve the objectives of the project; (4) If two or more agencies file applications for the same...

  7. 31 CFR 800.211 - Entity.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Entity. 800.211 Section 800.211 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF INVESTMENT SECURITY, DEPARTMENT OF THE TREASURY REGULATIONS PERTAINING TO MERGERS, ACQUISITIONS, AND TAKEOVERS BY...

  8. 48 CFR 12.211 - Technical data.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Technical data. 12.211... ACQUISITION OF COMMERCIAL ITEMS Special Requirements for the Acquisition of Commercial Items 12.211 Technical data. Except as provided by agency-specific statutes, the Government shall acquire only the technical...

  9. 48 CFR 211.275 - Radio frequency identification.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Radio frequency identification. 211.275 Section 211.275 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS... Requirements Documents 211.275 Radio frequency identification. ...

  10. (211)Rn/(211)At and (209)At production with intense mass separated Fr ion beams for preclinical (211)At-based α-therapy research.

    Science.gov (United States)

    Crawford, Jason R; Kunz, Peter; Yang, Hua; Schaffer, Paul; Ruth, Thomas J

    2017-04-01

    Mass-separated francium beams ((211)Fr or (213)Fr) were implanted into solid targets for producing (211)Rn (14.6h half-life) or (209)At (5.41h), in situ. (211)Rn was transferred to dodecane and isolated from contaminants, providing sources for (211)At (7.21h) production by (211)Rn decay (73%). (209)At was recovered with high radionuclidic purity in aqueous solutions, directly. These experiments demonstrated Fr beam implantations as a novel method for producing preclinical quantities of (211)Rn/(211)At (for therapy) and (209)At (for imaging). Copyright © 2017 Elsevier Ltd. All rights reserved.

  11. 32 CFR 552.211 - Purpose.

    Science.gov (United States)

    2010-07-01

    ... Installation of Aberdeen Proving Ground, Maryland § 552.211 Purpose. This subpart establishes policies, responsibilities, and procedures for protests, pickeing, and other similar demonstrations on the Aberdeen Proving Ground installation. ...

  12. 21 CFR 211.103 - Calculation of yield.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Calculation of yield. 211.103 Section 211.103 Food... § 211.103 Calculation of yield. Actual yields and percentages of theoretical yield shall be determined... by a second person, or, if the yield is calculated by automated equipment under § 211.68, be...

  13. 76 FR 24798 - Airworthiness Directives; Rolls-Royce plc (RR) RB211-Trent 875-17, RB211-Trent 877-17, RB211...

    Science.gov (United States)

    2011-05-03

    ...-30-AD; Amendment 39-16657; AD 2011-08-07] RIN 2120-AA64 Airworthiness Directives; Rolls-Royce plc (RR... 2. The FAA amends Sec. 39.13 by adding the following new AD: 2011-08-07 Rolls-Royce plc: Amendment... applies to Rolls-Royce plc (RR) RB211-Trent 875-17, RB211-Trent 877-17, RB211-Trent 884-17, RB211-Trent...

  14. 24 CFR 1710.211 - Utilities.

    Science.gov (United States)

    2010-04-01

    ... DEVELOPMENT (INTERSTATE LAND SALES REGISTRATION PROGRAM) LAND REGISTRATION Reporting Requirements § 1710.211 Utilities. (a) Water. (1) State the estimated cost to the developer of the central water system. (2) If water is to be supplied by a central system, furnish a letter from the supplier that it will supply the...

  15. 42 CFR 93.211 - Hearing.

    Science.gov (United States)

    2010-10-01

    ... HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH MISCONDUCT Definitions § 93.211 Hearing. Hearing means that part of the research misconduct proceeding from the time a respondent files a request for an administrative hearing to contest ORI findings of research misconduct and...

  16. 12 CFR 211.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM INTERNATIONAL BANKING OPERATIONS (REGULATION K) International Operations of U.S. Banking Organizations § 211.2 Definitions. Unless... an individual or an organization. (u) Portfolio investment means an investment in an organization...

  17. 27 CFR 28.211 - General.

    Science.gov (United States)

    2010-04-01

    ... TREASURY LIQUORS EXPORTATION OF ALCOHOL Exportation of Wine With Benefit of Drawback § 28.211 General. Wines manufactured, produced, bottled in bottles packed in containers, or packaged in casks or other bulk containers in the United States on which an internal revenue tax has been paid or determined, and...

  18. 49 CFR 377.211 - Computation of time.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Computation of time. 377.211 Section 377.211 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL MOTOR CARRIER SAFETY... Goods Freight Forwarders § 377.211 Computation of time. Time periods involving calendar days shall be...

  19. 49 CFR 211.15 - Notice and participation.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Notice and participation. 211.15 Section 211.15 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RULES OF PRACTICE Rulemaking Procedures § 211.15 Notice and participation. (a...

  20. 48 CFR 1852.211-70 - Packaging, handling, and transportation.

    Science.gov (United States)

    2010-10-01

    ... transportation. 1852.211-70 Section 1852.211-70 Federal Acquisition Regulations System NATIONAL AERONAUTICS AND... and Clauses 1852.211-70 Packaging, handling, and transportation. As prescribed in 1811.404-70, insert the following clause: Packaging, Handling, and Transportation (SEPT 2005) (a) The Contractor shall...

  1. 21 CFR 211.192 - Production record review.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Production record review. 211.192 Section 211.192 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Records and Reports § 211.192...

  2. 21 CFR 211.50 - Sewage and refuse.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Sewage and refuse. 211.50 Section 211.50 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Buildings and Facilities § 211.50 Sewage...

  3. 21 CFR 211.63 - Equipment design, size, and location.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Equipment design, size, and location. 211.63 Section 211.63 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Equipment § 211...

  4. 42 CFR 59.211 - Publications and copyright.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Publications and copyright. 59.211 Section 59.211... PLANNING SERVICES Grants for Family Planning Service Training § 59.211 Publications and copyright. Except as may otherwise be provided under the terms and conditions of the award, the grantee may copyright...

  5. 40 CFR 211.103 - Number and gender.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Number and gender. 211.103 Section 211... PRODUCT NOISE LABELING General Provisions § 211.103 Number and gender. In this part, words in the singular will be understood to include the plural, and words in the masculine gender will be understood to...

  6. 21 CFR 211.130 - Packaging and labeling operations.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Packaging and labeling operations. 211.130 Section 211.130 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Labeling Control § 211.130 Packaging and labeling operations. There shall be written procedures designed to...

  7. 20 CFR 211.13 - Payments made after death.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Payments made after death. 211.13 Section 211... CREDITABLE RAILROAD COMPENSATION § 211.13 Payments made after death. Payments made by an employer with respect to a deceased employee but paid after the calendar year of the employee's death to the employee's...

  8. 21 CFR 211.52 - Washing and toilet facilities.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Washing and toilet facilities. 211.52 Section 211... § 211.52 Washing and toilet facilities. Adequate washing facilities shall be provided, including hot and cold water, soap or detergent, air driers or single-service towels, and clean toilet facilities easily...

  9. 40 CFR 86.211-94 - Exhaust gas analytical system.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Exhaust gas analytical system. 86.211-94 Section 86.211-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... New Medium-Duty Passenger Vehicles; Cold Temperature Test Procedures § 86.211-94 Exhaust gas...

  10. Building 211 cyclotron characterization survey report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-03-30

    The Building 211 Cyclotron Characterization Survey includes an assessment of the radioactive and chemical inventory of materials stored within the facility; an evaluation of the relative distribution of accelerator-produced activation products within various cyclotron components and adjacent structures; measurement of the radiation fields throughout the facility; measurement and assessment of internal and external radioactive surface contamination on various equipment, facility structures, and air-handling systems; and an assessment of lead (Pb) paint and asbestos hazards within the facility.

  11. 21 CFR 137.211 - White corn flour.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false White corn flour. 137.211 Section 137.211 Food and... Related Products § 137.211 White corn flour. (a) White corn flour is the food prepared by so grinding and bolting cleaned white corn that when tested by the method prescribed in paragraph (b)(2) of this section...

  12. 9 CFR 2.11 - Denial of initial license application.

    Science.gov (United States)

    2010-01-01

    ... have violated any Federal, State, or local laws or regulations pertaining to animal cruelty within 1... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Denial of initial license application. 2.11 Section 2.11 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT...

  13. 7 CFR 1220.211 - Powers of the Board.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Powers of the Board. 1220.211 Section 1220.211 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... the United States or any agency thereof, in general obligations of any State or any political...

  14. 33 CFR 211.1 - Real estate defined.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Real estate defined. 211.1... DEFENSE REAL ESTATE ACTIVITIES OF THE CORPS OF ENGINEERS IN CONNECTION WITH CIVIL WORKS PROJECTS Real Estate; General § 211.1 Real estate defined. The term real estate as used in this part includes land...

  15. 33 CFR 211.22 - Real estate Claims Officers.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Real estate Claims Officers. 211..., DEPARTMENT OF DEFENSE REAL ESTATE ACTIVITIES OF THE CORPS OF ENGINEERS IN CONNECTION WITH CIVIL WORKS PROJECTS Real Estate Claims § 211.22 Real estate Claims Officers. In each Division Office the Division...

  16. 21 CFR 211.182 - Equipment cleaning and use log.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Equipment cleaning and use log. 211.182 Section 211.182 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Records and...

  17. 21 CFR 211.22 - Responsibilities of quality control unit.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Responsibilities of quality control unit. 211.22... Personnel § 211.22 Responsibilities of quality control unit. (a) There shall be a quality control unit that... have been fully investigated. The quality control unit shall be responsible for approving or rejecting...

  18. 14 CFR 145.211 - Quality control system.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Quality control system. 145.211 Section 145...) SCHOOLS AND OTHER CERTIFICATED AGENCIES REPAIR STATIONS Operating Rules § 145.211 Quality control system. (a) A certificated repair station must establish and maintain a quality control system acceptable to...

  19. 40 CFR 211.110-2 - National security exemptions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false National security exemptions. 211.110... ABATEMENT PROGRAMS PRODUCT NOISE LABELING General Provisions § 211.110-2 National security exemptions. (a) A new product which is produced to conform with specifications developed by national security agency...

  20. 14 CFR 125.211 - Seat and safety belts.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Seat and safety belts. 125.211 Section 125.211 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED... Standard No. 213 (49 CFR 571.213)), vest- and harness-type child restraint systems, and lap held child...

  1. 21 CFR 211.94 - Drug product containers and closures.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Drug product containers and closures. 211.94 Section 211.94 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... and closures shall be clean and, where indicated by the nature of the drug, sterilized and processed...

  2. 12 CFR 211.8 - Investments and activities abroad.

    Science.gov (United States)

    2010-01-01

    ... INTERNATIONAL BANKING OPERATIONS (REGULATION K) International Operations of U.S. Banking Organizations § 211.8... attributable to activities not listed in § 211.10 of this part; and (3) Portfolio investments. Make portfolio... portfolio investments by the investor and its affiliates in an organization engaged in activities that are...

  3. 31 CFR 211.1 - Withholding delivery of checks.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Withholding delivery of checks. 211.1 Section 211.1 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE DELIVERY OF CHECKS AND WARRANTS TO...

  4. 33 CFR 211.4 - Acquisition of land.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Acquisition of land. 211.4... Estate; General § 211.4 Acquisition of land. (a) Real property and interests therein may be acquired by...) Purchase. It is the policy of the Department of the Army to secure title to lands, or the desired interest...

  5. 12 CFR 211.11 - Advisory opinions under Regulation K.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Advisory opinions under Regulation K. 211.11... INTERNATIONAL BANKING OPERATIONS (REGULATION K) International Operations of U.S. Banking Organizations § 211.11 Advisory opinions under Regulation K. (a) Request for advisory opinion. Any person may submit a request to...

  6. 21 CFR 211.134 - Drug product inspection.

    Science.gov (United States)

    2010-04-01

    ... representative sample of units shall be collected at the completion of finishing operations and shall be visually... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Drug product inspection. 211.134 Section 211.134 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS...

  7. 46 CFR 67.211 - Requirement for citizenship declaration.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Requirement for citizenship declaration. 67.211 Section....211 Requirement for citizenship declaration. (a) Instruments in the nature of a bill of sale or deed... ineligible for filing and recording unless accompanied by a declaration of citizenship, except as provided in...

  8. 75 FR 51654 - Airworthiness Directives; Rolls-Royce plc (RR) RB211-22B and RB211-524 Series Turbofan Engines

    Science.gov (United States)

    2010-08-23

    ...-10] RIN 2120-AA64 Airworthiness Directives; Rolls-Royce plc (RR) RB211-22B and RB211-524 Series.... The FAA amends Sec. 39.13 by adding the following new AD: 2010-17-10 Rolls-Royce plc: Amendment 39... AD applies to Rolls-Royce plc RB211-22B series and RB211-524B4-D-02, RB211-524D4-19, RB211-524D4-39...

  9. Leed and STM Study of cs on Cu(211)

    Science.gov (United States)

    Caragiu, M.; Seyller, Tl.; Diehl, R. D.; Norris, A. G.; McGrath, R.; Muryn, C. A.

    A low-temperature (25 K) STM study of Cs adsorption on Cu(211) indicates that Cs forms variable-density structures which align along the step edges of the Cu(211) surface. The density of the overlayer increases with Cs coverage, forming a quasihexagonal c(2×2) structure at a coverage of 0.17. A dynamical LEED study of that structure at 130 K indicates that the Cs atoms are adsorbed on top of the Cu atoms in the center of the terraces, with a Cs-Cu nearest-neighbor distance of 3.56± 0.04 Å. This structure is accompanied by a significant rumpling of the Cu(211) surface.

  10. 33 CFR 211.2 - Authority to acquire real estate.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Authority to acquire real estate..., DEPARTMENT OF DEFENSE REAL ESTATE ACTIVITIES OF THE CORPS OF ENGINEERS IN CONNECTION WITH CIVIL WORKS PROJECTS Real Estate; General § 211.2 Authority to acquire real estate. (a) Congressional authority...

  11. 48 CFR 752.211-70 - Language and measurement.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Language and measurement....211-70 Language and measurement. The following clause shall be used in all USAID-direct contracts. Language and Measurement (JUN 1992) (a) The English language shall be used in all written communications...

  12. 22 CFR 211.1 - General purpose and scope; legislation.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false General purpose and scope; legislation. 211.1...; legislation. (a) Legislation. The Agricultural Trade Development and Assistance Act of 1954, as amended (Pub...-624, 104 Stat. 3632-65 (1990). The legislation implemented by the regulation in this part (as of the...

  13. 46 CFR 107.211 - Original Certificate of Inspection.

    Science.gov (United States)

    2010-10-01

    ....211 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS... submitting before construction is started: (1) A completed Application for Inspection of U.S. Vessel, Form CG... the Navigation and Vessel Inspection Circular, “Inspection and Certification of Existing Mobile...

  14. 31 CFR 31.211 - Organizational conflicts of interest.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Organizational conflicts of interest... ASSET RELIEF PROGRAM Conflicts of Interest § 31.211 Organizational conflicts of interest. (a) Retained... organizational conflict of interest unless the conflict has been disclosed to Treasury under this Section and...

  15. 12 CFR 211.13 - Supervision and reporting.

    Science.gov (United States)

    2010-01-01

    ... financial performance, risk exposure, management policies, operations, and controls. (ii) Complete... INTERNATIONAL BANKING OPERATIONS (REGULATION K) International Operations of U.S. Banking Organizations § 211.13... conducting international operations under this subpart shall supervise and administer their foreign branches...

  16. 37 CFR 211.5 - Deposit of identifying material.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Deposit of identifying... COPYRIGHT OFFICE AND PROCEDURES MASK WORK PROTECTION § 211.5 Deposit of identifying material. (a) General. This section prescribes rules pertaining to the deposit of identifying material for registration of a...

  17. 27 CFR 25.211 - Beer returned to brewery.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Beer returned to brewery..., DEPARTMENT OF THE TREASURY LIQUORS BEER Beer Returned to Brewery § 25.211 Beer returned to brewery. (a) General. Beer, produced in the United States, on which the brewer has paid or determined the tax may be...

  18. 12 CFR 211.33 - Investments and extensions of credit.

    Science.gov (United States)

    2010-01-01

    ... INTERNATIONAL BANKING OPERATIONS (REGULATION K) Export Trading Companies § 211.33 Investments and extensions of... trading companies, except that an Edge or agreement corporation not engaged in banking may invest as much... investor in an export trading company or companies may extend credit directly or indirectly to the export...

  19. 12 CFR 211.31 - Authority, purpose, and scope.

    Science.gov (United States)

    2010-01-01

    ... INTERNATIONAL BANKING OPERATIONS (REGULATION K) Export Trading Companies § 211.31 Authority, purpose, and scope... investments and participation in export trading companies by bank holding companies and the specified...) under the authority of the Bank Holding Company Act of 1956 (BHC Act) (12 U.S.C. 1841 et seq.), the Bank...

  20. 1q21.1 Microduplication expression in adults

    Science.gov (United States)

    Dolcetti, Alessia; Silversides, Candice K.; Marshall, Christian R.; Lionel, Anath C.; Stavropoulos, Dimitri J.; Scherer, Stephen W.; Bassett, Anne S.

    2013-01-01

    Purpose Rare, recurrent chromosome 1q21.1 duplications have been associated with developmental delay, congenital anomalies, and macrocephaly in children. Data on adult clinical expression would help to inform genetic counseling. Methods A systematic review of 22 studies reporting 107 individuals (59 children and 48 adults) with 1q21.1 duplications was conducted. We compiled the available phenotypic data to attempt to identify the most highly associated clinical features and to determine expression in adults. We also report on seven adult cases newly identified in the studies of schizophrenia and tetralogy of Fallot at our center. Results Five cases were ascertained as controls, 32 as relatives of probands, and 70 as having clinical features: autism spectrum disorder (n = 15), congenital heart disease (n = 12), schizophrenia (n = 10), or other, mostly developmental, features (n = 33). The 1q21.1 duplication was significantly enriched in the cohorts with schizophrenia (P = 0.0155) and tetralogy of Fallot (P = 0.0040) at our center as compared with controls. There was a paucity of clinical data for adults; the most common features, other than those used for ascertainment, included macrocephaly and abnormalities of possible connective tissue origin (e.g., carpal tunnel syndrome). Conclusion Further data are needed to characterize lifetime expression of 1q21.1 duplications. These initial results, however, suggest that anticipatory care should include attention to later-onset conditions such as schizophrenia. PMID:23018752

  1. 31 CFR 575.211 - Evasions; attempts; conspiracies.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Evasions; attempts; conspiracies. 575... § 575.211 Evasions; attempts; conspiracies. Any transaction for the purpose of, or which has the effect... set forth in this subpart, is hereby prohibited. Any attempt to violate the prohibitions set forth in...

  2. 31 CFR 538.211 - Evasions; attempts; conspiracies.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Evasions; attempts; conspiracies. 538... § 538.211 Evasions; attempts; conspiracies. Any transaction by any United States person or within the United States that evades or avoids, or has the purpose of evading or avoiding, or attempts to violate...

  3. Adsorbate Reorganization at Steps: NO on Pd(211)

    DEFF Research Database (Denmark)

    Hammer, Bjørk; Nørskov, Jens Kehlet

    1997-01-01

    The interaction of nitric oxide, NO, with the stepped Pd(211) surface is studied using density functional theory slab calculations. Calculated chemisorption energies and geometries reveal that surface sites are not populated in a sequential manner as the NO coverage is increased. This comes about...

  4. 21 CFR 211.165 - Testing and release for distribution.

    Science.gov (United States)

    2010-04-01

    ... Section 211.165 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES..., including the identity and strength of each active ingredient, prior to release. Where sterility and/or... released prior to completion of sterility and/or pyrogen testing, provided such testing is completed as...

  5. 48 CFR 1552.211-76 - Legal analysis.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Legal analysis. 1552.211-76... analysis. As prescribed in 1511.011-76, insert this contract clause when it is determined that the contract involves legal analysis. Legal Analysis (APR 1984) The Contractor shall furnish to the Project Officer one...

  6. 12 CFR 211.23 - Nonbanking activities of foreign banking organizations.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Nonbanking activities of foreign banking organizations. 211.23 Section 211.23 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM INTERNATIONAL BANKING OPERATIONS (REGULATION K) Foreign Banking Organizations § 211.23...

  7. 48 CFR 1552.211-80 - Data standards for the transmission of laboratory measurement results.

    Science.gov (United States)

    2010-10-01

    ... Texts of Provisions and Clauses 1552.211-80 Data standards for the transmission of laboratory... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Data standards for the transmission of laboratory measurement results. 1552.211-80 Section 1552.211-80 Federal Acquisition Regulations...

  8. 33 CFR 211.111 - Certification terminating rights of former owners.

    Science.gov (United States)

    2010-07-01

    ... of former owners. 211.111 Section 211.111 Navigation and Navigable Waters CORPS OF ENGINEERS... Portion of the Mcclellan-Kerr Navigation Project in Oklahoma, to Former Owners § 211.111 Certification terminating rights of former owners. If no application for reconveyance is made by a former owner within...

  9. 21 CFR 211.184 - Component, drug product container, closure, and labeling records.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Component, drug product container, closure, and labeling records. 211.184 Section 211.184 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH... PHARMACEUTICALS Records and Reports § 211.184 Component, drug product container, closure, and labeling records...

  10. 40 CFR 80.211 - What are the requirements for treating imported gasoline as blendstock?

    Science.gov (United States)

    2010-07-01

    ... imported gasoline as blendstock? 80.211 Section 80.211 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Gasoline Sulfur Gasoline Sulfur Standards § 80.211 What are the requirements for treating imported gasoline as blendstock...

  11. 36 CFR 211.4 - Cooperation for fire prevention and control.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Cooperation for fire prevention and control. 211.4 Section 211.4 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE ADMINISTRATION Cooperation § 211.4 Cooperation for fire prevention and control. The Forest Service...

  12. 48 CFR 552.211-92 - Radio Frequency Identification (RFID) using passive tags.

    Science.gov (United States)

    2010-10-01

    ... Identification (RFID) using passive tags. 552.211-92 Section 552.211-92 Federal Acquisition Regulations System... Provisions and Clauses 552.211-92 Radio Frequency Identification (RFID) using passive tags. As prescribed in 511.204(b)(11), insert the following clause: Radio Frequency Identification (RFID) Using Passive Tags...

  13. 40 CFR 2.211 - Safeguarding of business information; penalty for wrongful disclosure.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Safeguarding of business information; penalty for wrongful disclosure. 2.211 Section 2.211 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL PUBLIC INFORMATION Confidentiality of Business Information § 2.211 Safeguarding of...

  14. 75 FR 33738 - Airworthiness Directives; Rolls-Royce plc (RR) RB211-524 Series and RB211 Trent 500, 700, and 800...

    Science.gov (United States)

    2010-06-15

    ... plc (RR) RB211-524 Series and RB211 Trent 500, 700, and 800 Series Turbofan Engines AGENCY: Federal... holidays. Fax: (202) 493-2251. Contact Rolls-Royce plc, P.O. Box 31, Derby, DE24 8BJ, United Kingdom; phone... Information Rolls-Royce plc has issued Alert Service Bulletin RB.211-72-AF964, Revision 1, dated June 6, 2008...

  15. Measuring the diffraction properties of an imaging quartz(211) crystal

    Energy Technology Data Exchange (ETDEWEB)

    Haugh, M. J.; Jacoby, K. D.; Koch, J. A. [National Security Technologies, LLC, Livermore, California 94550 (United States); Chen, H.; Schneider, M. B. [Lawrence Livermore National Laboratory, 7000 East Avenue, Livermore, California 94550 (United States); Hill, K. W. [Princeton Plasma Physics Laboratory, Princeton, New Jersey 08543 (United States)

    2016-06-15

    A dual goniometer X-ray system was used to measure the reflectivity curve for a spherically bent quartz(211) crystal. An analysis of the dual goniometer instrument response function for the rocking curve width measurement was developed and tested against the actual measurements. The rocking curve was measured at 4510.8 eV using the Ti Kα1 characteristic spectral line. The crystal is the dispersion element for a high resolution spectrometer used for plasma studies. It was expected to have a very narrow rocking curve width. The analysis showed that we could measure the upper bound for the rocking curve width of the Qz(211) crystal. The upper bound was 58 μrad giving a lower bound for the instrument resolving power E/ΔE = 34 000. Greatly improved insight into the dual goniometer operation and its limitations was achieved.

  16. Micromachined cutting blade formed from {211}-oriented silicon

    Science.gov (United States)

    Fleming, James G.; Sniegowski, Jeffry J.; Montague, Stephen

    2003-09-09

    A cutting blade is disclosed fabricated of micromachined silicon. The cutting blade utilizes a monocrystalline silicon substrate having a {211} crystalline orientation to form one or more cutting edges that are defined by the intersection of {211} crystalline planes of silicon with {111} crystalline planes of silicon. This results in a cutting blade which has a shallow cutting-edge angle .theta. of 19.5.degree.. The micromachined cutting blade can be formed using an anisotropic wet etching process which substantially terminates etching upon reaching the {111} crystalline planes of silicon. This allows multiple blades to be batch fabricated on a common substrate and separated for packaging and use. The micromachined cutting blade, which can be mounted to a handle in tension and optionally coated for increased wear resistance and biocompatibility, has multiple applications including eye surgery (LASIK procedure).

  17. A 2-1-1 research collaboration: participant accrual and service quality indicators.

    Science.gov (United States)

    Eddens, Katherine S; Alcaraz, Kassandra I; Kreuter, Matthew W; Rath, Suchitra; Greer, Regina

    2012-12-01

    In times of crises, 2-1-1 serves as a lifeline in many ways. These crises often cause a spike in call volume that can challenge 2-1-1's ability to meet its service quality standards. For researchers gathering data through 2-1-1s, a sudden increase in call volume might reduce accrual as 2-1-1 has less time to administer study protocols. Research activities imbedded in 2-1-1 systems may affect directly 2-1-1 service quality indicators. Using data from a 2-1-1 research collaboration, this paper examines the impact of crises on call volume to 2-1-1, how call volume affects research participant accrual through 2-1-1, and how research recruitment efforts affect 2-1-1 service quality indicators. t-tests were used to examine the effect of call volume on research participant accrual. Linear and logistic regressions were used to examine the effect of research participant accrual on 2-1-1 service quality indicators. Data were collected June 2010-December 2011; data were analyzed in 2012. Findings from this collaboration suggest that crises causing spikes in call volume adversely affect 2-1-1 service quality indicators as well as accrual of research participants. Administering a brief (2-3 minute) health risk assessment did not affect service quality negatively, but administering a longer (15-18 minute) survey had a modest adverse effect on these indicators. In 2-1-1 research collaborations, both partners need to understand the dynamic relationship among call volume, research accrual, and service quality and adjust expectations accordingly. If research goals include administering a longer survey, increased staffing of 2-1-1 call centers may be needed to avoid compromising service quality. Copyright © 2012 American Journal of Preventive Medicine. Published by Elsevier Inc. All rights reserved.

  18. Comparison of (211)At-PRIT and (211)At-RIT of Ovarian Microtumors in a Nude Mouse Model

    DEFF Research Database (Denmark)

    Frost, Sofia H L; Bäck, Tom; Chouin, Nicolas

    2013-01-01

    radioimmunotherapy (RIT) using (211)At-labeled MX35 in a nude mouse model. Methods: Mice were inoculated i.p. with 1×10(7) NIH:OVCAR-3 cells. After 3 weeks, they received PRIT (1.0 or 1.5 MBq), RIT (0.9 MBq), or no treatment. Concurrently, 10 additional animals were sacrificed and examined to determine disease....... Despite advanced disease in many animals at the time of treatment, PRIT demonstrated good potential to treat disseminated ovarian cancer....

  19. MicroRNA 211 Functions as a Metabolic Switch in Human Melanoma Cells.

    Science.gov (United States)

    Mazar, Joseph; Qi, Feng; Lee, Bongyong; Marchica, John; Govindarajan, Subramaniam; Shelley, John; Li, Jian-Liang; Ray, Animesh; Perera, Ranjan J

    2016-01-19

    MicroRNA 211 (miR-211) negatively regulates genes that drive invasion of metastatic melanoma. Compared to normal human melanocytes, miR-211 expression is significantly reduced or absent in nonpigmented melanoma cells and lost during human melanoma progression. To investigate the molecular mechanism of its tumor suppressor function, miR-211 was ectopically expressed in nonpigmented melanoma cells. Ectopic expression of miR-211 reduced hypoxia-inducible factor 1α (HIF-1α) protein levels and decreased cell growth during hypoxia. HIF-1α protein loss was correlated with the downregulation of a miR-211 target gene, pyruvate dehydrogenase kinase 4 (PDK4). We present evidence that resumption of miR-211-mediated downregulation of PDK4 in melanoma cells causes inhibition of invasion by nonpigmented melanomas via HIF-1α protein destabilization. Thus, the tumor suppressor miR-211 acts as a metabolic switch, and its loss is expected to promote cancer hallmarks in human melanomas. Melanoma, one of the deadliest forms of skin cancer, kills nearly 10,000 people in the United States per year. We had previously shown that a small noncoding RNA, termed miR-211, suppresses invasion and the growth of aggressive melanoma cells. The results presented here support the hypothesis that miR-211 loss in melanoma cells causes abnormal regulation of energy metabolism, which in turn allows cancer cells to survive under low oxygen concentrations-a condition that generally kills normal cells. These findings highlight a novel mechanism of melanoma formation: miR-211 is a molecular switch that is turned off in melanoma cells, raising the hope that in the future we might be able to turn the switch back on, thus providing a better treatment option for melanoma. Copyright © 2016, American Society for Microbiology. All Rights Reserved.

  20. 9 CFR 205.211 - Applicability of court decisions under the UCC.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Applicability of court decisions under the UCC. 205.211 Section 205.211 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS... a person engaged in farming operations takes free of a security interest created by his seller even...

  1. Serum CYFRA 21-1 in Egyptian women with breast cancer

    African Journals Online (AJOL)

    Samia A. Ebied

    2016-03-07

    Mar 7, 2016 ... a Applied Medical Chemistry Department, Medical Research Institute, Alexandria University, Egypt ... uate the clinical significance of serum CYFRA21-1 in patients with breast cancer by analyzing the correlation ... CYFRA21-1 was superior to CA15.3 and CEA as a diagnostic marker for breast cancer using.

  2. 12 CFR 211.22 - Interstate banking operations of foreign banking organizations.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Interstate banking operations of foreign banking organizations. 211.22 Section 211.22 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM INTERNATIONAL BANKING OPERATIONS (REGULATION K) Foreign Banking...

  3. 12 CFR 211.3 - Foreign branches of U.S. banking organizations.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Foreign branches of U.S. banking organizations. 211.3 Section 211.3 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM INTERNATIONAL BANKING OPERATIONS (REGULATION K) International Operations of U.S. Banking...

  4. 20 CFR 404.211 - Computing your average indexed monthly earnings.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Computing your average indexed monthly earnings. 404.211 Section 404.211 Employees' Benefits SOCIAL SECURITY ADMINISTRATION FEDERAL OLD-AGE, SURVIVORS AND DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts Average-Indexed-Monthly...

  5. 25 CFR 211.4 - Authority and responsibility of the Bureau of Land Management (BLM).

    Science.gov (United States)

    2010-04-01

    ... limited to, resource evaluation, approval of drilling permits, mining and reclamation, production plans... Management (BLM). 211.4 Section 211.4 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND...: Unproven Area, 43 CFR part 3260—Geothermal Resources Operations, 43 CFR part 3280—Geothermal Resources Unit...

  6. Serum CYFRA 21-1 in Egyptian women with breast cancer | Ebied ...

    African Journals Online (AJOL)

    Aim of the work: The aim of the present study was to evaluate the clinical significance of serum CYFRA21-1 in patients with breast cancer by analyzing the correlation between serum CYFRA21-1 titers, clinicopathological ... Further prospective studies using greater number of patients are required to confirm our findings.

  7. 22 CFR 211.9 - Liability for loss damage or improper distribution of commodities.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Liability for loss damage or improper distribution of commodities. 211.9 Section 211.9 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT... English translation and shall be forwarded as set forth in paragraphs (c)(1) (iii) and (iv) of this...

  8. 48 CFR 1552.211-79 - Compliance with EPA Policies for Information Resources Management.

    Science.gov (United States)

    2010-10-01

    ... Policies for Information Resources Management. 1552.211-79 Section 1552.211-79 Federal Acquisition... Information Resources Management (OCT 2000) (a) Definition. Information Resources Management (IRM) is defined... includes both information itself, and the management of information and related resources such as personnel...

  9. 45 CFR 400.211 - Methodology to be used to determine time-eligibility of refugees.

    Science.gov (United States)

    2010-10-01

    ...-eligibility of refugees. 400.211 Section 400.211 Public Welfare Regulations Relating to Public Welfare OFFICE OF REFUGEE RESETTLEMENT, ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES REFUGEE RESETTLEMENT PROGRAM Federal Funding Federal Funding for Expenditures for Determining...

  10. 211 service reassures callers during August 2003 blackout

    Energy Technology Data Exchange (ETDEWEB)

    May, C.

    2004-07-01

    Community Information Toronto (CIT) in partnership with the City of Toronto and the United Way of Greater Toronto launched Canada's first 211 customer service to link residents to essential services in the event of unusual occurrences such as power outages. During the August 2003 blackout, the service proved to be responsible and capable of addressing the concerns of residents and providing information on available community services. CIT provided uninterrupted service to more than 1,000 callers during the early hours of the blackout, despite the fact that the staff were undergoing the same difficulties that callers were facing. This paper describes how the CIT staff responded to the blackout and demonstrates the organizational commitment of CIT to customer service. CIT staff played an important role in reassuring the population on how to look after themselves without power, water and the ability to cook meals. They also provided information on shelters and other community services. The information technology staff also verified the extent of the outage. While most residents received the service and support they needed, it was noted that the service could be strengthened further if it were part of a formalized emergency response system and had better resources to provide support for the ill and elderly. Each month, the CIT responds to nearly 30,000 calls and receives 50,000 visits to its website. The fail safe mechanism for the 211 system includes an Uninterrupted Power Supply (UPS) for up to 30 hours, after which time the calls are transferred manually.

  11. 7 CFR 1400.211 - Persons and legal entities not considered to be actively engaged in farming.

    Science.gov (United States)

    2010-01-01

    ... actively engaged in farming. 1400.211 Section 1400.211 Agriculture Regulations of the Department of... Payment Eligibility § 1400.211 Persons and legal entities not considered to be actively engaged in farming... through 1400.210 and a landowner who rents land to a farming operation for cash or a crop share guaranteed...

  12. 23 CFR 633.211 - Implementation of the Clean Air Act and the Federal Water Pollution Control Act.

    Science.gov (United States)

    2010-04-01

    ... Water Pollution Control Act. 633.211 Section 633.211 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT...) implementing requirements with respect to the Clean Air Act and the Federal Water Pollution Control Act are... Contracts (Appalachian Contracts) § 633.211 Implementation of the Clean Air Act and the Federal Water...

  13. 36 CFR 211.6 - Cooperation in forest investigations or the protection, management, and improvement of the...

    Science.gov (United States)

    2010-07-01

    ... investigations or the protection, management, and improvement of the National Forest System. 211.6 Section 211.6... § 211.6 Cooperation in forest investigations or the protection, management, and improvement of the... investigations or for the protection, management, and improvement of the National Forest System and only in...

  14. 20 CFR 30.211 - How does a claimant establish that the employee has or had contracted cancer?

    Science.gov (United States)

    2010-04-01

    ... employee has or had contracted cancer? 30.211 Section 30.211 Employees' Benefits OFFICE OF WORKERS... Cancer Under Parts B and E of Eeoicpa § 30.211 How does a claimant establish that the employee has or had contracted cancer? A claimant establishes that the employee has or had contracted a specified cancer (as...

  15. ISO TC211 standards on Provenance for Earth science

    Science.gov (United States)

    Di, L.; Deng, M.

    2014-12-01

    Data provenance, also called lineage, records the derivation history of a data product. The history could include the algorithms used, the process steps taken, the computing environment run, data sources input to the processes, the organization/person responsible for the product, etc. Provenance provides important information to data users for them to determine the usability and reliability of the product. In the science domain, the data provenance is especially important since scientists need to use the information to determine the scientific validity of a data product and to decide if such a product can be used as the basis for further scientific analysis. Provenance is a kind of metadata. In Earth science domain, the International Organization for Standardization (ISO) Technical Committee 211 (ISO TC 211) have set geospatial metadata standards for geospatial data, including ISO 19115:2003-Metadata, ISO 19115-2:2009-Metadata-Part 2: Extensions for imagery and gridded data, and ISO 19115-1:2014 - Metadata -- Part 1: Fundamentals. ISO 19115 and ISO 19115-1 define the fundamental metadata for documenting geospatial data products, and ISO 19115-2 provides additional metadata classes for imagery and gridded data. ISO 19115-1:2014 is the revised version of ISO 19115:2003. ISO 19115 and ISO 19115-1 define fundamental lineage information classes and subclasses. They miss some key information classes needed for documenting the provenance in the Web service environment, such as the running environment, the algorithms, and software executables. However, ISO 19115-2 extends the lineage model in ISO 19115 and provides additional metadata classes needed for documenting provenance information. The combination of lineage models in ISO 19115 and ISO 19115-2 provides a comprehensive provenance information model needed for the web service environment. Currently the ISO Provence standard is not compatible with W3C Prov standard. The revision of ISO 19115-2 will be started in

  16. Serum CYFRA 21-1 in Egyptian women with breast cancer

    Directory of Open Access Journals (Sweden)

    Samia A. Ebied

    2017-03-01

    Full Text Available Introduction: Cytokeratin fragment 21.1 (CYFRA 21.1 assay detects a serum fragment of cytokeratin 19 (CK19 and is employed in the diagnosis and management of lung cancer, particularly of squamous cell histotype. Breast carcinoma has been demonstrated to express CK19 fragments in the primary and metastatic lesions and CK19 mRNA is detectable in peripheral blood from patients affected by breast cancer. Aim of the work: The aim of the present study was to evaluate the clinical significance of serum CYFRA21-1 in patients with breast cancer by analyzing the correlation between serum CYFRA21-1 titers, clinicopathological factors and prognosis in comparison with serum CA15.3 and CEA tested in the same samples. Subjects and methods: This study included 60 breast cancer patients and 25 healthy females as control group. Three blood samples were drawn from each patient, before surgery, two weeks after surgery and after 6 cycles of chemotherapy. One blood sample was drawn from each subject of control group. Serum was separated and kept frozen till used for estimation of CYFRA21-1 by enzyme linked immunosorbent assay (ELISA and serum CA15.3 and CEA by immunoradiometric assay (IRMA. Results: Serum CYFRA21-1 was highly elevated in breast cancer patients than in controls and was significantly associated with tumor size, clinical stage and axillary lymph node involvement. Serum CYFRA21-1 was superior to CA15.3 and CEA as a diagnostic marker for breast cancer using ROC curve analysis. Higher levels of serum CYFRA21-1 and CA15.3 were significantly associated with poor prognosis in primary breast cancer patients. Conclusions: The measurement of serum CYFRA 21-1 in breast cancer patients may be useful for detecting disease relapse and for assessing surgical and chemotherapeutic efficacy. Further prospective studies using greater number of patients are required to confirm our findings.

  17. Preparation and preclinical evaluation of {sup 211}At-labelled compounds for {alpha}-particle radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, R.H.

    1994-12-31

    The interest for {alpha}-particle emitters in internal radiotherapy is increasing due to improved conjugation chemistry. Experimental work has concentrated on {sup 211}At and {sup 212}Bi since these to nuclides have radiochemical and physical properties suitable for medical application. In this report it is demonstrated that biologically active {sup 211}At-labelled compounds can be prepared within a relatively short time allowing utilization of this 7.2 h {alpha}-particle. It is further shown that {sup 211}At-TP-3 treatment of human osteosarcoma in vitro gives promising therapeutic ratios. 76 refs., 5 figs., 3 tabs.

  18. Cathodoluminescence studies on GaN on Si(211) and Si(311) substrates; Kathodolumineszenzuntersuchungen an GaN auf Si(211)- und Si(311)-Substraten

    Energy Technology Data Exchange (ETDEWEB)

    Mueller, Mathias; Dempewolf, Anja; Bertram, Frank; Hempel, Thomas; Christen, Juergen; Ravash, Roghaiyeh; Dadgar, Armin; Krost, Alois [Institut fuer Experimentelle Physik, Otto-von-Guericke-Universitaet Magdeburg (Germany)

    2011-07-01

    Spectrally resolved cathodoluminescence measurements were used to study GaN layers on Si(211) and Si(311 substrates at liquid helium temperatures. Non-c axis oriented GaN growth allows a reduction of polarization fields and thus the quantum confined Stark effect (QCSE) that reduces the efficiency of optoelectronic devices. The authors used appropriated high-indices Si(h11) substrates with a MOVPE grown AlN seed layer and an AlGaN buffer layer, two thick GaN layers with an AlN interlayer. The low-temperature luminescence spectra showed three dominant luminescence channels: the bound exciton D(0),X), donor-acceptor pairs (DAP) and basal plane stacking faults luminescence. The stacking fault luminescence on Si(211) is significantly reduced compared to GaN on Si(311). The results indicate a strong inhomogeneity of Si(311) compared to Si(211).

  19. Preparation and in vivo evaluation of novel linkers for {sup 211}At labeling of proteins

    Energy Technology Data Exchange (ETDEWEB)

    Talanov, Vladimir S. [Radiation Oncology Branch, Center for Cancer Research, National Cancer Institute, National Institutes of Health, Bethesda, MD 20892 (United States); Yordanov, Alexander T. [Radiation Oncology Branch, Center for Cancer Research, National Cancer Institute, National Institutes of Health, Bethesda, MD 20892 (United States); Garmestani, Kayhan [Metabolism Branch, Center for Cancer Research, National Cancer Institute, National Institutes of Health, Bethesda, MD 20892 (United States); Milenic, Diane E. [Radiation Oncology Branch, Center for Cancer Research, National Cancer Institute, National Institutes of Health, Bethesda, MD 20892 (United States); Arora, Hans C. [Radiation Oncology Branch, Center for Cancer Research, National Cancer Institute, National Institutes of Health, Bethesda, MD 20892 (United States); Plascjak, Paul S. [Department of Nuclear Medicine, Clinical Center, National Institutes of Health, Bethesda, MD 20892 (United States); Eckelman, William C. [Department of Nuclear Medicine, Clinical Center, National Institutes of Health, Bethesda, MD 20892 (United States); Waldmann, Thomas A. [Metabolism Branch, Center for Cancer Research, National Cancer Institute, National Institutes of Health, Bethesda, MD 20892 (United States); Brechbiel, Martin W. [Radiation Oncology Branch, Center for Cancer Research, National Cancer Institute, National Institutes of Health, Bethesda, MD 20892 (United States)]. E-mail: martinwb@mail.nih.gov

    2004-11-01

    The syntheses, radiolabeling, antibody conjugation and in vivo evaluation of new linkers for {sup 211}At labeling of monoclonal antibodies are described. Syntheses of the N-succinimidyl esters and labeling with {sup 211}At to form succinimidyl 4-methoxymethyl-3-[{sup 211}At]astatobenzoate (9) and succinimidyl 4-methylthiomethyl-3-[{sup 211}At]astatobenzoate (11) from the corresponding bromo-aryl esters is reported. Previously reported succinimidyl N-{l_brace}4-[{sup 211}At]astatophenethyl{r_brace}succinamate (SAPS) is employed as a standard of in vivo stability. Each agent is conjugated with Herceptin in parallel with their respective {sup 125}I analogue, succinimidyl 4-methoxymethyl-3-[{sup 125}I]iodobenzoate (10), succinimidyl 4-methylthiomethyl-3-[{sup 125}I]iodobenzoate (12) and succinimidyl N-{l_brace}4-[{sup 125}I]iodophenethyl{r_brace}succinamate (SIPS), respectively, for comparative assessment in LS-174T xenograft-bearing mice. With 9 and 11, inclusion of an electron pair donor in the ortho position does not appear to provide in vivo stability comparable to SAPS. Variables in radiolabeling chemistry of these three agents with {sup 211}At are notable. Sequential elimination of acetic acid and oxidizing agent, N-chlorosuccinimide (NCS), from the {sup 211}At radiolabeling protocol for forming SAPS improves yield, product purity and consistency. NCS appears to be critical for the radiolabeling of 6 with {sup 211}At. Formation of 11, however, is found to require the absence of NCS. Elimination of acetic acid is found to have no effect on radiolabeling efficiency or yield for either of these reactions.

  20. Characterization of articular chondrocytes isolated from 211 osteoarthritic patients.

    Science.gov (United States)

    Laganà, Matteo; Arrigoni, Chiara; Lopa, Silvia; Sansone, Valerio; Zagra, Luigi; Moretti, Matteo; Raimondi, Manuela Teresa

    2014-03-01

    We analyzed specific features of chondrocytes as cellular yield, cell doubling rates and the dependence between these parameters and patient-related data in a set of 211 osteoarthritic (OA) patients undergoing total joint replacement. For each patient the data available were joint type, age and gender. Knee samples chosen randomly among all biopsies were graded according to ICRS score. Patients' age ranged between 30 and 90 years with a mean age of 66 ± 9.7 years. Patients were divided into age classes and statistically significant differences in proliferation rate at passage 1 were found between chondrocytes derived from young and old donors, with the last ones characterized by a lower proliferation rate. A similar trend was observed for proliferation rate at passage 2. For all the samples, cellular yields ranged between 0.1 and 5.5 million cells/g of tissue. No significant correlation was observed between the level of cartilage degeneration (ICRS score) and cellular yield and proliferation rates. However, in samples with a high degree of cartilage degeneration (ICRS score 4) the cellular yield was lower compared to the other three groups (ICRS scores 1-3). In this study we performed a systematic characterization of basic parameters of chondrocytes originating from a wide group of OA patients. Considering the use of autologous chondrocytes in chondral treatments, the characterization of cell basic features may represent an important step to determine the quality of the cell source which is a major determinant in the outcome of cell-based therapies.

  1. A comparison of classical and H-type bovine spongiform encephalopathy associated with E211K prion protein polymorphism in wild type and EK211 cattle following intracranial inoculation

    Directory of Open Access Journals (Sweden)

    Jo Moore

    2016-09-01

    Full Text Available In 2006, a case of H-type bovine spongiform encephalopathy (BSE-H was diagnosed in a cow that was associated with a heritable polymorphism in the bovine prion protein gene (PRNP resulting in a lysine for glutamine amino acid substitution at codon 211 (called E211K of the prion protein. Although the prevalence of this polymorphism is low, cattle carrying the K211 allele may be predisposed to rapid onset of BSE-H when exposed or to the potential development of a genetic BSE. This study was conducted to better understand the relationship between the K211 polymorphism and its effect on BSE phenotype. BSE-H from the US 2006 case was inoculated intracranially (IC in one PRNP wild type (EE211 calf and one EK211 calf. In addition, one wild type calf and one EK211 calf were inoculated IC with brain homogenate from a US 2003 classical BSE case. All cattle developed clinical disease. The survival times of the E211K BSE-H inoculated EK211 calf (10 months was shorter than the wild type calf (18 months. This genotype effect was not observed in classical BSE inoculated cattle (both 26 months. Significant changes in retinal function were observed in H-type BSE challenged cattle only. Cattle challenged with the same inoculum showed similar severity and neuroanatomical distribution of vacuolation and disease-associated prion protein deposition in the brain, though differences in neuropathology were observed between E211K BSE-H and classical BSE inoculated animals. Western blot results for brain tissue from challenged animals were consistent with the inoculum strains. This study demonstrates that the phenotype of E211K BSE-H remains stable when transmitted to cattle without the K211 polymorphism, and exhibits a number of features that differ from classical BSE in both wild type and heterozygous EK211 animals.

  2. 75 FR 61363 - Airworthiness Directives; Rolls-Royce plc RB211-524 Series, -535 Series, RB211 Trent 700 Series...

    Science.gov (United States)

    2010-10-05

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Rolls-Royce plc... Federal holidays. Fax: (202) 493-2251. Contact Rolls-Royce plc, P.O. Box 31, Derby, DE24 8BJ, United... docket. Relevant Service Information Rolls-Royce plc has issued Alert Service Bulletin RB.211-72-AF458...

  3. Salivary and serum level of CYFRA 21-1 in oral precancer and oral squamous cell carcinoma.

    Science.gov (United States)

    Rajkumar, K; Ramya, R; Nandhini, G; Rajashree, P; Ramesh Kumar, A; Nirmala Anandan, S

    2015-01-01

    CYFRA 21-1, a constituent of the intermediate filament proteins of epithelial cells, is known to be increased in many cancers. This study was designed to estimate the levels of salivary and serum CYFRA 21-1 in patients with oral precancer and oral squamous cell carcinoma (OSCC) and compare them with healthy controls. Each group comprised of 100 subjects. Saliva and blood samples were collected from patients with OSCC, premalignant subjects, and normal healthy subjects. Serum and salivary CYFRA 21-1 levels were measured by enzyme-linked immunosorbent assay. Appropriate statistical tests were employed to assess diagnostic potency of CYFRA 21-1. We found a significant increase in CYFRA 21-1 level in OSCC compared with PML and healthy subjects. Salivary CYFRA 21-1 levels in OSCC was threefold higher when compared to serum levels. PML group showed increased salivary CYFRA 21-1 when compared to control subjects, but it was significantly lower compared with OSCC. Receiver operator characteristic curve analysis showed salivary CYFRA 21-1 to have superior sensitivity in detecting OSCC compared with serum CYFRA 21-1. The outcome of this study suggests that salivary CYFRA 21-1 can be utilized as a biomarker in early detection of oral cancer. © 2013 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  4. Diagnostic value of mesothelin in pleural fluids: comparison with CYFRA 21-1 and CEA.

    Science.gov (United States)

    Filiberti, Rosa; Parodi, Stefano; Libener, Roberta; Ivaldi, Giovanni Paolo; Canessa, Pier Aldo; Ugolini, Donatella; Bobbio, Barbara; Marroni, Paola

    2013-06-01

    CYFRA 21-1 and CEA have been applied for the differential diagnosis of malignant pleural mesothelioma (MPM). The soluble mesothelin-related peptide (SMRP) has been proposed as a specific marker for distinguishing MPM from benign diseases and other malignancies in pleural effusions (PEs). In this study, we evaluated the usefulness of SMRP in PEs in the detection of mesotheliomas by comparing it with that of CYFRA 21-1, CEA, and with cytological examination. One hundred and seventy-seven consecutive patients (57 MPM, 64 metastatic tumors, and 56 benign diseases) were evaluated using commercial tests. The performance of the markers was analyzed by standard ROC analysis methods, using the area under a ROC curve (AUC) as a measure of accuracy. CYFRA 21-1 better differentiated malignant from benign effusions. The corresponding area under the receiver operating characteristic curve was 0.87, while it was 0.74 for SMRP and 0.64 for CEA (p < 0.001). Conversely, SMRP differentiated MPM from all other PEs better than both CYFRA 21-1 and CEA (AUC = 0.84, 0.76, and 0.32, respectively, p = 0.003). Low levels of CEA were associated with a MPM diagnosis. The AUC for differentiating MPM from metastases was 0.81 for SMRP, 0.61 for CYFRA 21-1, and 0.20 for CEA (p < 0.001). In cases with negative or suspicious cytology, SMRP and CYFRA 21-1 identified 36/71 and 46/66 malignant PEs (29 and 31 MPM, respectively). Only 1 MPM showed a high CEA concentration. No single marker showed the best performance in any comparison. Results suggest that SMRP could improve CYFRA 21-1 and CEA accuracy in the differential diagnosis of MPM.

  5. Structural evolution due to Zn and Te adsorption on As-exposed Si(211): density functional calculation

    Energy Technology Data Exchange (ETDEWEB)

    Gupta, Bikash C; Konar, Shyamal [Department of Physics, Visva-Bharati, Santiniketan 731235 (India); Grein, C H; Sivananthan, S [Department of Physics, University of Illinois at Chicago, 845 W Taylor Street, Chicago, IL 60607-7059 (United States)

    2009-09-16

    Systematic theoretical investigations are carried out under the density functional formalism in an effort to understand the initial structural evolution due to the adsorption of ZnTe on As-exposed Si(211). Our calculations indicate that after the adsorption of Zn and Te on the As-exposed Si(211), the stable atomic structure qualitatively follows the ideal atomic structure of Si(211) with alteration of various bond lengths. Since the basic symmetry of the Si(211) is preserved after the adsorption of ZnTe, the deposition of ZnTe on the As terminated Si(211) prior to the deposition of CdTe and HgCdTe is useful for obtaining an ultimate quality layer of HgCdTe on Si(211). Some of our results are compared with the available experimental results, and they are found to agree with each other qualitatively.

  6. Exploring 2-1-1 Service Requests As Potential Markers for Cancer Control Needs

    Science.gov (United States)

    Alcaraz, Kassandra I.; Arnold, Lauren D.; Eddens, Katherine S.; Lai, Choi; Rath, Suchitra; Greer, Regina; Kreuter, Matthew W.

    2012-01-01

    Background Delivering health information and referrals through 2-1-1 is promising, but these systems need efficient ways of identifying callers at increased risk. Purpose This study explores the utility of using 2-1-1 service request data to predict callers’ cancer control needs. Methods Using data from a large sample of callers (N=4,101) to United Way 2-1-1 Missouri, logistic regression was used to examine the relationship between caller demographics and type of service request, and cancer control needs. Results Of six types of service requests examined, two were associated with one or more cancer control needs. Two of the service request types were also associated with health insurance status. Conclusions Findings suggest routinely collected 2-1-1 service request data may be useful in helping to efficiently identify callers with specific cancer prevention and control needs. However, to apply this approach in 2-1-1 systems across the country, further research and ongoing surveillance is necessary. PMID:23157767

  7. 1q21.1 microduplication in a patient with mental impairment and congenital heart defect.

    Science.gov (United States)

    Sun, Guowen; Tan, Zhiping; Fan, Liangliang; Wang, Jian; Yang, Yifeng; Zhang, Weizhi

    2015-10-01

    1q21.1 duplication is a rare copy number variant with multiple congenital malformations, including developmental delay, autism spectrum disorder, dysmorphic features and congenital heart anomalies. The present study described a Chinese female patient (age, four years and eight months) with multiple malformations, including congenital heart defect, mental impairment and developmental delay. The parents and the monozygotic twin sister of the patient, however, were physically and psychologically normal. High‑resolution genome‑wide single nucleotide polymorphism array revealed a 1.6‑Mb duplication in chromosome region 1q21.1. This chromosome region contained HFE2, a critical gene involved in hereditary hemochromatosis. However, the parents and monozygotic twin sister of the patient did not carry this genomic lesion. To the best of our knowledge, the present study was the first to report on a 1q21.1 duplication patient in mainland China.

  8. The Adverse Effect of the 2-1-1 Regimen for Rabies PEP in Preschool Children.

    Science.gov (United States)

    Liu, Shu Qing; Tao, Xiao Yan; Yu, Peng Cheng; Jin, Chun Qiu; Yu, Hong Jie; Chen, Mei Shun; Zhu, Wu Yang

    2017-05-01

    Post-exposure prophylaxis (PEP) has proved to be the most important measure for rabies prevention and control. There is little information regarding adverse reactions to the Essen and 2-1-1 regimens in preschool children (aged 0-6). We reexamined the outcomes of 1,109 preschool children who were vaccinated using SPEEDA under the Essen regimen between January 2011 and December 2012 and 1,267 preschool children under the 2-1-1 regimen between January 2013 and December 2014. We find that, in preschool children, the febrile reaction after the first 2-dose injection in the 2-1-1 regimen was significantly higher than that induced by the first 1-dose in the Essen procedure. Thus, we recommend that the Essen regimen should still be used for rabies PEP in preschool children. Copyright © 2017 The Editorial Board of Biomedical and Environmental Sciences. Published by China CDC. All rights reserved.

  9. Effect of transition metal-doped Ni(211) for CO dissociation: Insights from DFT calculations

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Kuiwei; Zhang, Minhua [Key Laboratory for Green Chemical Technology of Ministry of Education, R& D Center for Petrochemical Technology, Tianjin University, Tianjin 300072 (China); Collaborative Innovation Center of Chemical Science and Engineering (Tianjin), Tianjin 300072 (China); Yu, Yingzhe, E-mail: yzhyu@tju.edu.cn [Key Laboratory for Green Chemical Technology of Ministry of Education, R& D Center for Petrochemical Technology, Tianjin University, Tianjin 300072 (China)

    2017-03-31

    Highlights: • Doping the step edge of Ni(211) with Fe or Ru observably enhances CO dissociation. • Rh doping is unfavorable for CO activation both kinetically and thermodynamically. • Two neat linear relations are proposed besides the Brønsted–Evans–Polanyi relation. • The differences of CO adsorption are rationalized via the Blyholder model. - Abstract: Density functional theory slab calculations were performed to investigate the adsorption and dissociation of CO over pure and M-doped Ni(211) (M = Fe, Co, Ru and Rh) with the aim to elucidate the effect of transition metal doping for CO activation. Doping the step edge of Ni(211) with Fe, Co and Ru is found to enhance the binding of CO in the initial state (IS) (in the sequence by the improvement degree: Fe > Ru > Co) as well as the co-adsorption of C and O in the final state (FS) (Ru > Fe > Co). In contrast, Rh doping is unfavorable both in the IS and in the FS. Analysis of the overall potential energy surfaces (PES) suggests CO dissociation is facilitated by Fe, Ru and Co doping both kinetically and thermodynamically, wherein Fe and Ru behave extraordinary. Interestingly, Fe substitute is slightly superior to Ru in kinetics whereas the contrary is the case in thermodynamics. Rh doping elevates the energy height from 0.97 eV on Ni(211) to 1.32 eV and releases 0.39 eV less heat relative to Ni(211), again manifesting a negative effect. Besides the classical Brønsted–Evans–Polanyi relationship, we put forward another two neat linear relations, which can well describe the feature of CO dissociation. The differences of CO adsorption and activation in the IS over pure and doped Ni(211) surfaces are rationalized via electronic structure analysis. The findings presented herein are expected to provide theoretical guidance for catalyst design and optimization in relevant processes.

  10. Determination of levitation force and pinning properties of (Sm123){sub 1-x}(Yb211){sub x} bulk superconductor depending on Yb211 doping ratio

    Energy Technology Data Exchange (ETDEWEB)

    Ozturk, K. [Department of Physics, Faculty of Arts and Sciences, Karadeniz Technical University, 61080 Trabzon (Turkey); Celik, S. [Department of Physics, Faculty of Arts and Sciences, Rize University, 53100 Rize (Turkey); Cansiz, A. [Electrical Electronics Engineering Department, Ataturk University, 25240 Erzurum (Turkey)

    2009-11-15

    The vertical force density curves of (Sm123){sub 1-x}(Yb211){sub x} high temperature superconductor (HTS) samples prepared by a melt-powder-melt-growth technique were measured during vertical and lateral traverses in zero field cooling (ZFC) regime for various doping levels (x). It was determined that the maximum vertical force density of the samples increases when the doping level increases and after certain level of the doping the force saturates. The pinning properties, which create attractive force, were enhanced up to a certain Yb211 doping level by introducing locally suppressed superconducting regions. These results indicate that the optimization fabrication conditions and Yb211 doping level should be further investigated for larger dimensional samples to enhance technological applicability. The frozen image model was used to predict the experimentally measured levitation force between a permanent magnet (PM) and the superconductor samples. Various configurations of the PM/HTS force interaction were tested according to the magnet and superconductor size. The doped HTS samples do not show very strong diamagnetic behavior as the frozen image model predicts. The levitation force behavior regarding the dimensions of the PM and HTS indicates an illustration how the diamagnetic behavior of the superconductor transforms into the flux pinning. (Abstract Copyright [2009], Wiley Periodicals, Inc.)

  11. A comparison of classical and H-type bovine spongiform encephalopathy associated with E211K prion protein polymorphism in wild type and EK211 cattle following intracranial inoculation

    Science.gov (United States)

    In 2006, a case of H-type bovine spongiform encephalopathy (BSE-H) was diagnosed in a cow that was associated with a heritable polymorphism in the bovine prion protein gene (PRNP) resulting in a lysine for glutamine amino acid substitution at codon 211 (called E211K) of the prion protein. Although t...

  12. 31 CFR 211.2 - Claims for the release of withheld checks or for the proceeds thereof.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Claims for the release of withheld checks or for the proceeds thereof. 211.2 Section 211.2 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT...

  13. 75 FR 69611 - Airworthiness Directives; Rolls-Royce plc RB211-Trent 768, 772, and 772B Turbofan Engines

    Science.gov (United States)

    2010-11-15

    ... Directives; Rolls-Royce plc RB211-Trent 768, 772, and 772B Turbofan Engines AGENCY: Federal Aviation... require the same initial and repetitive visual inspections of Rolls-Royce plc RB211-Trent 768 and 772... directive (AD) 98-09-27, Amendment 39-10508 (63 FR 24911, May 6, 1998): Rolls-Royce plc: Docket No. FAA-2010...

  14. 17 CFR 230.140 - Definition of “distribution” in section 2(11) for certain transactions.

    Science.gov (United States)

    2010-04-01

    ... in section 2(11) for certain transactions. 230.140 Section 230.140 Commodity and Securities Exchanges... Definition of “distribution” in section 2(11) for certain transactions. A person, the chief part of whose..., to furnish the proceeds with which to acquire the securities of such issuer or affiliated issuers, is...

  15. 25 CFR 211.42 - Annual rentals and expenditures for development on leases other than oil and gas, and geothermal...

    Science.gov (United States)

    2010-04-01

    ... other than oil and gas, and geothermal resources. 211.42 Section 211.42 Indians BUREAU OF INDIAN AFFAIRS... other than oil and gas, and geothermal resources. (a) Unless otherwise authorized by the Secretary, a lease for minerals other than oil, gas and geothermal resources shall provide for a yearly development...

  16. 8 CFR 211.3 - Expiration of immigrant visas, reentry permits, refugee travel documents, and Form I-551.

    Science.gov (United States)

    2010-01-01

    ... permits, refugee travel documents, and Form I-551. 211.3 Section 211.3 Aliens and Nationality DEPARTMENT... Expiration of immigrant visas, reentry permits, refugee travel documents, and Form I-551. An immigrant visa, reentry permit, refugee travel document, or Form I-551 shall be regarded as unexpired if the rightful...

  17. 29 CFR 825.211 - Maintenance of benefits under multi-employer health plans.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Maintenance of benefits under multi-employer health plans... Family and Medical Leave Act § 825.211 Maintenance of benefits under multi-employer health plans. (a) A multi-employer health plan is a plan to which more than one employer is required to contribute, and...

  18. 5 CFR 531.211 - Setting pay for a newly appointed employee.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Setting pay for a newly appointed... REGULATIONS PAY UNDER THE GENERAL SCHEDULE Determining Rate of Basic Pay Setting Pay When Appointment Or Position Changes § 531.211 Setting pay for a newly appointed employee. (a) First appointment. An agency...

  19. 33 CFR 211.25 - General considerations in the acquiring of Federal jurisdiction.

    Science.gov (United States)

    2010-07-01

    ... WITH CIVIL WORKS PROJECTS Federal Jurisdiction over Real Estate § 211.25 General considerations in the acquiring of Federal jurisdiction. (a) Laws governing the acquisition of Federal jurisdiction—(1) Constitution of the United States. By Article 1, Section 8, Clause 17, of the Constitution, Congress has the...

  20. Spitzer spectral line mapping of the HH211 outflow

    DEFF Research Database (Denmark)

    Dionatos, Odyssefs; Nisini, Brunella; Cabrit, Sylvie

    2010-01-01

    Aims: We employ archival Spitzer slit-scan observations of the HH211 outflow in order to investigate its warm gas content, assess the jet mass flux in the form of H2 and probe for the existence of an embedded atomic jet. Methods: Detected molecular and atomic lines are interpreted by means of emi...

  1. 46 CFR 109.211 - Testing of emergency lighting and power systems.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Testing of emergency lighting and power systems. 109.211... emergency power system is tested at least once each week; (2) Each emergency generator is tested at least... emergency lighting and power systems is tested every six months under actual connected load for a period of...

  2. 76 FR 24796 - Airworthiness Directives; Rolls-Royce plc RB211-Trent 800 Series Turbofan Engines

    Science.gov (United States)

    2011-05-03

    ... FURTHER INFORMATION CONTACT: Alan Strom, Aerospace Engineer, Engine Certification Office, FAA, Engine... EASA AD 2008-0099, and imposes more restrictive life limits in the Heavy Flight Profile Parts. You may... following actions. Multiple Flight Profile Monitoring Parts (1) For RB211-Trent 800 series engines being...

  3. Improving Student Success in Principles of Accounting 211 with the Integration of Situational Leadership Methods.

    Science.gov (United States)

    Ewell, Paul L.

    2001-01-01

    Looks at the failure rate of students in Accounting 211 in the Virginia Community College System. States that rote teaching styles that do not incorporate interdisciplinary and other diverse methods, do not take into account developing learning skills, and do not encourage active learning are doomed to fail. Makes recommendations for new…

  4. 12 CFR 211.26 - Examination of offices and affiliates of foreign banks.

    Science.gov (United States)

    2010-01-01

    ... FEDERAL RESERVE SYSTEM INTERNATIONAL BANKING OPERATIONS (REGULATION K) Foreign Banking Organizations § 211... other office or affiliate of a foreign bank conducting business in any state. (2) Examination of... when reviewed in the context of the foreign bank's entire U.S. operations otherwise necessitate an...

  5. 28 CFR 2.11 - Application for parole; notice of hearing.

    Science.gov (United States)

    2010-07-01

    ... RECOMMITMENT OF PRISONERS, YOUTH OFFENDERS, AND JUVENILE DELINQUENTS United States Code Prisoners and Parolees § 2.11 Application for parole; notice of hearing. (a) A federal prisoner (including a committed youth offender or prisoner sentenced under the Narcotic Addict Rehabilitation Act) desiring to apply for parole...

  6. Whole genome analysis of Klebsiella pneumoniae T2-1-1 from human oral cavity.

    Science.gov (United States)

    Chan, Kok-Gan; Yin, Wai-Fong; Chan, Xin-Yue

    2016-03-01

    Klebsiella pneumoniae T2-1-1 was isolated from the human tongue debris and subjected to whole genome sequencing on HiSeq platform and annotated on RAST. The nucleotide sequence of this genome was deposited into DDBJ/EMBL/GenBank under the accession JAQL00000000.

  7. 47 CFR 25.211 - Analog video transmissions in the Fixed-Satellite Services.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Analog video transmissions in the Fixed...) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Standards § 25.211 Analog video transmissions in the Fixed-Satellite Services. (a) Downlink analog video transmissions in the band 3700-4200 MHz...

  8. 12 CFR 211.45 - Accounting for fees on international loans.

    Science.gov (United States)

    2010-01-01

    ... the administrative cost over the effective life of the loan. (b) Accounting treatment. Subject to... accordance with generally accepted accounting principles. Interpretations ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Accounting for fees on international loans. 211...

  9. 5 CFR 847.211 - Death of employee during election opportunity period.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Death of employee during election... Qualifying Move § 847.211 Death of employee during election opportunity period. (a) When an employee eligible... employee is deemed to have made the election and to be covered, at time of death, by the retirement system...

  10. 12 CFR 211.34 - Procedures for filing and processing notices.

    Science.gov (United States)

    2010-01-01

    ... RESERVE SYSTEM INTERNATIONAL BANKING OPERATIONS (REGULATION K) Export Trading Companies § 211.34... investors in export trading companies shall be made in accordance with the general consent or prior notice... investment an export trading company: (i) If the eligible investor is well capitalized and well managed; (ii...

  11. MicroRNA-211 Regulates Oxidative Phosphorylation and Energy Metabolism in Human Vitiligo.

    Science.gov (United States)

    Sahoo, Anupama; Lee, Bongyong; Boniface, Katia; Seneschal, Julien; Sahoo, Sanjaya K; Seki, Tatsuya; Wang, Chunyan; Das, Soumen; Han, Xianlin; Steppie, Michael; Seal, Sudipta; Taieb, Alain; Perera, Ranjan J

    2017-09-01

    Vitiligo is a common chronic skin disorder characterized by loss of epidermal melanocytes and progressive depigmentation. Vitiligo has complex immune, genetic, environmental, and biochemical causes, but the exact molecular mechanisms of vitiligo development and progression, particularly those related to metabolic control, are poorly understood. In this study we characterized the human vitiligo cell line PIG3V and the normal human melanocyte line HEM-l by RNA sequencing, targeted metabolomics, and shotgun lipidomics. Melanocyte-enriched microRNA-211, a known metabolic switch in nonpigmented melanoma cells, was severely down-regulated in vitiligo cell line PIG3V and skin biopsy samples from vitiligo patients, whereas its predicted targets PPARGC1A, RRM2, and TAOK1 were reciprocally up-regulated. microRNA-211 binds to PGC1-α 3' untranslated region locus and represses it. Although mitochondrial numbers were constant, mitochondrial complexes I, II, and IV and respiratory responses were defective in vitiligo cells. Nanoparticle-coated microRNA-211 partially augmented the oxygen consumption rate in PIG3V cells. The lower oxygen consumption rate, changes in lipid and metabolite profiles, and increased reactive oxygen species production observed in vitiligo cells appear to be partly due to abnormal regulation of microRNA-211 and its target genes. These genes represent potential biomarkers and therapeutic targets in human vitiligo. Copyright © 2017 The Authors. Published by Elsevier Inc. All rights reserved.

  12. 30 CFR 77.211 - Draw-off tunnels; stockpiling and reclaiming operations; general.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Draw-off tunnels; stockpiling and reclaiming... WORK AREAS OF UNDERGROUND COAL MINES Surface Installations § 77.211 Draw-off tunnels; stockpiling and reclaiming operations; general. (a) Tunnels located below stockpiles, surge piles, and coal storage silos...

  13. 25 CFR 211.46 - Inspection of premises, books and accounts.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Inspection of premises, books and accounts. 211.46... premises, books and accounts. Lessees shall allow the Indian mineral owner, the Indian mineral owner's... and submit all related reports required by the lease and applicable regulations. Books and records...

  14. 50 CFR 216.211 - Specified activity and specified geographical region.

    Science.gov (United States)

    2010-10-01

    .... Gulf of Mexico § 216.211 Specified activity and specified geographical region. (a) Regulations in this... Mexico adjacent to the coasts of Texas, Mississippi, Louisiana, Alabama, and Florida. The incidental, but... dolphins, 27 Clymene dolphins, 12 rough-toothed dolphins, 14 striped dolphins, 15 melon-headed whales, 10...

  15. 76 FR 2605 - Airworthiness Directives; Rolls-Royce plc RB211-Trent 800 Series Turbofan Engines

    Science.gov (United States)

    2011-01-14

    ... in increased fatigue life usage which is considered to have led to crack initiation and propagation... to have led to crack initiation and propagation prior to reaching the blades declared life limit. A... flight cycles after the effective date of this AD. 3D Blades shown in RR ASB No. ASB RB.211-72- AG244...

  16. Cure of human ovarian carcinoma solid xenografts by fractionated [211At] alpha-radioimmunotherapy

    DEFF Research Database (Denmark)

    Bäck, Tom A; Chouin, Nicolas; Lindegren, Sture

    2017-01-01

    -10 days apart allowing bone-marrow recovery) with (211)At-MX35-F(ab')2 at different activities (close to acute myelotoxicity). Mean absorbed dose to tumors and organs were estimated from biodistribution data and summed for the fractions. Tumor growth was monitored for 100 days and survival for 1 year...

  17. Evaluation of effects on the peritoneum after intraperitoneal α-radioimmunotherapy with (211)At

    DEFF Research Database (Denmark)

    Cederkrantz, Elin; Angenete, Eva; Bäck, Tom

    2012-01-01

    is highly irradiated compared with other normal tissues. To address this issue, mice were injected with (211)At-trastuzumab to irradiate the peritoneum to absorbed doses ranging between 0 and 50 Gy and followed for up to 34 weeks. The peritoneum-to-plasma clearance of a small tracer, (51)Cr-ethylenediamine...

  18. Understanding the impact of 1q21.1 copy number variant

    Directory of Open Access Journals (Sweden)

    Harvard Chansonette

    2011-08-01

    Full Text Available Abstract Background 1q21.1 Copy Number Variant (CNV is associated with a highly variable phenotype ranging from congenital anomalies, learning deficits/intellectual disability (ID, to a normal phenotype. Hence, the clinical significance of this CNV can be difficult to evaluate. Here we described the consequences of the 1q21.1 CNV on genome-wide gene expression and function of selected candidate genes within 1q21.1 using cell lines from clinically well described subjects. Methods and Results Eight subjects from 3 families were included in the study: six with a 1q21.1 deletion and two with a 1q21.1 duplication. High resolution Affymetrix 2.7M array was used to refine the 1q21.1 CNV breakpoints and exclude the presence of secondary CNVs of pathogenic relevance. Whole genome expression profiling, studied in lymphoblast cell lines (LBCs from 5 subjects, showed enrichment of genes from 1q21.1 in the top 100 genes ranked based on correlation of expression with 1q21.1 copy number. The function of two top genes from 1q21.1, CHD1L/ALC1 and PRKAB2, was studied in detail in LBCs from a deletion and a duplication carrier. CHD1L/ALC1 is an enzyme with a role in chromatin modification and DNA damage response while PRKAB2 is a member of the AMP kinase complex, which senses and maintains systemic and cellular energy balance. The protein levels for CHD1L/ALC1 and PRKAB2 were changed in concordance with their copy number in both LBCs. A defect in chromatin remodeling was documented based on impaired decatenation (chromatid untangling checkpoint (DCC in both LBCs. This defect, reproduced by CHD1L/ALC1 siRNA, identifies a new role of CHD1L/ALC1 in DCC. Both LBCs also showed elevated levels of micronuclei following treatment with a Topoisomerase II inhibitor suggesting increased DNA breaks. AMP kinase function, specifically in the deletion containing LBCs, was attenuated. Conclusion Our studies are unique as they show for the first time that the 1q21.1 CNV not only

  19. Congenital heart defects in recurrent reciprocal 1q21.1 deletion and duplication syndromes: rare association with pulmonary valve stenosis.

    Science.gov (United States)

    Digilio, M Cristina; Bernardini, Laura; Consoli, Federica; Lepri, Francesca R; Giuffrida, M Grazia; Baban, Anwar; Surace, Cecilia; Ferese, Rosangela; Angioni, Adriano; Novelli, Antonio; Marino, Bruno; De Luca, Alessandro; Dallapiccola, Bruno

    2013-03-01

    Microdeletion 1q21.1 (del 1q21.1) and the reciprocal microduplication 1q21.1 (dup 1q21.1) are newly recognized genomic disorders, characterized by developmental delay, dysmorphic features and congenital malformations. Congenital heart defect (CHD) is a major feature of del 1q21.1, and has been occasionally reported in dup 1q21.1. We report here a family segregating del 1q21.1 in 3 members. Two of the affected family members had CHD, including the proband with syndromic atrial septal defect, pulmonary valve stenosis (PVS), and muscular ventricular septal defects, and the maternal uncle with non-syndromic PVS. This finding prompted investigation of the role of recurrent rearrangements of chromosome 1q21.1 in the pathogenesis of PVS. We gathered 38 patients with PVS (11 syndromic and 27 non-syndromic), and searched for genomic rearrangements of 1q21.1. A dup 1q21.1 was detected in a single sporadic non-syndromic patient. Review of the CHDs in published del 1q21.1 and dup 1q21.1 subjects showed a great heterogeneity in anatomic types. In conclusion, the present family illustrates recurrent CHD in del 1q21.1, expressing either as syndromic in one family member or as non-syndromic in the another one. The spectrum of CHDs associated with del 1q21.1 and dup 1q21.1 can occasionally include PVS. Copyright © 2012 Elsevier Masson SAS. All rights reserved.

  20. (211) oriented ZnTe growth on m-plane sapphire by MBE

    Energy Technology Data Exchange (ETDEWEB)

    Nakasu, Taizo [Department of Electrical Engineering and Bioscience, Waseda University, Tokyo 169-8555 (Japan); Kobayashi, Masakazu [Department of Electrical Engineering and Bioscience, Waseda University, Tokyo 169-8555 (Japan); Kagami Memorial Research Institute for Materials Science and Technology, Waseda University, 2-8-26, Tokyo 169-0051 (Japan); Togo, Hiroyoshi [NTT Microsystem Integration Laboratories, Atugi-shi 243-0198 (Japan); Asahi, Toshiaki [Technology Development Center, JX Nippon Mining and Metals Corporation, Hitachi-shi 317-0056 (Japan)

    2013-11-15

    Single-crystalline and single domain ZnTe thin films are sought for high-performance terahertz wave detectors, and ZnTe/sapphire heterostructures were considered since the Electro-Optical (EO) effect could be obtained only from epilayers. ZnTe epilayers were grown on m-plane sapphire substrates by molecular beam epitaxy, and the potential of single domain epilayers was explored. Through the X-ray diffraction pole figure measurement it was confirmed that one (100) oriented ZnTe domain along with two kinds of (211) oriented domains were formed on the m-plane sapphire when the layer was grown at 340 C. When the layer was grown at 350 C, the (211) oriented domain dominated the film. (copyright 2013 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  1. Structure, strain, and composition profiling of InAs/GaAs(211)B quantum dot superlattices

    Energy Technology Data Exchange (ETDEWEB)

    Florini, N.; Dimitrakopulos, G. P.; Kioseoglou, J.; Kehagias, Th., E-mail: kehagias@auth.gr [Physics Department, Aristotle University of Thessaloniki, 54624 Thessaloniki (Greece); Germanis, S.; Pelekanos, N. T. [Department of Materials Science and Technology, University of Crete, P.O. Box 2208, 70013 Heraklion (Greece); Microelectronics Research Group, IESL-FORTH, P.O. Box 1385, 71110 Heraklion (Greece); Katsidis, C. [Department of Materials Science and Technology, University of Crete, P.O. Box 2208, 70013 Heraklion (Greece); Hatzopoulos, Z. [Microelectronics Research Group, IESL-FORTH, P.O. Box 1385, 71110 Heraklion (Greece); Department of Physics, University of Crete, P.O. Box 2208, 70013 Heraklion (Greece)

    2016-01-21

    The morphology, nanostructure, and strain properties of InAs quantum dots (QDs) grown on GaAs(211)B, uncapped or buried, are explored by transmission electron microscopy and related quantitative techniques. Besides the built-in piezoelectric field, other differences of (211) growth compared to (100)-oriented growth are discussed in terms of the (211) surface non-singularity, leading to anisotropic shape of the QDs and local chemical inhomogeneity of the wetting layer. The shape of the uncapped QDs was precisely defined as truncated pyramidal, elongated along the 〈111〉 direction, and bounded by the (110), (100), and (213) facets. Local strain measurements showed that large surface QDs were almost unstrained due to plastic relaxation, exhibiting small residual elastic strain at the interface that gradually diminished toward their apex. Conversely, buried QDs were pseudomorphically grown on GaAs. By postulating a plane stress state, we have established a systematic increase of the local strain from the base toward the apex region of the QDs. Using Vegard's law, their chemical composition profiles were calculated, revealing an indium content gradient along the growth direction and compositional variants among different QDs. Photoluminescence measurements showed variations in emission energy between the QDs and consistency with a graded In-content, which complied with the quantitative strain analysis.

  2. DISCOVERY OF A NEW TeV GAMMA-RAY SOURCE: VER J0521+211

    Energy Technology Data Exchange (ETDEWEB)

    Archambault, S. [Physics Department, McGill University, Montreal, QC H3A 2T8 (Canada); Arlen, T.; Aune, T. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Behera, B.; Federici, S. [DESY, Platanenallee 6, D-15738 Zeuthen (Germany); Beilicke, M.; Buckley, J. H.; Bugaev, V. [Department of Physics, Washington University, St. Louis, MO 63130 (United States); Benbow, W. [Fred Lawrence Whipple Observatory, Harvard-Smithsonian Center for Astrophysics, Amado, AZ 85645 (United States); Bird, R. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Bouvier, A. [Santa Cruz Institute for Particle Physics and Department of Physics, University of California, Santa Cruz, CA 95064 (United States); Byrum, K. [Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, IL 60439 (United States); Cesarini, A.; Connolly, M. P. [School of Physics, National University of Ireland Galway, University Road, Galway (Ireland); Ciupik, L. [Astronomy Department, Adler Planetarium and Astronomy Museum, Chicago, IL 60605 (United States); Cui, W.; Feng, Q.; Finley, J. P. [Department of Physics, Purdue University, West Lafayette, IN 47907 (United States); Errando, M. [Department of Physics and Astronomy, Barnard College, Columbia University, NY 10027 (United States); Falcone, A., E-mail: fortin@veritas.sao.arizona.edu, E-mail: errando@astro.columbia.edu, E-mail: jholder@physics.udel.edu, E-mail: sfegan@llr.in2p3.fr [Department of Astronomy and Astrophysics, 525 Davey Lab, Pennsylvania State University, University Park, PA 16802 (United States); Collaboration: VERITAS Collaboration; and others

    2013-10-20

    We report the detection of a new TeV gamma-ray source, VER J0521+211, based on observations made with the VERITAS imaging atmospheric Cherenkov Telescope Array. These observations were motivated by the discovery of a cluster of >30 GeV photons in the first year of Fermi Large Area Telescope observations. VER J0521+211 is relatively bright at TeV energies, with a mean photon flux of (1.93 ± 0.13{sub stat} ± 0.78{sub sys}) × 10{sup –11} cm{sup –2} s{sup –1} above 0.2 TeV during the period of the VERITAS observations. The source is strongly variable on a daily timescale across all wavebands, from optical to TeV, with a peak flux corresponding to ∼0.3 times the steady Crab Nebula flux at TeV energies. Follow-up observations in the optical and X-ray bands classify the newly discovered TeV source as a BL Lac-type blazar with uncertain redshift, although recent measurements suggest z = 0.108. VER J0521+211 exhibits all the defining properties of blazars in radio, optical, X-ray, and gamma-ray wavelengths.

  3. The usefulness of CYFRA 21-1 to diagnose and predict preeclampsia: a nested case-control study.

    Science.gov (United States)

    Kuessel, Lorenz; Zeisler, Harald; Ristl, Robin; Binder, Julia; Pateisky, Petra; Schmid, Maximilian; Marschalek, Julian; Perkmann, Thomas; Haslacher, Helmuth; Husslein, Heinrich

    2016-11-03

    The ability to identify patients at risk for developing preeclampsia is important for preventing morbidity and mortality in both the mother and child. Although CYFRA 21-1 (a fragment of Cytokeratin 19) is considered a promising biomarker for diagnosing preeclampsia, little is known regarding the levels of CYFRA 21-1 during pregnancy. Here, we measured serum CYFRA 21-1 levels in women with an uneventful pregnancy and in women whose pregnancy was complicated by preeclampsia. Furthermore we evaluated whether maternal CYFRA 21-1 levels can be used to predict and/or diagnose preeclampsia. Longitudinal, sequential blood samples were collected prospectively at seven predetermined visits during pregnancy. Maternal CYFRA 21-1 levels were measured in 50 women with an uneventful pregnancy (control group) and in 10 asymptomatic women whose pregnancy was later complicated by preeclampsia (PE_long group). In addition, CYFRA 21-1 levels were measured from a single sample collected from a separate group of 50 pregnant women with symptomatic preeclampsia (PE_state group). The CYFRA 21-1 levels were significantly higher in the PE_state group compared to the control group (p preeclampsia, the ROC curve for diagnosing preeclampsia in gestational week 28-32 showed the largest AUC of 0.92, at a cut-off point of 3.1 ng/ml, leading to sensitivity of 92 % and specificity of 80 %. The elevated serum levels of CYFRA 21-1 observed in both groups of women with preeclampsia may reflect endothelial damage and/or dysfunction. Our results suggest that maternal serum CYFRA 21-1 is a promising biomarker for diagnosing preeclampsia. Although its value for predicting the long-term occurrence of subsequent preeclampsia may be limited, our findings indicate a trend towards elevated maternal CYFRA 21-1 levels preceding the short-term occurrence of preeclampsia in asymptomatic women. Additional prospective longitudinal studies are needed in order to determine the value of measuring maternal serum

  4. 76 FR 12277 - Airworthiness Directives; Rolls-Royce plc RB211-Trent 768, 772, and 772B Turbofan Engines

    Science.gov (United States)

    2011-03-07

    ...-AD; Amendment 39-16620; AD 98-09-27R1] RIN 2120-AA64 Airworthiness Directives; Rolls-Royce plc RB211... of Rolls-Royce plc RB211-Trent 768 and 772 series turbofan engine thrust reverser hinge lugs and..., Amendment 39-10508 (63 FR 24911, May 6, 1998): 98-09-27R1 Rolls-Royce plc: Amendment 39-16620. Docket No...

  5. Public broadcasting, media engagement, and 2-1-1: using mass communication to increase the use of social services.

    Science.gov (United States)

    Shah, Dhavan V; McLeod, Douglas M; Rojas, Hernando; Sayre, Benjamin G; Vraga, Emily; Scholl, Rosanne M; Jones, Clive; Shaw, Amy

    2012-12-01

    The 2008-2009 subprime mortgage crisis was catastrophic, not only for the global economy but for families across the social spectrum. The resultant economic upheaval threatened the livelihoods, well-being, and health of many citizens, who were often unsure where to turn for help. At this critical juncture, public broadcasting stations worked to connect viewers to support resources through 2-1-1. This study was designed to evaluate the ability of public broadcasting to increase the use of information and referral services. Autoregressive integrated moving average (ARIMA) modeling and regression analysis document the relationship between public broadcasting initiatives and 2-1-1 call volume in 35 highly affected U.S. markets. Time-series data from St. Louis MO were collected and analyzed in 2008. Station-level data from across the nation were collected during 2009-2010 and analyzed in 2010. ARIMA results show a distinct linkage between the timing and duration of Channel 9 in St. Louis MO (KETC) programming and a subsequent (approximately 400%) increase in 2-1-1 calls regarding financial services and assistance. Regression path analysis not only found evidence of this same effect nationally but also showed that differences in the broadcaster's orientation and approach mediated effects. Specifically, stations' orientations toward engagement were mediated through strong outreach strategies to increase 2-1-1 use. This study documents the ability of public broadcasting to help citizens in need connect with social resources through 2-1-1 services. By focusing attention on the mortgage crisis and its attendant consequences, and by publicizing 2-1-1 services as a gateway to supportive resources, public broadcasters fostered linkages between those in need and social resources. Moreover, the level of a station's commitment to engaging citizens had a strong bearing on the success of its programming initiatives and community partnerships with organizations such as 2-1-1

  6. Environmental Assessment for the Independent Waste Handling Facility, 211-F at the Savannah River Site

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-08-01

    Currently, liquid Low Activity Waste (LAW) and liquid High Activity Waste (HAW) are generated from various process operational facilities/processes throughout the Savannah River Site (SRS) as depicted on Figure 2-1. Prior to storage in the F-Area tank farm, these wastes are neutralized and concentrated to minimize their volume. The Waste Handling Facility (211-3F) at Building 211-F Complex (see Figure 2-2) is the only existing facility onsite equipped to receive acidic HAW for neutralization and volume reduction processing. Currently, Building 221-F Canyon (see Figure 2-2) houses the neutralization and evaporation facilities for HAW volume reduction and provides support services such as electric power and plant, process, and instrument air, waste transfer capabilities, etc., for 21 1-F operations. The future plan is to deactivate the 221-F building. DOE`s purpose is to be able to process the LAW/HAW that will continue to be generated on site. DOE needs to establish an alternative liquid waste receipt and treatment capability to support site facilities with a continuing mission. The desire is for Building 211-F to provide the receipt and neutralization functions for LAW and HAW independent of 221-F Canyon. The neutralization capability is required to be part of the Nuclear Materials Stabilization Programs (NMSP) facilities since the liquid waste generated by the various site facilities is acidic. Tn order for Waste Management to receive the waste streams, the solutions must be neutralized to meet Waste Management`s acceptance criteria. The Waste Management system is caustic in nature to prevent corrosion and the subsequent potential failure of tanks and associated piping and hardware.

  7. 6,7-Bismethoxy-2,11-dihydroxytetraphenylene Derived Macrocycles: Synthesis, Structures, and Complexation with Fullerenes.

    Science.gov (United States)

    Deng, Chun-Lin; Xiong, Xiao-Dong; Chik, David T W; Cai, Zongwei; Peng, Xiao-Shui; Wong, Henry N C

    2015-11-01

    6,7-Bismethoxy-2,11-dihydroxytetraphenylene (1), a novel building block of tetraphenylene-derived macrocycles, was synthesized via palladium-catalyzed cross-coupling reactions and characterized by X-ray diffraction. The relevant macrocyclic hosts derived from 1 have well-defined structures with fixed conformations both in solution and solid state. They showed efficient and unique properties toward complexation with fullerenes C60 and C70 in toluene. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  8. Update on the 2+1+1 flavor QCD equation of state with HISQ

    CERN Document Server

    Bazavov, A; DeTar, C; Foley, J; Gottlieb, Steven; Heller, U M; Hetrick, J E; Laiho, J; Levkova, L; Osborn, J; Sugar, R; Toussaint, D; Van de Water, R S; Zhou, R

    2013-01-01

    We present recent results on the QCD equation of state with 2+1+1 flavors of highly improved staggered quarks (HISQ). We focus on three sets of ensembles with temporal extent 6, 8 and 10, that reach up to temperatures of 967, 725 and 580 MeV, respectively. The strange and charm quark masses are tuned to the physical values and the light quarks mass is set to one fifth of the strange. This corresponds to a Goldstone pion of about 300 MeV.

  9. Low lying baryon spectrum with N{sub f}=2+1+1 dynamical twisted quarks

    Energy Technology Data Exchange (ETDEWEB)

    Drach, Vincent; Jansen, Karl [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany). John von Neumann-Inst. fuer Computing NIC; Carbonell, Jaume; Papinutto, Mauro [UJF, CNRS/IN2P3, INPG (France). Lab. de Physique Subatomique et de Cosmologie; Alexandrou, Constantia [Cyprus Univ., Nicosia (Cyprus). Dept. of Physics

    2010-12-15

    We present first results on the octet and decuplet strange baryon spectrum with N{sub f}=2+1+1 twisted mass quarks. We use an Osterwalder Seiler valence strange quark with a mass tuned to the kaon and compare the results with those obtained in the unitary setup. This comparison allows to perform a first study of the lattice artefacts introduced by the mixed action approach. We investigate the effect of the strange and charm quarks in the sea by using two lattice spacings and comparing with preceding N{sub f}=2 twisted mass fermion calculations. (orig.)

  10. Derivation of Soil Screening Guidelines for Gross Alpha/Beta Radioactivity for United States Air Force Deployment Sites

    Science.gov (United States)

    2007-04-19

    the emission of 7 alpha particles and 4 beta particles. Three radionuclides ( francium -223, astatine-215, and polonium-211) are not listed below...no no Uranium-233 159,200 y alpha yes no Thorium-229 7,300 y alpha yes no Radium-225 14.9 d beta no no Actinium-225 10.0 d alpha no no Francium

  11. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  12. 42 CFR 137.211 - How does a Self-Governance Tribe learn whether self-governance activities have resulted in...

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false How does a Self-Governance Tribe learn whether self-governance activities have resulted in savings as described in § 137.210. 137.211 Section 137.211 Public... OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Operational Provisions Savings § 137.211 How does...

  13. 48 CFR 211.274-4 - Policy for reporting of Government-furnished equipment in the DoD Item Unique Identification...

    Science.gov (United States)

    2010-10-01

    ... DEFENSE ACQUISITION PLANNING DESCRIBING AGENCY NEEDS Using and Maintaining Requirements Documents 211.274... contract state otherwise; (b) Government-furnished material; (c) Reparables; (d) Contractor-acquired...

  14. Lattice QCD with Nf=2+1+1 domain-wall quarks

    Directory of Open Access Journals (Sweden)

    Yu-Chih Chen

    2017-04-01

    Full Text Available We perform hybrid Monte Carlo simulation of (2+1+1-flavors lattice QCD with the optimal domain-wall fermion (which has the effective 4D Dirac operator exactly equal to the Zolotarev optimal rational approximation of the overlap Dirac operator. The gauge ensemble is generated on the 323×64 lattice with the extent Ns=16 in the fifth dimension, and with the plaquette gauge action at β=6/g2=6.20. The lattice spacing (a≃0.063 fm is determined by the Wilson flow, using the value t0=0.1416(8 fm obtained by the MILC Collaboration for the (2+1+1-flavors QCD. The masses of s and c quarks are fixed by the masses of the vector mesons ϕ(1020 and J/ψ(3097 respectively; while the mass of the u/d quarks is heavier than their physical values, with the unitary pion mass Mπ≃280 MeV (and MπL≃3. We compute the point-to-point quark propagators, and measure the time-correlation functions of meson and baryon interpolators. Our results of the mass spectra of the lowest-lying hadrons containing s and c quarks are in good agreement with the high energy experimental values, together with the predictions of the charmed baryons which have not been observed in experiments.

  15. In-beam γ -ray spectroscopy of low- and medium-spin levels in 211Po

    Science.gov (United States)

    Slotte, J. M. K.; Granholm, P.; Öhman, R.; Lönnroth, T.; Juutinen, S.; Suhonen, J.; Jones, P. M.; Julin, R.; Pakarinen, J.; Rahkila, P.; Scholey, C.; Sorri, J.; Uusitalo, J.

    2017-10-01

    The structure of the low- and medium-spin levels of the 211Po nucleus have been studied with in-beam γ -ray spectroscopy with the 208Pb(α ,n )211Po fusion-evaporation reaction. The level scheme was further extended with levels of the configurations π (h9/2) 2+-4+ 2⊗ν g9 /2 , π (h9/2) 8+2⊗ν g9 /2 , π (h9/2) 2+-4+ 2⊗ν i11 /2 , π (h9/2) 2+-4+ 2⊗ν j15 /2 , π (h9/2f7/2) 8+⊗ν g9 /2 , and π (h9/2) 0+2⊗ν (g9/2) 0+2(s1/2) -1 . The single-particle neutron states ν d5 /2 and ν s1 /2 were also identified. Furthermore, a number of states feeding the low-spin structures were added.

  16. Characterization of (211) and (100) CdTe Layers Grown on Si Substrates by Metalorganic Vapor-Phase Epitaxy

    Science.gov (United States)

    Yasuda, K.; Niraula, M.; Kojima, M.; Kitagawa, S.; Tsubota, S.; Yamaguchi, T.; Ozawa, J.; Agata, Y.

    2017-11-01

    Single-crystal (211) and (100) CdTe layers have been grown by metalorganic vapor-phase epitaxy using the same condition on (211) and (100) Si substrates, respectively. Prior to the growth, substrates of both orientations were pretreated using the same pretreatment procedure. The crystal qualities of the grown layers were evaluated by full-width at half-maximum values of double-crystal x-ray rocking curves, and photoluminescence spectra at 4.2 K. (211) CdTe layers showed better crystallinity than (100) layers. The crystal quality of the (100) CdTe layers was also compared with that of layers grown on an epitaxial (100) GaAs layer on Si substrate. The results suggest that (100) CdTe layers with improved crystal quality could be obtained by optimizing the procedure of the Si substrates.

  17. Synthesis of trapezohedral indium oxide nanoparticles with high-index {211} facets and high gas sensing activity.

    Science.gov (United States)

    Han, Xiguang; Han, Xiao; Sun, Linqiang; Gao, Shengguang; Li, Liang; Kuang, Qin; Xie, Zhaoxiong; Wang, Chao

    2015-06-14

    Nanocrystals with high-index facets usually exhibit higher catalytic activities than those with only low-index facets. Trapezohedron-shaped (TS) In2O3 particles with exposed high-index {211} facets were successfully synthesized in an oleic acid (OA) and trioctylamine (TOA) system. It has been demonstrated that the gas sensing activity of TS In2O3 particles with exposed high-index {211} facets is higher than that of octahedron-shaped In2O3 particles with exposed low-index {111} facets.

  18. Domain-wall lattices in the Te-W(211) system

    Science.gov (United States)

    Stolzenberg, M.; Lyuksyutov, I.; Bauer, E.

    1990-12-01

    The adsorbate-substrate system Te-W(211) is studied in the temperature and coverage range 100

  19. Baryon spectrum using Nf=2+1+1 ensembles of twisted mass fermions

    CERN Document Server

    Alexandrou, C; Hadjiyiannakou, K; Jansen, K; Kallidonis, C; Koutsou, G

    2014-01-01

    We present results on the masses of the low-lying baryons using ten ensembles of gauge configurations with $N_f =2+1+1$ dynamical twisted mass fermions, at three values of the lattice spacing, spanning a pion mass range from about 210 MeV to about 430 MeV. The strange and charm quark masses are tuned to approximately their physical values. We examine isospin symmetry breaking effects on the baryon mass and the dependence on the lattice spacing. After taking the continuum limit we use chiral perturbation theory to extrapolate to the physical vlaue of the pion mass for all forty baryons. We provide predictions for the masses of doubly and triply charmed baryons that have not yet been measured experimentally.

  20. Properties of pseudoscalar flavour-singlet mesons from 2+1+1 twisted mass lattice QCD

    Energy Technology Data Exchange (ETDEWEB)

    Cichy, Krzysztof [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany). John von Neumann-Inst. fuer Computing NIC; Poznan Univ. (Poland). Faculty of Physics; Drach, Vincent; Garcia Ramos, Elena; Jansen, Karl [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany). John von Neumann-Inst. fuer Computing NIC; Michael, Chris [Liverpool Univ. (United Kingdom). Dept. of Mathematical Sciences; Ottnad, Konstantin; Urbach, Carsten; Zimmermann, Falk [Bonn Univ. (Germany). Inst. fuer Strahlen- und Kernphysik

    2012-11-15

    We study properties of pseudoscalar flavour-singlet mesons from Wilson twisted mass lattice QCD with N{sub f}=2+1+1 dynamical quark flavors. Results for masses are presented at three values of the lattice spacing and light quark masses corresponding to values of the pion mass from 230 MeV to 500 MeV. We briefly discuss scaling effects and the light and strange quark mass dependence of M{sub {eta}}. In addition we present an exploratory study using Osterwalder-Seiler type strange and charm valence quarks. This approach avoids some of the complications of the twisted mass heavy doublet. We present first results for matching valence and unitary actions and a comparison of statistical uncertainties.

  1. Antidepressant effects of curcumin and HU-211 coencapsulated solid lipid nanoparticles against corticosterone-induced cellular and animal models of major depression.

    Science.gov (United States)

    He, Xiaolie; Zhu, Yanjing; Wang, Mei; Jing, Guoxin; Zhu, Rongrong; Wang, Shilong

    Major depression is a complex neuropsychiatric disorder with few treatment approaches. The use of nontargeted antidepressants induced many side effects with their low efficacy. A more precise targeting strategy is to develop nanotechnology-based drug delivery systems; hence, we employed solid lipid nanoparticles (SLNs) to encapsulate HU-211 and curcumin (Cur). The antidepressant effects of the dual-drug nanoparticles (Cur/SLNs-HU-211) for major depression treatment were investigated in corticosterone-induced cellular and animal models of major depression. Cur/SLNs-HU-211 can effectively protect PC12 cells from corticosterone-induced apoptosis and can release more dopamine, which may be associated with the higher uptake of Cur/SLNs-HU-211 shown by cellular uptake behavior analysis. Additionally, Cur/SLNs-HU-211 significantly reduced the immobility time in forced swim test, enhanced fall latency in rotarod test, and improved the level of dopamine in mice blood. Cur/SLNs-HU-211 can deliver more Cur to the brain and thus produce a significant increase in neurotransmitters level in brain tissue, especially in the hippocampus and striatum. The results of Western blot and immunofluorescence revealed that Cur/SLNs-HU-211 can significantly enhance the expression of CB1, p-MEK1, and p-ERK1/2. Our study suggests that Cur/SLNs-HU-211 may have great potential for major depression treatment.

  2. In vivo chlorine and sodium MRI of rat brain at 21.1 T

    Science.gov (United States)

    Elumalai, Malathy; Kitchen, Jason A.; Qian, Chunqi; Gor’kov, Peter L.; Brey, William W.

    2017-01-01

    Object MR imaging of low-gamma nuclei at the ultrahigh magnetic field of 21.1 T provides a new opportunity for understanding a variety of biological processes. Among these, chlorine and sodium are attracting attention for their involvement in brain function and cancer development. Materials and methods MRI of 35Cl and 23Na were performed and relaxation times were measured in vivo in normal rat (n = 3) and in rat with glioma (n = 3) at 21.1 T. The concentrations of both nuclei were evaluated using the center-out back-projection method. Results T1 relaxation curve of chlorine in normal rat head was fitted by bi-exponential function (T1a = 4.8 ms (0.7) T1b = 24.4 ± 7 ms (0.3) and compared with sodium (T1 = 41.4 ms). Free induction decays (FID) of chlorine and sodium in vivo were bi-exponential with similar rapidly decaying components of T2a∗=0.4 ms and T2a∗=0.53 ms, respectively. Effects of small acquisition matrix and bi-exponential FIDs were assessed for quantification of chlorine (33.2 mM) and sodium (44.4 mM) in rat brain. Conclusion The study modeled a dramatic effect of the bi-exponential decay on MRI results. The revealed increased chlorine concentration in glioma (~1.5 times) relative to a normal brain correlates with the hypothesis asserting the importance of chlorine for tumor progression. PMID:23748497

  3. Copy number variation at 1q21.1 associated with neuroblastoma.

    Science.gov (United States)

    Diskin, Sharon J; Hou, Cuiping; Glessner, Joseph T; Attiyeh, Edward F; Laudenslager, Marci; Bosse, Kristopher; Cole, Kristina; Mossé, Yaël P; Wood, Andrew; Lynch, Jill E; Pecor, Katlyn; Diamond, Maura; Winter, Cynthia; Wang, Kai; Kim, Cecilia; Geiger, Elizabeth A; McGrady, Patrick W; Blakemore, Alexandra I F; London, Wendy B; Shaikh, Tamim H; Bradfield, Jonathan; Grant, Struan F A; Li, Hongzhe; Devoto, Marcella; Rappaport, Eric R; Hakonarson, Hakon; Maris, John M

    2009-06-18

    Common copy number variations (CNVs) represent a significant source of genetic diversity, yet their influence on phenotypic variability, including disease susceptibility, remains poorly understood. To address this problem in human cancer, we performed a genome-wide association study of CNVs in the childhood cancer neuroblastoma, a disease in which single nucleotide polymorphism variations are known to influence susceptibility. We first genotyped 846 Caucasian neuroblastoma patients and 803 healthy Caucasian controls at approximately 550,000 single nucleotide polymorphisms, and performed a CNV-based test for association. We then replicated significant observations in two independent sample sets comprised of a total of 595 cases and 3,357 controls. Here we describe the identification of a common CNV at chromosome 1q21.1 associated with neuroblastoma in the discovery set, which was confirmed in both replication sets. This CNV was validated by quantitative polymerase chain reaction, fluorescent in situ hybridization and analysis of matched tumour specimens, and was shown to be heritable in an independent set of 713 cancer-free parent-offspring trios. We identified a previously unknown transcript within the CNV that showed high sequence similarity to several neuroblastoma breakpoint family (NBPF) genes and represents a new member of this gene family (NBPF23). This transcript was preferentially expressed in fetal brain and fetal sympathetic nervous tissues, and the expression level was strictly correlated with CNV state in neuroblastoma cells. These data demonstrate that inherited copy number variation at 1q21.1 is associated with neuroblastoma and implicate a previously unknown neuroblastoma breakpoint family gene in early tumorigenesis of this childhood cancer.

  4. Hydrodeoxygenation of Phenol to Benzene and Cyclohexane on Rh(111) and Rh(211) Surfaces: Insights from Density Functional Theory

    DEFF Research Database (Denmark)

    Garcia-Pintos, Delfina; Voss, Johannes; Jensen, Anker Degn

    2016-01-01

    Herein we describe the C-O cleavage of phenol and cyclohexanol over Rh (111) and Rh (211) surfaces using density functional theory calculations. Our analysis is complemented by a microkinetic model of the reactions, which indicates that the C-O bond cleavage of cyclohexanol is easier than that of...

  5. Role of miR-211 in Neuronal Differentiation and Viability: Implications to Pathogenesis of Alzheimer’s Disease

    Science.gov (United States)

    Fan, Chunying; Wu, Qi; Ye, Xiaoyang; Luo, Hongxue; Yan, Dongdong; Xiong, Yi; Zhu, Haili; Diao, Yarui; Zhang, Wei; Wan, Jun

    2016-01-01

    Alzheimer’s disease (AD) is an age-related irreversible neurodegenerative disorder characterized by extracellular β Amyloid(Aβ) deposition, intracellular neurofibrillary tangles and neuronal loss. The dysfunction of neurogenesis and increased degeneration of neurons contribute to the pathogenesis of AD. We now report that miR-211-5p, a small non-coding RNA, can impair neurite differentiation by directly targeting NUAK1, decrease neuronal viability and accelerate the progression of Aβ-induced pathologies. In this study, we observed that during embryonic development, the expression levels of miR-211-5p were down-regulated in the normal cerebral cortexes of mice. However, in APPswe/PS1ΔE9 double transgenic adult mice, it was up-regulated from 9 months of age compared to that of the age-matched wild type mice. Studies in primary cortical neuron cultures demonstrated that miR-211-5p can inhibit neurite growth and branching via NUAK1 repression and decrease mature neuron viability. The impairments were more obvious under the action of Aβ. Our data showed that miR-211-5p could inhibit cortical neuron differentiation and survival, which may contribute to the synaptic failure, neuronal loss and cognitive dysfunction in AD. PMID:27458373

  6. Final Evaluation Report for the C.S. 211 Bilingual Gifted and Talented Program 1978-1979.

    Science.gov (United States)

    Brumberg, Stephan F.; Toledo, Victor

    This report provides a program description and evaluation findings of a bilingual program for gifted and talented children conducted at C.S. 211, an elementary school serving black and Hispanic children in an economically deprived area of the Bronx, New York. The program's goals, which included above grade level reading and mathematics performance…

  7. Anti-CD45 radioimmunotherapy using 211At with bone marrow transplantation prolongs survival in a disseminated murine leukemia model

    Energy Technology Data Exchange (ETDEWEB)

    Orozco, Johnnie J.; Back, Tom; Kenoyer, Aimee L.; Balkin, Ethan R.; Hamlin, Donald K.; Wilbur, D. Scott; Fisher, Darrell R.; Frayo, Shani; Hylarides, Mark; Green, Damian J.; Gopal, Ajay K.; Press, Oliver W.; Pagel, John M.

    2013-05-15

    Anti-CD45 Radioimmunotherapy using an Alpha-Emitting Radionuclide 211At Combined with Bone Marrow Transplantation Prolongs Survival in a Disseminated Murine Leukemia Model ABSTRACT Despite aggressive chemotherapy combined with hematopoietic cell transplant (HCT), many patients with acute myeloid leukemia (AML) relapse. Radioimmunotherapy (RIT) using antibodies (Ab) labeled primarily with beta-emitting radionuclides has been explored to reduce relapse.

  8. 76 FR 40217 - Airworthiness Directives; Rolls-Royce plc (RR) RB211-524 Series Turbofan Engines

    Science.gov (United States)

    2011-07-08

    ...; AD 2011-13-01] RIN 2120-AA64 Airworthiness Directives; Rolls-Royce plc (RR) RB211-524 Series Turbofan... plc (RR): Amendment 39-16724; Docket No. FAA- 2011-0624; Directorate Identifier 2010-NE-11-AD.... (2) For service information identified in this AD, contact Rolls-Royce plc, P.O. Box 31, Derby, DE24...

  9. 75 FR 801 - Airworthiness Directives; Rolls-Royce plc RB211-Trent 500, 700, and 800 Series Turbofan Engines

    Science.gov (United States)

    2010-01-06

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Rolls-Royce plc... airworthiness directive (AD) for Rolls-Royce plc RB211-Trent 800 series turbofan engines. That AD currently... through Friday, except Federal holidays. Fax: (202) 493-2251. Contact Rolls-Royce plc, P.O. Box 31, DERBY...

  10. 75 FR 58290 - Airworthiness Directives; Rolls-Royce plc RB211 Trent 700 and Trent 800 Series Turbofan Engines

    Science.gov (United States)

    2010-09-24

    ...-27-AD; Amendment 39-16446; AD 2010-20-11] RIN 2120-AA64 Airworthiness Directives; Rolls-Royce plc...-Royce plc: Amendment 39-16446. Docket No. FAA- 2010-0364; Directorate Identifier 2009-NE-27-AD...) None. Applicability (c) This AD applies to Rolls-Royce plc model (RR) RB211 Trent 768-60, 772-60, 772B...

  11. 75 FR 15326 - Airworthiness Directives; Rolls-Royce plc RB211-Trent 500, 700, and 800 Series Turbofan Engines

    Science.gov (United States)

    2010-03-29

    ... plc RB211-Trent 500, 700, and 800 Series Turbofan Engines AGENCY: Federal Aviation Administration (FAA...., West Building Ground Floor, Room W12-140, Washington, DC 20590- 0001. Contact Rolls-Royce plc, P.O. Box...-16092 (74 FR 62222, November 27, 2009), with a proposed AD. The proposed AD applies to Rolls-Royce plc...

  12. 75 FR 61361 - Airworthiness Directives; Rolls-Royce plc (RR) RB211-535 Series Turbofan Engines

    Science.gov (United States)

    2010-10-05

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Rolls-Royce plc (RR...-Royce plc., P.O. Box 31, Derby, DE24 8BJ, United Kingdom; Telephone: 011 44 1332 242424, Fax: 011 44... docket. Relevant Service Information Rolls-Royce plc has issued Alert Service Bulletin (ASB) RB.211-72...

  13. 75 FR 17630 - Airworthiness Directives; Rolls-Royce plc RB211 Trent 700 and Trent 800 Series Turbofan Engines

    Science.gov (United States)

    2010-04-07

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Rolls-Royce plc...-Royce plc has issued Alert Service Bulletin RB.211-72-AG086, dated December 4, 2008. The actions.... 39.13 2. The FAA amends Sec. 39.13 by adding the following new AD: Rolls-Royce plc: Docket No. FAA...

  14. Mutations in the Arabidopsis AtMRS2-11/AtMGT10/VAR5 Gene Cause Leaf Reticulation

    Directory of Open Access Journals (Sweden)

    Shuang Liang

    2017-11-01

    Full Text Available In higher plants, the development of functional chloroplasts is essential for photosynthesis and many other physiological processes. With a long-term goal of elucidating the genetic regulation of chloroplast development, we identified two allelic leaf variegation mutants, variegated5-1 (var5-1 and var5-2. Both mutants showed a distinct leaf reticulation phenotype of yellow paraveinal regions and green interveinal regions, and the leaf reticulation phenotype correlated with photosynthetic defects. Through the identification of mutation sites in the two mutant alleles and the molecular complementation, we confirmed that VAR5 encodes a CorA family of Mg2+ transporters also known as AtMRS2-11/AtMGT10. Using protoplast transient expression and biochemical fractionation assays, we demonstrated that AtMRS2-11/AtMGT10/VAR5 likely localizes to the chloroplast envelope. Moreover, we established that AtMRS2-11/AtMGT10/VAR5 forms large molecular weight complexes in the chloroplast and the sizes of these complexes clearly exceed those of their bacterial counterparts, suggesting the compositions of CorA Mg2+ transporter complex is different between the chloroplast and bacteria. Our findings indicate that AtMRS2-11/AtMGT10/VAR5 plays an important role in the tissue specific regulation of chloroplast development.

  15. 18 CFR 292.211 - Petition for initial determination on whether a project has a substantial adverse effect on the...

    Science.gov (United States)

    2010-04-01

    ... determination on whether a project has a substantial adverse effect on the environment (AEE petition). 292.211... (AEE petition). (a) An applicant that has filed a petition under § 292.210 may also file an AEE... filing of the AEE petition does not relieve the applicant of the filing requirements of § 292.208(c). (c...

  16. Inherent point defects at the thermal higher-Miller index (211)Si/SiO{sub 2} interface

    Energy Technology Data Exchange (ETDEWEB)

    Iacovo, S.; Stesmans, A., E-mail: andre.stesmans@fys.kuleuven.be [Department of Physics and Astronomy, University of Leuven, 3001 Leuven (Belgium)

    2014-12-29

    Electron spin resonance (ESR) studies were carried out on the higher-Miller index (211)Si/SiO{sub 2} interface thermally grown in the temperature range T{sub ox} = 400–1066 °C to assess interface quality in terms of inherently incorporated point defects. This reveals the presence predominantly of two species of a P{sub b}-type interface defect (interfacial Si dangling bond), which, based on pertinent ESR parameters, is typified as P{sub b0}{sup (211)} variant, close to the P{sub b0} center observed in standard (100)Si/SiO{sub 2}—known as utmost detrimental interface trap. T{sub ox} ≳ 750 °C is required to minimize the P{sub b0}{sup (211)} defect density (∼4.2 × 10{sup 12 }cm{sup −2}; optimized interface). The data clearly reflect the non-elemental nature of the (211)Si face as an average of (100) and (111) surfaces. It is found that in oxidizing (211)Si at T{sub ox} ≳ 750 °C, the optimum Si/SiO{sub 2} interface quality is retained for the two constituent low-index (100) and (111) faces separately, indicating firm anticipating power for higher-index Si/SiO{sub 2} interfaces in general. It implies that, as a whole, the quality of a thermal higher-index Si/SiO{sub 2} interface can never surmount that of the low-index (100)Si/SiO{sub 2} structure.

  17. Preparation and in vivo evaluation of a novel stabilized linker for {sup 211}At labeling of protein

    Energy Technology Data Exchange (ETDEWEB)

    Talanov, Vladimir S. [Radiation Oncology Branch, Center for Cancer Research, National Cancer Institute, National Institutes of Health, Bethesda, MD 20892 (United States)]. E-mail: vstalanov@msrce.howard.edu; Garmestani, Kayhan [Metabolism Branch, Center for Cancer Research, National Cancer Institute, National Institutes of Health, Bethesda, MD 20892 (United States); Regino, Celeste A.S. [Radiation Oncology Branch, Center for Cancer Research, National Cancer Institute, National Institutes of Health, Bethesda, MD 20892 (United States); Milenic, Diane E. [Radiation Oncology Branch, Center for Cancer Research, National Cancer Institute, National Institutes of Health, Bethesda, MD 20892 (United States); Plascjak, Paul S. [Department of Nuclear Medicine, Clinical Center, National Institutes of Health, Bethesda, MD 20892 (United States); Waldmann, Thomas A. [Metabolism Branch, Center for Cancer Research, National Cancer Institute, National Institutes of Health, Bethesda, MD 20892 (United States); Brechbiel, Martin W. [Radiation Oncology Branch, Center for Cancer Research, National Cancer Institute, National Institutes of Health, Bethesda, MD 20892 (United States)]. E-mail: martinwb@mail.nih.gov

    2006-05-15

    Significant improvement of in vivo stability of {sup 211}At-labeled radioimmunoconjugates achieved upon employment of a recently reported new linker, succinimidyl N-2-(4-[{sup 211}At]astatophenethyl)succinamate (SAPS), prompted additional studies of its chemistry. The {sup 211}At radiolabeling of succinimidyl N-2-(4-tributylstannylphenethyl)succinamate (1) was noted to decline after storage at -15{sup o}C for greater than 6 months. Compound 1 was found to degrade via a ring closure reaction with the formation of N-2-(4-tributylstannylphenethyl)succinimide (3), and a modified procedure for the preparation of 1 was developed. The N-methyl structural analog of 1, succinimidyl N-2-(4-tributylstannylphenethyl)-N-methyl succinamate (SPEMS), was synthesized to investigate the possibility of improving the stability of reagent-protein linkage chemistry. Radiolabeling of SPEMS with {sup 211}At generates succinimidyl N-2-(4-[{sup 211}At]astatophenethyl)-N-methyl succinamate (Methyl-SAPS), with yields being consistent for greater than 1 year. Radiolabelings of 1 and SPEMS with {sup 125}I generated succinimidyl N-2-(4-[{sup 125}I]iodophenethyl)succinamate (SIPS) and succinimidyl N-2-(4-[{sup 125}I]iodophenethyl)-N-methyl succinamate (Methyl-SIPS), respectively, and showed no decline in yields. Methyl-SAPS, SAPS, Methyl-SIPS and SIPS were conjugated to Herceptin for a comparative assessment in LS-174T xenograft-bearing mice. The conjugates of Herceptin with Methyl-SAPS or Methyl-SIPS demonstrated immunoreactivity equivalent to if not superior to the SAPS and SIPS paired analogs. The in vivo studies also revealed that the N-methyl modification resulted in a superior statinated product.

  18. Preparing a journey to the east of {sup 208}Pb with ISOLTRAP: Isobaric purification at A = 209 and new masses for {sup 211-213}Fr and {sup 211}Ra

    Energy Technology Data Exchange (ETDEWEB)

    Kowalska, M.; Herlert, A. [CERN, Physics Department, Geneva 23 (Switzerland); Naimi, S.; Audi, G.; Lunney, D.; Minaya-Ramirez, E. [Universite de Paris Sud, CSNSM-IN2P3-CNRS, Orsay (France); Agramunt, J.; Estevez, E.; Rubio, B. [CSIC-Universidad de Valencia, IFIC, Valencia (Spain); Algora, A. [CSIC-Universidad de Valencia, IFIC, Valencia (Spain); Institute of Nuclear Research of the Hungarian Academy of Sciences, Debrecen (Hungary); Beck, D.; Herfurth, F. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Blank, B. [Universite Bordeaux 1/CNRS/IN2P3, CENBG, Gradignan Cedex (France); Blaum, K.; Boehm, C.; Kellerbauer, A.; Neidherr, D.; Warring, U. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Breitenfeldt, M.; Rosenbusch, M.; Schweikhard, L. [Ernst-Moritz-Arndt-Universitaet, Institut fuer Physik, Greifswald (Germany); Fraile, L.M.; Olaizola, B. [Universidad Complutense, Departamento de Fisica Atomica, Molecular y Nuclear, Madrid (Spain); George, S. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Johannes Gutenberg-Universitaet, Institut fuer Physik, Mainz (Germany); Riisager, K. [University of Aarhus, Department of Physics and Astronomy, Aarhus (Denmark); Schwarz, S. [Michigan State University, NSCL, East Lansing, MI (United States)

    2009-12-15

    With the Penning trap mass spectrometer ISOLTRAP, located at ISOLDE/CERN, preparatory work has been performed towards mass and decay studies on neutron-rich Hg and Tl isotopes beyond N=126. The properties of these isotopes are not well known because of large isobaric contamination coming mainly from surface-ionised Fr. Within the studies, production tests using several target-ion source combinations were performed. It was furthermore demonstrated around mass number A=209 that the resolving power required to purify Fr is achievable with ISOLTRAP. In addition, masses of several isobaric contaminants, {sup 211-213}Fr and {sup 211}Ra, were determined with a three-fold improved precision. The results influence masses of more than 20 other nuclides in the {sup 208}Pb region. (orig.)

  19. Linear hygrothermal viscoelastic characterization of Nafion NRE 211 proton exchange membrane

    Energy Technology Data Exchange (ETDEWEB)

    Patankar, K.A. [Macromolecular Science and Engineering, Virginia Polytechnic Institute and State University, Blacksburg, VA (United States); Dillard, D.A.; Case, S.W. [Engineering Science and Mechanics Department, Virginia Polytechnic Institute and State University, Blacksburg, VA (United States); Ellis, M.W. [Mechanical Engineering Department, Virginia Polytechnic Institute and State University, Blacksburg, VA (United States); Lai, Y.H.; Gittleman, C.S. [Fuel Cell Research Laboratory, General Motors Corporation, Honeoye Falls, NY (United States)

    2012-10-15

    The tensile relaxation modulus of a commercially available proton exchange membrane, Nafion registered NRE 211, was obtained over a range of humidity levels and temperatures using a commercial dynamic mechanical analyzer (DMA). Hygral stress relaxation master curves were first constructed, followed by a hygrothermal master curve using the time temperature moisture superposition principle. The hygrothermal master curve was fitted using a 10-term Prony series and validated using longer term stress relaxation tests. To validate the results from the stress relaxation experiments, short and long-term creep compliance was converted into stress relaxation modulus using a well-known viscoelastic conversion formula, and compared with the relaxation modulus obtained under identical conditions. Good agreement was found between the two datasets. It was evident that relaxation data at 2% RH at the test temperatures was not superposable with the master curves obtained at higher relative humidity (10% < RH < 90%) at the temperature range 70 C < T < 90 C. It was observed that the longer term relaxation modulus under humid conditions matched well with the hygrothermal master curve; however, the longer term relaxation modulus under dry conditions was significantly higher than the relaxation master curve obtained under dry conditions, raising the possibility of a physical aging process in the ionomer and/or irreversible morphological changes in the membrane under dry conditions. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  20. The Neutron Electric Dipole Moment using $N_f{=}2{+}1{+}1$ twisted mass fermions

    CERN Document Server

    Alexandrou, C; Constantinou, M; Hadjiyiannakou, K; Jansen, K; Koutsou, G; Ottnad, K; Petschlies, M

    2015-01-01

    We evaluate the neutron electric dipole moment $\\vert\\vec{d}_N\\vert$ using lattice QCD techniques. The gauge configurations analysed are produced by the European Twisted Mass Collaboration using $N_f{=}2{+}1{+}1$ twisted mass fermions at one value of the lattice spacing of $a \\simeq 0.082 \\ {\\rm fm}$ and a light quark mass corresponding to $m_{\\pi} \\simeq 373 \\ {\\rm MeV}$. Our approach to extract the neutron electric dipole moment is based on the calculation of the $CP$-odd electromagnetic form factor $F_3(Q^2)$ for small values of the vacuum angle $\\theta$ in the limit of zero Euclidean momentum transfer $Q^2$. The limit $Q^2 \\to 0$ is realised either by adopting a parameterization of the momentum dependence of $F_3(Q^2)$ and performing a fit, or by employing new position space methods, which involve the elimination of the kinematical momentum factor in front of $F_3(Q^2)$. The computation in the presence of a $CP$-violating term requires the evaluation of the topological charge ${\\cal Q}$. This is computed ...

  1. Parent-reported problems in 211 adopted children: some risk and protective factors.

    Science.gov (United States)

    Howe, D

    1997-05-01

    Parents of 211 adopted children, now young adults, were interviewed about their children's behaviour and development during childhood and adolescence. The children were placed for adoption at different ages. The quality of children's pre-placement care also varied, older-placed children generally experiencing adverse backgrounds prior to joining their adoptive parents. Depending on their quality of pre-placement care, the children were placed in one of three groups for the purposes of analysis: (a) baby adoptions, (b) older-children adoptions in which children had enjoyed satisfactory care as babies, and (c) older-children adoptions in which children had experienced adverse care as babies. The rate of adolescent problem behaviours varied between the three groups, with the older-children adoptions/adverse baby care group showing the highest rates. Two subgroups were identified. A quarter of the baby-adopted children were reported to have had problem behaviours during adolescence. In contrast, no problem behaviours were reported in 28% of the older-adopted/adverse baby care children. Some possible risk and protective factors are explored.

  2. Axial, Scalar and Tensor Charges of the Nucleon from 2+1+1-flavor Lattice QCD

    CERN Document Server

    Bhattacharya, Tanmoy; Cohen, Saul; Gupta, Rajan; Lin, Huey-Wen; Yoon, Boram

    2016-01-01

    We present results for the isovector axial, scalar and tensor charges $g^{u-d}_A$, $g^{u-d}_S$ and $g^{u-d}_T$ of the nucleon needed to probe the Standard Model and novel physics. The axial charge is a fundamental parameter describing the weak interactions of nucleons. The scalar and tensor charges probe novel interactions at the TeV scale in neutron and nuclear $\\beta$-decays, and the flavor-diagonal tensor charges $g^{u}_T$, $g^{d}_T$ and $g^{s}_T$ are needed to quantify the contribution of the quark electric dipole moment (EDM) to the neutron EDM. The lattice-QCD calculations were done using nine ensembles of gauge configurations generated by the MILC Collaboration using the HISQ action with 2+1+1 dynamical flavors. These ensembles span three lattice spacings $a \\approx 0.06, 0.09$ and $0.12$ fm and light-quark masses corresponding to the pion masses $M_\\pi \\approx$ 135, 225 and 315 MeV. High-statistics estimates on five ensembles using the all-mode-averaging method allow us to quantify all systematic unce...

  3. ART: Surveying the Local Universe at 2-11 keV

    Science.gov (United States)

    O'Dell, S. L.; Ramsey, B. D.; Adams, M. L.; Brandt, W. N.; Bubarev, M. V.; Hassinger, G.; Pravlinski, M.; Predehl, P.; Romaine, S. E.; Swartz, D. A.; hide

    2008-01-01

    The Astronomical Rontgen Telescope (ART) is a medium-energy x-ray telescope system proposed for the Russian-led mission Spectrum Rontgen-Gamma (SRG). Optimized for performance over the 2-11-keV band, ART complements the softer response of the SRG prime instrument-the German eROSITA x-ray telescope system. The anticipated number of ART detections is 50,000-with 1,000 heavily-obscured (N(sub H)> 3x10(exp 23)/sq cm) AGN-in the SRG 4-year all-sky survey, plus a comparable number in deeper wide-field (500 deg(sup 2) total) surveys. ART's surveys will provide a minimally-biased, nearly-complete census of the local Universe in the medium-energy x-ray band (including Fe-K lines), at CCD spectral resolution. During long (approx.100-ks) pointed observations, ART can obtain statistically significant spectral data up to about 15 keY for bright sources and medium-energy x-ray continuum and Fe-K-line spectra of AGN detected with the contemporaneous NuSTAR hard-x-ray mission.

  4. Phthalocyanine-BODIPY dye: synthesis, characterization, and utilization for pattern recognition of CYFRA 21-1 in whole blood samples.

    Science.gov (United States)

    Stefan-van Staden, Raluca-Ioana; Comnea-Stancu, Ionela Raluca; Yanık, Hülya; Göksel, Meltem; Alexandru, Anghel; Durmuş, Mahmut

    2017-08-29

    Phthalocyanine-BODIPY dye (BODIPY = boron dipyrromethene) was synthesized, fully characterized, and used for molecular recognition of CYFRA 21-1, a lung cancer biomarker, from whole blood samples. Thin films of three magnesium oxides ((MgO) n , where n = 8, 9, or 10)) were deposited on a paper substrate, and they were immersed in a solution of phthalocyanine-BODIPY dye (1.17 × 10(-3) mol/L) for the design of stochastic sensors. Limits of determination of picograms per milliliter magnitude order were recorded for the proposed stochastic sensors. CYFRA 21-1 was reliably identified and determined with recoveries higher than 95% and RSD lower than 1% in whole blood samples.

  5. Shelf-life of ɛ-lysyl-3-(trimethylstannyl)benzamide immunoconjugates, precursors for 211At labeling of antibodies

    DEFF Research Database (Denmark)

    Aneheim, Emma; Halleröd, Jenny; Albertsson, Per

    2015-01-01

    and good cell-binding property after labeling with (211)At. The stability of the conjugates was found to be pH dependent with high stability at pH≥7 and less stability at pH≤5.5. The immunoconjugates (based on trastuzumab) could be kept for more than 3 months in a phosphate buffered saline solution (pH 7...

  6. 75 FR 50877 - Airworthiness Directives; Rolls-Royce plc RB211-524C2 Series Turbofan Engines

    Science.gov (United States)

    2010-08-18

    ...-21-AD; Amendment 39-16405; AD 2010-17-13] RIN 2120-AA64 Airworthiness Directives; Rolls-Royce plc... 2. The FAA amends Sec. 39.13 by adding the following new AD: 2010-17-13 Rolls-Royce plc (Formerly.... Affected ADs (b) None. Applicability (c) This AD applies to Rolls-Royce plc (RR) model RB211-524C2-19 and...

  7. Treatment of HER2-positive breast carcinomatous meningitis with intrathecal administration of {alpha}-particle-emitting {sup 211}At-labeled trastuzumab

    Energy Technology Data Exchange (ETDEWEB)

    Boskovitz, Abraham; McLendon, Roger E.; Okamura, Tatsunori [Department of Pathology, Duke University Medical Center, Durham, NC 27710 (United States); Sampson, John H. [Department of Surgery, Duke University Medical Center, Durham, NC 27710 (United States); Bigner, Darell D. [Department of Pathology, Duke University Medical Center, Durham, NC 27710 (United States); Zalutsky, Michael R. [Department of Radiology, Duke University Medical Center, Durham, NC 27710 (United States)], E-mail: zalut001@mc.duke.edu

    2009-08-15

    Introduction: Carcinomatous meningitis (CM) is a devastating disease characterized by the dissemination of malignant tumor cells into the subarachnoid space along the brain and spine. Systemic treatment with monoclonal antibody (mAb) trastuzumab can be effective against HER2-positive systemic breast carcinoma but, like other therapies, is ineffective against CM. The goal of this study was to evaluate the therapeutic effect of {alpha}-particle emitting {sup 211}At-labeled trastuzumab following intrathecal administration in a rat model of breast carcinoma CM. Methods: Athymic rats were injected intrathecally with MCF-7/HER2-18 breast carcinoma cells through a surgically implanted indwelling intrathecal catheter. In Experiment 1, animals received 33 or 66 {mu}Ci {sup 211}At-labeled trastuzumab, cold trastuzumab or saline. In Experiment 2, animals were inoculated with a lower tumor burden and received 46 or 92 {mu}Ci {sup 211}At-labeled trastuzumab or saline. In Experiment 3, animals received 28 {mu}Ci {sup 211}At-labeled trastuzumab, 30 {mu}Ci {sup 211}At-labeled TPS3.2 control mAb or saline. Histopathological analysis of the neuroaxis was performed at the end of the study. Results: In Experiment 1, median survival increased from 21 days for the saline and cold trastuzumab groups to 45 and 48 days for 33 and 66 {mu}Ci {sup 211}At-labeled trastuzumab, respectively. In Experiment 2, median survival increased from 23 days for saline controls to 68 and 92 days for 46 and 92 {mu}Ci {sup 211}At-labeled trastuzumab, respectively. In Experiment 3, median survival increased from 20 days to 29 and 36 days for animals treated with {sup 211}At-labeled TPS3.2 and {sup 211}At-labeled trastuzumab, respectively. Long-term survivors were observed exclusively in the {sup 211}At-trastuzumab-treated groups. Conclusion: Intrathecal {sup 211}At-labeled trastuzumab shows promise as a treatment for patients with HER2-positive breast CM.

  8. MicroRNA-211-5p suppresses tumour cell proliferation, invasion, migration and metastasis in triple-negative breast cancer by directly targeting SETBP1.

    Science.gov (United States)

    Chen, Liang-Liang; Zhang, Zhou-Jing; Yi, Zhan-Bo; Li, Jian-Jun

    2017-06-27

    Triple-negative breast cancer (TNBC) accounts for 15-20% of all breast cancer in women globally. This subtype often has early and high recurrence rates, resulting in poor survival, partially due to lack of targeted therapies. To date, the detailed molecular mechanisms underlying TNBC progression are unclear. Given the crucial role of microRNAs (miRNAs) in cancer metastasis, we aimed to analyse the expression and function of a metastasis-associated miRNA named miR-211-5p in TNBC. MiRNA array analysis was performed to search for metastasis-associated miRNAs in TNBC. The miR-211-5p expression in tumour tissues, adjacent non-tumourous breast tissues of TNBC patients and cell lines were evaluated by real-time PCR. The protein expression levels were analysed by western blot, immunohistochemistry and in situ hybridisation. Luciferase reporter assays were employed to validate the target of miR-211-5p. The effect of miR-211-5p on TNBC progression was investigated in vitro and in vivo. MiR-211-5p was significantly downregulated in TNBC, and its expression level was associated with overall survival in TNBC. The expression of miR-211-5p suppressed TNBC cell proliferation, invasion, migration and metastasis in vitro and in vivo. Furthermore, SETBP1 was identified as a target of miR-211-5p. Through gain-of-function and loss-of-function studies, SETBP1 was shown to significantly affect colony and cell number in vitro. Enforced expression of miR-211-5p inhibited the expression of SETBP1 significantly and the restoration of SETBP1 expression reversed the inhibitory effects of miR-211-5p on TNBC cell proliferation and metastasis. These findings collectively demonstrate a tumour suppressor role of miR-211-5p in TNBC progression by targeting SETBP1, suggesting that miR-211-5p could serve as a potential prognostic biomarker and therapeutic target for TNBC.

  9. The Novel Long Noncoding RNA TUSC7 Inhibits Proliferation by Sponging MiR-211 in Colorectal Cancer

    Directory of Open Access Journals (Sweden)

    Jian Xu

    2017-02-01

    Full Text Available Background/Aims: The novel long noncoding RNA (lncRNA tumor suppressor candidate 7 (TUSC7 has been reported as a potential tumor suppressor, while the functional role of TUSC7 is still unknown in colorectal cancer (CRC. Here, we characterized TUSC7 expression profile in CRC patients and investigated its biological function and potential molecular mechanism. Methods: RNA isolation, qRT-PCR, cell counter kit-8 assay, cell cycle assay, EdU assay, and western blot were performed. Statistical analyses were performed using SPSS 18.0 software and p value < 0.05 was considered as statistically significant. Results: In a cohort of CRC patients, we found TUSC7 was significantly downregulated in CRC tissues compared with adjacent non-tumor tissues (P < 0.01. Patients with high expression of TUSC7 had better survival than those with low expression of TUSC7 (HR = 0.342, 95% CI: 0.120-0.972, P = 0.044. Cell count kit 8 and EdU assays showed that ectopic expression of TUSC7 in HCT116 and SW480 cells significantly inhibited cell proliferation rate. After silence of TUSC7 with small interfering RNA, cell proliferation rate increased. Flow cytometry analyses revealed cycles were arrested at G1 phase after TUSC7 overexpression. We found there were 2 binding sites of miR-211-3p within the sequence of TUSC7 and TUSC7 expression level was negatively correlated with miR-211-3p. TUSC7 overexpression increased the expression level of CDK6, which is a downstream target of miR-211-3p, in both RNA and protein level. Furthermore, luciferase reporter assay indicated that TUSC7 could sponge miR-211-3p. Conclusion: To summary, we demonstrated that TUSC7 is a potential tumor suppressor in CRC, and TUSC7 could inhibit CRC cell proliferation by completely sponging miR-211-3p.

  10. Retrospective evaluation of 211 patients with maxillofacial reconstruction using parietal bone graft for implants insertion.

    Science.gov (United States)

    Depeyre, Arnaud; Touzet-Roumazeille, Sandrine; Lauwers, Ludovic; Raoul, Gwenael; Ferri, Joel

    2016-09-01

    For a century, autologous bone grafts have been used in maxillofacial reconstruction. The ideal bone harvest site and grafting procedure remains a point of contention in regards to obtaining optimal long-term results with sufficient bone quantity and density without serious complications. More recently, confronted with growing patient requests and biomaterials development, maxillofacial surgeons and dentists have been considering these issues as they relate to pre-implant surgery. This study sought to evaluate implant success rate and complications following pre-implant surgery with parietal bone grafting. A retrospective study was carried out on patients who underwent maxillofacial reconstruction of different sites (symphysis, mandibular corpus, maxillary sinus and premaxilla) for the purpose of implant insertion. 311 procedures in 211 patients were included. The implant osseointegration rate was around 95%. Clinical follow-up ranged from 10 months to 11 years. A secondary procedure was performed in 6.1% of cases and we noted no serious complications at the harvest site. With good revascularization and osseointegration of the graft, the use of parietal bone leads to an implant success rate similar to that seen in the literature. Moreover, the use of this material results in few infections and low bone resorption provided there is strict immobilization of the graft and no tension on the soft tissue sutures. Parietal bone grafts technique possess the required qualities for the success of implant surgery, offering results at least as interesting as others using autogenous bone and with no serious complications on donor site. Copyright © 2016 European Association for Cranio-Maxillo-Facial Surgery. Published by Elsevier Ltd. All rights reserved.

  11. Kaon semileptonic decays with $N_f=2+1+1$ HISQ fermions and physical light-quark masses

    Energy Technology Data Exchange (ETDEWEB)

    Gámiz, E. [Granada U., Theor. Phys. Astrophys.; Bazavov, A. [Brookhaven; Bernard, C. [Washington U., St. Louis; DeTar, C. [Utah U.; Du, D. [Syracuse U.; El-Khadra, A. X. [Illinois U., Urbana; Freeland, E. D. [Art Inst. of Chicago; Gottlieb, Steven [Indiana U.; Heller, U. M. [APS, New York; Komijani, J. [TUM-IAS, Munich; Kronfeld, A. S. [Fermilab; Laiho, J. [Syracuse U.; Mackenzie, P. B. [Fermilab; Neil, E. T. [Colorado U.; Primer, T. [Arizona U.; Simone, J. N. [Fermilab; Sugar, R. [UC, Santa Barbara; Toussaint, D. [Arizona U.; Van de Water, R. S. [Fermilab; Zhou, Ran [Fermilab

    2016-11-13

    We discuss the reduction of errors in the calculation of the form factor $f_+^{K \\pi}(0)$ with HISQ fermions on the $N_f=2+1+1$ MILC configurations from increased statistics on some key ensembles, new data on ensembles with lattice spacings down to 0.042 fm and the study of finite-volume effects within staggered ChPT. We also study the implications for the unitarity of the CKM matrix in the first row and for current tensions with leptonic determinations of $\\vert V_{us}\\vert$.

  12. Kaon semileptonic decays with $N_f=2+1+1$ HISQ fermions and physical light-quark masses

    CERN Document Server

    Gamiz, E; Bernard, C; DeTar, C; Du, D; El-Khadra, A X; Freeland, E D; Gottlieb, Steven; Heller, U M; Komijani, J; Kronfeld, A S; Laiho, J; Mackenzie, P B; Neil, E T; Primer, T; Simone, J N; Sugar, R; Toussaint, D; Van de Water, R S; Zhou, Ran

    2016-01-01

    We discuss the reduction of errors in the calculation of the form factor $f_+^{K \\pi}(0)$ with HISQ fermions on the $N_f=2+1+1$ MILC configurations from increased statistics on some key ensembles, new data on ensembles with lattice spacings down to 0.042 fm and the study of finite-volume effects within staggered ChPT. We also study the implications for the unitarity of the CKM matrix in the first row and for current tensions with leptonic determinations of $\\vert V_{us}\\vert$.

  13. Computing K and D meson masses with N{sub f}=2+1+1 twisted mass lattice QCD

    Energy Technology Data Exchange (ETDEWEB)

    Baron, Remi [CEA, Centre de Saclay, 91 - Gif-sur-Yvette (France). IRFU/Service de Physique Nucleaire; Blossier, Benoit; Boucaud, Philippe [Paris XI Univ., 91 - Orsay (FR). Lab. de Physique Theorique] (and others)

    2010-05-15

    We discuss the computation of the mass of the K and D mesons within the framework of N{sub f}=2+1+1 twisted mass lattice QCD from a technical point of view. These quantities are essential, already at the level of generating gauge configurations, being obvious candidates to tune the strange and charm quark masses to their physical values. In particular, we address the problems related to the twisted mass flavor and parity symmetry breaking, which arise when considering a non-degenerate (c,s) doublet. We propose and verify the consistency of three methods to extract the K and D meson masses in this framework. (orig.)

  14. South-East Asia bovine populations and the Japanese cattle breeds do not harbour the E211K variant of the PRNP

    Directory of Open Access Journals (Sweden)

    George Msalya

    2014-02-01

    Full Text Available An important outcome of intensive worldwide Bovine spongiform encephalopathy (BSE obtained with the surveillance by The National Creutzfeldt-Jakob Disease Surveillance Unit (http://www.cjd.ed.ac.uk/figures. htm, has been the detection of atypical BSE in cattle. The discovery of a prion protein gene (PRNP E211K variant in an atypical BSE case is particularly remarkable because it is analogous to the most common pathogenic mutation in humans (E200K, which causes hereditary Creutzfeldt-Jakob disease (CJD. Knowledge of the distribution and frequency of PRNP E211K variants in cattle populations is critical for understanding and managing atypical BSE. This study was carried out to investigate the prevalence of the E211K variant in the South-East Asia bovine populations and in the Japanese cattle breeds. It was discovered that E211K variant was monomorphic for a G allele and the GG genotype in the 745 animals analyzed in this study. Therefore, neither the Bos indicus nor the Bos taurus animals analyzed are presently known to harbor the 211K variant predicting that the number of carriers for this variant will also be vanishingly low.

  15. Isothermal and Multithermal Analysis of Coronal Loops Observed with Atmospheric Imaging Assembly. II. 211 Å Selected Loops

    Science.gov (United States)

    Schmelz, J. T.; Worley, B. T.; Anderson, D. J.; Pathak, S.; Kimble, J. A.; Jenkins, B. S.; Saar, S. H.

    2011-09-01

    An important component of coronal loop analysis involves conflicting results on the cross-field temperature distribution. Are loops isothermal or multithermal? The Atmospheric Imaging Assembly (AIA) on board the Solar Dynamics Observatory was designed in part to answer this question. AIA has a series of coronal filters that peak at different temperatures and cover the entire active region temperature range. These properties should make AIA ideal for multithermal analysis, but recent results have shown that the response functions of two of the filters, AIA 94 and 131 Å, are missing a significant number of low-temperature emission lines. Here we analyze coronal loops from several active regions that were chosen in the 211 Å channel of AIA, which has a peak response temperature of log T = 6.3. The differential emission measure (DEM) analysis of the 12 loops in our sample reveals that using data from the 131 Å AIA filter distorts the results, and we have no choice but to do the analysis without these data. The 94 Å data do not appear to be as important, simply because the chosen loops are not visible in this channel. If we eliminate the 131 Å data, however, we find that our DEM analysis is not well constrained on the cool temperature end of six of our loops. The information revealed by our 211 selected loops indicates that additional atomic data are required in order to pin down the cross-field temperature distribution.

  16. Absorbed Doses and Risk Estimates of (211)At-MX35 F(ab')2 in Intraperitoneal Therapy of Ovarian Cancer Patients

    DEFF Research Database (Denmark)

    Cederkrantz, Elin; Andersson, Håkan; Bernhardt, Peter

    2015-01-01

    PURPOSE: Ovarian cancer is often diagnosed at an advanced stage with dissemination in the peritoneal cavity. Most patients achieve clinical remission after surgery and chemotherapy, but approximately 70% eventually experience recurrence, usually in the peritoneal cavity. To prevent recurrence...... dose associated with i.p. administration of (211)At-MX35 F(ab')2. METHODS AND MATERIALS: Patients in clinical remission after salvage chemotherapy for peritoneal recurrence of ovarian cancer underwent i.p. infusion of (211)At-MX35 F(ab')2. Potassium perchlorate was given to block unwanted accumulation...... of (211)At in thyroid and other NIS-containing tissues. Mean absorbed doses to normal tissues were calculated from clinical data, including blood and i.p. fluid samples, urine, γ-camera images, and single-photon emission computed tomography/computed tomography images. Extrapolation of preclinical...

  17. The influence of slow cooling on Y211 size and content in single-grain YBCO bulk superconductor through the infiltration-growth process

    Energy Technology Data Exchange (ETDEWEB)

    Ouerghi, A [Systems and Applied Mechanics Laboratory LASMAP, Polytechnic School of Tunisia, Rue El Kawarezmi La Marsa 743, Université de Carthage Tunis (Tunisia); Moutalbi, N., E-mail: nahed.moutalbi@yahoo.fr [Systems and Applied Mechanics Laboratory LASMAP, Polytechnic School of Tunisia, Rue El Kawarezmi La Marsa 743, Université de Carthage Tunis (Tunisia); Noudem, J.G. [CRISMAT-ENSICAEN (UMR-CNRS 6508), Université de Caen-Basse-Normandie, F-14050 Caen (France); LUSAC, Université de Caen-Basse-Normandie F-50130 Cherbourg-Octeville (France); M' chirgui, A. [Systems and Applied Mechanics Laboratory LASMAP, Polytechnic School of Tunisia, Rue El Kawarezmi La Marsa 743, Université de Carthage Tunis (Tunisia)

    2017-03-15

    Highlights: • YBCO bulk superconductors are produced by optimized Seeded Infiltration and Growth process. • The slow cooling time, in a fixed slow cooling temperature window, affects considerably the surface morphology and the bulk’s microstructure. • The Y211 particle’s size and content depend on the slow cooling time and its distribution behavior changes from one position to another. • There is an optimum slow cooling time, estimated to 88h, over which the shrinkage for both the liquid phase and the Y211 pellet is maximal, without any improvement of the crystal grain growth. • The magnetic trapped flux distribution for a given sample brings out the single grain characteristic. - Abstract: Highly textured YBa{sub 2}Cu{sub 3}O{sub 7-δ} (Y123) superconductors were produced using modified Textured Top Seeded Infiltration Growth (TSIG) process. The liquid source is made of only Y123 powder whereas the solid source is composed of Y{sub 2}BaCuO{sub 5} (Y211) powder. We aim to control the amount of liquid that infiltrates the solid pellet, which in turn controls the final amount of Y{sub 2}BaCuO{sub 5} particles in Y123 matrix. The effect of the slow cooling kinetics on sample morphology, on grain growth and on final microstructure was too investigated. It is shown that appropriate slow cooling time may also contribute to the control of the amount of Y211 inclusions in the final structure of Y123 bulk. We report herein the Y211 particle size and density distribution in the whole Y123 matrix. The present work proves that finest Y211 particles locate under the seed and that their size and density increase with distance from the seed.

  18. Transcriptional Response in Mouse Thyroid Tissue after 211At Administration: Effects of Absorbed Dose, Initial Dose-Rate and Time after Administration.

    Directory of Open Access Journals (Sweden)

    Nils Rudqvist

    Full Text Available 211At-labeled radiopharmaceuticals are potentially useful for tumor therapy. However, a limitation has been the preferential accumulation of released 211At in the thyroid gland, which is a critical organ for such therapy. The aim of this study was to determine the effect of absorbed dose, dose-rate, and time after 211At exposure on genome-wide transcriptional expression in mouse thyroid gland.BALB/c mice were i.v. injected with 1.7, 7.5 or 100 kBq 211At. Animals injected with 1.7 kBq were killed after 1, 6, or 168 h with mean thyroid absorbed doses of 0.023, 0.32, and 1.8 Gy, respectively. Animals injected with 7.5 and 100 kBq were killed after 6 and 1 h, respectively; mean thyroid absorbed dose was 1.4 Gy. Total RNA was extracted from pooled thyroids and the Illumina RNA microarray platform was used to determine mRNA levels. Differentially expressed transcripts and enriched GO terms were determined with adjusted p-value 1.5, and p-value <0.05, respectively.In total, 1232 differentially expressed transcripts were detected after 211At administration, demonstrating a profound effect on gene regulation. The number of regulated transcripts increased with higher initial dose-rate/absorbed dose at 1 or 6 h. However, the number of regulated transcripts decreased with mean absorbed dose/time after 1.7 kBq 211At administration. Furthermore, similar regulation profiles were seen for groups administered 1.7 kBq. Interestingly, few previously proposed radiation responsive genes were detected in the present study. Regulation of immunological processes were prevalent at 1, 6, and 168 h after 1.7 kBq administration (0.023, 0.32, 1.8 Gy.

  19. Fine-needle aspirates CYFRA 21-1 is a useful tumor marker for detecting axillary lymph node metastasis in breast cancer patients.

    Directory of Open Access Journals (Sweden)

    Jung Hyun Yoon

    Full Text Available INTRODUCTION: To assess whether the value of CYFRA21-1 in the aspirates of ultrasonography-guided fine-needle aspiration biopsy (US-FNAB can contribute to improving the performances of US-FNAB in the diagnosis of axillary lymph node (LN metastasis in breast cancer patients. METHODS: US-FNAB was performed in 156 axillary LNs in 152 breast cancer patients (mean age: 51.4 years, range: 17-92 years. Concentrations of CYFRA21-1 were measured from washouts of the syringe used during US-FNAB. Tumor marker concentrations, US-FNAB, intraoperative sentinel node biopsy (SNB, and surgical pathology results were reviewed and analyzed. For comparison, the values of CEA and CA15-3 were also measured from washouts. RESULTS: Among the 156 LNs, 75 (48.1% were benign, and 81 (51.9% were metastases. Mean concentrations of CYFRA21-1 were significantly higher in metastasis compared to benign LNs (P<0.001. US-FNAB combined to CYFRA21-1 showed significantly higher sensitivity, NPV, and accuracy compared to US-FNAB alone (all values P<0.05. All diagnostic indices of US-FNAB combined to CYFRA21-1 were significantly higher compared to US-FNAB combined with CEA or CA15-3 (all P<0.001. Of the 28 metastatic LNs which showed metastasis on SNB, CYFRA21-1 showed higher positive rate of 75.0% (CEA or CA15-3∶60.7%, P = 0.076. CONCLUSION: Measuring CYFRA 21-1 concentrations from US-FNAB aspirates improves sensitivity, NPV, and accuracy of US-FNAB alone, and may contribute to reducing up to 75.0% of unnecessary intraoperative SNB. Compared to CEA or CA15-3, CYFRA21-1 shows significantly higher performances when combined to US-FNAB in the preoperative diagnosis of LN metastasis in breast cancer patients.

  20. Methane dissociation on the steps and terraces of Pt(211) resolved by quantum state and impact site.

    Science.gov (United States)

    Chadwick, Helen; Guo, Han; Gutiérrez-González, Ana; Menzel, Jan Paul; Jackson, Bret; Beck, Rainer D

    2018-01-07

    Methane dissociation on the step and terrace sites of a Pt(211) single crystal was studied by reflection absorption infrared spectroscopy (RAIRS) at a surface temperature of 120 K. The C-H stretch RAIRS signal of the chemisorbed methyl product species was used to distinguish between adsorption on step and terrace sites allowing methyl uptake to be monitored as a function of incident kinetic energy for both sites. Our results indicate a direct dissociation mechanism on both sites with higher reactivity on steps than on terraces consistent with a difference in an activation barrier height of at least 30 kJ/mol. State-specific preparation of incident CH4 with one quantum of antisymmetric (ν3) stretch vibration further increases the CH4 reactivity enabling comparison between translational and vibrational activation on both steps and terraces. The reaction is modeled with first principles quantum theory that accurately describes dissociative chemisorption at different sites on the surface.

  1. Methane dissociation on the steps and terraces of Pt(211) resolved by quantum state and impact site

    Science.gov (United States)

    Chadwick, Helen; Guo, Han; Gutiérrez-González, Ana; Menzel, Jan Paul; Jackson, Bret; Beck, Rainer D.

    2018-01-01

    Methane dissociation on the step and terrace sites of a Pt(211) single crystal was studied by reflection absorption infrared spectroscopy (RAIRS) at a surface temperature of 120 K. The C—H stretch RAIRS signal of the chemisorbed methyl product species was used to distinguish between adsorption on step and terrace sites allowing methyl uptake to be monitored as a function of incident kinetic energy for both sites. Our results indicate a direct dissociation mechanism on both sites with higher reactivity on steps than on terraces consistent with a difference in an activation barrier height of at least 30 kJ/mol. State-specific preparation of incident CH4 with one quantum of antisymmetric (ν3) stretch vibration further increases the CH4 reactivity enabling comparison between translational and vibrational activation on both steps and terraces. The reaction is modeled with first principles quantum theory that accurately describes dissociative chemisorption at different sites on the surface.

  2. Direct Growth of CdTe on a (211) Si Substrate with Vapor Phase Epitaxy Using a Metallic Cd Source

    Science.gov (United States)

    Iso, Kenji; Gokudan, Yuya; Shiraishi, Masumi; Murakami, Hisashi; Koukitu, Akinori

    2017-10-01

    We successfully performed epitaxial CdTe growth on a Si (211) substrate with vapor-phase epitaxy using a cost-effective metallic cadmium source as a group-II precursor. The thermodynamic data demonstrate that the combination of metallic Cd and diisopropyl-telluride (DiPTe) with a H2 carrier gas enables the growth of CdTe crystals. A CdTe single crystal with a (422) surface orientation was obtained when a growth temperature between 600°C and 650°C was employed. The surface morphology and crystalline quality were improved with increasing film thickness. The full-width at half-maximum of the x-ray rocking curves with a film thickness of 15.7 μm for the skew-symmetrical (422) and asymmetrical (111) reflection were 528 arcsec and 615 arcsec, respectively.

  3. Search for a gene responsible for Floating-Harbor syndrome on chromosome 12q15q21.1.

    Science.gov (United States)

    Lopez, Estelle; Callier, Patrick; Cormier-Daire, Valérie; Lacombe, Didier; Moncla, Anne; Bottani, Armand; Lambert, Sandy; Goldenberg, Alice; Doray, Bérénice; Odent, Sylvie; Sanlaville, Damien; Gueneau, Lucie; Duplomb, Laurence; Huet, Frédéric; Aral, Bernard; Thauvin-Robinet, Christel; Faivre, Laurence

    2012-02-01

    Floating-Harbor syndrome (FHS) is characterized by characteristic facial dysmorphism, short stature with delayed bone age, and expressive language delay. To date, the gene(s) responsible for FHS is (are) unknown and the diagnosis is only made on the basis of the clinical phenotype. The majority of cases appeared to be sporadic but rare cases following autosomal dominant inheritance have been reported. We identified a 4.7 Mb de novo 12q15-q21.1 microdeletion in a patient with FHS and intellectual deficiency. Pangenomic 244K array-CGH performed in a series of 12 patients with FHS failed to identify overlapping deletions. We hypothesized that FHS is caused by haploinsufficiency of one of the 19 genes or predictions located in the deletion found in our index patient. Since none of them appeared to be good candidate gene by their function, a high-throughput sequencing approach of the region of interest was used in eight FHS patients. No pathogenic mutation was found in these patients. This approach failed to identify the gene responsible for FHS, and this can be explained by at least four reasons: (i) our index patient could be a phenocopy of FHS; (ii) the disease may be clinically heterogeneous (since the diagnosis relies exclusively on clinical features), (iii) these could be genetic heterogeneity of the disease, (iv) the patient could carry a mutation in a gene located elsewhere. Recent descriptions of patients with 12q15-q21.1 microdeletions argue in favor of the phenocopy hypothesis. Copyright © 2012 Wiley Periodicals, Inc.

  4. Gamma-Ray Flaring Activity from the Gravitationally Lensed Blazar PKS 1830-211 Observed by Fermi LAT

    Energy Technology Data Exchange (ETDEWEB)

    Abdo, A. A.; et al.

    2015-01-23

    The Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope routinely detects the MeV-peaked flat-spectrum radio quasar PKS 1830–211 (z = 2.507). Its apparent isotropic γ-ray luminosity (E > 100 MeV), averaged over ~3 years of observations and peaking on 2010 October 14/15 at 2.9 × 10(50) erg s(–)(1), makes it among the brightest high-redshift Fermi blazars. No published model with a single lens can account for all of the observed characteristics of this complex system. Based on radio observations, one expects time-delayed variability to follow about 25 days after a primary flare, with flux about a factor of 1.5 less. Two large γ-ray flares of PKS 1830–211 have been detected by the LAT in the considered period, and no substantial evidence for such a delayed activity was found. This allows us to place a lower limit of about 6 on the γ-ray flux ratio between the two lensed images. Swift XRT observations from a dedicated Target of Opportunity program indicate a hard spectrum with no significant correlation of X-ray flux with the γ-ray variability. The spectral energy distribution can be modeled with inverse Compton scattering of thermal photons from the dusty torus. The implications of the LAT data in terms of variability, the lack of evident delayed flare events, and different radio and γ-ray flux ratios are discussed. Microlensing effects, absorption, size and location of the emitting regions, the complex mass distribution of the system, an energy-dependent inner structure of the source, and flux suppression by the lens galaxy for one image path may be considered as hypotheses for understanding our results.

  5. Thrombocytopenia-absent radius (TAR) syndrome: a clinical genetic series of 14 further cases. impact of the associated 1q21.1 deletion on the genetic counselling.

    Science.gov (United States)

    Houeijeh, Ali; Andrieux, Joris; Saugier-Veber, Pascale; David, Albert; Goldenberg, Alice; Bonneau, Dominique; Fouassier, Marc; Journel, Hubert; Martinovic, Jelana; Escande, Fabienne; Devisme, Louise; Bisiaux, Sophie; Chaffiotte, Caroline; Baux, Mathilde; Kerckaert, Jean-Pierre; Holder-Espinasse, Muriel; Manouvrier-Hanu, Sylvie

    2011-01-01

    Thrombocytopenia-absent radius Syndrome (TAR) is a rare congenital malformation syndrome of complicated transmission. 1q21.1 deletion is necessary but not sufficient for its expression. We report the result of a French multicentric clinical study, and we emphasized on the role of the associated 1q21.1 deletion in the diagnosis and the genetic counselling of our patients. We gathered information on 14 patients presenting with TAR syndrome and referred for genetic counselling in six different university hospitals (8 foetuses, 1 child and 5 adults). Clinical or pathology details, as well as skeletal X-rays were analyzed. Genetic studies were performed by Array-CGH, and Quantitative Multiplex PCR. We demonstrated the very variable phenotypes of TAR syndrome. Female:male ratio was ∼2:1. All patients presented with bilateral radial aplasia/hypoplasia with preserved thumbs. Phocomelia and lower limb anomalies were present in 28% of the cases. We reported the first case of cystic hygroma on affected foetus. 1q21.1 deletions ranging from 330 to 1100 kb were identified in all affected patients. Most of them were inherited from one healthy parent (80%). The identification of a 1q21.1 deletion allowed confirmation of TAR syndrome diagnosis, particularly in foetuses and in atypical phenotypes. Additionally, it allowed accurate genetic counselling, especially when it occurred de novo. These findings allowed discussing the diagnostic criteria and management towards TAR syndrome. Copyright © 2011 Elsevier Masson SAS. All rights reserved.

  6. Effect of Q211 and K222 PRNP polymorphic variants in the susceptibility of goats to oral infections with Goat Bovine Spongiform Encephalopathy

    NARCIS (Netherlands)

    Aguilar-Calvo, Patricia; Fast, C.; Tauscher, Kerstin; Espinosa, J.C.; Groschup, M.H.; Muhammad, Nadeem; Goldmann, W.; Langeveld, J.P.M.; Bossers, A.; Andreoletti, O.

    2015-01-01

    Background. The prion protein-encoding gene (PRNP) is one of the major determinants for scrapie occurrence in sheep and goats. However, its effect on bovine spongiform encephalopathy (BSE) transmission to goats is not clear.

    Methods. Goats harboring wild-type, R/Q211 or Q/K222 PRNP

  7. A historical overview of the development of manganese (Mn) pharmacokinetic data under Section 211(b) of the Clean Air Act (CAA)

    Science.gov (United States)

    Abstract for Manganese 2016A historical overview of the development of manganese (Mn) pharmacokinetic data under Section 211(b) of the Clean Air Act (CAA)William K BoyesBackground. In the 1990’s, the use of methylcyclopentadienyl manganese tricarbonyl (MMT) as an octane-enh...

  8. 5 CFR 839.211 - If these rules apply to me because I had a qualifying retirement coverage error, can I choose...

    Science.gov (United States)

    2010-01-01

    ... a qualifying retirement coverage error, can I choose which retirement plan I want to be in? 839.211... had a qualifying retirement coverage error, can I choose which retirement plan I want to be in? The... coverage error, your eligibility to choose your retirement plan may be affected by the situations described...

  9. Complete genome sequence of the biofilm-formingCurtobacteriumsp. strain BH-2-1-1, isolated from lettuce (Lactuca sativa) originating from a conventional field in Norway.

    Science.gov (United States)

    Dees, Merete Wiken; Brurberg, May Bente; Lysøe, Erik

    2016-12-01

    Here, we present the 3,795,952 bp complete genome sequence of the biofilm-forming Curtobacterium sp. strain BH-2-1-1, isolated from conventionally grown lettuce ( Lactuca sativa ) from a field in Vestfold, Norway. The nucleotide sequence of this genome was deposited into NCBI GenBank under the accession CP017580.

  10. In vitro evaluation of avidin antibody pretargeting using 211At-labeled and biotinylated poly-L-lysine as effector molecule

    DEFF Research Database (Denmark)

    Frost, Sofia H L; Jensen, Holger Lau; Lindegren, Sture

    2010-01-01

    Pretargeting is an approach for enhancing the therapeutic index of radioimmunotherapy by separating the administrations of tumor-targeting substance and radiolabel. In this study, a pretargeting model system of avidin-conjugated monoclonal antibody trastuzumab and biotinylated, (211)At-labeled po...

  11. Systemic administration and local microinjection into the central nervous system of the 5-HT(7) receptor agonist LP-211 modify the sleep-wake cycle in the rat.

    Science.gov (United States)

    Monti, Jaime M; Leopoldo, Marcello; Jantos, Héctor

    2014-02-01

    The effects of LP-211, a selective serotonin 5-HT7 receptor agonist were studied in adult rats implanted for chronic sleep recordings. Intraperitoneal administration of LP-211 (2.5-10mg/kg) during the light phase of the light-dark cycle significantly increased wakefulness (W) and reduced rapid-eye-movement sleep (REMS) and the number of REM periods during the 6-h recording period. Direct infusion of LP-211 into the dorsal raphe nucleus (DRN) (2-6 mM), locus coeruleus nucleus (LC) (4 mM), basal forebrain (horizontal limb of the diagonal band of Broca) (HDB) (2 mM) or laterodorsal tegmental nucleus (LDT) (4 mM) induced also a decrease of REMS. Additionally, microinjection of the 5-HT7 receptor ligand into the HDB (2 mM) augmented W. Presently, there is no satisfactory explanation for the effect of 5-HT7 receptor activation on W and REMS occurrence. Additional studies are required to characterize the neurotransmitter systems responsible for the actions of LP-211 on the behavioral states. Copyright © 2013 Elsevier B.V. All rights reserved.

  12. Replication Study and Meta-Analysis in European Samples Supports Association of the 3p21.1 Locus with Bipolar Disorder

    DEFF Research Database (Denmark)

    Vassos, Evangelos; Steinberg, Stacy; Cichon, Sven

    2012-01-01

    Common genetic polymorphisms at chromosome 3p21.1, including rs2251219 in polybromo 1 (PBRM1), have been implicated in susceptibility to bipolar affective disorder (BP) through genome-wide association studies. Subsequent studies have suggested that this is also a risk locus for other psychiatric...

  13. Implementing an Evidence-based Tobacco Control Program at Five 2-1-1 Call Centers: An Evaluation Using the Consolidated Framework for Implementation Research.

    Science.gov (United States)

    Thompson, Tess; Kreuter, Matthew W; Caito, Nicole; Williams, Rebecca S; Escoffery, Cam; Fernandez, Maria E; Kegler, Michelle C

    2017-10-10

    The Smoke-Free Homes Program (SFH) is an evidence-based intervention offered within 2-1-1 information and referral call centers to promote smoke-free homes in low-income populations. We used the Consolidated Framework for Implementation Research to conduct a mixed-methods analysis of facilitators and barriers to scaling up SFH to five 2-1-1 sites in the United States. Data were collected from staff in 2015-2016 via online surveys administered before (N = 120) and after SFH training (N = 101) and after SFH implementation (N = 79). Semi-structured telephone interviews were conducted in 2016 with 25 staff to examine attitudes towards SFH, ways local context affected implementation, and unintended benefits and consequences of implementing SFH. Post-implementation, 79% of respondents reported SFH was consistent with their 2-1-1's mission, 70% thought it led to more smoke-free homes in their population, 62% thought it was easy to adapt, and 56% thought participants were satisfied. Composite measures of perceived appropriateness of SFH for 2-1-1 callers and staff positivity toward SFH were significantly lower post-implementation than pre-implementation. In interviews, staff said SFH fit with their 2-1-1's mission but expressed concerns about intervention sustainability, time and resources needed for delivery, and how SFH fit into their workflow. Sites' SFH implementation experiences were affected both by demands of intervention delivery and by SFH's perceived effectiveness and fit with organizational mission. Future implementation of SFH and other tobacco control programs should address identified barriers by securing ongoing funding, providing dedicated staff time, and ensuring programs fit with staff workflow. Smoke-free homes policies reduce exposure to second-hand smoke. Partnering with social service agencies offers a promising way to scale up evidence-based smoke-free homes interventions among low-income populations. We found that the SFH intervention was acceptable

  14. Physicochemical, pharmacokinetic, efficacy and toxicity profiling of a potential nitrofuranyl methyl piperazine derivative IIIM-MCD-211 for oral tuberculosis therapy via in-silico-in-vitro-in-vivo approach.

    Science.gov (United States)

    Magotra, Asmita; Sharma, Anjna; Singh, Samsher; Ojha, Probir Kumar; Kumar, Sunil; Bokolia, Naveen; Wazir, Priya; Sharma, Shweta; Khan, Inshad Ali; Singh, Parvinder Pal; Vishwakarma, Ram A; Singh, Gurdarshan; Nandi, Utpal

    2017-11-21

    Recent tuberculosis (TB) drug discovery programme involve continuous pursuit for new chemical entity (NCE) which can be not only effective against both susceptible and resistant strains of Mycobacterium tuberculosis (Mtb) but also safe and faster acting with the target, thereby shortening the prolonged TB treatments. We have identified a potential nitrofuranyl methyl piperazine derivative, IIIM-MCD-211 as new antitubercular agent with minimum inhibitory concentration (MIC) value of 0.0072 μM against H37Rv strain. Objective of the present study is to investigate physicochemical, pharmacokinetic, efficacy and toxicity profile using in-silico, in-vitro and in-vivo model in comprehensive manner to assess the likelihood of developing IIIM-MCD-211 as a clinical candidate. Results of computational prediction reveal that compound does not violate Lipinski's, Veber's and Jorgensen's rule linked with drug like properties and oral bioavailability. Experimentally, IIIM-MCD-211 exhibits excellent lipophilicity that is optimal for oral administration. IIIM-MCD-211 displays evidence of P-glycoprotein (P-gp) induction but no inhibition ability in rhodamine cell exclusion assay. IIIM-MCD-211 shows high permeability and plasma protein binding based on parallel artificial membrane permeability assay (PAMPA) and rapid equilibrium dialysis (RED) model, respectively. IIIM-MCD-211 has adequate metabolic stability in rat liver microsomes (RLM) and favourable pharmacokinetics with admirable correlation during dose escalation study in Swiss mice. IIIM-MCD-211 has capability to appear into highly perfusable tissues. IIIM-MCD-211 is able to actively prevent progression of TB infection in chronic infection mice model. IIIM-MCD-211 shows no substantial cytotoxicity in HepG2 cell line. In acute toxicity study, significant increase of total white blood cell (WBC) count in treatment group as compared to control group is observed. Overall, amenable preclinical data make IIIM-MCD-211 ideal

  15. Fractionated radioimmunotherapy of intraperitoneally growing ovarian cancer in nude mice with {sup 211}At-MX35 F(ab'){sub 2}: therapeutic efficacy and myelotoxicity

    Energy Technology Data Exchange (ETDEWEB)

    Elgqvist, Joergen [Department of Radiation Physics, Sahlgrenska Academy at Goeteborg University, SE-413 45 Goeteborg (Sweden)]. E-mail: jorgen.elgqvist@radfys.gu.se; Andersson, Hakan [Department of Oncology, Sahlgrenska Academy at Goeteborg University, SE-413 45 Goeteborg (Sweden); Baeck, Tom [Department of Radiation Physics, Sahlgrenska Academy at Goeteborg University, SE-413 45 Goeteborg (Sweden); Claesson, Ingela [Department of Oncology, Sahlgrenska Academy at Goeteborg University, SE-413 45 Goeteborg (Sweden); Hultborn, Ragnar [Department of Oncology, Sahlgrenska Academy at Goeteborg University, SE-413 45 Goeteborg (Sweden); Jensen, Holger [PET and Cyclotron Unit, Rigshospitalet, 2100 Copenhagen (Denmark); Lindegren, Sture [Department of Radiation Physics, Sahlgrenska Academy at Goeteborg University, SE-413 45 Goeteborg (Sweden); Olsson, Marita [Bioinformatics Core Facility, Goeteborg University and Department of Mathematical Statistics, Chalmers University of Technology, SE-412 96 Goeteborg (Sweden); Palm, Stig [Department of Radiation Physics, Sahlgrenska Academy at Goeteborg University, SE-413 45 Goeteborg (Sweden); Warnhammar, Elisabet [Department of Oncology, Sahlgrenska Academy at Goeteborg University, SE-413 45 Goeteborg (Sweden); Jacobsson, Lars [Department of Radiation Physics, Sahlgrenska Academy at Goeteborg University, SE-413 45 Goeteborg (Sweden)

    2006-11-15

    Objective: The aim of this study was to investigate the therapeutic efficacy and myelotoxicity during fractionated radioimmunotherapy of ovarian cancer in mice. The study was performed using the monoclonal antibody MX35 F(ab'){sub 2} labeled with the {alpha}-particle emitter {sup 211}At. Methods: Animals were intraperitoneally inoculated with {approx}1x10{sup 7} cells of the cell line NIH:OVCAR-3. Four weeks later, the mice were given the first treatment. Six groups of animals were intraperitoneally injected with {approx}800, 3x {approx}267, {approx}400, 3x {approx}133, {approx}50 or 3x {approx}17 kBq {sup 211}At-MX35 F(ab'){sub 2} (n=18 in each group). The second and third injections for Groups 2, 4 and 6 were given 4 and 8 days after the first injection, respectively. As controls, animals were treated with unlabeled MX35 F(ab'){sub 2} (n=12). Eight weeks after the last injection, the animals were sacrificed and the presence of macro- and microscopic tumors and ascites was determined. Blood counts were determined for each mouse in Groups 1 and 2 before the first injection and 3, 7, 11, 15 and 23 days after the first injection. The calculation of the mean absorbed dose to the bone marrow was based on the ratio between the {sup 211}At-activity concentration in bone and blood [i.e., the bone-to-blood ratio (BBLR)] as well as that between the {sup 211}At-activity concentration in bone marrow and blood [i.e., the bone-marrow-to-blood ratio (BMBLR)] and the cumulated activity and absorbed fraction of the {alpha}-particles emitted by {sup 211}At in the bone marrow. Results: The tumor-free fractions of animals were 56% and 41% when treated with {approx}800 kBq and 3x {approx}267 kBq {sup 211}At-MX35 F(ab'){sub 2}, respectively; 39% and 28% when treated with {approx}400 kBq and 3x {approx}133 kBq {sup 211}At-MX35 F(ab'){sub 2}, respectively; and 17% and 22% when treated with {approx}50 kBq or 3x {approx}17 kBq {sup 211}At-MX35 F(ab'){sub 2

  16. A novel unbalanced de novo translocation der(5t(4;5(q26;q21.1 in adult T-cell precursor lymphoblastic leukemia

    Directory of Open Access Journals (Sweden)

    Kjeldsen Eigil

    2012-05-01

    Full Text Available Abstract We here describe a novel unbalanced de novo translocation der(5t(4;5(q26;q21.1 in a 39-year-old male diagnosed with acute T-cell lymphoblastic leukemia. Bone marrow (BM was massively infiltrated with 85 % highly proliferative polymorphic T-cell precursors. Immunologically, the malignant cells stained positive for CD7, CD34, intracytoplasmic CD3+, TdT + and negative for CD3 and CD5. G-banded chromosome analysis of BM cells showed the normal karyotype 46,XY[25] whereas BAC-based aCGH analysis revealed partial gain of 4q and partial loss of 5q. Multicolor karyotyping confirmed the presence of an unbalanced der(5t(4;5 as the sole structural abnormality. Subsequent high-resolution oligonucleotide-based aCGH analysis showed that the der(5t(4;5(q26;q21.1 resulted in partial trisomy of 4q26qter (117,719,015-190,613,014 and partial monosomy of 5q21.1qter (100,425,442-180,857,866 and that there was no indication of any gene disruptions resulting from the breakages. Interphase FISH analysis using BAC-based specific probes for 4q26 and 5q21.1 confirmed the breakpoints and revealed approximately 80 % abnormal cells accordingly. At 4q26 the MIR1973 gene is located centromeric to the breakpoint in the copy number neutral region and the TRAM1L1 gene is located within the gained region. At 5q21.1 the genes ST8SIA4 and MIR548p are located centromeric to the breakpoint and no known genes up to approximately 1 Mb telomeric to the breakpoint in the copy number loss region. Interestingly, only the gene ST8SIA4 at 5q21.1 have been implicated in T-cell regulation as it encodes one of the key enzymes for polysialysation of surface proteins on dendritic cells which are important regulators for T-cell proliferation. The der(5t(4;5 is thought to play a crucial role in the pathogenesis of acute T-ALL due to either gain of 4q, the loss of 5q, or deregulation of genes in proximity to the breakpoints.

  17. The Entire Nucleotide Sequence of Friend-Related and Paralysis-Inducing PVC-441 Murine Leukemia Virus (MuLV) and Its Comparison with Those of PVC-211 MuLV and Friend MuLV

    OpenAIRE

    Tanaka, Atsushi; Oka, Kiyomasa; Tanaka, Keiji; Jinno, Atsushi; Ruscetti, Sandra K.; Kai, Kazushige

    1998-01-01

    PVC-441 murine leukemia virus (MuLV) is a member of the PVC group of Friend MuLV (F-MuLV)-derived neuropathogenic retroviruses. In order to determine the molecular basis for the difference in neuropathogenicity between PVC-441 and the previously characterized PVC-211 MuLVs, the entire nucleotide sequence of PVC-441 MuLV was determined and compared with those of PVC-211 and F-MuLV. The results suggest that PVC-441 and PVC-211 MuLVs were formed as a result of random mutations of F-MuLV and deve...

  18. Radiotracer study of thorium complexation with humic acid at pH 2-11 using free-liquid electrophoresis

    Energy Technology Data Exchange (ETDEWEB)

    Benes, P. [Czech Technical Univ., Prague (Czech Republic). Dept. of Nuclear Chemistry

    2009-07-01

    Free-liquid electrophoresis was used for the study of thorium complexation with Aldrich humic acid (HA) in aqueous solutions of 0.01 M (NaClO{sub 4} + HClO{sub 4} or NaOH) with dependence on pH and concentration of thorium ({<=} 10{sup -9} - 10{sup -5} M, labelled with {sup 234}Th) and HA (0.1-10 mg/L). The abundances and the mean electrophoretic mobilities of thorium humate complexes were calculated from the electrophoretic mobilities of thorium measured. It has been found that negatively charged humate complexes dominate in the solutions of pH 2-11 containing 1-10 mg/L HA and up to 0.001 M HCO{sub 3}{sup -}. Experimental evidence was given of the formation of Th(OH){sub 4}HA{sup y-} complex at pH 8-11 and its stability constant was determined. New conclusions about spontaneous association of HA molecules at pH 2-6 and about binding of thorium by non-dissociated carboxyl groups of HA were drawn. (orig.)

  19. Up, down, strange and charm quark masses with Nf=2+1+1 twisted mass lattice QCD

    Directory of Open Access Journals (Sweden)

    N. Carrasco

    2014-10-01

    Full Text Available We present a lattice QCD calculation of the up, down, strange and charm quark masses performed using the gauge configurations produced by the European Twisted Mass Collaboration with Nf=2+1+1 dynamical quarks, which include in the sea, besides two light mass degenerate quarks, also the strange and charm quarks with masses close to their physical values. The simulations are based on a unitary setup for the two light quarks and on a mixed action approach for the strange and charm quarks. The analysis uses data at three values of the lattice spacing and pion masses in the range 210–450 MeV, allowing for accurate continuum limit and controlled chiral extrapolation. The quark mass renormalization is carried out non-perturbatively using the RI′-MOM method. The results for the quark masses converted to the MS¯ scheme are: mud(2 GeV=3.70(17 MeV, ms(2 GeV=99.6(4.3 MeV and mc(mc=1.348(46 GeV. We obtain also the quark mass ratios ms/mud=26.66(32 and mc/ms=11.62(16. By studying the mass splitting between the neutral and charged kaons and using available lattice results for the electromagnetic contributions, we evaluate mu/md=0.470(56, leading to mu=2.36(24 MeV and md=5.03(26 MeV.

  20. Computation of the chiral condensate using N{sub f}=2 and N{sub f}=2+1+1 dynamical flavors of twisted mass fermions

    Energy Technology Data Exchange (ETDEWEB)

    Cichy, K. [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany). John von Neumann-Inst. fuer Computing NIC; Poznan Univ. (Poland). Faculty of Physics; Garcia-Ramos, E. [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany). John von Neumann-Inst. fuer Computing NIC; Humboldt-Universitaet, Berlin (Germany); Jansen, K. [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany). John von Neumann-Inst. fuer Computing NIC; Shindler, A. [Forschungszentrum Juelich (Germany). IAS; Forschungszentrum Juelich (Germany). IKP; Forschungszentrum Juelich (Germany). JCHP; Collaboration: European Twisted Mass Collaboration

    2013-12-15

    We apply the spectral projector method, recently introduced by Giusti and Luescher, to compute the chiral condensate using N{sub f}=2 and N{sub f}=2+1+1 dynamical flavors of maximally twisted mass fermions. We present our results for several quark masses at three different lattice spacings which allows us to perform the chiral and continuum extrapolations. In addition we report our analysis on the O(a) improvement of the chiral condensate for twisted mass fermions. We also study the effect of the dynamical strange and charm quarks by comparing our results for N{sub f}=2 and N{sub f}=2+1+1 dynamical flavors.

  1. Nucleon form factors and moments of generalized parton distributions using N{sub f}= 2+1+1 twisted mass fermions

    Energy Technology Data Exchange (ETDEWEB)

    Alexandrou, C. [Univ. of Cyprus, Nicosia (Cyprus). Dept. of Physics; Cyprus Institute, Nicosia (Cyprus). Computation-based Science and Technology Research Center; Constantinou, M.; Kallidonis, C. [Univ. of Cyprus, Nicosia (Cyprus). Dept. of Physics; Dinter, S.; Drach, V. [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany). John von Neumann-Inst. fuer Computing NIC; Jansen, K. [Univ. of Cyprus, Nicosia (Cyprus). Dept. of Physics; Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany). John von Neumann-Inst. fuer Computing NIC; Koutsou, G. [Cyprus Institute, Nicosia (Cyprus). Computation-based Science and Technology Research Center; Collaboration: European Twisted Mass Collaboration

    2013-04-15

    We present results on the axial and the electromagnetic form factors of the nucleon, as well as, on the first moments of the nucleon generalized parton distributions using maximally twisted mass fermions. We analyze two N{sub f}=2+1+1 ensembles having pion masses of 210 MeV and 354 MeV at two values of the lattice spacing. The lattice scale is determined using the nucleon mass computed on a total of 18 N{sub f}=2+1+1 ensembles generated at three values of the lattice spacing, a. The renormalization constants are evaluated non-perturbatively with a perturbative subtraction of O(a''2)-terms. The moments of the generalized parton distributions are given in the MS scheme at a scale of {mu}=2 GeV. We compare with recent results obtained using different discretization schemes. The implications on the spin content of the nucleon are also discussed.

  2. Padrões dermatoscópicos do molusco contagioso: estudo de 211 lesões confirmadas por exame histopatológico Dermoscopic patterns of molluscum contagiosum: a study of 211 lesions confirmed by histopathology

    Directory of Open Access Journals (Sweden)

    Mayra Ianhez

    2011-02-01

    Full Text Available FUNDAMENTOS: Embora de fácil diagnóstico, o molusco contagioso pode apresentar-se como lesões inflamadas, únicas ou pequenas de difícil diagnóstico. OBJETIVO: Descrever características dermatoscópicas do molusco contagioso e comparar achados do exame clínico e dermatoscópico. MÉTODOS: Avaliou-se clínica e dermatoscopicamente lesões confirmadas pela histopatologia em 57 pacientes. RESULTADOS: Nos exames clínico e dermatoscópico de 211 lesões, foram visualizados orifícios em 50,24% e 96,68% das lesões e vasos em 6,16% e 89,10% delas, respectivamente. Os padrões vasculares encontrados em 188 lesões que apresentaram vasos à dermatoscopia foram coroa (72,34%, radial (54,25% e puntiforme (20,21%. Metade das 188 lesões apresentou padrão vascular combinado, sendo o padrão em flor (novo padrão vascular responsável por 19,68%. Foram identificados mais orifícios e vasos no exame dermatoscópico que no clínico, inclusive naquelas com inflamação, eczema perilesional e de tamanho pequeno. Vasos puntiformes relacionaram-se com inflamação, escoriação e eczema perilesional. CONCLUSÕES: A dermatoscopia das lesões de molusco mostrou-se superior ao exame dermatológico mesmo quando seu diagnóstico clínico torna-se difícil. A presença de orifícios, vasos e padrões vasculares específicos auxilia no seu diagnóstico e na diferenciação de outras lesões de pele.BACKGROUNDS: Although easily diagnosed, molluscum contagiosum may present as a single lesion or as several small, inflamed lesions of difficult diagnosis. OBJECTIVE: To describe the dermoscopic characteristics of molluscum contagiosum and to compare the findings from clinical examination and dermoscopy. METHODS: Histopathologically confirmed lesions were evaluated clinically and dermoscopically in 57 patients. RESULTS: At clinical examination and dermoscopy of 211 lesions, orifices were visualized in 50.24% and 96.68% of the lesions, and vessels in 6.16% and 89

  3. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...

  4. 76 FR 70336 - Airworthiness Directives; Rolls-Royce plc RB211-524G2-19; -524G2-T-19; -524G3-19; -524G3-T-19...

    Science.gov (United States)

    2011-11-14

    ... plc RB211-524G2-19; -524G2- T-19; -524G3-19; -524G3-T-19; 524H2-19; -524H2-T-19; -524H-36; and - 524H..., 2011. The Director of the Federal Register approved the incorporation by reference of Rolls-Royce plc... Information Rolls-Royce plc has issued Rolls-Royce plc Alert Service Bulletin No. RB.211-73-AG054, Revision 2...

  5. High-throughput microRNA (miRNAs arrays unravel the prognostic role of MiR-211 in pancreatic cancer.

    Directory of Open Access Journals (Sweden)

    Elisa Giovannetti

    Full Text Available BACKGROUND: Only a subset of radically resected pancreatic ductal adenocarcinoma (PDAC patients benefit from chemotherapy, and identification of prognostic factors is warranted. Recently miRNAs emerged as diagnostic biomarkers and innovative therapeutic targets, while high-throughput arrays are opening new opportunities to evaluate whether they can predict clinical outcome. The present study evaluated whether comprehensive miRNA expression profiling correlated with overall survival (OS in resected PDAC patients. METHODOLOGY/PRINCIPAL FINDINGS: High-resolution miRNA profiles were obtained with the Toray's 3D-Gene™-miRNA-chip, detecting more than 1200 human miRNAs. RNA was successfully isolated from paraffin-embedded primary tumors of 19 out of 26 stage-pT3N1 homogeneously treated patients (adjuvant gemcitabine 1000 mg/m(2/day, days-1/8/15, every 28 days, carefully selected according to their outcome (OS30 months (N = 6, i.e. short/long-OS. Highly stringent statistics included t-test, distance matrix with Spearman-ranked correlation, and iterative approaches. Unsupervised hierarchical analysis revealed that PDACs clustered according to their short/long-OS classification, while the feature selection algorithm RELIEF identified the top 4 discriminating miRNAs between the two groups. These miRNAs target more than 1500 transcripts, including 169 targeted by two or more. MiR-211 emerged as the best discriminating miRNA, with significantly higher expression in long- vs. short-OS patients. The expression of this miRNA was subsequently assessed by quantitative-PCR in an independent cohort of laser-microdissected PDACs from 60 resected patients treated with the same gemcitabine regimen. Patients with low miR-211 expression according to median value had a significantly shorter median OS (14.8, 95%CI = 13.1-16.5, vs. 25.7 months, 95%CI = 16.2-35.1, log-rank-P = 0.004. Multivariate analysis demonstrated that low miR-211 expression was an

  6. Real-time Scintillation Monitoring in Alaska from a Longitudinal Chain of ASTRA's SM-211 GPS TEC and Scintillation Receivers

    Science.gov (United States)

    Crowley, G.; Azeem, S. I.; Reynolds, A.; Santana, J.; Hampton, D. L.

    2013-12-01

    Amplitude and phase scintillation can cause serious difficulties for GPS receivers. Intense scintillation can cause loss of lock. High latitude studies generally show that phase scintillation can be severe, but the amplitude scintillation tends to be small. The reason for this is not yet understood. Furthermore, the actual causes of the ionospheric irregularities that produce high latitude scintillation are not well understood. While the gradient drift instability is thought to be important in the F-region, there may be other structures present in either the E- or F-regions. The role of particle precipitation is also not well understood. Four of ASTRA's CASES GPS receivers were deployed in Alaska to demonstrate our ability to map scintillation in realtime, to provide space weather services to GPS users, and to initiate a detailed investigation of these effects. These dual-frequency GPS receivers measure total electron content (TEC) and scintillation. The scintillation monitors were deployed in a longitudinal chain at sites in Kaktovic, Fort Yukon, Poker Flat, and Gakona. Scintillation statistics show phase scintillations to be largest at Kaktovic and smallest at Gakona. We present GPS phase scintillation and auroral emission results from the Alaska chain to characterize the correspondence between scintillation and auroral features, and to investigate the role of high latitude auroral features in driving the phase scintillations. We will also present data showing how phase scintillation can cause other GPS receivers to lose lock. The data and results are particularly valuable because they illustrate some of the challenges of using GPS systems for positioning and navigation in an auroral region like Alaska. These challenges for snowplough drivers were recently highlighted, along with the CASES SM-211 space weather monitor, in a special video in which ASTRA and three other small businesses were presented with an entrepreneurial award from William Shatner (http://youtu.be/bIVKEQH_YPk).

  7. Up, down, strange and charm quark masses with N{sub f}=2+1+1 twisted mass lattice QCD

    Energy Technology Data Exchange (ETDEWEB)

    Carrasco, N. [INFN, Sezione di Roma Tre, Via della Vasca Navale 84, I-00146 Rome (Italy); Deuzeman, A. [Albert Einstein Center for Fundamental Physics, Institute for Theoretical Physics, University of Bern, Sidlerstrasse 5, CH-3012 Bern (Switzerland); Dimopoulos, P. [Centro Fermi – Museo Storico della Fisica e Centro Studi e Ricerche Enrico Fermi, Compendio del Viminale, Piazza del Viminale 1, I-00184 Rome (Italy); Dipartimento di Fisica, Università di Roma “Tor Vergata”, Via della Ricerca Scientifica 1, I-00133 Rome (Italy); Frezzotti, R. [Dipartimento di Fisica, Università di Roma “Tor Vergata”, Via della Ricerca Scientifica 1, I-00133 Rome (Italy); INFN, Sezione di “Tor Vergata”, Via della Ricerca Scientifica 1, I-00133 Rome (Italy); Giménez, V. [Departament de Física Teòrica and IFIC, Univ. de València – CSIC, Dr. Moliner 50, E-46100 València (Spain); Herdoiza, G. [PRISMA Cluster of Excellence, Institut für Kernphysik, Johannes Gutenberg-Universität, D-55099 Mainz (Germany); Lami, P.; Lubicz, V. [Dipartimento di Matematica e Fisica, Università Roma Tre, Via della Vasca Navale 84, I-00146 Rome (Italy); INFN, Sezione di Roma Tre, Via della Vasca Navale 84, I-00146 Rome (Italy); Palao, D. [Goethe-Universität, Institut für Theoretische Physik, Max-von-Laue-Straße 1, D-60438 Frankfurt am Main (Germany); and others

    2014-10-15

    We present a lattice QCD calculation of the up, down, strange and charm quark masses performed using the gauge configurations produced by the European Twisted Mass Collaboration with N{sub f}=2+1+1 dynamical quarks, which include in the sea, besides two light mass degenerate quarks, also the strange and charm quarks with masses close to their physical values. The simulations are based on a unitary setup for the two light quarks and on a mixed action approach for the strange and charm quarks. The analysis uses data at three values of the lattice spacing and pion masses in the range 210–450 MeV, allowing for accurate continuum limit and controlled chiral extrapolation. The quark mass renormalization is carried out non-perturbatively using the RI′-MOM method. The results for the quark masses converted to the MS{sup ¯} scheme are: m{sub ud}(2 GeV)=3.70(17) MeV, m{sub s}(2 GeV)=99.6(4.3) MeV and m{sub c}(m{sub c})=1.348(46) GeV. We obtain also the quark mass ratios m{sub s}/m{sub ud}=26.66(32) and m{sub c}/m{sub s}=11.62(16). By studying the mass splitting between the neutral and charged kaons and using available lattice results for the electromagnetic contributions, we evaluate m{sub u}/m{sub d}=0.470(56), leading to m{sub u}=2.36(24) MeV and m{sub d}=5.03(26) MeV.

  8. Rupatadine is effective in the treatment of chronic spontaneous urticaria in children aged 2-11 years.

    Science.gov (United States)

    Potter, Paul; Mitha, Essack; Barkai, László; Mezei, Györgyi; Santamaría, Eva; Izquierdo, Iñaki; Maurer, Marcus

    2016-02-01

    Recommendations in current guidelines for the treatment of chronic spontaneous urticaria (CSU) in infants and children are mostly based on extrapolation of data obtained in adults. This study reports the efficacy and safety of rupatadine, a modern H1 and PAF antagonist recently authorized in Europe for children with allergic rhinitis and CSU. A double-blind, randomized, parallel-group, multicentre, placebo-controlled compared study to desloratadine was carried out in children aged 2-11 years with CSU, with or without angio-oedema. Patients received either rupatadine (1 mg/ml), or desloratadine (0.5 mg/ml) or placebo once daily over 6 weeks. A modified 7-day cumulative Urticaria Activity Score (UAS7) was employed as the primary end-point. The absolute change of UAS7 at 42 days showed statistically significant differences between active treatments vs. placebo (-5.5 ± 7.5 placebo, -11.8 ± 8.7 rupatadine and -10.6 ± 9.6 desloratadine; p rupatadine followed by desloratadine (-48.4%) and placebo (-30.3%). Rupatadine but not desloratadine was statistically superior to placebo in reduction of pruritus (-57%). Active treatments also showed a statistically better improvement in children's quality of life compared to placebo. Adverse events were uncommon and non-serious in both active groups. Rupatadine is effective and well tolerated in the relief of urticaria symptoms, improving quality of life over 6 weeks in children with CSU. This is the first study using a modified UAS to assess severity and efficacy outcome in CSU in children. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  9. 211–217

    Indian Academy of Sciences (India)

    Administrator

    5300 Bonn 1, FRG. Lakshmi Saripalli Joint Astronomy Programme, Department of Physics, Indian. Institute of Science, Bangalore 560012 and Radio Astronomy Centre, Tata Institute of. Fundamental Research, PO Box 1234, Bangalore 560012.

  10. AJHPE 211.indd

    African Journals Online (AJOL)

    The scholarship of teaching involves the integration of research into teaching activities, critical reflection of practice, and communication, and dissemination of .... were Dietetics, Nursing, Psychology and School of Public Health, the .... focused teaching and the stimulation of students' critical thinking by providing them with ...

  11. Absorbed Doses and Risk Estimates of {sup 211}At-MX35 F(ab'){sub 2} in Intraperitoneal Therapy of Ovarian Cancer Patients

    Energy Technology Data Exchange (ETDEWEB)

    Cederkrantz, Elin [Department of Radiation Physics, Institute for Clinical Sciences, Sahlgrenska Academy, University of Gothenburg, Gothenburg (Sweden); Andersson, Håkan [Department of Oncology, Institute for Clinical Sciences, Sahlgrenska Academy, University of Gothenburg, Gothenburg (Sweden); Bernhardt, Peter; Bäck, Tom [Department of Radiation Physics, Institute for Clinical Sciences, Sahlgrenska Academy, University of Gothenburg, Gothenburg (Sweden); Hultborn, Ragnar [Department of Oncology, Institute for Clinical Sciences, Sahlgrenska Academy, University of Gothenburg, Gothenburg (Sweden); Jacobsson, Lars [Department of Radiation Physics, Institute for Clinical Sciences, Sahlgrenska Academy, University of Gothenburg, Gothenburg (Sweden); Jensen, Holger [PET and Cyclotron Unit, Department of Clinical Physiology and Nuclear Medicine, Copenhagen University Hospital, Copenhagen (Denmark); Lindegren, Sture [Department of Radiation Physics, Institute for Clinical Sciences, Sahlgrenska Academy, University of Gothenburg, Gothenburg (Sweden); Ljungberg, Michael [Department of Medical Radiation Physics, Clinical Sciences, Lund University, Lund (Sweden); Magnander, Tobias; Palm, Stig [Department of Radiation Physics, Institute for Clinical Sciences, Sahlgrenska Academy, University of Gothenburg, Gothenburg (Sweden); Albertsson, Per, E-mail: per.albertsson@oncology.gu.se [Department of Oncology, Institute for Clinical Sciences, Sahlgrenska Academy, University of Gothenburg, Gothenburg (Sweden)

    2015-11-01

    Purpose: Ovarian cancer is often diagnosed at an advanced stage with dissemination in the peritoneal cavity. Most patients achieve clinical remission after surgery and chemotherapy, but approximately 70% eventually experience recurrence, usually in the peritoneal cavity. To prevent recurrence, intraperitoneal (i.p.) targeted α therapy has been proposed as an adjuvant treatment for minimal residual disease after successful primary treatment. In the present study, we calculated absorbed and relative biological effect (RBE)-weighted (equivalent) doses in relevant normal tissues and estimated the effective dose associated with i.p. administration of {sup 211}At-MX35 F(ab'){sub 2}. Methods and Materials: Patients in clinical remission after salvage chemotherapy for peritoneal recurrence of ovarian cancer underwent i.p. infusion of {sup 211}At-MX35 F(ab'){sub 2}. Potassium perchlorate was given to block unwanted accumulation of {sup 211}At in thyroid and other NIS-containing tissues. Mean absorbed doses to normal tissues were calculated from clinical data, including blood and i.p. fluid samples, urine, γ-camera images, and single-photon emission computed tomography/computed tomography images. Extrapolation of preclinical biodistribution data combined with clinical blood activity data allowed us to estimate absorbed doses in additional tissues. The equivalent dose was calculated using an RBE of 5 and the effective dose using the recommended weight factor of 20. All doses were normalized to the initial activity concentration of the infused therapy solution. Results: The urinary bladder, thyroid, and kidneys (1.9, 1.8, and 1.7 mGy per MBq/L) received the 3 highest estimated absorbed doses. When the tissue-weighting factors were applied, the largest contributors to the effective dose were the lungs, stomach, and urinary bladder. Using 100 MBq/L, organ equivalent doses were less than 10% of the estimated tolerance dose. Conclusion: Intraperitoneal {sup 211}At

  12. In vitro cytotoxicity of {sup 211}At-labeled trastuzumab in human breast cancer cell lines: effect of specific activity and HER2 receptor heterogeneity on survival fraction

    Energy Technology Data Exchange (ETDEWEB)

    Akabani, Gamal [Department of Radiology, Duke University Medical Center, P.O. Box 3808, Durham, NC 27710 (United States); Carlin, Sean [Department of Radiology, Duke University Medical Center, P.O. Box 3808, Durham, NC 27710 (United States); Welsh, Phil [Department of Radiology, Duke University Medical Center, P.O. Box 3808, Durham, NC 27710 (United States); Zalutsky, Michael R. [Department of Radiology, Duke University Medical Center, P.O. Box 3808, Durham, NC 27710 (United States)]. E-mail: zalut001@mc.duke.edu

    2006-04-15

    Introduction: Radioimmunotherapy with anti-HER2 monoclonal antibodies (mAbs) such as trastuzumab is a promising strategy for treating HER2-positive breast and ovarian carcinoma patients. The objective of this study was to determine the cytotoxic effectiveness of trastuzumab labeled with the 7.2-h half-life {alpha}-particle emitter {sup 211}At. Methods: Experiments were performed on SKBr-3, BT-474 and the transfected MCF7/HER2-18 human breast carcinoma cell lines. Intrinsic radiosensitivity was determined after exposure to external beam irradiation. The cytotoxicity of {sup 211}At-labeled trastuzumab was measured by clonogenic assays. The distribution of HER2 receptor expression on the cell lines was measured using fluorescence-activated cell sorting. A pharmacokinetic (PK)/microdosimetric model was established to assess the effects of specific activity (SA), HER2 receptor expression and absorbed dose on survival fraction (SF). Results: With external beam irradiation, the 2-Gy SF for BT-474, SKBr-3 and MCF7/HER2-18 cells was 0.78, 0.53 and 0.64 Gy, respectively. Heterogeneous HER2 expression was observed, with a subpopulation of cells lacking measurable receptor (14.5%, SKBr-3; 0.34%, MCF-7/HER2; 1.73%, BT-474). When plotted as a function of activity concentration, SF curves were biphasic and inversely proportional to SA; however, when the model was applied and absorbed doses calculated, the SF curve was monoexponential independent of SA. Thus, the PK model was able to demonstrate the effects of competition between cold and labeled mAb. These studies showed that the relative biological effectiveness of {sup 211}At-labeled trastuzaumab was about 10 times higher than that of external beam therapy. Conclusion: These in vitro studies showed that {sup 211}At-labeled trastuzumab mAb is an effective cytotoxic agent for the treatment of HER2-positive tumor cells. The SA of the labeled mAb and the homogeneity of HER2 receptor expression are important variables influencing

  13. FSHB-211 and FSHR 2039 are associated with serum levels of follicle-stimulating hormone and antimüllerian hormone in healthy girls

    DEFF Research Database (Denmark)

    Hagen, Casper P; Aksglæde, Lise; Sørensen, Kaspar

    2013-01-01

    To investigate whether genetic polymorphisms in the FSH pathway (FSHB-211 G→T and FSHR 2039 A→G) affect serum levels of FSH, antimüllerian hormone (AMH), and age at pubertal onset. FSH secretion and FSH signal transduction are enhanced in carriers of FSHB GG and FSHR AA, respectively. Furthermore......, the combined genotype FSHB GG+FSHR AA is the most favorable for male gonadal function, but the effect of this genotype has never been evaluated in peripubertal females. AMH is a marker of ovarian function and is negatively correlated with FSH in prepubertal girls....

  14. Potential plant growth-promoting strain Bacillus sp. SR-2-1/1 decolorized azo dyes through NADH-ubiquinone:oxidoreductase activity.

    Science.gov (United States)

    Mahmood, Faisal; Shahid, Muhammad; Hussain, Sabir; Shahzad, Tanvir; Tahir, Muhammad; Ijaz, Muhammad; Hussain, Athar; Mahmood, Khalid; Imran, Muhammad; Babar, Shahid Ali Khan

    2017-07-01

    In this study, a bacterial strain SR-2-1/1 was isolated from textile wastewater-irrigated soil for its concurrent potential of plant growth promotion and azo-dye decolorization. Analysis of 16S rRNA gene sequence confirmed its identity as Bacillus sp. The strain tolerated high concentrations (i.e. up to 1000mgL-1) of metals (Ni2+, Cd2+, Co2+, Zn2+, and Cr6+) and efficiently decolorized the azo dyes (i.e. reactive black-5, reactive red-120, direct blue-1 and congo red). It also demonstrated considerable in vitro phosphate solubilizing and 1-aminocyclopropane-1-carboxylic acid deaminase abilities at high metal and salt levels. Bioinformatics analysis of its 537bp azoreductase gene and deduced protein revealed that it decolorized azo dyes through NADH-ubiquinone:oxidoreductase enzyme activity. The deduced protein was predicted structurally and functionally different to those of its closely related database proteins. Thus, the strain SR-2-1/1 is a powerful bioinoculant for bioremediation of textile wastewater contaminated soils in addition to stimulation of plant growth. Copyright © 2017 Elsevier Ltd. All rights reserved.

  15. First principles study of (Cd, Hg, In, Tl, Sn, Pb, As, Sb, Bi, Se) modified Pt(111), Pt(100) and Pt(211) electrodes as CO oxidation catalysts

    DEFF Research Database (Denmark)

    Tripkovic, Vladimir

    2015-01-01

    CO oxidation is a prototype reaction for studying oxidation of small organic molecules. Certain adatom modified Pt electrodes have a large promotional effect on CO oxidation. However, the effect is often coverage dependent, and has a limited effect due to short lifetimes of the adatoms. The cover......CO oxidation is a prototype reaction for studying oxidation of small organic molecules. Certain adatom modified Pt electrodes have a large promotional effect on CO oxidation. However, the effect is often coverage dependent, and has a limited effect due to short lifetimes of the adatoms....... The coverage dependence as a function of potential for ten different adatom species (Cd, Hg, In, Tl, Sn, Pb, As, Sb, Bi, Se) on bare and CO saturated Pt(111), Pt(100) and Pt(211) surfaces has been established by means of Density Functional Theory calculations. Most of the adatoms are very stable under standard...... conditions and remain anchored to the surface until high potentials in supporting electrolytes. The stability is contingent on the electrode roughness and reduces in the following order: Pt(211) ≈ Pt(100) > Pt(111), except for Se adatoms, in which case the trend is reversed. The activity for CO oxidation...

  16. One-phonon octupole vibrational states in {sup 211}At, {sup 212}Rn, {sup 213}Fr and {sup 214}Ra with N = 126

    Energy Technology Data Exchange (ETDEWEB)

    Hwang, J.K.; Hamilton, J.H.; Ramayya, A.V. [Vanderbilt University, Physics Department, Nashville, TN (United States)

    2013-12-15

    Excited high spin states in {sup 211}At, {sup 212}Rn, {sup 213}Fr and {sup 214}Ra with N = 126 are reorganized and interpreted in terms of the stretched weak coupling of an octupole 3{sup -} phonon. Nearly identical sequences of levels with {Delta}I = 3 and the parity change are found, for the first time, up to 25{sup -} for 20 states of {sup 214}Ra, up to 35{sup -} for 36 states of {sup 212}Rn and up to 53/2{sup +} for 16 states of {sup 213}Fr. The stretched weak coupling of an octupole phonon is extended up to the highest excitation energy of 11355 keV for {sup 212}Rn which has the largest experimental B(E3) value of 44.1(88) W.u. for the 11{sup -} {yields} 8{sub 2}{sup +} transition. The stretched weak coupling of an octupole 3{sup -} phonon needs to be considered when single particle configurations are assigned to high spin states. Average octupole excitation energies of 657(51) keV for {sup 211}At, 1101(28) keV for {sup 212}Rn, 667(25) keV for {sup 213}Fr, and 709(25) keV for {sup 214}Ra are obtained. The calculated level energies are in a good agreement with the experimental level energies within the error limit of 4.3%. (orig.)

  17. Selective 5-HT7 receptor agonists LP 44 and LP 211 elicit an analgesic effect on formalin-induced orofacial pain in mice

    Science.gov (United States)

    DEMİRKAYA, Kadriye; AKGÜN, Özlem Martı; ŞENEL, Buğra; ÖNCEL TORUN, Zeynep; SEYREK, Melik; LACİVİTA, Enza; LEOPOLDO, Marcello; DOĞRUL, Ahmet

    2016-01-01

    ABSTRACT The most recently identified serotonin (5-HT) receptor is the 5-HT7 receptor. The antinociceptive effects of a 5-HT7 receptor agonist have been shown in neuropathic and inflammatory animal models of pain. A recent study demonstrated the functional expression of 5-HT7 receptors in the substantia gelatinosa (SG) of the trigeminal subnucleus caudalis, which receives and processes orofacial nociceptive inputs. Objective To investigate the antinociceptive effects of pharmacological activation of 5-HT7 receptors on orofacial pain in mice. Material and Methods Nociception was evaluated by using an orofacial formalin test in male Balb-C mice. Selective 5-HT7 receptor agonists, LP 44 and LP 211 (1, 5, and 10 mg/kg), were given intraperitoneally 30 min prior to a formalin injection. A bolus of 10 µl of 4% subcutaneous formalin was injected into the upper lip of mice and facial grooming behaviors were monitored. The behavioral responses consisted of two distinct periods, the early phase corresponding to acute pain (Phase I: 0–12 min) and the late phase (Phase II: 12–30 min). Results LP 44 and LP 211 (1, 5, and 10 mg/kg) produced an analgesic effect with reductions in face rubbing time in both Phase I and Phase II of the formalin test. Conclusion Our results suggest that 5-HT7 receptor agonists may be promising analgesic drugs in the treatment of orofacial pain. PMID:27383702

  18. Final Report for research grant entitled "Development of Reagents for Application of At-211 and Bi-213 to Targeted Radiotherapy of Cancer"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott

    2011-12-23

    This grant was a one-year extension of another grant with the same title (DE-FG03-98ER62572). The objective of the studies was to continue in vivo evaluation of reagents to determine which changes in structure were most favorable for in vivo use. The focus of our studies was development and optimization of reagents for pretargeting alpha-emitting radionuclides At-211 or Bi-213 to cancer cells. Testing of the reagents was conducted in vitro and in animal model systems. During the funding period, all three specific aims set out in the proposed studies were worked on, and some additional studies directed at development of a method for direct labeling of proteins with At-211 were investigated. We evaluated reagents in two different approaches in 'two step' pretargeting protocols. These approaches are: (1) delivery of the radionuclide on recombinant streptavidin to bind with pretargeted biotinylated monoclonal antibody (mAb), and alternatively, (2) delivery of the radionuclide on a biotin derivative to bind with pretargeted antibody-streptavidin conjugates. The two approaches were investigated as it was unclear which will be superior for the short half-lived alpha-emitting radionuclides.

  19. 47, XY, +der(Y),t(X;Y)(p21.1;p11.2): a unique case of XY sex reversal.

    Science.gov (United States)

    Zarate, Yuri A; Dwivedi, Alka; Bartel, Frank O; Corning, Ken; Dupont, Barbara R

    2011-02-01

    Translocations involving the short arms of the X and Y chromosomes are rare and can result in a functional disomy of the short arm of the X chromosome, including the dosage-sensitive sex reversal (DSS) locus. A result of such imbalance may be sex reversal with multiple congenital anomalies. We present the clinical and cytogenetic evaluation of a newborn infant with DSS and additional clinical findings of minor facial anomalies, left abdominal mass, 5th finger clinodactyly, and mild hypotonia. The external genitalia appeared to be normal female. The infant had bilateral corneal opacities and findings suggestive of anterior segment dysgenesis. Ultrasonography showed a small uterus with undetectable ovaries, and a left multicystic dysplastic kidney. High-resolution chromosome analysis identified the presence of a derivative Y chromosome, 47,XY, +der(Y)t(X;Y)(p21.1;p11.2), which was confirmed by fluorescence in situ hybridization studies. Array CGH showed a 35.1 Mb copy number gain of chromosome region Xp22.33-p21.1 and a 52.2 Mb copy number gain of Yp11.2-qter, in addition to the intact X and Y chromosomes. Previously reported patients with XY sex reversal have not had DSS with corneal opacities, dysgenesis of the anterior segment of the eye, and unilateral multicystic dysplastic kidney. These findings represent a new form of XY sex reversal due to an Xp duplication. Copyright © 2010 Wiley-Liss, Inc.

  20. A chromosome 10 variant with a 12 Mb inversion [inv(10)(q11.22q21.1)] identical by descent and frequent in the Swedish population.

    Science.gov (United States)

    Entesarian, Miriam; Carlsson, Birgit; Mansouri, Mahmoud Reza; Stattin, Eva-Lena; Holmberg, Eva; Golovleva, Irina; Stefansson, Hreinn; Klar, Joakim; Dahl, Niklas

    2009-03-01

    We identified a paracentric inversion of chromosome 10 [inv(10)(q11.22q21.1)] in 0.20% of Swedish individuals (15/7,439) referred for cytogenetic analysis. A retrospective analysis of 8,896 karyotypes from amniocenteses in Sweden revealed a carrier frequency of 0.079% (7/8,896) for the inversion. Cloning and detailed analysis of the inversion breakpoint regions show enrichment for interspersed repeat elements and AT-stretches. The centromeric breakpoint coincides with that of a predicted inversion from HapMap data, which suggests that this region is involved in several chromosome 10 variants. No known gene or predicted transcript are disrupted by the inversion which spans approximately 12 Mb. Carriers from four non-related Swedish families have identical inversion breakpoints and haplotype analysis confirmed that the rearrangement is identical by descent. Diagnosis was retrieved in 6 out of the 15 carriers referred for cytogenetic analysis. No consistent phenotype was found to be associated with the inversion. Our study demonstrates that the inv(10)(q11.22q21.1) is a rare and inherited chromosome variant with a broad geographical distribution in Sweden. 2009 Wiley-Liss, Inc.

  1. Selective 5-HT7 receptor agonists LP 44 and LP 211 elicit an analgesic effect on formalin-induced orofacial pain in mice.

    Science.gov (United States)

    Demirkaya, Kadriye; Akgün, Özlem Martı; Şenel, Buğra; Öncel Torun, Zeynep; Seyrek, Melik; Lacivita, Enza; Leopoldo, Marcello; Doğrul, Ahmet

    2016-01-01

    To investigate the antinociceptive effects of pharmacological activation of 5-HT7 receptors on orofacial pain in mice. Nociception was evaluated by using an orofacial formalin test in male Balb-C mice. Selective 5-HT7 receptor agonists, LP 44 and LP 211 (1, 5, and 10 mg/kg), were given intraperitoneally 30 min prior to a formalin injection. A bolus of 10 µl of 4% subcutaneous formalin was injected into the upper lip of mice and facial grooming behaviors were monitored. The behavioral responses consisted of two distinct periods, the early phase corresponding to acute pain (Phase I: 0-12 min) and the late phase (Phase II: 12-30 min). LP 44 and LP 211 (1, 5, and 10 mg/kg) produced an analgesic effect with reductions in face rubbing time in both Phase I and Phase II of the formalin test. Our results suggest that 5-HT7 receptor agonists may be promising analgesic drugs in the treatment of orofacial pain.

  2. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    Energy Technology Data Exchange (ETDEWEB)

    Koziorowski, J

    1998-10-01

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on {sup 211}At and {sup 124}I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[{sup 211}At]astato-2`-deoxyuridine (AUdR) and N-succinimidyl-4-[{sup 211}At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [{sup 124}I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[{sup 124}I]iodo-2`-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for

  3. A density functional theory study on the carbon chain growth of ethanol formation on Cu-Co (111) and (211) surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Ren, Bohua; Dong, Xiuqin; Yu, Yingzhe [Key Laboratory for Green Chemical Technology of Ministry of Education, R& D Center for Petrochemical Technology, Tianjin University, Tianjin 300072 (China); Collaborative Innovation Center of Chemical Science and Engineering (Tianjin), Tianjin 300072 (China); Wen, Guobin [Collaborative Innovation Center of Chemical Science and Engineering (Tianjin), Tianjin 300072 (China); Zhang, Minhua, E-mail: mhzhang@tju.edu.cn [Key Laboratory for Green Chemical Technology of Ministry of Education, R& D Center for Petrochemical Technology, Tianjin University, Tianjin 300072 (China); Collaborative Innovation Center of Chemical Science and Engineering (Tianjin), Tianjin 300072 (China)

    2017-08-01

    Highlights: • Calculations based on the first-principle density functional theory were carried out to study ethanol formation from syngas on Cu-Co surfaces. • The most controversial reactions in ethanol formation from syngas were researched: CO dissociation mechanism and the key reactions of carbon chain growth of ethanol formation (HCO insertion reactions (CHx + HCO → CHxCHO (x = 1–3))). • Four model surfaces (Cu-Co (111) and (211) with Cu-rich or Co-rich surfaces) were built to investigate the synergy of the Cu and Co components. • The PDOS of 4d orbitals and d-band center analysis of surface Cu and Co atoms of all surfaces were studied to reveal correlation between electronic property and catalytic performance. - Abstract: Calculations based on the first-principle density functional theory were carried out to study the most controversial reactions in ethanol formation from syngas on Cu-Co surfaces: CO dissociation mechanism and the key reactions of carbon chain growth of ethanol formation (HCO insertion reactions) on four model surfaces (Cu-Co (111) and (211) with Cu-rich or Co-rich surfaces) to investigate the synergy of the Cu and Co components since the complete reaction network of ethanol formation from syngas is a huge computational burden to calculate on four Cu-Co surface models. We investigated adsorption of important species involved in these reactions, activation barrier and reaction energy of H-assisted dissociation mechanism, directly dissociation of CO, and HCO insertion reactions (CH{sub x} + HCO → CH{sub x}CHO (x = 1–3)) on four Cu-Co surface models. It was found that reactions on Cu-rich (111) and (211) surfaces all have lower activation barrier in H-assisted dissociation and HCO insertion reactions, especially CH + HCO → CHCHO reaction. The PDOS of 4d orbitals of surface Cu and Co atoms of all surfaces were studied. Analysis of d-band center of Cu and Co atoms and the activation barrier data suggested the correlation between

  4. Toward a standard for the evaluation of PET-Auto-Segmentation methods following the recommendations of AAPM task group No. 211: Requirements and implementation.

    Science.gov (United States)

    Berthon, Beatrice; Spezi, Emiliano; Galavis, Paulina; Shepherd, Tony; Apte, Aditya; Hatt, Mathieu; Fayad, Hadi; De Bernardi, Elisabetta; Soffientini, Chiara D; Ross Schmidtlein, C; El Naqa, Issam; Jeraj, Robert; Lu, Wei; Das, Shiva; Zaidi, Habib; Mawlawi, Osama R; Visvikis, Dimitris; Lee, John A; Kirov, Assen S

    2017-08-01

    The aim of this paper is to define the requirements and describe the design and implementation of a standard benchmark tool for evaluation and validation of PET-auto-segmentation (PET-AS) algorithms. This work follows the recommendations of Task Group 211 (TG211) appointed by the American Association of Physicists in Medicine (AAPM). The recommendations published in the AAPM TG211 report were used to derive a set of required features and to guide the design and structure of a benchmarking software tool. These items included the selection of appropriate representative data and reference contours obtained from established approaches and the description of available metrics. The benchmark was designed in a way that it could be extendable by inclusion of bespoke segmentation methods, while maintaining its main purpose of being a standard testing platform for newly developed PET-AS methods. An example of implementation of the proposed framework, named PETASset, was built. In this work, a selection of PET-AS methods representing common approaches to PET image segmentation was evaluated within PETASset for the purpose of testing and demonstrating the capabilities of the software as a benchmark platform. A selection of clinical, physical, and simulated phantom data, including "best estimates" reference contours from macroscopic specimens, simulation template, and CT scans was built into the PETASset application database. Specific metrics such as Dice Similarity Coefficient (DSC), Positive Predictive Value (PPV), and Sensitivity (S), were included to allow the user to compare the results of any given PET-AS algorithm to the reference contours. In addition, a tool to generate structured reports on the evaluation of the performance of PET-AS algorithms against the reference contours was built. The variation of the metric agreement values with the reference contours across the PET-AS methods evaluated for demonstration were between 0.51 and 0.83, 0.44 and 0.86, and 0.61 and 1

  5. A new locus for autosomal recessive non-syndromic mental retardation maps to 1p21.1-p13.3.

    Science.gov (United States)

    Uyguner, O; Kayserili, H; Li, Y; Karaman, B; Nürnberg, G; Hennies, Hc; Becker, C; Nürnberg, P; Başaran, S; Apak, M Y; Wollnik, B

    2007-03-01

    Autosomal recessive inheritance of non-syndromic mental retardation (ARNSMR) may account for approximately 25% of all patients with non-specific mental retardation (NSMR). Although many X-linked genes have been identified as a cause of NSMR, only three autosomal genes are known to cause ARNSMR. We present here a large consanguineous Turkish family with four mentally retarded individuals from different branches of the family. Clinical tests showed cognitive impairment but no neurological, skeletal, and biochemical involvements. Genome-wide mapping using Human Mapping 10K Array showed a single positive locus with a parametric LOD score of 4.92 in a region on chromosome 1p21.1-p13.3. Further analyses using polymorphic microsatellite markers defined a 6.6-Mb critical region containing approximately 130 known genes. This locus is the fourth one linked to ARNSMR.

  6. Safety experience with bosentan in 146 children 2-11 years old with pulmonary arterial hypertension: results from the European Postmarketing Surveillance program

    DEFF Research Database (Denmark)

    Beghetti, M.; Hoeper, M.M.; Kiely, D.G.

    2008-01-01

    captured in the database. Predominant etiologies in children were idiopathic PAH (40.4%) and PAH related to congenital heart disease (45.2%). The majority of children were in New York Heart Association functional class II (28.1%) or III (50.7%), and median exposure to bosentan was 29.1 wk. Elevated......The oral dual endothelin receptor antagonist bosentan has been shown to improve the short- and medium-term course of adult pulmonary arterial hypertension (PAH); however, data from clinical studies in children are limited. This analysis investigated the safety profile of bosentan in pediatric...... patients in a European, prospective, noninterventional, Internet-based postmarketing surveillance database (Tracleer PMS). Pediatric patients (aged 2-11 y) were compared with patients aged > or =12 y. Over a 30-mo period, 4994 patients, including 146 bosentan-naive pediatric patients (51.4% males), were...

  7. Padrões dermatoscópicos do molusco contagioso: estudo de 211 lesões confirmadas por exame histopatológico

    OpenAIRE

    Ianhez, Mayra; Silmara da Costa P Cestari; Enokihara,Mauro Yoshiaki; Seize,Maria Bandeira de Paiva Melo

    2011-01-01

    FUNDAMENTOS: Embora de fácil diagnóstico, o molusco contagioso pode apresentar-se como lesões inflamadas, únicas ou pequenas de difícil diagnóstico. OBJETIVO: Descrever características dermatoscópicas do molusco contagioso e comparar achados do exame clínico e dermatoscópico. MÉTODOS: Avaliou-se clínica e dermatoscopicamente lesões confirmadas pela histopatologia em 57 pacientes. RESULTADOS: Nos exames clínico e dermatoscópico de 211 lesões, foram visualizados orifícios em 50,24% e 96,68% das...

  8. Correlation of Etch Pits and Dislocations in As-grown and Thermal Cycle-Annealed HgCdTe(211) Films

    Science.gov (United States)

    Vaghayenegar, M.; Jacobs, R. N.; Benson, J. D.; Stoltz, A. J.; Almeida, L. A.; Smith, David J.

    2017-08-01

    This paper reports observations of the different types of etch pits and dislocations present in thick HgCdTe (211) layers grown by molecular beam epitaxy on CdTe/Si (211) composite substrates. Dislocation analysis for as-grown and thermal cycle-annealed samples has been carried out using bright-field transmission electron microscopy. Triangular pits present in as-grown material are associated with a mixture of Frank partials and perfect dislocations, while pits with fish-eye shapes have perfect dislocations with 1/2[0\\bar{1}1] Burgers vector. The dislocations beneath skew pits are more complex as they have two different crystallographic directions, and are associated with a mixture of Shockley partials and perfect dislocations. Dislocation analysis of samples after thermal cycle annealing (TCA) shows that the majority of dislocations under the etch pits are short segments of perfect dislocations with 1/2[0\\bar{1}1] Burgers vector while the remainder are Shockley partials. The absence of fish-eye shape pits in TCA samples suggests that they are associated with mobile dislocations that have reacted during annealing, causing the overall etch pit density to be reduced. Very large pits with a density ˜2×103 cm-2 are observed in as-grown and TCA samples. These defects thread from within the CdTe buffer layer into the upper regions of the HgCdTe layers. Their depth in as-grown material is so large that it is not possible to locate and identify the underlying defects.

  9. A density functional theory study on the carbon chain growth of ethanol formation on Cu-Co (111) and (211) surfaces

    Science.gov (United States)

    Ren, Bohua; Dong, Xiuqin; Yu, Yingzhe; Wen, Guobin; Zhang, Minhua

    2017-08-01

    Calculations based on the first-principle density functional theory were carried out to study the most controversial reactions in ethanol formation from syngas on Cu-Co surfaces: CO dissociation mechanism and the key reactions of carbon chain growth of ethanol formation (HCO insertion reactions) on four model surfaces (Cu-Co (111) and (211) with Cu-rich or Co-rich surfaces) to investigate the synergy of the Cu and Co components since the complete reaction network of ethanol formation from syngas is a huge computational burden to calculate on four Cu-Co surface models. We investigated adsorption of important species involved in these reactions, activation barrier and reaction energy of H-assisted dissociation mechanism, directly dissociation of CO, and HCO insertion reactions (CHx + HCO → CHxCHO (x = 1-3)) on four Cu-Co surface models. It was found that reactions on Cu-rich (111) and (211) surfaces all have lower activation barrier in H-assisted dissociation and HCO insertion reactions, especially CH + HCO → CHCHO reaction. The PDOS of 4d orbitals of surface Cu and Co atoms of all surfaces were studied. Analysis of d-band center of Cu and Co atoms and the activation barrier data suggested the correlation between electronic property and catalytic performance. Cu-Co bimetallic with Cu-rich surface allows Co to have higher catalytic activity through the interaction of Cu and Co atom. Then it will improve the adsorption of CO and catalytic activity of Co. Thus it is more favorable to the carbon chain growth in ethanol formation. Our study revealed the factors influencing the carbon chain growth in ethanol production and explained the internal mechanism from electronic property aspect.

  10. PHYSICAL LOCALIZATION OF THE CHROMOSOMAL MARKER D13S31 PLACES THE WILSON DISEASE LOCUS AT THE JUNCTION OF BAND-Q14.3 AND BAND-Q21.1 OF CHROMOSOME-13

    NARCIS (Netherlands)

    KOOY, RF; VANDERVEEN, AY; VERLIND, E; HOUWEN, RHJ; SCHEFFER, H; BUYS, CHCM

    D13S31 is the marker closest to the Wilson disease locus according to genetic analysis. Its physical localisation was refined by fluorescent in situ hybridisation to the junction to chromosomal bands 13q14.3 and 13q21.1. Using polymerase chain reaction analysis, D13S31 and D13S59 (the closest

  11. Inv(X)(p21.1;q22.1) in a man with mental retardation, short stature, general muscle wasting, and facial dysmorphism: clinical study and mutation analysis of the NXF5 gene.

    NARCIS (Netherlands)

    Frints, S.G.; Jun, L.; Fryns, J.P.; Devriendt, K.; Teulingkx, R.; Berghe, L. van den; Vos, B. de; Borghgraef, M.; Chelly, J.; Portes, V. des; Bokhoven, J.H.L.M. van; Hamel, B.C.J.; Ropers, H.H.; Kalscheuer, V.M.M.; Raynaud, M.; Moraine, C.; Marynen, P.; Froyen, G.

    2003-01-01

    We describe a 59-year-old male (patient A059) with moderate to severe mental retardation (MR) and a pericentric inversion of the X-chromosome: inv(X)(p21.1;q22.1). He had short stature, pectus excavatum, general muscle wasting, and facial dysmorphism. Until now, no other patients with similar

  12. A functional EXXEK motif is essential for proton coupling and active glucosinolate transport by NPF2.11

    DEFF Research Database (Denmark)

    Jørgensen, Morten Egevang; Olsen, Carl Erik; Geiger, Dietmar

    2015-01-01

    The proton-dependent oligopeptide transporter (POT/PTR) family shares a highly conserved E1X1X2E2RFXYY (E1X1X2E2R) motif across all kingdoms of life. This motif is suggested to have a role in proton coupling and active transport in bacterial homologs. For the plant POT/PTR family, also known......K motif variant in a plant NPF transporter. Using liquid chromatography-mass spectrometry (LC-MS)-based uptake assays and two-electrode voltage clamp (TEVC) electrophysiology, we demonstrate an essential role for the E1X1X2E2K motif for accumulation of substrate by NPF2.11. Our data suggest...... that the highly conserved E1, E2 and K residues are involved in translocation of protons, as has been proposed for the E1X1X2E2R motif in bacteria. Furthermore, we show that the two residues X1 and X2 in the E1X1X2E2[K/R] motif are conserved as uncharged amino acids in POT/PTRs from bacteria to mammals...

  13. Phenotype and 244k array-CGH characterization of chromosome 13q deletions: an update of the phenotypic map of 13q21.1-qter

    DEFF Research Database (Denmark)

    Kirchhoff, Maria; Bisgaard, Anne-Marie; Stoeva, Radka

    2009-01-01

    Partial deletions of the long arm of chromosome 13 lead to variable phenotypes dependant on the size and position of the deleted region. In order to update the phenotypic map of chromosome 13q21.1-qter deletions, we applied 244k Agilent oligonucleotide-based array-CGH to determine the exact...... breakpoints in 14 patients with partial deletions of this region. Subsequently, we linked the genotype to the patient's phenotype. Using this approach, we were able to refine the smallest deletion region linked to short stature (13q31.3: 89.5-91.6 Mb), microcephaly (13q33.3-q34), cortical development...... malformations (13q33.1-qter), Dandy-Walker malformation (DWM) (13q32.2-q33.1), corpus callosum agenesis (CCA) (13q32.3-q33.1), meningocele/encephalocele (13q31.3-qter), DWM, CCA, and neural tube defects (NTDs) taken together (13q32.3-q33.1), ano-/microphthalmia (13q31.3-13qter), cleft lip/palate (13q31.3-13q33...

  14. ‘The woman was deceived and became a sinner’ – a literary-theological investigation of 1 Timothy 2:11–15

    Directory of Open Access Journals (Sweden)

    Abiola I. Mbamalu

    2014-07-01

    Full Text Available In 1 Timothy 2:11–15 women are forbidden to teach and have authority over men in the church. The ground for this instruction is the creation account in Genesis 2 that asserts the priority of Adam over Eve in the order of creation. The second reason for the instruction is the deception of Eve according to the account of the Fall in Genesis 3. This pericope has elicited arguments between advocates of egalitarianism and complementarianism revolving over the issues of grammar, the context of the Ephesian church with regard to false teachings and the comparison of this text with the other writings of Paul, for those that subscribe to the authorship of Paul. The contention of this article is that verse 15 provides a major clue as to how this text should be understood. In addition, the author’s rhetoric in this text is interrogated with regard to the text’s own internal literary and theological logic. In this regard, the author is found to be inconsistent in his outlook, for the grace that was poured out abundantly on him: a blasphemer, a persecutor and a violent man and on account of his ignorance andunbelief (1 Tm 1:12–16 is apparently, being denied women on account of Eve’s deception.

  15. ‘The woman was deceived and became a sinner’ – a literary-theological investigation of 1 Timothy 2:11–15

    Directory of Open Access Journals (Sweden)

    Abiola I. Mbamalu

    2014-02-01

    Full Text Available In 1 Timothy 2:11–15 women are forbidden to teach and have authority over men in the church. The ground for this instruction is the creation account in Genesis 2 that asserts the priority of Adam over Eve in the order of creation. The second reason for the instruction is the deception of Eve according to the account of the Fall in Genesis 3. This pericope has elicited arguments between advocates of egalitarianism and complementarianism revolving over the issues of grammar, the context of the Ephesian church with regard to false teachings and the comparison of this text with the other writings of Paul, for those that subscribe to the authorship of Paul. The contention of this article is that verse 15 provides a major clue as to how this text should be understood. In addition, the author’s rhetoric in this text is interrogated with regard to the text’s own internal literary and theological logic. In this regard, the author is found to be inconsistent in his outlook, for the grace that was poured out abundantly on him: a blasphemer, a persecutor and a violent man and on account of his ignorance andunbelief (1 Tm 1:12–16 is apparently, being denied women on account of Eve’s deception.

  16. The Johnson Space Center Management Information Systems (JSCMIS). 1: Requirements Definition and Design Specifications for Versions 2.1 and 2.1.1. 2: Documented Test Scenario Environments. 3: Security Design and Specifications

    Science.gov (United States)

    1986-01-01

    The Johnson Space Center Management Information System (JSCMIS) is an interface to computer data bases at NASA Johnson which allows an authorized user to browse and retrieve information from a variety of sources with minimum effort. This issue gives requirements definition and design specifications for versions 2.1 and 2.1.1, along with documented test scenario environments, and security object design and specifications.

  17. Prepuberal stimulation of 5-HT7-R by LP-211 in a rat model of hyper-activity and attention-deficit: permanent effects on attention, brain amino acids and synaptic markers in the fronto-striatal interface.

    Directory of Open Access Journals (Sweden)

    Lucia A Ruocco

    Full Text Available The cross-talk at the prefronto-striatal interface involves excitatory amino acids, different receptors, transducers and modulators. We investigated long-term effects of a prepuberal, subchronic 5-HT7-R agonist (LP-211 on adult behaviour, amino acids and synaptic markers in a model for Attention-Deficit/Hyperactivity Disorder (ADHD. Naples High Excitability rats (NHE and their Random Bred controls (NRB were daily treated with LP-211 in the 5th and 6th postnatal week. One month after treatment, these rats were tested for indices of activity, non selective (NSA, selective spatial attention (SSA and emotionality. The quantity of L-Glutamate (L-Glu, L-Aspartate (L-Asp and L-Leucine (L-Leu, dopamine transporter (DAT, NMDAR1 subunit and CAMKIIα, were assessed in prefrontal cortex (PFC, dorsal (DS and ventral striatum (VS, for their role in synaptic transmission, neural plasticity and information processing. Prepuberal LP-211 (at lower dose reduced horizontal activity and (at higher dose increased SSA, only for NHE but not in NRB rats. Prepuberal LP-211 increased, in NHE rats, L-Glu in the PFC and L-Asp in the VS (at 0.250 mg/kg dose, whereas (at 0.125 mg/kg dose it decreased L-Glu and L-Asp in the DS. The L-Glu was decreased, at 0.125 mg/kg, only in the VS of NRB rats. The DAT levels were decreased with the 0.125 mg/kg dose (in the PFC, and increased with the 0.250 mg/kg dose (in the VS, significantly for NHE rats. The basal NMDAR1 level was higher in the PFC of NHE than NRB rats; LP-211 treatment (at 0.125 mg/kg dose decreased NMDAR1 in the VS of NRB rats. This study represents a starting point about the impact of developmental 5-HT7-R activation on neuro-physiology of attentive processes, executive functions and their neural substrates.

  18. Association of breast-fed neonatal hyperbilirubinemia with UGT1A1 polymorphisms: 211G>A (G71R) mutation becomes a risk factor under inadequate feeding.

    Science.gov (United States)

    Sato, Hiroko; Uchida, Toshihiko; Toyota, Kentaro; Kanno, Miyako; Hashimoto, Taeko; Watanabe, Masashi; Nakamura, Tomohiro; Tamiya, Gen; Aoki, Kuraaki; Hayasaka, Kiyoshi

    2013-01-01

    Breastfeeding jaundice is a well-known phenomenon, but its pathogenesis is still unclear. Increased production of bilirubin, impaired hepatic uptake and metabolism of bilirubin, and increased enterohepatic circulation of bilirubin account for most cases of pathological neonatal hyperbilirubinemia. We previously reported that 211G>A (G71R) mutation of the UGT1A1 gene is prevalent in East Asians and is associated with the development of neonatal hyperbilirubinemia. Recently, significant association of G71R mutation with hyperbilirubinemia in breast-fed neonates was reported. We enrolled 401 full-term Japanese infants, who were exclusively breast-fed without supplementation of formula before developing hyperbilirubinemia, and classified them into two groups based on the degree of maximal body weight loss during the neonatal period. We analyzed the sex, gestational age, delivery mode, body weight at birth, maximal body weight loss and genotypes of G71R and (TA)(7) polymorphic mutations of UGT1A1. Statistical analysis revealed that maximal body weight loss during the neonatal period is the only independent risk factor for the development of neonatal hyperbilirubinemia. The effect of G71R mutation on neonatal hyperbilirubinemia is significant in neonates with 5% or greater maximal body weight loss and its influence increases in parallel with the degree of maximal body weight loss. Our study indicates that G71R mutation is a risk factor for neonatal hyperbilirubinemia only in infants with inadequate breastfeeding and suggests that adequate breastfeeding may overcome the genetic predisposing factor, G71R mutation, for the development of neonatal hyperbilirubinemia.

  19. Fine-mapping of 18q21.1 locus identifies single nucleotide polymorphisms associated with nonsyndromic cleft lip with or without cleft palate

    Directory of Open Access Journals (Sweden)

    AMIT KUMAR MITRA

    2016-05-01

    Full Text Available Nonsyndromic cleft lip with or without cleft palate (NSCL/P is one of the most common congenital birth defects. NSCL/P is a complex multifactorial disease caused by interactions between multiple environmental and genetic factors. However, the causal single nucleotide polymorphism (SNP signature profile underlying the risk of familial NSCL/P still remains unknown. We previously reported a 5.7-Mb genomic region on chromosome 18q21.1 locus that potentially contributes to autosomal dominant, low-penetrance inheritance of NSCL/P. In the current study, we performed exome sequencing on 12 familial genomes (6 affected individuals, 2 obligate carriers, and 4 seemingly unaffected individuals of a six-generation family to identify candidate SNPs associated with NSCL/P risk. Subsequently, targeted bidirectional DNA re-sequencing of polymerase chain reaction (PCR-amplified high-risk regions of MYO5B gene and sequenom iPLEX genotpying of 29 candidate SNPs were performed on a larger set of 33 members of this NSCL/P family (10 affected + 4 obligate carriers + 19 unaffected relatives to find SNPs significantly associated with NSCL/P trait. SNP versus NSCL/P association analysis showed the MYO5B SNP rs183559995 GA genotype had an odds ratio of 18.09 (95% Confidence Interval=1.86-176.34; gender-adjusted Pvalue=0.0019 compared to the reference GG genotype. Additionally, the following SNPs were also found significantly associated with NSCL/P risk: rs1450425 (LOXHD1, rs6507992 (SKA1, rs78950893 (SMAD7, rs8097060, rs17713847 (SCARNA17, rs6507872 (CTIF, rs8091995 (CTIF and rs17715416 (MYO5B.We could thus identify mutations in several genes as key candidate SNPs associated with the risk of NSCL/P in this large multi-generation family.

  20. Crestridge Vegetation Map [ds211

    Data.gov (United States)

    California Department of Resources — This layer represents vegetation communities in the Department of Fish and Game's Crestridge Ecological Reserve. The County of San Diego, the Conservation Biology...

  1. Performance of biomarkers SMRP, CA125, and CYFRA 21-1 as potential tumor markers for malignant mesothelioma and lung cancer in a cohort of workers formerly exposed to asbestos

    Energy Technology Data Exchange (ETDEWEB)

    Gube, M. [RWTH Aachen University, Institute for Occupational and Social Medicine, Medical Faculty, Aachen (Germany); Westfaelische Technische Hochschule, Institut fuer Arbeitsmedizin und Sozialmedizin am Universitaetsklinikum Aachen, Rheinisch, Aachen (Germany); Taeger, D.; Weber, D.G.; Pesch, B.; Johnen, G.; Gross, I.M.; Wiethege, T.; Weber, A.; Bruening, T. [Institute of the Ruhr-Universitaet Bochum (IPA), Institute for Prevention and Occupational Medicine of the German Social Accident Insurance, Bochum (Germany); Brand, P.; Mueller-Lux, A.; Kraus, T. [RWTH Aachen University, Institute for Occupational and Social Medicine, Medical Faculty, Aachen (Germany); Raithel, H.J. [University of Erlangen-Nuremberg, Institute for Occupational, Social and Environmental Medicine, Erlangen-Nuremberg (Germany)

    2011-03-15

    The aim of the study is to examine the cancer-predictive values of SMRP (soluble mesothelin-related peptides), CA125, and CYFRA21-1 as potential tumor markers for lung cancer and malignant mesothelioma in a cohort of workers formerly exposed to asbestos. A voluntary surveillance program has been established for German workers with former asbestos exposure. A subgroup of 626 subjects with a mean age of 63 years (range 53-70 years) at baseline was enrolled in an extended health examination program with high-resolution computer tomography (HRCT) of the chest and blood drawing between 1993 and 1997. Serum concentrations of SMRP, CA125, and CYFRA21-1 were measured in archived serum samples in 2005 and 2006. A mortality follow-up was conducted through 2007. So far, 12 cases with lung cancer and 20 cases with malignant mesothelioma have been observed in this cohort. The average time between sample collection and diagnosis was 4.7 years. Analyzed biomarkers showed low sensitivities (5-25%) and positive predictive values (4-30%) for both cancer sites. Marker combinations resulted in sensitivities between 5 and 50% and positive predictive values ranging from 3 to 14%. Even in those cases, where biomarker concentrations were available within 36 months before diagnosis, no trend for increasing biomarker levels was observed. The analyzed tumor markers were characterized by high specificities, but low sensitivities. SMRP, CA125, and CYFRA21-1 alone or in combination were less suitable to serve as predictors for the diagnosis of lung cancer or malignant mesothelioma. However, a prospective study with annual sampling might reveal a better predictive value of these markers. (orig.)

  2. Embracing a vision of the New Jerusalem (Rv 21:1−22:5 to impact on life and society

    Directory of Open Access Journals (Sweden)

    Martin H. Pohlmann

    2015-03-01

    Full Text Available Apocalyptic biblical literature has played a significant role in motivating and mobilising Christians. As part of this genre, the Apocalypse of John has played this mobilising role within the church throughout its history. Jerusalem is often incorporated into this genre to conjure up different emotions and images to impact many different people. For example, the Jew annually recites the words to fellow Jews at every Passover meal: ‘Next year in Jerusalem’. Most Christians know the hymn ‘The holy city’, originally penned by Frederic Weatherly in 1892. It lifts many a spirit as it conjures up the idea of a beautiful, perfect, heavenly city of God. However, there is more to this apocalyptic vision, which will be explored in this article. The city upholds the hope of decent godly living today. Whilst Jerusalem is a city with an extremely chequered history, it remains to be the launching pad of a dream that believers can embrace in order to impact society for the better. The vision in Revelation 21–22 is the launch of the ‘idea’ of God’s intention for society today, and the ‘implementation impetus’ is the primary role of the church. In the greater scheme of things, the world community is the target group for a better society for everyone.Aanneming van ’n visioen van die Nuwe Jerusalem (Op 21:1–22:5 ten einde ’n invloed op lewe en die samelewing uit te oefen. Apokaliptiese Bybelliteratuur het ’n beduidende rol in die motivering en aansporing van Christengemeenskappe gespeel. Die Openbaring van Johannes het hierdie motiveringsrol deurgaans in die geskiedenis van die kerkas deel van dié genre vertolk. Jerusalem is dikwels hierby ingesluit om ’n verskeidenheid van emosies en beelde op te roep ten einde ’n impak op ’n verskeidenheid mense te maak. Die Jood, byvoorbeeld, haal jaarliks die volgende woorde teenoor mede-Jode tydens die Paasmaaltyd aan: ‘Volgende jaar in Jerusalem’. Die meeste

  3. Reactive oxygen species and PI3K/Akt signaling play key roles in the induction of Nrf2-driven heme oxygenase-1 expression in sulforaphane-treated human mesothelioma MSTO-211H cells.

    Science.gov (United States)

    Lee, Yoon-Jin; Jeong, Hyang-Yun; Kim, Yong-Bae; Lee, Yong-Jin; Won, Seong Youn; Shim, Jung-Hyun; Cho, Moon-Kyun; Nam, Hae-Seon; Lee, Sang-Han

    2012-02-01

    The nuclear factor erythroid-derived 2 related factor 2 (Nrf2)/heme oxygenase (HO)-1 induction plays cytoprotective roles against oxidative injury, apoptosis, and anticancer therapy; however, little is known about its regulation in human mesothelioma MSTO-211H cells. In this study, we investigated Nrf2/HO-1 induction in response to sulforaphane and determined the signaling pathways involved in this process. Sulforaphane treatment decreased cell viability and triggered a rapid and transient increase in the intracellular ROS levels. Pretreatment with N-acetylcysteine (NAC) prevented sulforaphane-induced cytotoxicity. Erk1/2 was activated within 1h of sulforaphane addition, whereas Akt phosphorylation was suppressed until the first 8h, and was then maintained at an elevated level until 72h, displaying a biphasic regulatory feature. Nrf2 protein levels in both nuclear and whole cell lysates were increased after sulforaphane treatment and were decreased by pretreatment with NAC, actinomycin D and cycloheximide. Activation of the Nrf2/HO-1 system after sulforaphane treatment was suppressed by pretreatment with NAC or Ly294002, a PI3K inhibitor. Knockdown of Nrf2 with siRNA decreased cell viability and attenuated sulforaphane-induced HO-1 up-regulation. Overall, our results indicate that ROS generation and/or activation of PI3K/Akt signaling regulate cell survival and Nrf2-driven HO-1 expression in sulforaphane-treated MSTO-211H cells. Copyright © 2011 Elsevier Ltd. All rights reserved.

  4. Dynamic Mechanical Analysis (DMA) to Help Characterize Vespel SP-211 Polyimide Material for Use as a 750 F Valve Seal on the Ares I Upper Stage J-2X Engine

    Science.gov (United States)

    Wingard, Doug

    2013-01-01

    DuPont(tm) Vespel(R) SP-211 polyimide was selected as the top candidate seal material for use in the Oxidizer Turbine Bypass Valve (OTBV) on NASA's Ares I Upper Stage J-2X engine. In the OTBV, the seal material would get exposed to temperatures up to 750degF for approx 10 minutes at a time. Although the J-2X engine is not reusable, the valve material could be exposed to multiple temperature cycles up to 750degF during engine operation. The Constellation Program that included the Ares I rocket was eventually cancelled, but the J-2X engine was chosen for continued use for development of NASA's Space Launch System (SLS). The SLS is a heavy-lift launch vehicle that will have capability of taking astronauts and hardware to the Moon, Mars and asteroids. Dynamic mechanical analysis (DMA) was one of several test techniques used to characterize Vespel SP-211 to help prove its worthiness for use on the OTBV of the J-2X engine.

  5. Search for magnetic monopoles with the MoEDAL forward trapping detector in 2.11~fb$^{-1}$ of 13 TeV proton-proton collisions at the LHC

    CERN Document Server

    Acharya, B.; The MoEDAL collaboration; Baines, S.; Benes, P.; Bergmann, B.; Bernabéu, J.; Bevan, A.; Branzas, H.; Campbell, M.; Caramete, L.; Cecchini, S.; de Montigny, M.; De Roeck, A.; Ellis, J.R.; Fairbairn, M.; Felea, D.; Frank, M.; Frekers, D.; Garcia, C.; Hays, J.; Hirt, A.M.; Janecek, J.; Kim, D.-W.; Kinoshita, K.; Korzenev, A.; Lacarrère, D.H.; Lee, S.C.; Leroy, C.; Lionti, A.; Mamuzic, J.; Margiotta, A.; Mauri, N.; Mavromatos, N.E.; Mermod, P.; Mitsou, V.A.; Orava, R.; Ostrovskiy, I.; Parker, B.; Pasqualini, L.; Patrizii, L.; Păvălaş, G.E.; Pinfold, J.L.; Popa, V.; Pozzato, M.; Pospisil, S.; Rajantie, A.; Ruiz de Austri, R.; Sahnoun, Z.; Sakellariadou, M.; Santra, A.; Sarkar, S.; Semenoff, G.; Shaa, A.; Sirri, G.; Sliwa, K.; Soluk, R.; Spurio, M.; Srivastava, Y.N.; Suk, M.; Swain, J.; Tenti, M.; Togo, V.; Tuszyński, J.A.; Vento, V.; Vives, O.; Vykydal, Z.; Widom, A.; Willems, G.; Yoon, J.H.; Zgura, I.S.

    2017-01-01

    We update our previous search for trapped magnetic monopoles in LHC Run 2 using nearly six times more integrated luminosity and including additional models for the interpretation of the data. The MoEDAL forward trapping detector, comprising 222~kg of aluminium samples, was exposed to 2.11~fb$^{-1}$ of 13 TeV proton-proton collisions near the LHCb interaction point and analysed by searching for induced persistent currents after passage through a superconducting magnetometer. Magnetic charges equal to the Dirac charge or above are excluded in all samples. The results are interpreted in Drell-Yan production models for monopoles with spins 0, 1/2 and 1: in addition to standard point-like couplings, we also consider couplings with momentum-dependent form factors. The search provides the best current laboratory constraints for monopoles with magnetic charges ranging from two to five times the Dirac charge.

  6. Interaction between ALDH2*1*1 and DRD2/ANKK1 TaqI A1A1 genes may be associated with antisocial personality disorder not co-morbid with alcoholism.

    Science.gov (United States)

    Lu, Ru-Band; Lee, Jia-Fu; Huang, San-Yuan; Lee, Sheng-Yu; Chang, Yun-Hsuan; Kuo, Po-Hsiu; Chen, Shiou-Lan; Chen, Shih-Heng; Chu, Chun-Hsien; Lin, Wei-Wen; Wu, Pei-Lin; Ko, Huei-Chen

    2012-09-01

    Previous studies on acetaldehyde dehydrogenase 2 (ALDH2) focused on drinking behavior or alcoholism because the ALDH2*2 allele protects against the risk of developing alcoholism. The mechanism provides that the ALDH2 gene's protective effect is also involved in dopamine metabolism. The interaction of the ALDH2 gene with neurotransmitters, such as dopamine, is suggested to be related to alcoholism. Because alcoholism is often co-morbid with antisocial personality disorder (ASPD), previous association studies on antisocial alcoholism cannot differentiate whether those genes relate to ASPD with alcoholism or ASPD only. This study examined the influence of the interaction effect of the ALDH2*1*1, *1*2 or *2*2 polymorphisms with the dopamine 2 receptor (DRD2) Taq I polymorphism on ASPD. Our 541 Han Chinese male participants were classified into three groups: antisocial alcoholism (ASPD co-morbid with alcohol dependence, antisocial ALC; n = 133), ASPD without alcoholism (ASPD not co-morbid with alcohol dependence, antisocial non-ALC; n = 164) and community controls (healthy volunteers from the community; n = 244). Compared with healthy controls, individuals with the DRD2 A1/A1 and the ALDH2*1/*1 genotypes were at a 5.39 times greater risk for antisocial non-ALC than were those with other genotypes. Our results suggest that the DRD2/ANKK1 and ALDH2 genes interacted in the antisocial non-ALC group; a connection neglected in previous studies caused by not separating antisocial ALC from ASPD. Our study made this distinction and showed that these two genes may be associated ASPD without co-morbid alcoholism. © 2010 The Authors, Addiction Biology © 2010 Society for the Study of Addiction.

  7. Locoregional therapy with α-emitting trastuzumab against peritoneal metastasis of human epidermal growth factor receptor 2-positive gastric cancer in mice.

    Science.gov (United States)

    Li, Huizi Keiko; Morokoshi, Yukie; Nagatsu, Kotaro; Kamada, Tadashi; Hasegawa, Sumitaka

    2017-08-01

    Peritoneal metastasis of gastric cancer (PMGC) is incurable and thus has an extremely poor prognosis. We have found, however, that locoregionally administered trastuzumab armed with astatine-211 ((211) At-trastuzumab) is effective against human epidermal growth factor receptor 2 (HER2)-positive PMGC in a xenograft mouse model. We first observed that (211) At-trastuzumab can specifically bind and effectively kill NCI-N87 (N87) cells, which are HER2-positive human metastatic GC cells, both in vitro and in s.c. tumors. We established a PMGC mouse model using N87 xenografts stably expressing luciferase to test α-particle radioimmunotherapy with (211) At-trastuzumab against PMGC. Biodistribution analysis in this PMGC mouse model revealed that the i.p. administration of (211) At-trastuzumab (1 MBq) was a more efficient means of delivery of (211) At into metastatic tumors than i.v. injection; the maximum tumor uptake with i.p. administration was over 60% injected dose per gram of tissue (%ID/g) compared to approximately 18%ID/g with i.v. injection. Surprisingly, a single i.p. injection of (211) At-trastuzumab (1 MBq) was sufficient to completely eradicate intraperitoneally disseminated HER2-positive GC xenografts in two of six treated mice by inducing DNA double-strand breaks, and to drastically reduce the tumor burden in another three mice. No bodyweight loss, leukocytopenia, or significant biochemical changes in liver or kidney function were observed in the treatment group. Accordingly, locoregionally administered (211) At-trastuzumab significantly prolonged the survival time of HER2-positive PMGC mice compared with control treatments. Our results provide a proof-of-concept demonstration that locoregional therapy with (211) At-trastuzumab may offer a new treatment option for HER2-positive PMGC. © 2017 The Authors. Cancer Science published by John Wiley & Sons Australia, Ltd on behalf of Japanese Cancer Association.

  8. Childhood pre-B cell acute lymphoblastic leukemia with translocation t(1;19)(q21.1;p13.3) and two additional chromosomal aberrations involving chromosomes 1, 6, and 13: a case report.

    Science.gov (United States)

    Wafa, Abdulsamad; As'sad, Manar; Liehr, Thomas; Aljapawe, Abdulmunim; Al Achkar, Walid

    2017-04-07

    The translocation t(1;19)(q23;p13), which results in the TCF3-PBX1 chimeric gene, is one of the most frequent rearrangements observed in B cell acute lymphoblastic leukemia. It appears in both adult and pediatric patients with B cell acute lymphoblastic leukemia at an overall frequency of 3 to 5%. Most cases of pre-B cell acute lymphoblastic leukemia carrying the translocation t(1;19) have a typical immunophenotype with homogeneous expression of CD19, CD10, CD9, complete absence of CD34, and at least diminished CD20. Moreover, the translocation t(1;19) correlates with known clinical high risk factors, such as elevated white blood cell count, high serum lactate dehydrogenase levels, and central nervous system involvement; early reports indicated that patients with translocation t(1;19) had a poor outcome under standard treatment. We report the case of a 15-year-old Syrian boy with pre-B cell acute lymphoblastic leukemia with abnormal karyotype with a der(19)t(1;19)(q21.1;p13.3) and two yet unreported chromosomal aberrations: an interstitial deletion 6q12 to 6q26 and a der(13)t(1;13)(q21.1;p13). According to the literature, cases who are translocation t(1;19)-positive have a significantly higher incidence of central nervous system relapse than patients with acute lymphoblastic leukemia without the translocation. Of interest, central nervous system involvement was also seen in our patient. To the best of our knowledge, this is the first case of childhood pre-B cell acute lymphoblastic leukemia with an unbalanced translocation t(1;19) with two additional chromosomal aberrations, del(6)(q12q26) and t(1;13)(q21.3;p13), which seem to be recurrent and could influence clinical outcome. Also the present case confirms the impact of the translocation t(1;19) on central nervous system relapse, which should be studied for underlying mechanisms in future.

  9. Development and validation of a highly sensitive LC-ESI-MS/MS method for estimation of IIIM-MCD-211, a novel nitrofuranyl methyl piperazine derivative with potential activity against tuberculosis: Application to drug development.

    Science.gov (United States)

    Magotra, Asmita; Sharma, Anjna; Gupta, Ajai Prakash; Wazir, Priya; Sharma, Shweta; Singh, Parvinder Pal; Tikoo, Manoj Kumar; Vishwakarma, Ram A; Singh, Gurdarshan; Nandi, Utpal

    2017-08-15

    In the present study, a simple, sensitive, specific and rapid liquid chromatography (LC) tandem mass spectrometry (MS/MS) method was developed and validated according to the Food and Drug Administration (FDA) guidelines for estimation of IIIM-MCD-211 (a potent oral candidate with promising action against tuberculosis) in mice plasma using carbamazepine as internal standard (IS). Bioanalytical method consisted of one step protein precipitation for sample preparation followed by quantitation in LC-MS/MS using positive electrospray ionization technique (ESI) operating in multiple reaction monitoring (MRM) mode. Elution was achieved in gradient mode on High Resolution Chromolith RP-18e column with mobile phase comprised of acetonitrile and 0.1% (v/v) formic acid in water at the flow rate of 0.4mL/min. Precursor to product ion transitions (m/z 344.5/218.4 and m/z 237.3/194.2) were used to measure analyte and IS, respectively. All validation parameters were well within the limit of acceptance criteria. The method was successfully applied to assess the pharmacokinetics of the candidate in mice following oral (10mg/kg) and intravenous (IV; 2.5mg/kg) administration. It was also effectively used to quantitate metabolic stability of the compound in mouse liver microsomes (MLM) and human liver microsomes (HLM) followed by its in-vitro-in-vivo extrapolation. Copyright © 2017 Elsevier B.V. All rights reserved.

  10. A randomized open-labeled study to demonstrate the non-inferiority of purified chick-embryo cell rabies vaccine administered in the Zagreb regimen (2-1-1) compared with the Essen regimen in Chinese adults.

    Science.gov (United States)

    Ma, Jingchen; Wang, Hongchang; Li, Jun; Chang, Likuan; Xie, Yun; Liu, Zhonglin; Zhao, Yuliang; Malerczyk, Claudius; Claudius, Malerczyk

    2014-01-01

    The Zagreb regimen has been used for 20 years in various countries. In China, until 2010, the Zagreb schedule was only approved for purified chick embryo cell vaccine (PCECV) and purified Vero cell rabies vaccines (PVRV). In this phase III clinical trial, we aimed to demonstrate the safety and immunogenic non-inferiority of the Zagreb regimen compared with the Essen regimen in healthy adult Chinese immunized with PCECV (Rabipur®). The study enrolled 825 subjects aged 18 to 50 years; serum samples were collected on Days 0, 7, 14, 42, and at 13 months to assess rabies virus neutralizing antibody (RVNA) concentrations. Solicited and unsolicited local and systemic reactions were recorded for 6 days following the day of vaccination, and collected throughout the entire study period (Day 1 until Month 13). The Zagreb regimen was non-inferior to the Essen regimen with regard to RVNA concentrations after 7, 14, and 42 days, and 13 months of immunization. The non-inferiority of seroconversion was established at Days 14 and 42. The incidence of local and systemic reactions was similar between groups, and mostly of mild or moderate severity. Vaccine-related adverse events occurred more frequently in the Essen group than in the Zagreb group. Vaccination with PCECV under a 2-1-1 regimen is as safe and immunogenic as under the traditional 5-dose Essen regimen for rabies post-exposure prophylaxis, and is a more cost-effective option, has a more practical vaccination schedule, and can potentially increase compliance.

  11. Aespoe Hard Rock Laboratory. Aespoe Task Force on Engineered Barrier System. Modelling of THM-coupled processes for benchmark 2.1.1 and 2.1.2 with the code GeoSys/RockFlow

    Energy Technology Data Exchange (ETDEWEB)

    Nowak, Thomas; Kunz, Herbert (Federal Inst. for Geosciences and Natural Resources, Hannover (Germany))

    2009-03-15

    In 2004 the Swedish Nuclear Fuel and Waste Management Co. (SKB) initiated the project 'Task Force on Engineered Barrier Systems'. This project has the objectives to verify the ability to model THM-coupled processes (task 1) and gas migration processes (task 2) in the clay-rich buffer materials. The tasks are performed on the basis of appropriate benchmarks. This report describes the final results for the modelling of the THM-benchmarks 2.1.1(Buffer/Container Experiment) and 2.1.2 (Isothermal Test) with the code GeoSys/RockFlow. Both in-situ experiments were conducted in the Canadian Whiteshell Underground Research Laboratory (URL). An interim report (NOWAK 2008) documented the results of two axially symmetric models. This report documents the calculations of a laboratory experiment on the buffer material that is used as calibration for the hydraulic properties of the buffer material, the setting-up of a 3-D model of the URL for both ITT and BCE and the modelling results in comparison to measured values.

  12. Coarctation of the aorta and mild to moderate developmental delay in a child with a de novo deletion of chromosome 15(q21.1q22.2

    Directory of Open Access Journals (Sweden)

    Peters Sarika U

    2006-02-01

    Full Text Available Abstract Background Deletion of 15q21q22 is a rare chromosomal anomaly. To date, there have been nine reports describing ten individuals with different segmental losses involving 15q21 and 15q22. Many of these individuals have common features of growth retardation, hypotonia and moderate to severe mental retardation. Congenital heart disease has been described in three individuals with interstitial deletion involving this region of chromosome 15. Case presentation We report a child with coarctation of the aorta, partial agenesis of corpus callosum and mild to moderate developmental delay, with a de novo deletion of 15q21.1q22.2, detected by the array Comparative Genomic Hybridization (CGH. We utilized chromosome 15-specific microarray-based CGH to define the chromosomal breakpoints in this patient. Conclusion This is the first description of mapping of an interstitial deletion involving the chromosome 15q21q22 segment using the chromosome 15-specific array-CGH. The report also expands the spectrum of clinical phenotype associated with 15q21q22 deletion.

  13. Crystal structure of bis-(2-{[1,1-bis-(hy-droxy-meth-yl)-2-oxidoeth-yl]imino-meth-yl}-6-meth-oxy-phenolato)manganese(IV) 0.39-hydrate.

    Science.gov (United States)

    Buvaylo, Elena A; Vassilyeva, Olga Yu; Skelton, Brian W

    2015-11-01

    The title compound, [Mn(C12H15NO5)2]·0.39H2O, is a 0.39 hydrate of the isostructural complex bis-(2-{[1,1-bis-(hy-droxy-meth-yl)-2-oxidoeth-yl]imino-meth-yl}-6-meth-oxy-phenolato)manganese(IV) that has previously been reported by Back, Oliveira, Canabarro & Iglesias [Z. Anorg. Allg. Chem. (2015), 641, 941-947], based on room-temperature data. The current structure that was determined at 100 K reveals a lengthening of the c cell parameter compared with the published one due to the incorporation of the partial occupancy water mol-ecule. The title compound crystallizes in the tetra-gonal chiral space group P41212; the neutral [Mn(IV)(C12H15NO5)2] mol-ecule is situated on a crystallographic C 2 axis. The overall geometry about the central manganese ion is octa-hedral with an N2O4 core; each ligand acts as a meridional ONO donor. The coordination environment of Mn(IV) at 100 K displays a difference in one of the two Mn-O bond lengths, compared with the room-temperature structure. In the crystal, the neutral mol-ecules are stacked in a helical fashion along the c-axis direction.

  14. Evaluating 99mTc Auger electrons for targeted tumor radiotherapy by computational methods.

    Science.gov (United States)

    Tavares, Adriana Alexandre S; Tavares, João Manuel R S

    2010-07-01

    Technetium-99m (99mTc) has been widely used as an imaging agent but only recently has been considered for therapeutic applications. This study aims to analyze the potential use of 99mTc Auger electrons for targeted tumor radiotherapy by evaluating the DNA damage and its probability of correct repair and by studying the cellular kinetics, following 99mTc Auger electron irradiation in comparison to iodine-131 (131I) beta minus particles and astatine-211 (211At) alpha particle irradiation. Computational models were used to estimate the yield of DNA damage (fast Monte Carlo damage algorithm), the probability of correct repair (Monte Carlo excision repair algorithm), and cell kinetic effects (virtual cell radiobiology algorithm) after irradiation with the selected particles. The results obtained with the algorithms used suggested that 99mTc CKMMX (all M-shell Coster-Kroning--CK--and super-CK transitions) electrons and Auger MXY (all M-shell Auger transitions) have a therapeutic potential comparable to high linear energy transfer 211At alpha particles and higher than 131I beta minus particles. All the other 99mTc electrons had a therapeutic potential similar to 131I beta minus particles. 99mTc CKMMX electrons and Auger MXY presented a higher probability to induce apoptosis than 131I beta minus particles and a probability similar to 211At alpha particles. Based on the results here, 99mTc CKMMX electrons and Auger MXY are useful electrons for targeted tumor radiotherapy.

  15. Immunogenicity and safety of purified vero cell rabies vaccine (PVRV) produced by Liaoning Cheng Da Co. under Zagreb 2-1-1 or 5-dose Essen regimen in Chinese adults aged 50 and above.

    Science.gov (United States)

    Wang, Jing; Luo, FengJi; Feng, ZiJian; Li, Li; Bai, YunHua; Ai, Xing; Ma, JianXin; Zhang, Zheng; Shi, NianMin

    2017-01-02

    Two kinds of regimens (2-1-1 and 1-1-1-1-1) can be selected after Zagreb regimen(2-1-1)of PVRV was officially approved in Beijing in January 2015. Up to now, the subjects for most studies about the comparison between Zagreb and Essen regimen are under 50 y old, rarely at and above. Aging of the immune system may result in decreasing efficacy of vaccination, especially for adults aged above 65-70 y. This study compared the safety and immunogenicity of the Zagreb and Essen regimen in Chinese adults aged 50 and above with the goal to provide a supplemental data for this age group. A total of 114 cases were divided into 2 groups randomly, received PVRV under the Zagreb and Essen regimens respectively. Serum samples were collected at D0, D7, D14, D42, D180 and D365 to determine the rabies serum neutralizing antibody by rapid fluorescent focus inhibition test (RFFIT). Safety analyses were made by comparing the AEs in day-3, day-7, and day-(7 + 21) in Zagreb or day-(7 + 28) in Essen by gender and age cohorts. 617 blood samples were obtained. Two groups showed similar immunogenicity, the neutralizing antibody titer of all subjects at D14 and D42 showed >0.5 IU/ml. Under the same regimen, Subjects ≥65 y had lower GMC than those who <65 years from D7 to D365 within 2 groups. This difference was significantly shown on D7, D14, D180 in Zagreb group, and on D180 in Essen group (t = 2.38, p = 0.02; t = 3.78, p < 0.001; t = 2.30, p = 0.03; t = 4.42, p < 0.001). Subjects<65 years had higher seroconversion rate compared to ≥65 y on D7, D180 and D365 in both 2 groups, this difference was also significantly shown on D180, D365 in Zagreb group and on D180 in Essen group (χ 2 = 20.66, p < 0.001; χ 2 = 6.56, p = 0.02; χ 2 = 10.96, p = 0.002). Two regimens all showed favorable performances with mildly or common adverse events (AEs). The incidence of local AEs after 3 d in Essen group was higher than Zagreb group (χ 2 = 9.69, p = 0.002). The most common local AE was pain

  16. Spectroscopic study of erbium-activated crystals of double calcium yttrium fluoride Ca0.89Y0.11F2.11:Er3+: I. Intensity of spectra and luminescence kinetics

    Science.gov (United States)

    Tkachuk, A. M.; Ivanova, S. É.; Pellé, F.

    2009-06-01

    Ca0.89Y0.11F2.11:Er3+ (CYF:Er) crystals with an erbium content of 1-15 at % have been grown. The optical spectra and luminescence kinetics of CYF:Er crystals have been investigated at low (˜5 K) and room temperatures. Based on an analysis of the absorption spectra at low temperature, the structure of Stark splitting of erbium levels in CYF:Er crystals is determined. Room-temperature absorption spectra are used to calculate the spectra of absorption cross sections and oscillator strengths of transitions from the erbium ground state to excited multiplets. It is shown that the absorption spectrum of CYF:Er crystals contains broad bands in the ranges of 790-815 and 965-980 nm, which correspond to the range of emission of laser diodes. For the band peaking near 967 nm, the peak absorption cross section is σ{abs/max} = 2.7 × 10-21 cm2. The intensity parameters are determined by the Judd-Ofelt method to be Ω2 = 1.39 × 10-20, Ω4 = 1.34 × 10-20, and Ω6 = 2.24 × 10-20 cm2. The radiative transition probabilities, radiative lifetimes, and branching ratios are calculated with these values. The luminescence decay kinetics from excited erbium levels upon selective excitation is investigated and the experimental lifetimes of the 4 F 9/2, 4 S 3/2, and 4 G 11/2 radiative erbium levels are determined. The dependences of multiphonon relaxation rates on the energy gap in CYF:Er crystals are obtained. The rates of nonradiative multiphonon relaxation from radiative erbium levels are determined.

  17. Areva excellent business volume: backlog as of december 31, 2008: + 21.1% to 48.2 billion euros. 2008 revenue: + 10.4% to 13.2 billion euros; Areva excellent niveau d'activite: carnet de commandes au 31/12/2008: + 21,1% a 48,2 Mds d'euros. Chiffre d'affaires de l'exercice 2008: + 10,4% a 13,2 Mds d'euros

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2009-07-01

    AREVA's backlog stood at 48.2 billion euros as of December 31, 2008, for 21.1% growth year-on-year, including 21.8% growth in Nuclear and 16.5% growth in Transmission and Distribution. The Nuclear backlog came to 42.5 billion euros at December 31, 2008. The Transmission and Distribution backlog came to 5.7 billion euros at year-end. The group recognized revenue of 13.2 billion euros in 2008, for year-on-year growth of 10.4% (+9.8% like-for-like). Revenue outside France was up 10.5% to 9.5 billion euros, representing 72% of total revenue. Revenue was up 6.5% in the Nuclear businesses (up 6.3% LFL), with strong performance in the Reactors and Services division (+10.9% LFL) and the Front End division (+7.2% LFL). The Transmission and Distribution division recorded growth of 17% (+15.8% LFL). Revenue for the fourth quarter of 2008 rose to 4.1 billion euros, up 5.2% (+1.6% LFL) from that of the fourth quarter of 2007. Revenue for the Front End division rose to 3.363 billion euros in 2008, up 7.1% over 2007 (+7.2% LFL). Foreign exchange (currency translations) had a negative impact of 53 million euros. Revenue for the Reactors and Services division rose to 3.037 billion euros, up 11.8% over 2007 (+10.9% LFL). Foreign exchange (currency translations) had a negative impact of 47 million euros. Revenue for the Back End division came to 1.692 billion euros, a drop of 2.7% (-2.5% LFL). Foreign exchange (currency translations) had a negative impact of 3.5 million euros. Revenue for the Transmission and Distribution division rose to 5.065 billion euros in 2008, up 17.0% (+15.8% LFL)

  18. 5 CFR 9901.211 - Career groups.

    Science.gov (United States)

    2010-01-01

    ... Administrative Personnel DEPARTMENT OF DEFENSE HUMAN RESOURCES MANAGEMENT AND LABOR RELATIONS SYSTEMS (DEPARTMENT OF DEFENSE-OFFICE OF PERSONNEL MANAGEMENT) DEPARTMENT OF DEFENSE NATIONAL SECURITY PERSONNEL SYSTEM... work; qualifications or competencies; career or pay progression patterns; relevant labor-market...

  19. 25 CFR 211.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... mineral resources, title to which is held in trust by the United States, or is subject to a restriction... potential deposits of oil and gas, geothermal or solid mineral resources on the lands. Geothermal resources... which is held in trust by the United States or is subject to a restriction against alienation imposed by...

  20. 14 CFR 67.211 - Cardiovascular.

    Science.gov (United States)

    2010-01-01

    ... any of the following: (a) Myocardial infarction; (b) Angina pectoris; (c) Coronary heart disease that has required treatment or, if untreated, that has been symptomatic or clinically significant; (d...

  1. 48 CFR 211.274-1 - General.

    Science.gov (United States)

    2010-10-01

    ... delivered to DoD that will enhance logistics, contracting, and financial business transactions supporting... on leading practices and embraces open standards, DoD can— (a) Achieve lower life-cycle cost of item...

  2. 50 CFR 300.211 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... Wildlife and Fisheries INTERNATIONAL FISHING AND RELATED ACTIVITIES INTERNATIONAL FISHERIES REGULATIONS... does not directly or indirectly disclose the identity or business of any person who submits such... in context, any territory that has been authorized by an appropriate Contracting Party to participate...

  3. 12 CFR 211.21 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... general public; (4) Not used to pay routine operating expenses in the United States such as salaries, rent... the Federal Reserve District in which the foreign bank's home state is located. (d) Banking subsidiary... activities usual in connection with the business of banking in the countries where it is organized or...

  4. 48 CFR 211.275-2 - Policy.

    Science.gov (United States)

    2010-10-01

    ... that— (1) Contain items in any of the following classes of supply, as defined in DoD 4140.1-R, DoD Supply Chain Materiel Management Regulation, AP1.1.11: (i) Subclass of Class I—Packaged operational... administrative and housekeeping supplies and equipment. (iii) Class IIIP—Packaged petroleum, lubricants, oils...

  5. Publications | Page 211 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Computable features required to evaluate the efficacy of drugs and a universal algorithm to find optimally effective drug in a drug complex (open access). Background The H1N1 pandemic in 2009 and the H5N1 pandemic in 2005 demonstrated that the drugs approved to treat influenza A viruses have low efficacy.

  6. 23 CFR 650.211 - Guidelines.

    Science.gov (United States)

    2010-04-01

    ... located in the coastal zone management areas of States with coastal zone management programs approved by... utilize “Guidance Specifying Management Measures for Sources of Nonpoint Source Pollution in Coastal... Protection Agency guidance document for the design of projects within coastal zone management areas. 3 This...

  7. 14 CFR 1274.211 - Award procedures.

    Science.gov (United States)

    2010-01-01

    ... agreement is to be awarded to a consortium, a completed, formally executed Articles of Collaboration is... Integrated Financial Management (IFM) System at each center, all grant and cooperative agreement recipients...) database. Registration is required in order to obtain a Commercial and Government Entity (CAGE) code, which...

  8. 47 CFR 211.5 - Priorities.

    Science.gov (United States)

    2010-10-01

    ... intelligence; (4) Distribute essential food and other supplies critical to health; (5) Provide for critical... Telecommunication OFFICE OF SCIENCE AND TECHNOLOGY POLICY AND NATIONAL SECURITY COUNCIL EMERGENCY RESTORATION... nongovernment users is essential to achieve the objective of a single restoration priority system. (a) Priority...

  9. 29 CFR 1603.211 - Subpoenas.

    Science.gov (United States)

    2010-07-01

    ... STATE AND LOCAL GOVERNMENT EMPLOYEE COMPLAINTS OF EMPLOYMENT DISCRIMINATION UNDER SECTION 304 OF THE... party, the administrative law judge may on behalf of the Commission issue a subpoena requiring the... shall state the name and address of the party at whose request the subpoena was issued, identify the...

  10. 21 CFR 211.56 - Sanitation.

    Science.gov (United States)

    2010-04-01

    ... assigning responsibility for sanitation and describing in sufficient detail the cleaning schedules, methods..., fungicides, fumigating agents, and cleaning and sanitizing agents. Such written procedures shall be designed...

  11. 33 CFR 211.102 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... REAL ESTATE ACTIVITIES OF THE CORPS OF ENGINEERS IN CONNECTION WITH CIVIL WORKS PROJECTS Reconveyance... Engineer District, Tulsa, at Tulsa, Okla. (e) Director of Civil Works. The term “Director of Civil Works” when used herein shall mean the Director of Civil Works, Office, Chief of Engineers or the Assistant...

  12. 45 CFR 211.8 - Continuing hospitalization.

    Science.gov (United States)

    2010-10-01

    ... Public Welfare Regulations Relating to Public Welfare OFFICE OF FAMILY ASSISTANCE (ASSISTANCE PROGRAMS), ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES CARE AND TREATMENT OF MENTALLY... Administrator deems it to be in the interest of the eligible person or of the hospital affected, the...

  13. 27 CFR 40.211 - Package.

    Science.gov (United States)

    2010-04-01

    ... TREASURY (CONTINUED) TOBACCO MANUFACTURE OF TOBACCO PRODUCTS, CIGARETTE PAPERS AND TUBES, AND PROCESSED... consumption), offer for sale, or sell or otherwise dispose of, after removal, any tobacco products that are...

  14. Reference: 211 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 10) cause Arabidopsis to exhibit exaggerated prototypical Pi starvation responses, including cessation of primary root growth, extens...ive lateral root and root hair development, increase in

  15. 21 CFR 211.1 - Scope.

    Science.gov (United States)

    2010-04-01

    ... manufacturing practice for preparation of drug products for administration to humans or animals. (b) The current good manufacturing practice regulations in this chapter as they pertain to drug products; in parts 600... foods are manufactured, processed, packed, or held under current good manufacturing practice. [43 FR...

  16. Publications | Page 211 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The study shows high levels of arsenic, mercury, manganese and lead in... Impact 2.0 - New mechanisms for linking research and policy - Final Technical Report (restricted access). "New mechanisms for linking research and policy" supported a series of small research projects examining the use of online social networking ...

  17. 49 CFR 397.211 - Preemption determination.

    Science.gov (United States)

    2010-10-01

    ... highway routing designation of a State, political subdivision thereof, or Indian tribe is preempted under... is placed on file in the public docket. The Administrator may publish the determination or notice of... agency decision as to whether a particular highway routing designation of a State, political subdivision...

  18. 40 CFR 211.203 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... all trials under otherwise identical test conditions. (cc) Reverberation Time. The time that would be... characterized by very short rise time and duration. (o) Label. That item, as described in this regulation, which... field in which the angle of arrival of sound at a given point in space is random in time. (bb) Real-Ear...

  19. 34 CFR 682.211 - Forbearance.

    Science.gov (United States)

    2010-07-01

    ... valid identity theft report as defined in section 603(q)(4) of the Fair Credit Reporting Act (15 U.S.C... alleged identity theft as defined in § 682.402(e)(14), for a period not to exceed 120 days necessary for... qualify the borrower for loan forgiveness and associated forbearance under the requirements of the teacher...

  20. 7 CFR 1280.211 - Prohibited activities.

    Science.gov (United States)

    2010-01-01

    ... and agents of the lamb industry from engaging in: (a) Any action that would be a conflict of interest... AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE LAMB PROMOTION, RESEARCH, AND INFORMATION ORDER Lamb Promotion, Research, and Information Order Lamb Promotion, Research, and Information...

  1. 47 CFR 211.4 - Policy.

    Science.gov (United States)

    2010-10-01

    ... transmission of precedence-type messages and calls. (d) Communications common carriers will not interrupt.... (e) It is recognized that as a practical matter in providing for the maintenance or restoration of a... intermachine trunks to be restored to provide capacity for priority access line traffic. (g) The carriers are...

  2. 42 CFR 2.11 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... treatment. Disclose or disclosure means a communication of patient indentifying information, the affirmative verification of another person's communication of patient identifying information, or the communication of any... to prevent or treat child abuse or neglect, including training on nutrition and child care and...

  3. 10 CFR 26.211 - Fatigue assessments.

    Science.gov (United States)

    2010-01-01

    ... condition is impaired alertness with no other behaviors or physical conditions creating a reasonable suspicion of possible substance abuse, then the licensee need only conduct a fatigue assessment. If the... conducted in response to events requiring post-event drug and alcohol testing as specified in § 26.31(c...

  4. 8 CFR 211.2 - Passports.

    Science.gov (United States)

    2010-01-01

    ... jurisdiction over the port of entry, may waive the alien's lack of passport and admit the alien as an immigrant... Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS DOCUMENTARY REQUIREMENTS: IMMIGRANTS... days beyond the expiration date of his or her immigrant visa shall be presented by each immigrant...

  5. 29 CFR 1910.211 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... handle similar to that of a plane and a shoulder at the rear end, which is used for pushing short stock... motor, after the clutch is engaged with the flywheel at rest. (41) Knockout means a mechanism for... assembly is separate from the operating mechanism and machine supports; it rests on its own independent...

  6. Oil and Gas Extraction Sector (NAICS 211)

    Science.gov (United States)

    Environmental regulatory information for oil and gas extraction sectors, including oil and natural gas drilling. Includes information about NESHAPs for RICE and stationary combustion engines, and effluent guidelines for synthetic-based drilling fluids

  7. 5 CFR 211.102 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... military pay and allowances in the armed forces, except for training or for determining physical fitness... such as promotions. (d) Armed forces means the United States Army, Navy, Air Force, Marine Corps, and... with military pay and allowances in the armed forces, including training or for determining physical...

  8. Immunization with a Double-Mutant (R192G/L211A) of the Heat-Labile Enterotoxin of Escherichia coli Offers Partial Protection against Campylobacter jejuni in an Adult Mouse Intestinal Colonization Model.

    Science.gov (United States)

    Albert, M John; Haridas, Shilpa; Ebenezer, Mathew; Raghupathy, Raj; Khan, Islam

    2015-01-01

    We have previously shown that antibodies to cholera toxin (CT) reacted with the major outer membrane proteins (MOMPs) from Campylobacter jejuni strains on Western blot. Further, oral immunization with CT significantly protected against challenge with C. jejuni in an adult mouse colonization model of infection. CT and the heat-labile enterotoxin (LT) of enterotoxigenic Escherichia coli are structurally and functionally related. LT and its mutants including the double-mutant LT (R192G/L211A) (dmLT), are powerful mucosal adjuvants. Unlike LT which is reactogenic, dmLT has been shown to be safe for human use. In the current study, we determined whether rabbit anti-dmLT antibodies reacted with MOMPs from C. jejuni strains and whether immunization with dmLT would afford protection against C. jejuni. On Western blot, the MOMPs from C. jejuni 48 (Penner serotype O:19), C. jejuni 75 (O:3) and C. jejuni 111 (O:1,44) were probed with rabbit antibodies to dmLT or LT-E112K (a non-toxic LT mutant), which showed a lack of reaction. Adult BALB/c mice were orally immunized with dmLT and orally challenged with C. jejuni 48 or 111. Protection from colonization with the challenge bacteria was studied by enumerating Campylobacter colonies in feces daily for 9 days. Vaccination produced robust serum and stool antibody responses to dmLT and no antibody responses to C. jejuni MOMP. Vaccinated mice showed reduced colonization and excretion of both challenge strains compared to control mice. However, the differences were not statistically significant. The protective efficacy of the dmLT vaccine varied from 9.1% to 54.5%. The lack of cross-reaction between the MOMP and dmLT suggests that protection is not mediated by cross-reacting antibodies, but may be due to activation of innate immunity. As dmLT is safe for humans, it could be incorporated into a C. jejuni vaccine to enhance its efficacy.

  9. Immunization with a Double-Mutant (R192G/L211A of the Heat-Labile Enterotoxin of Escherichia coli Offers Partial Protection against Campylobacter jejuni in an Adult Mouse Intestinal Colonization Model.

    Directory of Open Access Journals (Sweden)

    M John Albert

    Full Text Available We have previously shown that antibodies to cholera toxin (CT reacted with the major outer membrane proteins (MOMPs from Campylobacter jejuni strains on Western blot. Further, oral immunization with CT significantly protected against challenge with C. jejuni in an adult mouse colonization model of infection. CT and the heat-labile enterotoxin (LT of enterotoxigenic Escherichia coli are structurally and functionally related. LT and its mutants including the double-mutant LT (R192G/L211A (dmLT, are powerful mucosal adjuvants. Unlike LT which is reactogenic, dmLT has been shown to be safe for human use. In the current study, we determined whether rabbit anti-dmLT antibodies reacted with MOMPs from C. jejuni strains and whether immunization with dmLT would afford protection against C. jejuni. On Western blot, the MOMPs from C. jejuni 48 (Penner serotype O:19, C. jejuni 75 (O:3 and C. jejuni 111 (O:1,44 were probed with rabbit antibodies to dmLT or LT-E112K (a non-toxic LT mutant, which showed a lack of reaction. Adult BALB/c mice were orally immunized with dmLT and orally challenged with C. jejuni 48 or 111. Protection from colonization with the challenge bacteria was studied by enumerating Campylobacter colonies in feces daily for 9 days. Vaccination produced robust serum and stool antibody responses to dmLT and no antibody responses to C. jejuni MOMP. Vaccinated mice showed reduced colonization and excretion of both challenge strains compared to control mice. However, the differences were not statistically significant. The protective efficacy of the dmLT vaccine varied from 9.1% to 54.5%. The lack of cross-reaction between the MOMP and dmLT suggests that protection is not mediated by cross-reacting antibodies, but may be due to activation of innate immunity. As dmLT is safe for humans, it could be incorporated into a C. jejuni vaccine to enhance its efficacy.

  10. The susceptibility of FSHB -211G > T and FSHR G-29A, 919A > G, 2039A > G polymorphisms to men infertility: an association study and meta-analysis.

    Science.gov (United States)

    Wu, Qiuyue; Zhang, Jing; Zhu, Peiran; Jiang, Weijun; Liu, Shuaimei; Ni, Mengxia; Zhang, Mingchao; Li, Weiwei; Zhou, Qing; Cui, Yingxia; Xia, Xinyi

    2017-08-01

    Male infertility is a complex disorder caused by genetic, developmental, endocrine, or environmental factors as well as unknown etiology. Polymorphisms in the follicle stimulating hormone beta subunit (FSHB) (rs10835638, c.-211G > T) and follicle stimulating hormone receptor (FSHR) (rs1394205, c.-29G > A; rs6165, c.919A > G; rs6166, c.2039 A > G) genes might disturb normal spermatogenesis and affect male reproductive ability. To further ascertain the aforementioned effects, we conducted a case-control study of 255 infertile men and 340 fertile controls from South China using the Mass ARRAY method, which was analyzed by the t-tests and logistic regression analysis using SPSS for Windows 14.0. In addition, a meta-analysis was performed by combining our results with previous reports using STATA 12.0. In the FSHB or FSHR gene single nucleotide polymorphism (SNP) evaluation, no statistically-significant difference was found in the frequency of allelic variants or in genotype distribution between cases and controls. However, a significant association for the comparison of GAA (P: 0.022, OR: 0.63, 95%CI: 0.43-0.94) was seen between the oligozoospermia and controls in haplotype analysis of rs1394205/rs6165/rs6166. In the meta-analysis, rs6165G allele and rs6166 GG genotype were associated with increased risk of the male infertility. This study suggested that FSHR GAA haplotype would exert protective effects against male sterility, which indicated that the combination of three SNP genotypes of FSHR was predicted to have a much stronger impact than either one alone. Then in the meta-analysis, a significant association was seen between FSHR rs6165, rs6166 polymorphisms and male infertility. In terms of male infertility with multifactorial etiology, further studies with larger sample sizes and different ethnic backgrounds or other risk factors are warranted to clarify the potential role of FSHB and FSHR polymorphisms in the pathogenesis of male infertility.

  11. Corrigendum to "Observation of Neon at mid and high latitudes in the sunlit Lunar Exosphere: Results from CHACE aboard MIP/Chandrayaan-1", Vol. 272 (2016), pp 206-211, doi 10.1016/j.icarus.2016.02.030

    Science.gov (United States)

    Pratim Das, Tirtha; Thampi, Smitha V.; Bhardwaj, Anil; Ahmed, S. M.; Sridharan, R.

    2017-03-01

    Our paper titled "Observation of Neon at mid and high latitudes in the sunlit Lunar Exosphere: Results from CHACE aboard MIP/Chandrayaan-1" (Icarus 272 (2016) 206-211) presents the results of the observations on the distribution of neutral Neon in the mid and high lunar latitudes by the CHACE instrument aboard Moon Impact Probe (MIP) in Chandrayaan-1. The authors recently noticed two errors in the representation of the results in two figures, although there is no change in the reported number densities and the other interpretations of the results.

  12. Alpha particle emitters in medicine

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, D.R.

    1989-09-01

    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ({sup 211}At) and natural bismuth-212 ({sup 212}Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ({sup 223}Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs.

  13. Enterotoxigenic Escherichia coli (ETEC) adhesin-toxoid MEFA (multiepitope fusion antigen) CFA/I/II/IV-3xSTaN12S-mnLTG192G/L211A derived antibodies inhibit adherence of seven adhesins (CFA/I, CFA/II & CFA/IV), neutralize enterotoxicity of both toxins (LT & STa), and protect piglets against diarrhea.

    Science.gov (United States)

    Nandre, Rahul; Ruan, Xiaosai; Lu, Ti; Duan, Qiangde; Sack, David; Zhang, Weiping

    2017-12-20

    Enterotoxigenic Escherichia coli (ETEC) are a leading cause of children's diarrhea and travelers' diarrhea. Vaccines inducing antibodies to broadly inhibit bacterial adherence and to neutralize toxin enterotoxicity are expected effective against ETEC-associated diarrhea. 6xHis-tagged adhesin-toxoid fusion proteins were shown to induce neutralizing antibodies to several adhesins and LT and STa toxins (X. Ruan, DA Sack, W. Zhang, PLoS ONE, 10:e0121623, 2015). However, antibodies derived from his-tagged CFA/I/II/IV-2xSTaA14Q-dmLT or CFA/I/II/IV-2xSTaN12S-dmLT protein were less effective in neutralizing STa enterotoxicity and were not evaluated in vivo for efficacy against ETEC diarrhea. Additionally, his-tagged proteins are considered less desirable for human vaccines. In this study, we produced a tag-less adhesin-toxoid MEFA (multiepitope fusion antigen) protein, enhanced anti-STa immunogenicity by including a third copy of STa toxoid STaN12S, and examined antigen immunogenicity in a murine model. Moreover, we immunized pregnant pigs with the tag-less adhesin-toxoid MEFA protein and evaluated passive antibody protection against STa+ or LT+ ETEC infection in a pig challenge model. Results showed that tag-less adhesin-toxoid MEFA CFA/I/II/IV-3xSTaN12S-mnLTR192G/L211A induced broad anti-adhesin and antitoxin antibody responses in the intraperitoneally immunized mice and the intramuscularly immunized pigs. Mouse and pig serum antibodies significantly inhibited adherence of seven CFA adhesins (CFA/I, CS1 to CS6) and effectively neutralized both toxins. More importantly, suckling piglets born to the immunized mothers acquired antibodies and were protected against STa+ ETEC and LT+ ETEC diarrhea. These results indicated tag-less CFA/I/II/IV-3xSTaN12S-mnLTR192G/L211A induced broadly protective anti-adhesin and antitoxin antibodies and suggested this adhesin-toxoid MEFA a potential antigen for developing broadly protective ETEC vaccines. Copyright © 2017 American Society for

  14. Multiple Nonconformities in Ice-Walled Lake Successions Indicate Periods with Cold Summers (24.4 - 22.5 ka, 21.1 - 19.2 ka, 18.5 - 18.1 ka) during the Last Deglaciation in Northeastern Illinois, USA

    Science.gov (United States)

    Curry, B. B.

    2014-12-01

    Unprecedented age control on many last glacial stratigraphic units and morainal ice-margin positions are interpreted from AMS radiocarbon ages of tundra plant macrofossils archived in low-relief ice-walled lake plain (IWLP) deposits the Lake Michigan Lobe (south-central Laurentide Ice Sheet). IWLPs are periglacial features that formed on morainal dead-ice permafrost. Lacustrine sediment, and the fossils contained therein, had physical and temporal proximity to the glacier which formed the underlying moraine. In modern ice-walled lakes, as the lake's ice cover begins to melt, moats form which allows access of sloughing tundra-mantled active layer sediment (soil) into the lakes. Multiple AMS ages from two sites with proglacial sediment buried by glacial max LIS diamicton, and IWLPs reveal evidence of episodic plant growth and sedimentation including ca. 24.0 to 24.4 ka (post Shelby Phase), 22.5 to 21.1 ka (post Livingston Phase), 18.1 to 17.4 ka (post Woodstock Phase). Although presently based on negative evidence, the associated nonconformities (listed in title) indicate periods when cold conditions did not promote development of the estival moat. Although the evidence does not preclude tundra growth during the cold summers, there was little landscape modification due to limited thawing of the active layer. At approximately the onset of the 19.2-18.5 "warm" period, at least two large deglacial discharge events flooded the Fox and Kankakee tributary valleys of the Illinois River. The latter, known as the Kankakee Torrent, occurred at 19.05 - 18.85 ka (σ1 range) at the Oswego channel complex. The temporal coincidence of the torrents and sedimentation in ice-walled lakes suggests that the post-Livingston Phase nonconformity (21.1 - 19.2 ka) was a period of lessened meltwater discharge through subglacial conduits (tunnel valleys) as the frozen toe promoted formation of subglacial lakes, buildup of pore-water pressures, and the release of subglacial water as "torrents

  15. 76 FR 65941 - Airworthiness Directives; Rolls-Royce plc RB211-524 Series, RB211-Trent 700 Series, and RB211...

    Science.gov (United States)

    2011-10-25

    ...-08-AD; Amendment 39-16849; AD 2011-22-07] RIN 2120-AA64 Airworthiness Directives; Rolls-Royce plc... for Service Information One commenter, Rolls-Royce plc (RR), asked us to consider changing the... Corporate Communications at Rolls-Royce plc, PO Box 31, Derby, DE24 8BJ, United Kingdom, phone: 011-44-1331...

  16. Assignment of human protein phosphatase 2A regulatory subunit genes B56{alpha}, B56{beta}, B56{gamma}, B56{delta}, and B56{epsilon} (PPP2R5A-PPP2R5E), highly expressed in muscle and brain, to chromosome regions 1q41, 11q12, 3p21, 6p21.1, and 7p11.1 {r_arrow} p12

    Energy Technology Data Exchange (ETDEWEB)

    McCright, B.; Virshup, D.M.; Brothman, A.R. [Univ. of Utah School of Medicine, Salt Lake City, UT (United States)

    1996-08-15

    The activity of the major intracellular protein phosphatase, protein phosphatase 2A WPM, is determined by the nature of the associated regulatory subunit. A new family of human PP2A regulatory subunits has recently been identified. Three of these subunits, B56{beta}, B56{delta}, and B56{epsilon}, are most highly expressed in brain, while the B56{alpha} and B56{gamma} isoforms are highly expressed in cardiac and skeletal muscle. Genes PPP2R5A-PPP2R5E encoding the phosphatase regulatory proteins B56{alpha}, B56{beta}, B56{gamma}, B56{delta}, and B56{epsilon} have now been mapped by fluorescence in situ hybridization to chromosome regions 1q41, 11q12, 3p21, 6p21.1, and 7p11.2-p12, respectively. 16 refs., 1 fig.

  17. RCT: Module 2.11, Radiological Work Coverage, Course 8777

    Energy Technology Data Exchange (ETDEWEB)

    Hillmer, Kurt T. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-07-20

    Radiological work is usually approved and controlled by radiation protection personnel by using administrative and procedural controls, such as radiological work permits (RWPs). In addition, some jobs will require working in, or will have the potential for creating, very high radiation, contamination, or airborne radioactivity areas. Radiological control technicians (RCTs) providing job coverage have an integral role in controlling radiological hazards. This course will prepare the student with the skills necessary for RCT qualification by passing quizzes, tests, and the RCT Comprehensive Phase 1, Unit 2 Examination (TEST 27566) and will provide in-the-field skills.

  18. 48 CFR 852.211-73 - Brand name or equal.

    Science.gov (United States)

    2010-10-01

    ... purchasing activity. Accordingly, to insure that sufficient information is available, the bidder must furnish... information) necessary for the purchasing activity to: (i) Determine whether the product offered meets the... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Brand name or equal. 852...

  19. Genetics Home Reference: 1q21.1 microdeletion

    Science.gov (United States)

    ... from the genetic change that causes thrombocytopenia-absent radius syndrome (TAR syndrome). TAR syndrome results from the ... C, Stevenson RE, Antonarakis SE, Chen C, Estivill X, Menten B, Gimelli G, Gribble S, Schwartz S, Sutcliffe JS, ...

  20. 25 CFR 211.1 - Purpose and scope.

    Science.gov (United States)

    2010-04-01

    ... the development of Indian tribal oil and gas, geothermal, and solid mineral resources except as... lands the title to which is held in trust by the United States or is subject to a restriction against alienation imposed by the United States. These regulations are intended to ensure that Indian mineral owners...

  1. 22 CFR 211.5 - Obligations of cooperating sponsor.

    Science.gov (United States)

    2010-04-01

    ... efficient operation of the program, including personnel to: (1) Plan, organize, implement, control, and... sponsor's internal audit or program staff, by expanding the scope of the independent financial and... conducted annually with respect to donated commodities and monetized proceeds, if commodity sales are...

  2. 9 CFR 113.211 - Feline Rhinotracheitis Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... production. All serials of vaccine shall be prepared from the first through the fifth passage from the Master... immunogenicity of vaccine prepared from the Master Seed in accordance with the Outline of Production shall be... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Feline Rhinotracheitis Vaccine, Killed...

  3. 2,11-Dibromo-5,8-dibutyl[4]helicene

    Directory of Open Access Journals (Sweden)

    Hiroyuki Isobe

    2012-04-01

    Full Text Available A racemic mixture of the title compound, C26H26Br2, a brominated [4]helicene, crystallizes, forming columns of stacked molecules. There are two crystallographically unique molecules in the asymmetric unit, both with the same helical handedness. As is typical with helicene congeners, the unique molecules show short interatomic contacts between H atoms at the fjord region, with H...H distances of 1.87 and 1.94 Å. Molecules with the same helical handedness segregate in the crystal packing, forming homochiral columns. The stacked molecules are piled in a column with alternate orientations. The shortest C...C distance in the stacked molecules is 3.306 (4 Å.

  4. 48 CFR 252.211-7003 - Item identification and valuation.

    Science.gov (United States)

    2010-10-01

    ... to a class of items with the same form, fit, function, and interface. Parent item means the item..., and parts embedded within delivered items as specified in Attachment Number __. (2) The unique item... item identifier is used). (10) Government's unit acquisition cost. (11) Unit of measure. (e) For...

  5. 46 CFR 10.211 - Criminal record review.

    Science.gov (United States)

    2010-10-01

    ... Applicants for MMCs Who Have Criminal Convictions Crime 1 Assessment periods Minimum Maximum Assessment Periods for Officer and Rating Endorsements Crimes Against Persons: Homicide (intentional) 7 years 20...) 1 year 5 years. Sexual Assault (rape, child molestation) 5 years 10 years. Robbery 5 years 10 years...

  6. Dicty_cDB: SHK211 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KSVDIHPTEPWILASLYDGNV YIWNYETQNMVKSFEVSPNNPVRTARFIAKKQWIVTGSDDTYIRVYNYNTMEKIKSFEAH ADYIRCIIVHPTLPYIL...KSVDIHPTEPWILASLYDGNV YIWNYETQNMVKSFEVSPNNPVRTARFIAKKQWIVTGSDDTYIRVYNYNTMEKIKSFEAH ADYIRCIIVHPTLPYIL

  7. Dicty_cDB: VHE211 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available F143854.1 Sinantherina socialis 82 kD heat shock protein (hsp82) gene, partial cd...Naegleria gruberi strain ATCC 30224 heat shock protein 90 (HSP-90) gene, partial cds. 86 3e-46 7 AF143854 |A

  8. 45 CFR 211.14 - Disclosure of information.

    Science.gov (United States)

    2010-10-01

    ... obtained at any time by any person, organization, or institution in the course of discharging the duties of... received by such agency or hospital in the course of discharging the duties under such agreement except as.... (b) An agreement made with an agency or hospital for care, treatment, and assistance pursuant to the...

  9. 29 CFR 553.211 - Law enforcement activities.

    Science.gov (United States)

    2010-07-01

    ... parking violations and issuing appropriate warnings or appearance notices, (7) Wage and hour compliance officers, (8) Equal employment opportunity compliance officers, (9) Tax compliance officers, (10) Coal... institution is any government facility maintained as part of a penal system for the incarceration or detention...

  10. 12 CFR 211.10 - Permissible activities abroad.

    Science.gov (United States)

    2010-01-01

    ... services offered abroad by the investor or others; (17) Underwriting life, annuity, pension fund-related...; (11) Organizing, sponsoring, and managing a mutual fund, if the fund's shares are not sold or distributed in the United States or to U.S. residents and the fund does not exercise managerial control over...

  11. 211 English Language, the Nigerian Education System and Human ...

    African Journals Online (AJOL)

    competence in the use of English language. Conclusion. Many issues have been raised in this paper some of which are: the communicative role of language, education as an instrument for change and human development, the importance of English as the language of education in Nigeria and the benefits of literacy in.

  12. Library Systems Office Organization. SPEC Kit and SPEC Flyer 211.

    Science.gov (United States)

    Muir, Scott P., Comp.

    The roles and responsibilities of the library systems officer continues to change as libraries move beyond the automation of library functions to offering resources in electronic formats and electronic access to information about collections beyond the walls of the home institution. This survey was designed to collect data and document some of the…

  13. 22 CFR Appendix I to Part 211 - Operational Plan

    Science.gov (United States)

    2010-04-01

    ...., that are necessary to achieve program impact, including determination of financial costs and sources of..., analysis and utilization of information. Include a schedule for carrying out the evaluation as well as a...) and (b), will be met. 5. Logistics. Provide a logistics plan that demonstrates the adequacy and...

  14. 48 CFR 252.211-7006 - Radio Frequency Identification.

    Science.gov (United States)

    2010-10-01

    ... of goods as well as additional information relating to the shipment, such as order information... configuration of goods within the transportation equipment. Bulk commodities means the following commodities... products such as seeds, grains, or animal feed. Case means either a MIL-STD-129 defined exterior container...

  15. 48 CFR 852.211-70 - Service data manuals.

    Science.gov (United States)

    2010-10-01

    ..., lubricating, mechanical adjustments and circuit calibration. Corrective maintenance shall consist of the data... (NOV 1984) (a) The successful bidder will supply operation/maintenance (service data) manuals with each... nomenclature, model number, effective date of the manual and the manufacturer's name and address. If the manual...

  16. 21 CFR 211.208 - Drug product salvaging.

    Science.gov (United States)

    2010-04-01

    ... (including animal feeding studies where applicable) that the drug products meet all applicable standards of identity, strength, quality, and purity and (b) evidence from inspection of the premises that the drug... that the drug products meet appropriate standards of identity, strength, quality, and purity. Records...

  17. 22 CFR 211.4 - Availability and shipment of commodities.

    Science.gov (United States)

    2010-04-01

    ... United States will finance the transfer of commodities at the lowest combination inland and ocean... must be submitted with requests for reimbursement. (e) Shipping instructions—(1) Shipments booked by A...

  18. Dicty_cDB: VFD211 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3276.1 Sequence 387 from Patent WO0102550. 66 8e-19 4 BI743342 |BI743342.1 kx41g12.y1 Parastrongyloides tric...hosuri FL pAMP1 v1 Chiapelli McCarter Parastrongyloides trichosuri cDNA 5' simila...r to SW:RS1A_STRPU P33095 40S RIBOSOMAL PROTEIN S15A ;, mRNA sequence. 80 4e-18 3 BG661408 |BG661408.1 kx01e04.y1 Parastrongyloides... trichosuri IL SL1 TOPO v2 Parastrongyloides trichosuri cDNA similar to SW:RS1A_HUMAN...661537.1 kx03b05.y1 Parastrongyloides trichosuri IL SL1 TOPO v2 Parastrongyloides trichosuri cDNA similar to

  19. Dicty_cDB: CHF211 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AY326398 |pid:none) Mya arenaria mitochondrial mortali... 230 7e-59 CP001016_127( CP001016 |pid:none)...EF028390_1( EF028390 |pid:none) Lytechinus variegatus mortalin mRN... 228 3e-58 protein update 2009. 3.31 PSORT

  20. Dicty_cDB: CHR211 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 'HPRT insertion targeting and chromosome engineering clone MHPN350f07. 50 0.13 1 ...BX965467 |BX965467.1 Forward strand read from insert in 5'HPRT insertion targeting and chromosome engineering

  1. 40 CFR 240.211-3 - Recommended procedures: Operations.

    Science.gov (United States)

    2010-07-01

    ... instruments. (13) Problems encountered and methods of solution. (d) An annual report should be prepared which... including at least monthly averages. (3) Number and qualifications of personnel in each job category; total... injuries, their cause and preventive measures instituted. (4) An identification and brief discussion of...

  2. 21 CFR 211.67 - Equipment cleaning and maintenance.

    Science.gov (United States)

    2010-04-01

    ...) Maintenance and cleaning schedules, including, where appropriate, sanitizing schedules; (3) A description in sufficient detail of the methods, equipment, and materials used in cleaning and maintenance operations, and the methods of disassembling and reassembling equipment as necessary to assure proper cleaning and...

  3. Genetics Home Reference: 1q21.1 microduplication

    Science.gov (United States)

    ... behavioral problems. Psychiatric disorders such as schizophrenia or mood disorders such as anxiety or depression occur in some ... Information What information about a genetic condition can statistics provide? Why are some genetic conditions more common ...

  4. All projects related to | Page 211 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Acute and Early HIV1 Infection in Childbearing Women during Pregnancy and Postpartum Period in Tanzania, Zambia, and Botswana. Project. National HIV ... Topic: SOUTH AFRICA, DISEASE TRANSMISSION, SEXUALLY TRANSMITTED DISEASES, HEALTH SERVICES, HEALTH EDUCATION. Region: South Africa ...

  5. 40 CFR 180.211 - Propachlor; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ..., meat 0.02 Horse, meat byproducts, except kidney 0.05 Milk 0.02 Sheep, fat 0.05 Sheep, kidney 0.2 Sheep, meat 0.02 Sheep, meat byproducts, except kidney 0.05 Sorghum, forage, forage 8.0 Sorghum, grain, forage...

  6. 21 CFR 211.113 - Control of microbiological contamination.

    Science.gov (United States)

    2010-04-01

    ..., designed to prevent objectionable microorganisms in drug products not required to be sterile, shall be... shall include validation of all aseptic and sterilization processes. [43 FR 45077, Sept. 29, 1978, as...

  7. Dicty_cDB: SFB211 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ---SKTNQCYAVILKFIKDAAKWNIDLNNFSLVGDSAGGNMAIVLGLMAKVRNGPSFKRI CLYYPAIDSGMNSGSYKEFHNDFYLTKDGMKWFWDAYTNSPKDTNEIYCSPSKCKESDVM...---SKTNQCYAVILKFIKDAAKWNIDLNNFSLVGDSAGGNMAIVLGLMAKVRNGPSFKRI CLYYPAIDSGMNSGSYKEFHNDFYLTKDGMKWFWDAYTNSPKDTNEIYCSPSKCKESDVM

  8. 47 CFR 73.211 - Power and antenna height requirements.

    Science.gov (United States)

    2010-10-01

    ... must operate with a minimum effective radiated power (ERP) as follows: (i) The minimum ERP for Class A stations is 0.1 kW. (ii) The ERP for Class B1 stations must exceed 6 kW. (iii) The ERP for Class B stations must exceed 25 kW. (iv) The ERP for Class C3 stations must exceed 6 kW. (v) The ERP for Class C2...

  9. 77 FR 211 - National Stalking Awareness Month, 2012

    Science.gov (United States)

    2012-01-03

    ... suffer anxiety attacks, feelings of anger or helplessness, and depression. Fearing for their safety, some... are real, and they take a profound and ongoing toll on men, women, teens, and children across our...

  10. 21 CFR 211.186 - Master production and control records.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Records and..., and signed by a second person. The preparation of master production and control records shall be... variations may be permitted, however, in the amount of components necessary for the preparation in the dosage...

  11. 14 CFR 171.211 - Maintenance and operations requirements.

    Science.gov (United States)

    2010-01-01

    ..., the owner or his representative shall participate. (e) The owner shall provide a stock of spare parts... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Maintenance and operations requirements... Maintenance and operations requirements. (a) The owner of the facility shall establish an adequate maintenance...

  12. 48 CFR 2052.211-71 - Technical progress report.

    Science.gov (United States)

    2010-10-01

    ... Report to the project officer and the contracting officer. The report is due within 15 calendar days after the end of the report period and must identify the title of the project, the contract number... investigator, the contract period of performance, and the period covered by the report. Each report must...

  13. 48 CFR 211.274-3 - Policy for valuation.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE ACQUISITION PLANNING DESCRIBING AGENCY NEEDS Using and Maintaining Requirements... the time of delivery; and (3) For items delivered under a time-and-materials contract, the contractor...

  14. 48 CFR 52.211-5 - Material Requirements.

    Science.gov (United States)

    2010-10-01

    ... (CONTINUED) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52... components, whether manufactured from virgin material, recovered material in the form of raw material, or..., and commonly reused within, an original manufacturing process. Remanufactured means factory rebuilt to...

  15. 5 CFR 575.211 - Termination of a service agreement.

    Science.gov (United States)

    2010-01-01

    ...., for unacceptable performance or conduct), if the employee receives a rating of record (or an official performance appraisal or evaluation under a system not covered by 5 U.S.C. chapter 43 or 5 CFR part 430) of... needs of the agency. For example, an agency may terminate a service agreement when the employee's...

  16. 18 CFR 281.211 - Filing and documentation.

    Science.gov (United States)

    2010-04-01

    ... in writing no later than July 31, 1979, and shall be accompanied by the data described in paragraph... priority 1 entitlements) be reclassified as priority 1 entitlements. Such requests shall be made in writing...) Priority 2—1) Essential agricultural users. (i) Each request for classification of essential agricultural...

  17. 25 CFR 211.27 - Duration of leases.

    Science.gov (United States)

    2010-04-01

    ... duration shall be measured from the date of approval by the Secretary. (b) An oil and gas or geothermal... duration without actual production of oil, gas, or geothermal resources. Provided, that this extension does... committed shall be considered as if it occurs on the leasehold itself. If there is a conflict between the...

  18. 25 CFR 211.56 - Geological and geophysical permits.

    Science.gov (United States)

    2010-04-01

    ... conflict with any mineral leases entered into pursuant to this part, may be approved by the Secretary with... contract, or authorize the production of, or removal of oil and gas, geothermal resources, or other...

  19. Imagery metadata development based on ISO/TC 211 standards

    Directory of Open Access Journals (Sweden)

    Rong Xie

    2007-04-01

    Full Text Available This paper reviews the present status and major problems of the existing ISO standards related to imagery metadata. An imagery metadata model is proposed to facilitate the development of imagery metadata on the basis of conformance to these standards and combination with other ISO standards related to imagery. The model presents an integrated metadata structure and content description for any imagery data for finding data and data integration. Using the application of satellite data integration in CEOP as an example, satellite imagery metadata is developed, and the resulting satellite metadata list is given.

  20. 12 CFR 211.43 - Allocated transfer risk reserve.

    Science.gov (United States)

    2010-01-01

    ... set forth in the “Instructions to Consolidated Financial Statements for Bank Holding Companies” (Form... specified. (3) Consolidation. A banking institution shall establish an ATRR, as required, on a consolidated... set forth in the instructions for preparation of Consolidated Reports of Condition and Income (FFIEC...

  1. Dicty_cDB: VHO211 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nogaster tweety (tty), flightless (fli), dodo (dod), penguin (pen), small optic lobes (sol), innocent byst...ander (iby), waclaw (waw), bobby sox (bbx), sluggish (slg), helicase (hlc), misato

  2. Worker-Centered Learning: Labor's Role. ERIC Digest No. 211.

    Science.gov (United States)

    Spence, Janet G.

    Globalization of the economy and rapid technological innovation challenge today's work force to prepare for continuous change. In response to a strong mandate from their membership, labor unions have formed partnerships to deliver the necessary worker education. Because they are in daily contact with workers and have a holistic knowledge of…

  3. Publications | Page 211 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Bulletin research matters, juin 2008 (open access) · Gestion de la demande en eau : tirer le meilleur parti des ressources hydriques disponibles (restricted access) · Modes de gestion des hommes et des femmes entrepreneurs dans les petites et moyennes entreprises (PME) à Dakar : mémoire de maîtrise (restricted access).

  4. Dicty_cDB: CFC211 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fspqikrwyanfcqnphw*dyytrs*rf* *h*ec*sqnprqrrystrsttshfrr*tiggwsysl*lqhskgihspfssqikrwyanfc knshw*nhy...fspqikrwyanfcqnphw*dyytrs*rf* *h*ec*sqnprqrrystrsttshfrr*tiggwsysl*lqhskgihspfssqikrwyanfc knshw*nhy

  5. SPECT assay of radiolabeled monoclonal antibodies. Progress report, September 1, 1992--August 24, 1993

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1993-08-20

    The overall goal of this project is to improve the effectiveness of single photon emission computed tomography (SPECT) to image and quantify radiolabeled monoclonal antibodies. During the past year, we have made significant progress toward this goal, and this report summarizes that work. Our efforts have been mainly directed along three fronts. First, we have developed and tested new reconstruction methods including three-dimensional iterative algorithms that model non-uniform attenuation and distance-dependent detector response. Both fan beam and parallel beam collimator geometries have been modeled and novel ways of improving the efficiency of the computationally intensive methods have been introduced. Second, an ultra-high resolution, small field-of-view pinhole collimator has been constructed and evaluated. Reconstructed spatial resolution of 1 to 3 mm (FWHM) has been achieved in phantom scans with a useful field-of-view of 9 to 10 cm. Finally, we have investigated the ability of SPECT to image and quantify astatine-211 distributions. Reconstructed images of phantom data demonstrated quantitative accuracy to within 10% with proper attenuation and scatter compensation.

  6. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  7. Optimizing MIBG therapy of neuroendocrine tumors: preclinical evidence of dose maximization and synergy

    Energy Technology Data Exchange (ETDEWEB)

    Mairs, Rob J. [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)], E-mail: r.mairs@beatson.gla.ac.uk; Boyd, Marie [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)

    2008-08-15

    [{sup 131}I]meta-Iodobenzylguanidine ([{sup 131}I]MIBG) has been used for the therapy of tumors of neuroectodermal origin since the 1980s. Its role in the management of these malignancies remains controversial because of the large variation in response rates. Appreciation of the mode of conveyance of [{sup 131}I]MIBG via the noradrenaline transporter into malignant cells and of factors that influence the activity of the uptake mechanism has indicated various ways in which the effectiveness of this type of targeted radiotherapy may be improved. Experimental observations indicate that radiolabeling of MIBG to high specific activity reduced the amount of cold competitor, thereby increasing tumor dose and minimizing pressor effects. We observed supra-additive tumor cell kill and inhibition of tumor growth following combined topotecan and [{sup 131}I]MIBG treatment. The improved efficacy is related to topotecan's increased disruption of DNA repair. Radiation damage to targeted tumors may also be enhanced by the use of the {alpha}-particle emitter [{sup 211}At]astatine rather than {sup 131}I as radiolabel. Furthermore, recent experimental findings indicate that [{sup 123}I]MIBG may have therapeutic potential over and above its utility as an imaging agent. It has recently been demonstrated that potent cytotoxic bystander effects were induced by the intracellular concentration of [{sup 131}I]MIBG, [{sup 123}I]MIBG or meta-[{sup 211}At]astatobenzylguanidine. Identification of the nature of bystander factors could be exploited to maximize the specificity and potency of MIBG-targeted radiotherapy. By employing a range of strategies, there are good prospects for the improvement of the [{sup 131}I]MIBG therapy of neuroectodermal tumors.

  8. Quantitative Single-Particle Digital Autoradiography with α-Particle Emitters for Targeted Radionuclide Therapy using the iQID Camera

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Brian W.; Frost, Sophia; Frayo, Shani; Kenoyer, Aimee L.; Santos, E. B.; Jones, Jon C.; Green, Damian J.; Hamlin, Donald K.; Wilbur, D. Scott; Fisher, Darrell R.; Orozco, Johnnie J.; Press, Oliver W.; Pagel, John M.; Sandmaier, B. M.

    2015-07-01

    Abstract Alpha emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50–80 μm) causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with alpha emitters may inactivate targeted cells with minimal radiation damage to surrounding tissues. For accurate dosimetry in alpha-RIT, tools are needed to visualize and quantify the radioactivity distribution and absorbed dose to targeted and non-targeted cells, especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, iQID (ionizing-radiation Quantum Imaging Detector), for use in alpha-RIT experiments. Methods: The iQID camera is a scintillator-based radiation detection technology that images and identifies charged-particle and gamma-ray/X-ray emissions spatially and temporally on an event-by-event basis. It employs recent advances in CCD/CMOS cameras and computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, we evaluated this system’s characteristics for alpha particle imaging including measurements of spatial resolution and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 (211At) activity distributions in cryosections of murine and canine tissue samples. Results: The highest spatial resolution was measured at ~20 μm full width at half maximum (FWHM) and the alpha particle background was measured at a rate of (2.6 ± 0.5) × 10–4 cpm/cm2 (40 mm diameter detector area). Simultaneous imaging of multiple tissue sections was performed using a large-area iQID configuration (ø 11.5 cm

  9. Quantitative single-particle digital autoradiography with α-particle emitters for targeted radionuclide therapy using the iQID camera

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Brian W., E-mail: brian.miller@pnnl.gov [Pacific Northwest National Laboratory, Richland, Washington 99354 and College of Optical Sciences, The University of Arizona, Tucson, Arizona 85719 (United States); Frost, Sofia H. L.; Frayo, Shani L.; Kenoyer, Aimee L.; Santos, Erlinda; Jones, Jon C.; Orozco, Johnnie J. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 (United States); Green, Damian J.; Press, Oliver W.; Pagel, John M.; Sandmaier, Brenda M. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 and Department of Medicine, University of Washington, Seattle, Washington 98195 (United States); Hamlin, Donald K.; Wilbur, D. Scott [Department of Radiation Oncology, University of Washington, Seattle, Washington 98195 (United States); Fisher, Darrell R. [Dade Moeller Health Group, Richland, Washington 99354 (United States)

    2015-07-15

    Purpose: Alpha-emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50–80 μm), causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with α emitters may thus inactivate targeted cells with minimal radiation damage to surrounding tissues. Tools are needed to visualize and quantify the radioactivity distribution and absorbed doses to targeted and nontargeted cells for accurate dosimetry of all treatment regimens utilizing α particles, including RIT and others (e.g., Ra-223), especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, the ionizing-radiation quantum imaging detector (iQID) camera, for use in α-RIT experiments. Methods: The iQID camera is a scintillator-based radiation detection system that images and identifies charged-particle and gamma-ray/x-ray emissions spatially and temporally on an event-by-event basis. It employs CCD-CMOS cameras and high-performance computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, the authors evaluated its characteristics for α-particle imaging, including measurements of intrinsic detector spatial resolutions and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 ({sup 211}At) activity distributions in cryosections of murine and canine tissue samples. Results: The highest spatial resolution was measured at ∼20 μm full width at half maximum and the α-particle background was measured at a rate as low as (2.6 ± 0.5) × 10{sup −4} cpm/cm{sup 2} (40 mm diameter detector area

  10. Immuno-vectorization of radioelements emitters of alpha particles: a new therapy in cancerology; Immunovectorisation de radioelements emetteurs de particules alpha: une nouvelle voie therapeutique en cancerologie

    Energy Technology Data Exchange (ETDEWEB)

    Bourgeois, M

    2007-05-15

    The radio-immunotherapy is an anti cancerous therapy which consists in vectorising with immuno-specific agents very radio toxic radioelements on tumors or in their environment to destroy them. The first part of this report presents the different characteristics of antibodies as well as their means of production under monoclonal shapes specifically steered against a tumoral antigen of interest. The second part of this report replaces the importance of the immunological vectors in the context of the nuclear medicine. It is notably described that the different methods which allow to radio-label the vector, as well as the different ways of optimization which were envisaged to improve the targeting of radioelements on a tumor. These different developments allow to define the potential place of the alpha radio-immunotherapy in treatments and so re-place the interest of the experimental part. If the radio-immunotherapy, using beta emitters isotopes as the {sup 131}iodine or the{sup 90}yttrium, is today current in anti cancerous therapy, it finds limits because of the disintegration characteristics of the isotopes it uses. Indeed, compared with alpha particles, the beta particles deposit less energy by unit of length in the crossed material.The experimental part of this report aims at studying the feasibility of the coupling between an immunological vector and an alpha emitter isotope.The different tests led on the bismuth 213, the bismuth 212, the lead 212 and the astatine 211 demonstrated that the fixation of these radionuclides was possible. This research theme is strengthened by the construction in Nantes of a cyclotron with high energy ( A.R.R.O.N.A.X.) and the optimization of the obtained promising results should allow a therapeutic use in oncology of the alpha radio-immunotherapy. (N.C.)

  11. 76 FR 24793 - Airworthiness Directives; Rolls-Royce plc (RR) RB211-524 Series and RB211 Trent 500, 700, and 800...

    Science.gov (United States)

    2011-05-03

    .... Request To Change Nomenclature of HPC Rotor Shaft One commenter, Hawaiian Airlines, asks us to change ``HPC rotor shaft'' to ``HP compressor drum.'' The commenter states that the HPC drum in the Trent 700 engine is a six stage rotor and is referred to as the ``HPC rotor shaft.'' Since each engine model has...

  12. 75 FR 27964 - Airworthiness Directives; Rolls-Royce plc (RR) RB211-22B and RB211-524 Series Turbofan Engines

    Science.gov (United States)

    2010-05-19

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Rolls-Royce plc (RR... Federal holidays. Fax: (202) 493-2251. Contact Rolls-Royce plc, P.O. Box 31, Derby, DE24 8BJ, United... examining the MCAI in the AD docket. Relevant Service Information Rolls-Royce plc has issued Alert Service...

  13. ISA 247: trans-ISA 247, trans-R 1524, ISA(TX)247, ISAtx 247, ISATx247, LX 211, LX211, R 1524, R-1524.

    Science.gov (United States)

    2007-01-01

    Isotechnika is developing the immunosuppressive drug ISA 247, a calcineurin inhibitor that is undergoing clinical development for the treatment of psoriasis (phase III) and prevention of organ rejection after transplantation (phase II). Preclinical development for uveitis is also underway. Other autoimmune disease indications that could be explored include arthritis, type I diabetes and Crohn's disease. ISA 247 was being co-developed as R 1524 by Isotechnika and Roche. However, Roche is no longer involved in the development of this compound. Based on analysis of previously collected data, the trans-ISA 247 isomer was found to be more bioavailable and it is expected that this isomer can be administered at a lower dose compared with the previous formulation that consisted of an equivalent mixture of the two geometric isomers (cis and trans). Preclinical observations indicate that ISA 247 has the potential to be more potent and less toxic than other marketed immunosuppressants in its class used for the prevention of transplant rejection. Experiments to date suggest that ISA 247 is about three times as potent as ciclosporin, while genotoxicity studies in animals have shown that the compound has a significantly reduced tendency to cause renal toxicity. The combination of reduced toxicity and improved potency would give ISA 247 a therapeutic benefit over existing calcineurin-based treatments. Isotechnika and Roche entered into a co-development and commercialisation agreement in April 2002, with Roche gaining the exclusive worldwide marketing rights for ISA 247; Isotechnika received milestone payments of $US4 million and $CAN21.9 million in September 2002 and May 2003, respectively. The agreement was restructured in April 2004, under which Isotechnika will now solely manage and fund the clinical development of trans-ISA 247. Upon successful completion of these trials, Isotechnika will conduct at its own expense a phase IIb study in renal transplantation and phase III studies in psoriasis. Roche will have the right to opt-in to the development and commercialisation of trans-ISA 247 for transplant indications up to the end of the phase IIb renal transplantation trial. Isotechnika retains all rights to develop and commercialise the product outside of transplant indications. Under an agreement signed with Cellgate Inc. on 25 April 2006, Isotechnika has the option to obtain an exclusive licence to develop and commercialise conjugates consisting of Cellgate's patented transporter technology, for the topical delivery of ISA 247 in patients with mild-to-moderate psoriasis. Cellgate will perform studies to evaluate the feasibility of using their technology to topically deliver ISA 247. In return, Isotechnika will pay Cellgate Inc. a total of $US500 000, with $US100 000 paid upfront, and the remainder at predetermined time points. Upon successful completion of the studies, Isotechnika has the option to further develop and commercialise conjugates for topical delivery of ISA 247. Isotechnika and Atrium Medical Corporation announced an exclusive worldwide licensing agreement for ISA 247 alone and in combination with TAFA 93 with respect to drug-eluting devices, in September 2005. Atrium's implantable products include those for the local, non-systemic treatment of vascular and cardiovascular disorders, soft tissue repair and other disorders. In May 2006, Isotechnika licensed ISA 247 to Lux Biosciences for ophthalmic indications. Under terms of the agreement, Lux Biosciences obtains the exclusive worldwide marketing rights to ISA 247 for treatment and prophylaxis of all ophthalmic indications. The company will be responsible for development, registration and marketing of the drug for ophthalmic indications and will make upfront and milestone payments to Isotechnika in addition to royalties on any sales. Isotechnika formalised a manufacturing agreement with Swiss-based Lonza Ltd in June 2004. Under the terms of the agreement, Lonza will manufacture sufficient quantities of trans-ISA 247 in a GMP environment for use in the company's upcoming clinical trials. Isotechnika completed the phase III SPIRIT trial of ISA 247 for psoriasis in Canada. The randomised, double-blind trial compared the efficacy of three doses of ISA 247 (0.2 mg/kg [low dose], 0.3 mg/kg [mid dose] and 0.4 mg/kg [high dose] twice daily) with placebo, with equal numbers of patients assigned to each of the four groups. Subsequent to the first 12 weeks, those patients who received placebo moved into the mid-dose group for the remaining 12 weeks of the study. Patients already receiving ISA 247 remained in their respective dosing groups for the final 12 weeks of the trial. Patients completing the 24-week SPIRIT trial were given the opportunity to continue therapy for an addditonal 36 weeks or to discontinue therapy. Those patients who chose to enrol in the extension trial were moved from the 0.2 mg/kg bid (low-dose) or 0.4 mg/kg bid (high-dose) groups into the the 0.3 bid mg/kg bid (mid dose) group. Patients who commenced the SPIRIT trial in the mid-dose group remained on the same dosage regimen for the duration of the extension trial. The goal of the extension trial is to demonstrate continued therapeutic benefit to psoriasis patients while gathering long-term safety data. So far, data has been received on 193 patients receiving treatment for a total of 48 weeks. A phase IIa trial investigating the safety and efficacy of ISA 247 in renal transplantation was completed in the US and Canada in January 2003. The trial compared ISA 247 with ciclosporin (Neoral in approximately 130 stable renal transplant patients who underwent transplantation at least 6 months prior to enrolment; patient recruitment was completed in October 2002. Half of the patients were treated with ciclosporin and the other half received ISA 247 over a 90-day period. An extension trial was then initiated in which another 200 patients were treated with ISA 247 for up to 6 months from the time of transplantation. Results from the trial were reported. All endpoints were achieved in a multiple ascending dose study of trans-ISA 247 in November 2004. The study, initiated in June 2004, was conducted by SFBC Anapharm in Montreal, Canada and involved 43 healthy volunteers. Final dosing recommendations are to be determined in phase III trials in patients with psoriasis. Interim results reported in September 2004, of a double-blind, parallel-group, placebo and moxifloxacin controlled, randomised single-dose QTc trial in healthy volunteers, showed no evidence of QTc prolongation when trans-ISA 247 was administered at therapeutic doses. A single ascending dose (SAD) trial for trans-ISA 247 was completed in July 2004. The SAD trial was conducted among healthy volunteers to assess the appropriate dosage of trans-ISA 247 for further clinical evaluations. The trial commenced in March 2004 with approximately 46 subjects enrolled under the supervision of MDS Pharma Services in Phoenix, Arizona, USA. Isotechnika received US FDA approval for the SAD trial in February 2004. A European patent (No. EP 0 991 660) entitled 'Deuterated and Undeuterated Cyclosporine Analgoues and Their Use as Immunomodulating Agents' was issued to Isotechnika for ISA 247, in October 2006. A US patent entitled 'Novel Cyclosporin Analogue Formulations' was issued to Isotechnika (No. 7 060 672) for ISA 247 in June 2006. The patent claims have been filed in 36 countries, and in the US it is the first patent to be issued in this patent family. Isotechnika was issued a US patent (No. 6 998 385, entitled 'Cyclosporine Analogue Mixtures and their use as Immunomodulating Agents') in February 2006 covering mixtures of cis- and trans- isomers of ISA 257. This patent is the first US patent to be issued in this family of patents. These patent claims have been filed in 36 countries. Three patents relating to this claim were previously issued in the following countries; Morocco (No. 26337 issued 1 October 2004); Pakistan (No. 138338 issued 30 September 2004) and South Africa (No. 2004/2270 issued 25 May 2005). A US patent (No 6 686 454) was issued in February 2004 entitled 'Antibodies to Specific Regions of Cyclosporine Related Compounds'. This patent covers a novel, simple and cost-effective assay used in the use and management of ISA 247. It also received another US patent entitled 'Deuterated Cyclosporine Analogs and their Use as Immunomodulating Agents'. Isotechnika has received patents for chemical composition of ISA 247 in New Zealand (November 2001; New Zealand Patent No. 502362), Canada (December 2001; Canadian Patent No. 2 298 572), South Korea (June 2006; South Korean Patent No. 585348) and Australia (November 2002; Australian Patent No. 750245). In addition, Isotechnika announced in August 2003 that it had been granted US patent No. 6 605 593, entitled 'Deuterated Ciclosporine Analogs and their use as Immunomodulating Agents'. An additional US patent covering ISA 247 was granted in September 2003.

  14. The role of alpha therapy for local and systemic treatment of cancer

    Energy Technology Data Exchange (ETDEWEB)

    Allen, B.J. [St George Hospital, Kogarah, NSW (Australia)

    1998-03-01

    Major problems in the management of cancer relate to the inability to control some primary lesions, e.g. glioblastoma multiforme (GBM), and the inability to deal with metastatic cancer arising from malignant cancers such as melanoma, breast and other cancers. Binary alpha therapy using neutron capture in boron-10 offers the potential for improved prognosis for high grade brain tumours such as GBM and melanoma metastases to the brain. Metastatic cancer proceeds through a number of quite separate stages in the development of lethal disease, i e. cells in transit, preangiogenic lesions, subclinical and clinical lesions. Early stages offer the potential for control if targeted alpha therapy is applied. However, the dose must be localised to the cancer cell and this requirement rules out beta-emitting radionuclides, which are more suited for clinical lesions. Alpha-emitting radionuclides are the most appropriate toxins, as their efficacy depends on the linear energy transfer (LET) and range of the alpha particles. After matching the cancer stage, radiolabel and carrier, we find that {sup 149}Tb is the radionuclide of choice for systemic therapy in all aspects except production. The production of {sup 149}Tb in {mu}Ci (kBq) quantities has been achieved using the heavy ion reaction at the ANU tandem accelerator at Canberra and in multi-mCi (MBq) quantities using the spallation reaction in combination with on-line isotope separation technology of ISOLDE at CERN. Terbium is ideally suited for chelation to monoclonal antibodies to produce stable radio-immunoconjugates (RIC). Astatine-211 is a halide and has potential for the elimination of early stage melanoma metastases as At-MTB. However, the availability of the alpha generators {sup 228}Th-{sup 212}Bi and {sup 225}Ac-{sup 213}Bi facilitates the use of Bi-RIC in clinical trials for acute myeloid leukaemia and cystic glioma. Alpha therapy has the potential to control refractory cancers when treated at the minimum residual

  15. 48 CFR 2852.211-70 - Brand-name or equal.

    Science.gov (United States)

    2010-10-01

    ... information reasonably available to the purchasing activity. To ensure the sufficient information is available..., drawings, or other information) necessary for the purchasing activity to: (i) determine whether the product... furnished or information otherwise available to the purchasing activity. (2) If the bidder proposes to...

  16. 49 CFR 1544.211 - Use of X-ray systems.

    Science.gov (United States)

    2010-10-01

    ... high-speed film from accessible property and checked baggage before inspection. This sign must also... training of operators of the system is established, which includes training in radiation safety, the...

  17. CERN Accelerator School: Intensity Limitations in Particle Beams | 2-11 November

    CERN Multimedia

    2015-01-01

    Registration is now open for the CERN Accelerator School’s specialised course on Intensity Limitations in Particle Beams, to be held at CERN between 2 and 11 November 2015.   This course will mainly be of interest to staff in accelerator laboratories, university departments and companies manufacturing accelerator equipment. Many accelerators and storage rings, whether intended for particle physics experiments, synchrotron light sources or industrial applications, require beams of high brightness and the highest possible intensities. A good understanding of the possible limitations is required to achieve the desired performance. The programme for this course will cover the interaction of beams with their surroundings, with other beams and further collective effects. Lectures on the effects and possible mitigations will be complemented by tutorials. Further information can be found at: http://cas.web.cern.ch/cas/Intensity-Limitations-2015/IL-advert.html   http:/...

  18. 22 CFR 1203.735-211 - Activities relating to private organizations and politics.

    Science.gov (United States)

    2010-04-01

    ... the overthrow of our constitutional form of Government in the United States, knowing that such... political management or in political campaigns. These restrictions do not in any way affect the right of a...

  19. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (211-0612-272217)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  20. 48 CFR 252.211-7005 - Substitutions for military or Federal specifications and standards.

    Science.gov (United States)

    2010-10-01

    ...: Substitutions For Military or Federal Specifications and Standards (NOV 2005) (a) Definition. “SPI process,” as... via the Internet at http://guidebook.dcma.mil/20/guidebook_process.htm (paragraph 4.2). (c) An offeror..., but is not yet listed at the Internet site specified in paragraph (b) of this clause, submit...

  1. 49 CFR 180.211 - Repair, rebuilding and reheat treatment of DOT-4 series specification cylinders.

    Science.gov (United States)

    2010-10-01

    ... of the cylinder specification. (2) The person performing the repair must use the procedure, equipment... used at the time of original manufacture. (iv) Other welding procedures that are permitted by CGA... meet the acceptance criteria in the applicable specification or be scrapped. (4) After all welding and...

  2. China Report, Science and Technology, No. 211, Computer Development and Applications -- III.

    Science.gov (United States)

    1983-10-13

    tryout period, just the transportation of nitrogen fertilizer alone was able to save the state 230,000 yuan and transportation of 17.71 million ton-km...it were to be completed manually. What is even more difficult is the fact that the computer was not to.perform the computation mechanically for it also...according to the Nernst equation the electromotive force [ EMF ] of the cell should be: E, E° ±S.logCfo.K..,C] (1) - 44 - where E° is a constant, S is the

  3. EMPHASIS(TM)/Nevada UTDEM User Guide Version 2.1.1.

    Energy Technology Data Exchange (ETDEWEB)

    Turner, C. David; Pasik, Michael F.; Pointon, Timothy D.; Pointon, Timothy D.; Cartwright, Keith

    2014-08-01

    The Unstructured Time - Domain ElectroMagnetics (UTDEM) portion of the EMPHASIS suite solves Maxwell's equations using finite - element techniques on unstructured meshes. This document provides user - specific information to facilitate the use of the code for ap plications of interest. Acknowledgement The authors would like to thank all of those individuals who have helped to bring EMPHASIS/Nevada to the point it is today, including Bill Bohnhoff, Rich Drake, and all of the NEVADA code team.

  4. Baryon spectrum with Nƒ=2+1+1 twisted mass fermions

    DEFF Research Database (Denmark)

    Alexandrou, C.; Drach, V.; Jansen, K.

    2014-01-01

    . The light sea quarks correspond to pseudo scalar masses in the range of about 210 to 430 MeV. We use the Iwasaki improved gluonic action at three values of the coupling constant corresponding to lattice spacing a = 0.094, 0.082 and 0.065 fm determined from the nucleon mass. We check for both finite volume...

  5. Page 1 Anatomy of the Sugarcane Moth Borers—II 211 tº deagus ...

    Indian Academy of Sciences (India)

    The ostium bursae or the genital opening of the bursa-copulatrix lies on ventral surface of the eighth abdominal segment on a heavily chitinized al plate. Within this oval plate (Fig. 3) the genital opening proper is arded laterally by two strongly chitinized sword-shaped arms with their ices directed forward. These arms are ...

  6. Structural evaluation of W-211 flexible receiver platforms and tank pit walls

    Energy Technology Data Exchange (ETDEWEB)

    Shrivastava, H.P.

    1997-11-03

    This document is a structural analysis of the Flexible Receiver Platforms and the tank-pit wall during removal of equipment and during a accidental drop of that equipment. The platform and the pit walls must withstand a accidental drop of a mixer and transfer pumps in specific pits in tanks 102-AP and 104-AP. A mixer pump will be removed from riser 11 in pit 2A on tank 241-AP-102. A transfer pump will be removed from riser 13 in pit 2D on tank 241-AP-102 and another transfer pump will be removed from riser 3A in pit 4A on tank 241-AP-104.

  7. WE-G-211-02: Origins and Development of Magnetic Resonance Imaging.

    Science.gov (United States)

    Clarke, G

    2012-06-01

    The method of magnetic resonance imaging (MRI) was an extension of nuclear magnetic resonance (NMR) spectroscopy that was enabled by computational systems capable of performing the Fast Fourier Transform. Initially, a diverse group of methods were proposed for producing images with NMR, with the multi-slice spin-warp spin echo MRI method winning out as the first clinically useful approach. Immediately radiologists were impressed in the soft tissue contrast seen in MR images and the great flexibility with which image contrast could be manipulated. Over the years, advances in both hardware and the implementation of new pulse sequences of increasing complexity led to the increasing utility of MRI. The great success of MRI research contributed to the awarding of both the Nobel Prize in Chemistry for Richard Ernst in 1991 and the Nobel Prize in Physiology or Medicine for Lauterbur and Mansfield in 2003. The evolution of the modality produced increasing speed of acquisition, finer spatial resolution and an expanding range of clinical applications. Technological advances included improvements in gradient coils, superconducting magnets, phased array radiofrequency coils, and partially parallel image reconstruction algorithms. The wide range of applications developed include MR angiography, BOLD contrast functional MRI, and diffusion-weighted MRI. This section of the symposium will conclude with a look a current developments and where they are likely to take the field into the future. © 2012 American Association of Physicists in Medicine.

  8. 75 FR 61114 - Airworthiness Directives; Rolls-Royce plc RB211-Trent 800 Series Turbofan Engines

    Science.gov (United States)

    2010-10-04

    ... shortly after receipt. FOR FURTHER INFORMATION CONTACT: James Lawrence, Aerospace Engineer, Engine... part assessment using either ``Multiple Flight Profile Monitoring'', or ``Heavy Flight Profile... supplemental NPRM revises the proposed AD to correct certain life limits for the Heavy Flight Profile Parts. We...

  9. : tous les projets | Page 211 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La hausse des taxes sur le tabac en Amérique latine constitue une occasion unique d'améliorer la santé publique et, pour les économies nationales, de réaliser des gains nets. Date de début : 7 mars 2012. End Date: 6 mai 2014. Sujet: TAX REVENUES, TOBACCO INDUSTRY, MORTALITY DECLINE, DISEASES, HEALTH ...

  10. 78 FR 211 - Paper and Paper-Based Packaging Promotion, Research and Information Order; Referendum Procedures

    Science.gov (United States)

    2013-01-02

    ... Packaging Promotion, Research and Information Order; Referendum Procedures AGENCY: Agricultural Marketing... January 2, 2013 Part IV Department of Agriculture Agricultural Marketing Service 7 CFR Part 1222 Paper and Paper-Based Packaging Promotion, Research and Information Order; Referendum Procedures; Proposed Rule #0...

  11. Sulfur Deprivation Results in Oxidative Perturbation in Chlorella sorokiniana (211/8k).

    Science.gov (United States)

    Salbitani, Giovanna; Vona, Vincenza; Bottone, Claudia; Petriccione, Milena; Carfagna, Simona

    2015-05-01

    Sulfur deficiency in plant cells has not been considered as a potential abiotic factor that can induce oxidative stress. We studied the antioxidant defense system of Chlorella sorokiniana cultured under sulfur (S) deficiency, imposed for a maximum period of 24 h, to evaluate the effect of an S shortage on oxidative stress. S deprivation induced an immediate (30 min) but transient increase in the intracellular H2O2 content, which suggests that S limitation can lead to a temporary redox disturbance. After 24 h, S deficiency in Chlorella cells decreased the glutathione content to Chlorella cells. The accumulation of total ascorbate, changes in the reduced glutathione/oxidized glutathione (GSH/GSSG) ratios and an increase in the activity of SOD and APX enzymes indicate that oxidative perturbation occurs during S deprivation. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  12. Subtask 2.11 - An Investigation into the EERC Staged Electrostatic Precipitator Concept

    Energy Technology Data Exchange (ETDEWEB)

    Ye Zhuang; Jay Almlie; Stanley Miller

    2008-03-31

    A new concept of electrostatic precipitator (ESP), named a Staged ESP (an Energy & Environmental Research Center proprietary), was conceived in June 2004. The concept is based on a simple design that can be retrofitted on existing coal-fired power plants to provide high particulate matter (PM) collection efficiency without compromising reliability. A prototype of Staged ESP was designed, fabricated, and tested in two different combustion coal flue gases with different fly ash resistivities. Several design parameters of the Staged ESP were evaluated under various operating conditions to optimize PM collection performance. A set of particulate sampling data, including aerodynamic particle sizer, scanning mobility particle sizer, and U.S. Environmental Protection Agency Method 5 data, was collected to determine PM emissions of the Staged ESP configurations. These data were compared against data collected with a conventional ESP configuration. Compared to PM capture performance in conventional ESPs, an additional 30% to 70% reductions on total PM emissions were achieved for Staged ESPs in flue gas with medium- to high-resistivity fly ashes. Experimental data proved that the Staged ESP concept is capable of achieving higher PM collection efficiency, especially for particles in the submicrometer size range typically thought difficult to capture in an ESP.

  13. 14 CFR 211.20 - Initial foreign air carrier permit or transfer of a permit.

    Science.gov (United States)

    2010-01-01

    ..., etc., from the beginning of operations to the present. Also, if the applicant is a new airline (i.e., an airline that began direct air services within the past 12 months), briefly summarize the business... whether the applicant has been involved in any safety or tariff violations or any fatal accidents. If so...

  14. Preliminary production of 211At at the Texas A&M University Cyclotron Institute.

    Science.gov (United States)

    Martin, Thomas Michael; Bhakta, Vihar; Al-Harbi, Abeer; Hackemack, Michael; Tabacaru, Gabriel; Tribble, Robert; Shankar, Sriram; Akabani, Gamal

    2014-07-01

    A feasibility study for the production of the alpha particle-emitting radionuclide At was performed at the Texas A&M University Cyclotron Institute as part of the Interdisciplinary Radioisotope Production and Radiochemistry Program. The mission of this program centers upon the production of radionuclides for use in diagnostic and therapeutic nuclear medicine with the primary focus on development of novel therapeutic strategies. As a first step in establishing this program, two goals were outlined: (i) verify production of At and compare results to published data, and (ii) evaluate shielding and radiological safety issues for large-scale implementation using an external target. The radionuclide At was produced via the Bi (α, 2n) At reaction using the K500 cyclotron. Two experiments were conducted, using beam energies of 27.8 MeV and 25.3 MeV, respectively. The resulting yields for At were found to be 36.0 MBq μA h and 12.4 MBq μA h, respectively, which fall within the range of published yield data. Strategies for increasing absolute yield and production efficiency were also evaluated, which focused chiefly on using a new target designed for use with the K150 cyclotron, which will enable the use of a higher beam current. Finally, neutron and gamma dose rates during production were evaluated by using the Monte Carlo code MCNPX. It was determined that a simple structure consisting of 4-in thick borated polyethylene will reduce the neutron dose rate within the cyclotron production vault by approximately a factor of 2, thereby decreasing activation of equipment.

  15. EMPHASIS(TM)/Nevada Unstructured FEM Implementation Version 2.1.1.

    Energy Technology Data Exchange (ETDEWEB)

    Turner, C. David; Pointon, Timothy D.; Cartwright, Keith

    2014-08-01

    EMPHASIS TM /NEVADA is the SIERRA/NEVADA toolkit implementation of portions of the EMP HASIS TM code suite. The purpose of the toolkit i m- plementation is to facilitate coupling to other physics drivers such as radi a- tion transport as well as to better manage code design, implementation, co m- plexity, and important verification and validation processes. This document describes the theory and implementation of the unstructured finite - element method solver , associated algorithms, and selected verification and valid a- tion . Acknowledgement The author would like to recognize all of the ALEGRA team members for their gracious and willing support through this initial Nevada toolkit - implementation process. Although much of the knowledge needed was gleaned from document a- tion and code context, they were always willing to consult personally on some of the less obvious issues and enhancements necessary.

  16. SU-E-T-211: Peer Review System for Ensuring Quality of Radiation Therapy Treatments.

    Science.gov (United States)

    Kapoor, R; Kapur, P; Kumar, S A; Alex, D; Ranka, S; Palta, J

    2012-06-01

    To demonstrate a Web-based electronic peer review system that has the potential to improve quality of care for radiation therapy patients. The system provides tools that allow radiation oncologists to seek peer review of target and critical structure delineation, treatment plans, and share clinical data with peers to optimize radiation therapy treatments. Peer review of radiation therapy treatment planning data prior to its initiation improves the quality of radiation therapy and clinical outcomes. Web-based access to radiation therapy treatment planning data and medical records mitigate existing geographical and temporal constraints. With internet access, the healthcare provider can access the data from any location and review it in an interactive and collaborative manner. Interoperability standard like DICOM-RT and IHE-RO compliant RT Systems have facilitated the design and implementation of PRS with Silverlight Web technology, .net Framework and SQL Server. Local DICOM-RT archive and cloud based services are deployed to facilitate remote peer reviews. To validate the PRS system, we tested the system for 100 patients with Philips Pinnacle v 9.0 and Varian Eclipse v 8.9 treatment planning system (TPS). We transmitted the DICOM RT data from the TPS to the cloud based services via the PRS local DICOM RT Archive. Various CT simulation based parameters such as orientation of CT, properties of RT structures etc. were compared between the TPS and PRS system. Data integrity of other parameters such as patient demographics (patient name, ID, attending physician etc.) and dose volume related parameters were also evaluated. Such rigorous testing allowed us to optimize the functionalities and clinical implementation of the PRS. We believe that the PRS will improve the quality and safety of a broad spectrum of radiation therapy patients treated in underserved areas while discouraging the overutilization of expensive radiation treatment modalities. This research and development project is supported by the James and Ester King Biomedical Research Program grant # RC1-09KW-09-26829. © 2012 American Association of Physicists in Medicine.

  17. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (211-0612-332211)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  18. 20 CFR 416.211 - You are a resident of a public institution.

    Science.gov (United States)

    2010-04-01

    ... INCOME FOR THE AGED, BLIND, AND DISABLED Eligibility Reasons Why You May Not Get Ssi Benefits for Which... socialization and life skills; or (iv) Providing occasional or incidental medical or remedial care. (3) Serving...

  19. Manganese Analysis in Water Samples. Training Module 5.211.2.77.

    Science.gov (United States)

    Bonte, John L.; Davidson, Arnold C.

    This document is an instructional module package prepared in objective form for use by an instructor familiar with the spectrophotometric analysis of manganese in water using the persulfate method. Included are objectives, an instructor guide, student handouts, and transparency masters. A video tape is also available from the author. This module…

  20. 12 CFR 211.6 - Permissible activities of Edge and agreement corporations in the United States.

    Science.gov (United States)

    2010-01-01

    ... management with respect to securities, other financial instruments, real-property interests, and other... GOVERNORS OF THE FEDERAL RESERVE SYSTEM INTERNATIONAL BANKING OPERATIONS (REGULATION K) International... the United States. (a) Activities incidental to international or foreign business. An Edge or...

  1. 20 CFR 702.211 - Notice of employee's injury or death; designation of responsible official.

    Science.gov (United States)

    2010-04-01

    ... (including foreman, hatchboss or timekeeper), local plant manager or personnel office official; (2) to any... manager, personnel office official, company nurse or other individual traditionally entrusted with this duty, who is located full-time on the premises of the covered facility. The employer must designate at...

  2. 49 CFR 375.211 - Must I have an arbitration program?

    Science.gov (United States)

    2010-10-01

    ... TRANSPORTATION OF HOUSEHOLD GOODS IN INTERSTATE COMMERCE; CONSUMER PROTECTION REGULATIONS Before Offering... expeditious decisionmaking process. (5) You must not charge the individual shipper more than one-half of the total cost for instituting the arbitration proceeding against you. In the arbitrator's decision, the...

  3. 48 CFR 552.211-89 - Non-manufactured wood packaging material for export.

    Science.gov (United States)

    2010-10-01

    ..., crating, packing blocks, drums, load boards, pallet collars, and skids. (b) Non-manufactured wood pallets..., all non-manufactured wood pallets or packaging material with a probability of entering countries...-1, and MIL-STD-2073-1. (f) Delays in delivery caused by non-complying pallets or wood package...

  4. C.S. 211 Bilingual Gifted and Talented Program. Final Evaluation Report, 1979-80.

    Science.gov (United States)

    Brumberg, Stephan F.; Toledo, Victor

    This Title VII Bilingual Gifted and Talented Program was conducted in a community school district in New York City in 1979-80. The program served Hispanic students in grades K-6. A description of the school and the rationale for the program are presented, and program objectives are discussed. These are grouped in three major areas: (1) the…

  5. 49 CFR 232.211 - Class III brake tests-trainline continuity inspection.

    Science.gov (United States)

    2010-10-01

    ...) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION BRAKE SYSTEM SAFETY STANDARDS FOR FREIGHT... performed on a train by a qualified person, as defined in § 232.5, to test the train brake system when the... have previously received a Class I brake test, have not been off air more than four hours, and the cars...

  6. Development of MBE II-VI Epilayers on GaAs(211)B

    Science.gov (United States)

    2012-10-01

    INTRODUCTION Over 20 years of research1–8 has been devoted to developing an alternative substrate to CdZnTe for heteroepitaxial growth of HgCdTe...alternatives to CdZnTe discussed above, InSb is the only substrate that has near-perfect lattice and thermal matching to HgCdTe, in addition to having a

  7. Page 1 Bull. Mater, Sci., Vol. 16, No. 3, June 1993, pp. 205-211. (C ...

    Indian Academy of Sciences (India)

    Abstract, Adsorption of basic dye methylene blue by some Indian clays has been studied. BET plotting of the adsorption isotherms was applied to determine the specific surfaces of clays and heat of adsorption. About 10-20% lower values of specific surfaces were obtained when compared with the most accurate ...

  8. 12 CFR 211.4 - Permissible activities and investments of foreign branches of member banks.

    Science.gov (United States)

    2010-01-01

    ... GOVERNORS OF THE FEDERAL RESERVE SYSTEM INTERNATIONAL BANKING OPERATIONS (REGULATION K) International..., such obligations for its own account in relation to any one country in an amount exceeding the greater... where local law requires other investors to hold directors' qualifying shares or similar types of...

  9. 76 FR 36981 - Airworthiness Directives; Rolls-Royce plc RB211-Trent 500 Series Turbofan Engines

    Science.gov (United States)

    2011-06-24

    ... energy debris release, the formation of carbon in the RH fuel manifold constitutes a potentially unsafe... energy debris release, the formation of carbon in the RH fuel manifold constitutes a potentially unsafe... input may cause formation of carbon in a specific region of the RH fuel manifold. As advanced thermal...

  10. 40 CFR 94.211 - Emission-related maintenance instructions for purchasers.

    Science.gov (United States)

    2010-07-01

    ... agreement) which is identified by brand, trade, or corporate name. Such instructions also will not directly... in-use experience without the signal. To that end, the manufacturer may in a given model year market...

  11. Theoretical study of physical properties and oxygen incorporation effect in nanolaminated ternary carbides 211-MAX phases

    KAUST Repository

    Kanoun, Mohammed

    2012-01-01

    In this chapter, we employ ab initio approaches to review some important physical properties of nanolaminated ternary carbides MAX phases. We fi rstly use an all electron full-potential linearized augmented plane-wave method within the generalized gradient approximation and the density functional theory approaches, to explore the existence of a steric effect on the M site in these compounds. The elastic properties are also reported in order to assess the mechanical stability. The substitution of oxygen for carbon in Ti 2 SnC M n +1 AX n, forming Ti 2 SnC 1- x O x, is examined next, where we simulated the effect of oxygen incorporation on mechanical and electronic properties using projector augmented wave method. We show that oxygen has interesting effects on both of elastic and electronic properties, that the bulk modulus decreases when oxygen concentration increases. The bonding in Ti 2 SnC 1- x O x has a tendency to a covalent-ionic nature with the presence of metallic character. © 2012 Woodhead Publishing Limited.

  12. Archaeological Investigations at Site 45-DO-211, Chief Joseph Dam Project, Washington.

    Science.gov (United States)

    1984-01-01

    Items--rushes and bark for matting and baskets, for Instance. They could gather edible seeds and roots as well as brush for fuel. Driftwood from the...well, but our only diagnostic artifacts are historic American and Chinese artifacts spanning the last part of the ninetheenth century up to the...of natural processes. AMPHIBIA (NISP=16) Ranidae/Bufonldae ( frogs , toads) -- 16 elements. Inadequate comparative collections precluded more precise

  13. 211 Vulnérabilité des troupeaux transhumants aux mutations ...

    African Journals Online (AJOL)

    ZAKARI SOUF

    de l'élevage et de l'éleveur aux risques climatiques dans la commune de Malanville. C'est dire ... climat et la capacité d'adaptation de ces populations aux risques et événements climatiques extrêmes. Plusieurs .... (conseillers techniques en zootechnie, en production végétale, en aménagement et gestion des ressources.

  14. 18 CFR 1304.211 - Change in ownership of grandfathered structures or alterations.

    Science.gov (United States)

    2010-04-01

    ... TENNESSEE VALLEY AUTHORITY APPROVAL OF CONSTRUCTION IN THE TENNESSEE RIVER SYSTEM AND REGULATION OF... activities and structures must: (1) Maintain existing permitted docks, piers, boathouses, and other shoreline..., for any new construction, or for removal of trees or other vegetation (except for mowing of lawns...

  15. 5 CFR 591.211 - What are the categories of consumer expenditures?

    Science.gov (United States)

    2010-01-01

    ... expenditure groups. OPM subdivides each MEG into primary expenditure groups (PEGs). There are approximately 40 PEGs. (c) Detailed expenditure categories. OPM further subdivides each PEG into other categories down... level of tabulated CES categories. OPM classifies each DEC into one of the PEGs to aggregate DECs with...

  16. 22 CFR 211.7 - Arrangements for entry and handling in foreign country.

    Science.gov (United States)

    2010-04-01

    ... upon by AID/W and provided in the applicable shipping contract or in paragraph (d) and (e) of this... applicable charter or booking contract. The cooperating sponsor shall be responsible for all costs related to... Post that all necessary arrangements for receiving the commodities have been made, and shall assume...

  17. δ37Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine.

  18. δ³⁷Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine. This thesis presents the first chlorine

  19. A mouse model of the schizophrenia-associated 1q21.1 microdeletion syndrome exhibits altered mesolimbic dopamine transmission

    DEFF Research Database (Denmark)

    Nielsen, Jacob; Fejgin, Kim; Sotty, Florence

    2017-01-01

    and basic functions such as reflexes, ASR, thermal pain sensitivity, and motor performance were unaltered. Similarly, anxiety related measures, baseline prepulse inhibition, and seizure threshold were unaltered. In addition to the central nervous system-related phenotypes, Df(h1q21)/+ mice exhibited reduced...

  20. Oahu Hyperspectral Imagery 2000 (211-0612-332211) - Visual Interpretation from Remote Sensing Imagery Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...