WorldWideScience

Sample records for astatine 207

  1. Radiochemistry of astatine

    Energy Technology Data Exchange (ETDEWEB)

    Ruth, T J; Dombsky, M; D' Auria, J M; Ward, T E

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs. (DLC)

  2. Discovery of the astatine, radon, francium, and radium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-09-15

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  3. Discovery of the astatine, radon, francium, and radium isotopes

    CERN Document Server

    Fry, C

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Discovery of the astatine, radon, francium, and radium isotopes

    Science.gov (United States)

    Fry, C.; Thoennessen, M.

    2013-09-01

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  5. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Energy Technology Data Exchange (ETDEWEB)

    Uusitalo, J.; Jakobsson, U. [Department of Physics, University of Jyvaeskylae (Finland); Collaboration: RITU-Gamma Gollaboration

    2011-11-30

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  6. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Science.gov (United States)

    Uusitalo, J.; Jakobsson, U.

    2011-11-01

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  7. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  8. Measurement of the first ionization potential of astatine by laser ionization spectroscopy.

    Science.gov (United States)

    Rothe, S; Andreyev, A N; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yuri; Köster, U; Lane, J F W; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt, K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine.

  9. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Jakobsson, U., E-mail: ulrjak@kth.se; Cederwall, B. [KTH, The Division of Nuclear Physics, AlbaNova University Center, SE-10691 Stockholm (Sweden); Uusitalo, J.; Auranen, K.; Badran, H.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; Herzáň, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J. [University of Jyvaskyla, Department of Physics, P.O. Box 35, FI-40014 University of Jyvaskyla (Finland); and others

    2015-10-15

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2{sup +} state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2{sup +} state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2{sup +} state and the spherical 9/2{sup −} ground state in {sup 203}Fr and {sup 205}Fr.

  10. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Science.gov (United States)

    Jakobsson, U.; Uusitalo, J.; Auranen, K.; Badran, H.; Cederwall, B.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; HerzáÅ, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J.; Scholey, C.; Sorri, J.; Stolze, S.

    2015-10-01

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2+ state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2+ state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2+ state and the spherical 9/2- ground state in 203Fr and 205Fr.

  11. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...

  12. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    NARCIS (Netherlands)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Koester, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjoedin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical

  13. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  14. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even sing...... of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies....

  15. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  16. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  17. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  18. At R207

    CERN Multimedia

    CERN PhotoLab

    1976-01-01

    The photo shows the fast electronics racks of the experiment R207 by the CERN-Holland-Manchester Collaboration. R207 aimed at the study of diffraction dissociation and formation at small momentum transfers. Gerjan Bobbink and Alan Rudge stand in front of the racks.

  19. Adsorption of the astatine species on a gold surface: A relativistic density functional theory study

    Science.gov (United States)

    Demidov, Yuriy; Zaitsevskii, Andréi

    2018-01-01

    We report first-principle based studies of the adsorption interaction of astatine species on a gold surface. These studies are aimed primarily at the support and interpretation of gas chromatographic experiments with superheavy elements, tennessine (Ts, Z = 117), a heavier homologue of At, and possibly its pseudo-homologue nihonium (Nh, Z = 113). We use gold clusters with up to 69 atoms to simulate the adsorption sites and estimate the desorption energies of At & AtOH from a stable gold (1 1 1) surface. To describe the electronic structure of At -Aun and AtOH -Aun complexes, we combine accurate shape-consistent relativistic pseudopotentials and non-collinear two-component relativistic density functional theory. The predicted desorption energies of At and AtOH on gold are 130 ± 10 kJ/mol and 90 ± 10 kJ/mol, respectively. These results confirm the validity of the estimates derived from chromatographic data (147 ± 15 kJ/mol for At, and 100-10+20 kJ/mol for AtOH).

  20. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  1. At R207

    CERN Multimedia

    1975-01-01

    With R207 the CERN-Holland-Manchester Collaboration studied proton-proton diffraction dissociation at small momentum transfer. This followed, at Intersection 2, the study of correlations associated with high transverse momentum particles by Daresbury-Liverpool-RHEL Collaboration (R205) and of multiplicity and rapidity distributions in diffractive collisions by CERN-Holland-Lancaster-Manchester (R206), and used part of the previous set-up.

  2. At R207

    CERN Multimedia

    1975-01-01

    At the centre, a barrel shaped hodoscope surrounds the beams' crossing point. It was previously used for experiments R205 and R206 which did run in 1974. After their completion in mid 1975 the equipment of R205 was removed, and that of R206 was modified and rearranged to create two small angle spectrometers, one on each side of the intersection, for experiment R207 (diffraction dissociation and formation at small momentum transfer), by the CERN-Holland-Manchester Collaboration. (see also photos 7508109X and 7508113X) Here on the right, Lars Leistam.

  3. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  4. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  5. 19 CFR 207.105 - Confidentiality.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Confidentiality. 207.105 Section 207.105 Customs... and Committee Proceedings § 207.105 Confidentiality. (a) Protection of proprietary and privileged.... (b) Confidentiality of proceedings. Upon the request of any charged party pursuant to § 207.106 of...

  6. 40 CFR 240.207 - Aesthetics.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Aesthetics. 240.207 Section 240.207 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE THERMAL PROCESSING OF SOLID WASTES Requirements and Recommended Procedures § 240.207 Aesthetics. ...

  7. 1 CFR 20.7 - Deadline dates.

    Science.gov (United States)

    2010-01-01

    ... 1 General Provisions 1 2010-01-01 2010-01-01 false Deadline dates. 20.7 Section 20.7 General... DOCUMENTS HANDLING OF THE UNITED STATES GOVERNMENT MANUAL STATEMENTS § 20.7 Deadline dates. The Manual is... basis. Therefore, agencies must comply with the deadline dates established by the Director of the...

  8. 30 CFR 90.207 - Compliance sampling.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Compliance sampling. 90.207 Section 90.207... MANDATORY HEALTH STANDARDS-COAL MINERS WHO HAVE EVIDENCE OF THE DEVELOPMENT OF PNEUMOCONIOSIS Sampling Procedures § 90.207 Compliance sampling. (a) The operator shall take five valid respirable dust samples for...

  9. 47 CFR 54.207 - Service areas.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 3 2010-10-01 2010-10-01 false Service areas. 54.207 Section 54.207... SERVICE Carriers Eligible for Universal Service Support § 54.207 Service areas. (a) The term service area means a geographic area established by a state commission for the purpose of determining universal...

  10. 34 CFR 300.207 - Personnel development.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 2 2010-07-01 2010-07-01 false Personnel development. 300.207 Section 300.207 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION... CHILDREN WITH DISABILITIES Local Educational Agency Eligibility § 300.207 Personnel development. The LEA...

  11. 49 CFR 393.207 - Suspension systems.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Suspension systems. 393.207 Section 393.207... NECESSARY FOR SAFE OPERATION Frames, Cab and Body Components, Wheels, Steering, and Suspension Systems § 393.207 Suspension systems. (a) Axles. No axle positioning part shall be cracked, broken, loose or missing...

  12. 27 CFR 41.207 - [Reserved

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false 41.207 Section 41.207 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE... TOBACCO Tobacco Products Importers Filing and Retention of Records and Reports § 41.207 ...

  13. 7 CFR 1220.207 - Alternate members.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Alternate members. 1220.207 Section 1220.207... CONSUMER INFORMATION Soybean Promotion and Research Order United Soybean Board § 1220.207 Alternate members... members of the Board. (b) The Secretary shall appoint one alternate member of the Board for each unit...

  14. 49 CFR 107.207 - Processing.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Processing. 107.207 Section 107.207 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION... PROCEDURES Preemption Preemption Determinations § 107.207 Processing. (a) The Chief Counsel may initiate an...

  15. 40 CFR 2.207 - Class determinations.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Class determinations. 2.207 Section 2.207 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL PUBLIC INFORMATION Confidentiality of Business Information § 2.207 Class determinations. (a) The General Counsel may make and issue a...

  16. 5 CFR 630.207 - Travel time.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Travel time. 630.207 Section 630.207... and General Provisions for Annual and Sick Leave § 630.207 Travel time. The travel time granted an employee under section 6303(d) of title 5, United States Code, is inclusive of the time necessarily...

  17. 47 CFR 18.207 - Technical report.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false Technical report. 18.207 Section 18.207... Applications and Authorizations § 18.207 Technical report. When required by the Commission a technical report...(s) under which the equipment is or will be marketed. (e) A statement of the rated technical...

  18. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  19. Evidence for Bismuth-207 in Global Fallout

    DEFF Research Database (Denmark)

    Aarkrog, Asker; Dahlgaard, Henning; Holm, Elis

    1984-01-01

    Samples of lichen, moss, soil and air collected since 1961 in Greenland, Svalbard, Iceland, the Faroe Islands, Sweden and Denmark have been remeasured for γ-emitting radionuclides by Ge(Li) spectroscopy. The samples have shown the presence of 207Bi (physical half-life 38 years), a nuclide which h...... not been reported earlier in world-wide fallout. The concentrations of 207Bi have been compared with those of 60Co, 125Sb, and 137Cs. From this comparison the production of 207Bi is estimated at 1 PBq. It is assumed that the 207Bi is created in thermonuclear tested explosions in general...

  20. 31 CFR 560.207 - Prohibited investment.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Prohibited investment. 560.207... § 560.207 Prohibited investment. Except as otherwise authorized pursuant to this part, and... investment by a United States person in Iran or in property (including entities) owned or controlled by the...

  1. 47 CFR 97.207 - Space station.

    Science.gov (United States)

    2010-10-01

    ... space station licensee has assessed and limited the amount of debris released in a planned manner during... space station becoming a source of debris by collisions with large debris or other operational space... 47 Telecommunication 5 2010-10-01 2010-10-01 false Space station. 97.207 Section 97.207...

  2. 24 CFR 1003.207 - Ineligible activities.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Ineligible activities. 1003.207... Activities § 1003.207 Ineligible activities. The general rule is that any activity that is not authorized... section identifies specific activities that are ineligible and provides guidance in determining the...

  3. 24 CFR 570.207 - Ineligible activities.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false Ineligible activities. 570.207... URBAN DEVELOPMENT COMMUNITY FACILITIES COMMUNITY DEVELOPMENT BLOCK GRANTS Eligible Activities § 570.207 Ineligible activities. The general rule is that any activity that is not authorized under the provisions of...

  4. 49 CFR 1540.207 - [Reserved

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 9 2010-10-01 2010-10-01 false 1540.207 Section 1540.207 Transportation Other Regulations Relating to Transportation (Continued) TRANSPORTATION SECURITY ADMINISTRATION, DEPARTMENT OF HOMELAND SECURITY CIVIL AVIATION SECURITY CIVIL AVIATION SECURITY: GENERAL RULES Security Threat...

  5. 31 CFR 800.207 - Covered transaction.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Covered transaction. 800.207 Section 800.207 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF INVESTMENT SECURITY, DEPARTMENT OF THE TREASURY REGULATIONS PERTAINING TO MERGERS, ACQUISITIONS, AND...

  6. 7 CFR 62.207 - Official assessment.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Official assessment. 62.207 Section 62.207 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946 AND...

  7. 40 CFR 86.207-94 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false 86.207-94 Section 86.207-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty Passenger...

  8. 5 CFR 179.207 - Hearing.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Hearing. 179.207 Section 179.207 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS... copies of such records to the employee. (e) Hearing official. The Office may request an administrative...

  9. 44 CFR 207.4 - Responsibilities.

    Science.gov (United States)

    2010-10-01

    ... HOMELAND SECURITY DISASTER ASSISTANCE MANAGEMENT COSTS § 207.4 Responsibilities. (a) General. This section identifies key responsibilities of FEMA and grantees in carrying out section 324 of the Stafford Act, 42 U.S...: (1) Determining the lock-in amount for management costs in accordance with § 207.5. (2) Obligating...

  10. 19 CFR 207.112 - Hearings.

    Science.gov (United States)

    2010-04-01

    ... INJURY TO DOMESTIC INDUSTRIES RESULTS FROM IMPORTS SOLD AT LESS THAN FAIR VALUE OR FROM SUBSIDIZED... and Committee Proceedings § 207.112 Hearings. (a) Purpose of and scheduling of hearings. An...

  11. Dicty_cDB: VHD207 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHD207 (Link to dictyBase) - - - Contig-U16597-1 VHD207P (Link to Original site) VHD207F...(Link to library) Clone ID VHD207 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig...Contig-U16597-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHD2-A/VHD207Q.Seq.d/ Representative...Representative seq. ID VHD207P (Link to Original site) Representative DNA sequence >VHD207 (VHD207Q) /CSM/VH/VHD2-A/VHD207Q...d/ GAATNAACTCTTGTTGTTTGTTTGAAAATCAAATCAATTTCCTTTAAAGATAGTTTTTTA AAGAAAAATGGCACCACCAACAAAAGAATTAACAAATA

  12. An automated flow system incorporating in-line acid dissolution of bismuth metal from a cyclotron irradiated target assembly for use in the isolation of astatine-211

    Energy Technology Data Exchange (ETDEWEB)

    O’Hara, Matthew J.; Krzysko, Anthony J.; Niver, Cynthia M.; Morrison, Samuel S.; Owsley, Stanley L.; Hamlin, Donald K.; Dorman, Eric F.; Scott Wilbur, D.

    2017-04-01

    Astatine-211 (211At) is a promising cyclotron-produced radionuclide being investigated for use in targeted alpha therapy of blood borne and metastatic cancers, as well as treatment of tumor remnants after surgical resections. The isolation of trace quantities of 211At, produced within several grams of a Bi metal cyclotron target, involves a complex, multi-step procedure: (1) Bi metal dissolution in strong HNO3, (2) distillation of the HNO3 to yield Bi salts containing 211At, (3) dissolution of the salts in strong HCl, (4) solvent extraction of 211At from bismuth salts with diisopropyl ether (DIPE), and (5) back-extraction of 211At from DIPE into NaOH, leading to a purified 211At product. Step (1) has been addressed first to begin the process of automating the onerous 211At isolation process. A computer-controlled Bi target dissolution system has been designed. The system performs in-line dissolution of Bi metal from the target assembly using an enclosed target dissolution block, routing the resulting solubilized 211At/Bi mixture to the subsequent process step. The primary parameters involved in Bi metal solubilization (HNO3 concentration and influent flow rate) were optimized prior to evaluation of the system performance on replicate cyclotron irradiated targets. The results indicate that the system performs reproducibly, having nearly quantitative release of 211At from irradiated targets, with cumulative 211At recoveries that follow a sigmoidal function. The predictable nature of the 211At release profile allows the user to tune the system to meet target processing requirements.

  13. Reagents for astatination of biomolecules. 2. Conjugation of anionic boron cage pendant groups to a protein provides a method for direct labeling that is stable to in vivo deastatination.

    Science.gov (United States)

    Wilbur, D Scott; Chyan, Ming-Kuan; Hamlin, Donald K; Vessella, Robert L; Wedge, Timothy J; Hawthorne, M Frederick

    2007-01-01

    Cancer-targeting biomolecules labeled with 211At must be stable to in vivo deastatination, as control of the 211At distribution is critical due to the highly toxic nature of alpha-particle emission. Unfortunately, no astatinated aryl conjugates have shown in vivo stability toward deastatination when (relatively) rapidly metabolized proteins, such as monoclonal antibody Fab' fragments, are labeled. As a means of increasing the in vivo stability of 211At-labeled proteins, we have been investigating antibody conjugates of boron cage moieties. In this investigation, protein-reactive derivatives containing a nido-carborane (2), a bis-nido-carborane derivative (Venus Flytrap Complex, 3), and four 2-nonahydro-closo-decaborate(2-) derivatives (4-7) were prepared and conjugated with an antibody Fab' fragment such that subsequent astatination and in vivo tissue distributions could be obtained. To aid in determination of stability toward in vivo deastatination, the Fab'-borane conjugates were also labeled with 125I, and that material was coinjected with the 211At-labeled Fab'. For comparison, direct labeling of the Fab' with 125I and 211At was conducted. Direct labeling with Na[125I]I and Chloramine-T gave an 89% radiochemical yield. However, direct labeling of the Fab' with Na[211At]At and Chloramine-T resulted in a yield of Studies to optimize the closo-decaborate(2-) conjugates for protein labeling are underway.

  14. 30 CFR 207.1 - Required recordkeeping.

    Science.gov (United States)

    2010-07-01

    ... SALES AGREEMENTS OR CONTRACTS GOVERNING THE DISPOSAL OF LEASE PRODUCTS General Provisions § 207.1... per year for each record keeper to maintain copies of sales contracts, agreements, or other documents... of Management and Budget, Paperwork Reduction Project 1010-0061, Washington, DC 20503. ...

  15. 48 CFR 207.470 - Statutory requirements.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE ACQUISITION PLANNING ACQUISITION PLANNING Equipment Lease or Purchase 207.470 Statutory... any contract for any vessel, aircraft, or vehicle, through a lease, charter, or similar agreement with... vehicles. The contracting officer shall not enter into any contract for the lease or charter of any vessel...

  16. 5 CFR 430.207 - Monitoring performance.

    Science.gov (United States)

    2010-01-01

    ... MANAGEMENT Performance Appraisal for General Schedule, Prevailing Rate, and Certain Other Employees § 430.207 Monitoring performance. (a) Minimum period. An appraisal program shall establish a minimum period of...) Assisting employees in improving unacceptable performance at any time during the appraisal period that...

  17. 8 CFR 207.4 - Approved application.

    Science.gov (United States)

    2010-01-01

    ... Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADMISSION OF REFUGEES § 207.4 Approved application. Approval of Form I-590 by an officer in charge outside the United States authorizes the district director of the port of entry in the United States to admit the applicant...

  18. 8 CFR 207.2 - Applicant processing.

    Science.gov (United States)

    2010-01-01

    .... Transportation for the applicant from his/her present abode to the place of resettlement in the United States... Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADMISSION OF REFUGEES § 207.2 Applicant processing. (a) Forms. Each applicant who seeks admission as a refugee shall submit an...

  19. 8 CFR 207.1 - Eligibility.

    Science.gov (United States)

    2010-01-01

    ... for admission to the United States by filing an application in accordance with § 207.2. In those areas too distant from a Service office, the application may be filed at a designated United States consular... United States and has travelled to and entered that country as a consequence of his/her flight from...

  20. 40 CFR 96.207 - Computation of time.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Computation of time. 96.207 Section 96.207 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) NOX... Trading Program General Provisions § 96.207 Computation of time. (a) Unless otherwise stated, any time...

  1. 40 CFR 97.207 - Computation of time.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Computation of time. 97.207 Section 97.207 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED... Provisions § 97.207 Computation of time. (a) Unless otherwise stated, any time period scheduled, under the...

  2. 19 CFR 207.27 - Short life cycle products.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Short life cycle products. 207.27 Section 207.27... SUBSIDIZED EXPORTS TO THE UNITED STATES Final Determinations, Short Life Cycle Products § 207.27 Short life... scope of the product category into which to classify the short life cycle merchandise identified by the...

  3. 49 CFR 1542.207 - Access control systems.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 9 2010-10-01 2010-10-01 false Access control systems. 1542.207 Section 1542.207..., DEPARTMENT OF HOMELAND SECURITY CIVIL AVIATION SECURITY AIRPORT SECURITY Operations § 1542.207 Access control systems. (a) Secured area. Except as provided in paragraph (b) of this section, the measures for...

  4. 49 CFR 382.207 - Pre-duty use.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Pre-duty use. 382.207 Section 382.207 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL MOTOR CARRIER SAFETY... ALCOHOL USE AND TESTING Prohibitions § 382.207 Pre-duty use. No driver shall perform safety-sensitive...

  5. 47 CFR 13.207 - Preparing an examination.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false Preparing an examination. 13.207 Section 13.207 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL COMMERCIAL RADIO OPERATORS Examination System § 13.207... examination. Each five letters of the alphabet must be counted as one word or one code group. Each numeral...

  6. 49 CFR 1560.207 - Oversight of process.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 9 2010-10-01 2010-10-01 false Oversight of process. 1560.207 Section 1560.207..., DEPARTMENT OF HOMELAND SECURITY CIVIL AVIATION SECURITY SECURE FLIGHT PROGRAM Passenger Redress § 1560.207 Oversight of process. The redress process and its implementation are subject to review by the TSA and DHS...

  7. 33 CFR 207.370 - Big Fork River, Minn.; logging.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Big Fork River, Minn.; logging. 207.370 Section 207.370 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE NAVIGATION REGULATIONS § 207.370 Big Fork River, Minn.; logging. (a) During the season...

  8. 33 CFR 207.800 - Collection of navigation statistics.

    Science.gov (United States)

    2010-07-01

    ... statistics. 207.800 Section 207.800 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE NAVIGATION REGULATIONS § 207.800 Collection of navigation statistics. (a... received by the Waterborne Commerce Statistics Center within 30 days after the close of the month in which...

  9. 44 CFR 207.5 - Determination of management cost funding.

    Science.gov (United States)

    2010-10-01

    ... cost funding. 207.5 Section 207.5 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF HOMELAND SECURITY DISASTER ASSISTANCE MANAGEMENT COSTS § 207.5 Determination of management cost funding. (a) General. This section describes how FEMA determines the amount of funds that it...

  10. 20 CFR 725.207 - Determination of dependency; divorced spouse.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Determination of dependency; divorced spouse. 725.207 Section 725.207 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION, DEPARTMENT OF LABOR...) § 725.207 Determination of dependency; divorced spouse. For the purpose of augmenting benefits, an...

  11. 47 CFR 101.207 - Suspension of transmission.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Suspension of transmission. 101.207 Section 101.207 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES FIXED MICROWAVE SERVICES Operational Requirements § 101.207 Suspension of transmission. Transmission...

  12. 8 CFR 207.9 - Termination of refugee status.

    Science.gov (United States)

    2010-01-01

    ... REFUGEES § 207.9 Termination of refugee status. The refugee status of any alien (and of the spouse or child of the alien) admitted to the United States under section 207 of the Act shall be terminated by any... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Termination of refugee status. 207.9...

  13. 8 CFR 207.7 - Derivatives of refugees.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Derivatives of refugees. 207.7 Section 207... REFUGEES § 207.7 Derivatives of refugees. (a) Eligibility. A spouse, as defined in section 101(a)(35) of..., shall be granted refugee status if accompanying or following-to-join the principal alien. An...

  14. 24 CFR 92.207 - Eligible administrative and planning costs.

    Science.gov (United States)

    2010-04-01

    ... assistance programs. (b) Staff and overhead. Staff and overhead costs directly related to carrying out the... planning costs. 92.207 Section 92.207 Housing and Urban Development Office of the Secretary, Department of... Prohibited Activities § 92.207 Eligible administrative and planning costs. A participating jurisdiction may...

  15. Parity nonconservation in {sup 207}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Leuschner, M.; Cain, B.; Knott, J.E.; Komives, A.; Szymanski, J.J. [Indiana University Cyclotron Facility, Bloomington, Indiana 47405 (United States); Andalkar, A.; Girit, I.C.; Petrov, M. [Princeton University, Princeton, New Jersey 08540 (United States); Bowman, J.D. [Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States)

    1995-07-10

    Two experiments are currently underway to measure the single-particle weak mixing matrix element for the 1064 KeV transition in {sup 207}Pb. One experiment measures the circular polarization of the 1064 KeV gamma ray emitted from an unpolarized source, while the other experiment measures the forward-backward asymmetry of gamma rays emitted from a polarized source. Analysis of the first set of polarized source data yields an upper limit of 46 eV for the single-particle weak mixing matrix element. {copyright} {ital 1995} {ital American} {ital Institute} {ital of} {ital Physics}.

  16. Resonance capture cross section of 207Pb

    CERN Document Server

    Domingo-Pardo, C.; Aerts, G.; Alvarez-Pol, H.; Alvarez-Velarde, F.; Andriamonje, S.; Andrzejewski, J.; Assimakopoulos, P.; Audouin, L.; Badurek, G.; Baumann, P.; Becvar, F.; Berthoumieux, E.; Bisterzo, S.; Calvino, F.; Cano-Ott, D.; Capote, R.; Carrapico, C.; Cennini, P.; Chepel, V.; Chiaveri, E.; Colonna, N.; Cortes, G.; Couture, A.; Cox, J.; Dahlfors, M.; David, S.; Dillman, I.; Dolfini, R.; Dridi, W.; Duran, I.; Eleftheriadis, C.; Embid-Segura, M.; Ferrant, L.; Ferrari, A.; Ferreira-Marques, R.; Fitzpatrick, L.; Frais-Koelbl, H.; Fujii, K.; Furman, W.; Gallino, R.; Goncalves, I.; Gonzalez-Romero, E.; Goverdovski, A.; Gramegna, F.; Griesmayer, E.; Guerrero, C.; Gunsing, F.; Haas, B.; Haight, R.; Heil, M.; Herrera-Martinez, A.; Igashira, M.; Isaev, S.; Jericha, E.; Kadi, Y.; Kappeler, F.; Karamanis, D.; Karadimos, D.; Kerveno, M.; Ketlerov, V.; Koehler, P.; Konovalov, V.; Kossionides, E.; Krticka, M.; Lamboudis, C.; Leeb, H.; Lindote, A.; Lopes, I.; Lozano, M.; Lukic, S.; Marganiec, J.; Marrone, S.; Mastinu, P.; Mengoni, A.; Milazzo, P.M.; Moreau, C.; Mosconi, M.; Neves, F.; Oberhummer, H.; Oshima, M.; O'Brien, S.; Pancin, J.; Papachristodoulou, C.; Papadopoulos, C.; Paradela, C.; Patronis, N.; Pavlik, A.; Pavlopoulos, P.; Perrot, L.; Plag, R.; Plompen, A.; Plukis, A.; Poch, A.; Pretel, C.; Quesada, J.; Rauscher, T.; Reifarth, R.; Rosetti, M.; Rubbia, C.; Rudolf, G.; Rullhusen, P.; Salgado, J.; Sarchiapone, L.; Savvidis, I.; Stephan, C.; Tagliente, G.; Tain, J.L.; Tassan-Got, L.; Tavora, L.; Terlizzi, R.; Vannini, G.; Vaz, P.; Ventura, A.; Villamarin, D.; Vincente, M.C.; Vlachoudis, V.; Vlastou, R.; Voss, F.; Walter, S.; Wendler, H.; Wiescher, M.; Wisshak, K.

    2006-01-01

    The radiative neutron capture cross section of 207Pb has been measured at the CERN neutron time of flight installation n_TOF using the pulse height weighting technique in the resolved energy region. The measurement has been performed with an optimized setup of two C6D6 scintillation detectors, which allowed us to reduce scattered neutron backgrounds down to a negligible level. Resonance parameters and radiative kernels have been determined for 16 resonances by means of an R-matrix analysis in the neutron energy range from 3 keV to 320 keV. Good agreement with previous measurements was found at low neutron energies, whereas substantial discrepancies appear beyond 45 keV. With the present results, we obtain an s-process contribution of 77(8)% to the solar abundance of 207Pb. This corresponds to an r-process component of 23(8)%, which is important for deriving the U/Th ages of metal poor halo stars.

  17. 19 CFR 207.11 - Contents of petition.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Contents of petition. 207.11 Section 207.11 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION NONADJUDICATIVE INVESTIGATIONS INVESTIGATIONS...) The petition shall allege the elements necessary for the imposition of a duty under section 701(a) or...

  18. 18 CFR 292.207 - Procedures for obtaining qualifying status.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Procedures for obtaining qualifying status. 292.207 Section 292.207 Conservation of Power and Water Resources FEDERAL... certification or recertification order was issued; (F) A decrease in the amount of fossil fuel used by a small...

  19. 29 CFR 1952.207 - Changes to approved plans.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 9 2010-07-01 2010-07-01 false Changes to approved plans. 1952.207 Section 1952.207 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... plans. (a) Legislation. (1) On March 29, 1994, the Assistant Secretary approved Minnesota's revised...

  20. 49 CFR 195.207 - Transportation of pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Transportation of pipe. 195.207 Section 195.207 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY...

  1. 24 CFR 904.207 - Use of appendix.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Use of appendix. 904.207 Section 904.207 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued... appendix. A Content Guide for Counseling and Training Program (Appendix I) is provided as further detailed...

  2. 19 CFR 351.207 - Termination of investigation.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Termination of investigation. 351.207 Section 351.207 Customs Duties INTERNATIONAL TRADE ADMINISTRATION, DEPARTMENT OF COMMERCE ANTIDUMPING AND...) Introduction. “Termination” is a term of art that refers to the end of an antidumping or countervailing duty...

  3. 5 CFR 591.207 - Which areas are COLA areas?

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Which areas are COLA areas? 591.207... ALLOWANCES AND DIFFERENTIALS Cost-of-Living Allowance and Post Differential-Nonforeign Areas Cost-Of-Living Allowances § 591.207 Which areas are COLA areas? OPM has established the following COLA areas: (a) City of...

  4. 5 CFR 551.207 - Professional exemption criteria.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Professional exemption criteria. 551.207 Section 551.207 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PAY... work requiring knowledge of an advanced type in a field of science or learning customarily acquired by...

  5. 37 CFR 2.207 - Methods of payment.

    Science.gov (United States)

    2010-07-01

    ... COMMERCE RULES OF PRACTICE IN TRADEMARK CASES Fees and Payment of Money in Trademark Cases § 2.207 Methods of payment. (a) All payments of money required in trademark cases, including fees for the processing... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Methods of payment. 2.207...

  6. 42 CFR 50.207 - Sterilization by hysterectomy.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Sterilization by hysterectomy. 50.207 Section 50... GENERAL APPLICABILITY Sterilization of Persons in Federally Assisted Family Planning Projects § 50.207 Sterilization by hysterectomy. (a) Programs or projects to which this subpart applies shall not perform or...

  7. 23 CFR 633.207 - Construction labor and materials.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Construction labor and materials. 633.207 Section 633... OPERATIONS REQUIRED CONTRACT PROVISIONS Federal-Aid Contracts (Appalachian Contracts) § 633.207 Construction labor and materials. (a) Construction and materials shall be in accordance with the State highway...

  8. 15 CFR 280.207 - Answer and demand for hearing.

    Science.gov (United States)

    2010-01-01

    ... this part. (d) English language required. The answer, all other papers, and all documentary evidence... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Answer and demand for hearing. 280.207 Section 280.207 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade NATIONAL...

  9. 8 CFR 207.6 - Control over approved refugee numbers.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Control over approved refugee numbers. 207... ADMISSION OF REFUGEES § 207.6 Control over approved refugee numbers. Current numerical accounting of approved refugees is maintained for each special group designated by the President. As refugee status is...

  10. 14 CFR 121.207 - Provisionally certificated airplanes: Operating limitations.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Provisionally certificated airplanes... AND OPERATIONS OPERATING REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Airplane Performance Operating Limitations § 121.207 Provisionally certificated airplanes: Operating limitations. In...

  11. 5 CFR 734.207 - Candidacy for public office.

    Science.gov (United States)

    2010-01-01

    ..., accepting, or receiving political contributions for his or her own campaign; however, such solicitation... REGULATIONS (CONTINUED) POLITICAL ACTIVITIES OF FEDERAL EMPLOYEES Permitted Activities § 734.207 Candidacy for...

  12. A note on {sup 207}Bi in environmental samples

    Energy Technology Data Exchange (ETDEWEB)

    Bossew, P. [European Commission, DG Joint Research Centre, Institute of Environment and Sustainability, Radioactivity Environmental Monitoring Group. Via Fermi 1, I-21020 Ispra, Vatican City State, Holy See (Italy)]. E-mail: peter.bossew@jrc.it; Lettner, H. [Institute of Physics and Biophysics, University of Salzburg, Hellbrunner Strasse 34, A-5020 Salzburg (Austria)]. E-mail: herbert.lettner@sbg.ac.at; Hubmer, A. [Institute of Physics and Biophysics, University of Salzburg, Hellbrunner Strasse 34, A-5020 Salzburg (Austria)

    2006-07-01

    Traces of the radionuclide {sup 207}Bi were identified in soil and cryoconite (glacier sediment) samples from Alpine regions of Austria. This nuclide has been produced in thermonuclear explosions mainly in the early 1960s and subsequently dispersed in the atmosphere. Activity concentrations up to 22 Bq/kg d.m. have been found. The ratio {sup 207}Bi:{sup 137}Cs(global fallout) equals (1.70 {+-} 0.12)10{sup -3}, which is in accordance with literature data. When low levels of {sup 207}Bi are assessed by gamma spectrometry, corrections must be made for a gamma line produced in the lead shield by neutron activation due to cosmic neutrons.

  13. Dust properties of the cometary globule Barnard 207 (LDN 1489)

    Science.gov (United States)

    Togi, Aditya; Witt, Adolf N.; John, Demi St.

    2017-09-01

    Barnard 207 (B207, LDN 1489, LBN 777), also known as the Vulture Head nebula, is a cometary globule in the Taurus-Auriga-Perseus molecular cloud region. B207 is known to host a Class I protostar, IRAS 04016+2610, located at a projected distance of 8400 au from the dense core centre. Using imaging and photometry over a wide wavelength range, from UV to sub-mm, we study the physical properties of B207 and the dust grains contained within. The core density, temperature, and mass are typical of other globules found in the Milky Way interstellar medium (ISM). The increase in the dust albedo with increasing optical wavelengths, along with the detection of coreshine in the near infrared, indicates the presence of larger dust grains in B207. The measured optical, near-, mid- and far-infrared intensities are in agreement with the CMM+AMM and CMM+AMMI dust grain type of The Heterogeneous dust Evolution Model for Interstellar Solids (THEMIS), suggesting mantle formation on the dust grains throughout the globule. We investigate the possibility of turbulence being responsible for diffusing dust grains from the central core to external outer layers of B207. However, in situ formation of large dust grains cannot be excluded. The reduced images (FITS file) in UV and optical bands are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/605/A99

  14. 24 CFR 207.256b - Modification of mortgage terms.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Modification of mortgage terms. 207... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MULTIFAMILY HOUSING MORTGAGE INSURANCE Contract Rights and Obligations Rights and Duties of...

  15. 19 CFR 207.21 - Final phase notice of scheduling.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Final phase notice of scheduling. 207.21 Section... INVESTIGATIONS OF WHETHER INJURY TO DOMESTIC INDUSTRIES RESULTS FROM IMPORTS SOLD AT LESS THAN FAIR VALUE OR FROM... notice of scheduling. (a) Notice from the administering authority of an affirmative preliminary...

  16. 50 CFR 216.207 - Applications for Letters of Authorization.

    Science.gov (United States)

    2010-10-01

    ... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Construction and Operation of Offshore Oil and Gas Facilities in the U.S. Beaufort Sea § 216.207 Applications for Letters of Authorization...

  17. Measurement of the conversion ration for 207Bi

    DEFF Research Database (Denmark)

    Andersen, Verner; Christensen, Carl Jørgen

    1968-01-01

    The conversion ratios for the 570 keV and 1064 keV transitions in 207Bi were measured with a 4πβ spectrometer. The αK values were 0.0156±3.0% and 0.084(±10%), respectively, in reasonable agreement with theory....

  18. 27 CFR 555.207 - Construction of type 1 magazines.

    Science.gov (United States)

    2010-04-01

    ..., FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE EXPLOSIVES COMMERCE IN EXPLOSIVES Storage § 555.207...) Fabricated metal wall construction. Metal wall construction is to consist of sectional sheets of steel or... through the roof and into the magazine at such an angle that the bullet would strike the explosives within...

  19. 41 CFR 101-27.207-1 - Agency controls.

    Science.gov (United States)

    2010-07-01

    ... Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 27-INVENTORY MANAGEMENT 27.2-Management of Shelf-Life Materials § 101-27.207-1 Agency controls. Agencies shall establish the necessary... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Agency controls. 101-27...

  20. 41 CFR 101-27.207 - Control and inspection.

    Science.gov (United States)

    2010-07-01

    ... Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 27-INVENTORY MANAGEMENT 27.2-Management of Shelf-Life Materials § 101-27.207 Control and inspection. ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Control and inspection...

  1. 44 CFR 207.8 - Management cost funding oversight.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Management cost funding..., DEPARTMENT OF HOMELAND SECURITY DISASTER ASSISTANCE MANAGEMENT COSTS § 207.8 Management cost funding... accountability of funds provided for management costs as required by part 13 of this chapter, especially §§ 13.20...

  2. 44 CFR 207.10 - Review of management cost rates.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Review of management cost..., DEPARTMENT OF HOMELAND SECURITY DISASTER ASSISTANCE MANAGEMENT COSTS § 207.10 Review of management cost rates. (a) FEMA will review management cost rates not later than 3 years after this rule is in effect and...

  3. 8 CFR 207.5 - Waiting lists and priority handling.

    Science.gov (United States)

    2010-01-01

    ... from these lists in a manner that will best support the policies and interests of the United States... association with the United States, compelling humanitarian concerns, and public interest factors. ... REFUGEES § 207.5 Waiting lists and priority handling. Waiting lists are maintained for each designated...

  4. 9 CFR 113.207 - Encephalomyelitis Vaccine, Eastern, Western, and Venezuelan, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ..., Western, and Venezuelan, Killed Virus. 113.207 Section 113.207 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.207 Encephalomyelitis...

  5. 49 CFR 238.207 - Link between coupling mechanism and car body.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Link between coupling mechanism and car body. 238.207 Section 238.207 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL... Requirements for Tier I Passenger Equipment § 238.207 Link between coupling mechanism and car body. All...

  6. 24 CFR 3280.207 - Requirements for foam plastic thermal insulating materials.

    Science.gov (United States)

    2010-04-01

    ... mineral fiber insulation or an equivalent thermal barrier; or (3) The foam plastic insulating material has... thermal insulating materials. 3280.207 Section 3280.207 Housing and Urban Development Regulations Relating... SAFETY STANDARDS Fire Safety § 3280.207 Requirements for foam plastic thermal insulating materials. (a...

  7. 19 CFR 207.118 - Role of the General Counsel in advising the Commission.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Role of the General Counsel in advising the Commission. 207.118 Section 207.118 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION... Provisions of A Protective Order Issued During Panel and Committee Proceedings § 207.118 Role of the General...

  8. 41 CFR 101-27.207-3 - Marking material to show extended shelf life.

    Science.gov (United States)

    2010-07-01

    ... extended shelf life. 101-27.207-3 Section 101-27.207-3 Public Contracts and Property Management Federal...-INVENTORY MANAGEMENT 27.2-Management of Shelf-Life Materials § 101-27.207-3 Marking material to show extended shelf life. When the shelf-life period of Type II material (except for critical end-use items as...

  9. 5 CFR 880.207 - Adjustment of accounts after finding of death.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Adjustment of accounts after finding of death. 880.207 Section 880.207 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL... Procedures § 880.207 Adjustment of accounts after finding of death. After a missing annuitant is determined...

  10. 31 CFR 515.207 - Entry of vessels engaged in trade with Cuba.

    Science.gov (United States)

    2010-07-01

    ... with Cuba. 515.207 Section 515.207 Money and Finance: Treasury Regulations Relating to Money and... REGULATIONS Prohibitions § 515.207 Entry of vessels engaged in trade with Cuba. Except as specifically... place in Cuba to engage in the trade of goods or the purchase or provision of services, may enter a U.S...

  11. 28 CFR 45.3 - Disciplinary proceedings under 18 U.S.C. 207(j).

    Science.gov (United States)

    2010-07-01

    .... 207(j). 45.3 Section 45.3 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) EMPLOYEE RESPONSIBILITIES § 45.3 Disciplinary proceedings under 18 U.S.C. 207(j). (a) Upon a determination by the Assistant... authorized by 18 U.S.C. 207(j), or subjected to other appropriate disciplinary action under that statute. The...

  12. 44 CFR 207.7 - Procedures for requesting management cost funding.

    Science.gov (United States)

    2010-10-01

    ... management cost funding. 207.7 Section 207.7 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF HOMELAND SECURITY DISASTER ASSISTANCE MANAGEMENT COSTS § 207.7 Procedures for requesting management cost funding. (a) General. This section describes the procedures to be used by the...

  13. 21 CFR 207.40 - Establishment registration and drug listing requirements for foreign establishments.

    Science.gov (United States)

    2010-04-01

    ... in the English language. (c) Each foreign drug establishment required to register under paragraph (a... requirements for foreign establishments. 207.40 Section 207.40 Food and Drugs FOOD AND DRUG ADMINISTRATION... LISTING OF DRUGS IN COMMERCIAL DISTRIBUTION Procedure for Foreign Drug Establishments § 207.40...

  14. 27 CFR 27.207 - Bottles to be used for display purposes.

    Science.gov (United States)

    2010-04-01

    ... display purposes. 27.207 Section 27.207 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND... Requirements for Liquor Bottles § 27.207 Bottles to be used for display purposes. Empty liquor bottles may be imported and furnished to liquor dealers for display purposes, provided each bottle is marked to show that...

  15. Untersuchung zur Rolle der Profilaggrin-Peptide FLG176-207, FLG162-184 und FLG162-207 in der kutanen Abwehr

    OpenAIRE

    Garske, Kristin

    2016-01-01

    Es wurde die Hypothese aufgestellt, dass Peptidfragmente des Profilaggrins antimikrobielle Eigenschaften aufweisen. Im Rahmen dieser Dissertation war deshalb geplant, drei in antimikrobiell aktiven HPLC-Fraktionen enthaltene FLG-Peptide (FLG176-207, FLG162-207 und FLG162-184) hinsichtlich möglicher antimikrobieller Eigenschaften zu untersuchen.

  16. 25 CFR 170.207 - What is the intent of IRRHPP emergency/disaster funding?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false What is the intent of IRRHPP emergency/disaster funding? 170.207 Section 170.207 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER INDIAN RESERVATION ROADS PROGRAM Indian Reservation Roads Program Funding Irr High Priority Project (irrhpp) § 170.207 What is the intent of IRRHPP...

  17. [Clinical study of serum and tissue concentrations of FT-207 and 5-FU in patients with cancer of the large intestine following preoperative application of FT-207 suppositories].

    Science.gov (United States)

    Okuda, M; Teramoto, T; Yoshida, H; Sato, K; Ushijima, Y; Uematsu, Y

    1982-09-01

    1.5 g/day of FT-207 suppository was administered for two weeks prior to operation to twenty patients with large bowel carcinoma of familiar poliposis coli. The level of FT-207 and 5-FU in serum, lymph node, tumor and normal colonic mucosa were determined by bioassay. The levels of FT-207 in the rectum, sigmoid colon and tumor were higher than that in serum. The levels of 5-FU in the rectum, sigmoid colon, tumor and lymph node were also higher than that in serum. The levels of FT-207 and 5-FU in carcinoma of the rectum was higher than those in serum. Compared with the level in normal rectal mucosa, only the level of 5-FU in rectal carcinoma was higher. From the histological point of view, the highest levels of FT-207 and 5-FU was observed in well-differentiated adenocarcinoma. There was no side effect experienced in our series, therefore, FT-207 suppository seems to be one of the safe promising preoperative chemotherapies.

  18. 9 CFR 205.207 - “Amount” and “County or parish”.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false âAmountâ and âCounty or parishâ. 205.207 Section 205.207 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS... of such product owned by the person in question is subject to the security interest in question. (c...

  19. 7 CFR 205.207 - Wild-crop harvesting practice standard.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Wild-crop harvesting practice standard. 205.207 Section 205.207 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) ORGANIC FOODS PRODUCTION ACT PROVISIONS NATIONAL...

  20. 24 CFR 206.207 - Allowable charges and fees after endorsement.

    Science.gov (United States)

    2010-04-01

    ... endorsement. 206.207 Section 206.207 Housing and Urban Development Regulations Relating to Housing and Urban... and fees after endorsement. (a) Reasonable and customary charges. The mortgagee may collect reasonable and customary charges and fees from the mortgagor after insurance endorsement by adding them to the...

  1. 75 FR 76953 - Foreign-Trade Zone 207-Richmond, VA Site Renumbering Notice

    Science.gov (United States)

    2010-12-10

    ... Foreign-Trade Zones Board Foreign-Trade Zone 207--Richmond, VA Site Renumbering Notice Foreign-Trade Zone 207 was approved by the Foreign-Trade Zones Board on March 31, 1995 (Board Order 733) and expanded on... Drive, Ashland. For further information, contact Maureen Hinman at [email protected]trade.gov or (202) 482...

  2. 33 CFR 207.270 - Tallahatchie River, Miss., between Batesville and the mouth; logging.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Tallahatchie River, Miss., between Batesville and the mouth; logging. 207.270 Section 207.270 Navigation and Navigable Waters CORPS... Tallahatchie River, Miss., between Batesville and the mouth; logging. (a) The floating of “sack”, rafts, or of...

  3. 27 CFR 44.207 - To commercial vessels and aircraft for consumption as supplies.

    Science.gov (United States)

    2010-04-01

    ... aircraft for consumption as supplies. 44.207 Section 44.207 Alcohol, Tobacco Products and Firearms ALCOHOL... TOBACCO PRODUCTS AND CIGARETTE PAPERS AND TUBES, WITHOUT PAYMENT OF TAX, OR WITH DRAWBACK OF TAX Removal of Shipments of Tobacco Products and Cigarette Papers and Tubes by Manufacturers and Export Warehouse...

  4. 5 CFR 930.207 - Details and assignments to other duties within the same agency.

    Science.gov (United States)

    2010-01-01

    ... within the same agency. 930.207 Section 930.207 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT... same agency. (a) An agency may detail an administrative law judge from one administrative law judge position to another administrative law judge position within the same agency in accordance with 5 U.S.C...

  5. CD207+/langerin positive dendritic cells in invasive and in situ cutaneous malignant melanoma

    Directory of Open Access Journals (Sweden)

    Grzegorz Dyduch

    2017-05-01

    Full Text Available Introduction : Dendritic cells are crucial for cutaneous immune response. Their role in melanoma progression is however a matter of controversy. Material and methods : The number of dendritic cells within epidermis and in peri- and intratumoral location was analyzed using CD207 immunostain in 17 cases of in situ and 25 case of invasive melanoma. Results : Average peritumoral CD207+ cells count was 22.88 for all cases, 17.94 for in situ lesions and 26.24 for invasive cases. Average epidermal CD207+ cells count was 164.47 for all cases, 183.00 for in situ lesions and 150.78 – for invasive cases. In case of invasive melanomas, peritumoral CD207+ cells count was positively correlated with Breslow stage (R = 0.59 mitotic activity within the tumor (R = 0.62. Invasive cases with regression showed higher intratumoral and epidermal CD207+ cells count than the ones without (275.00 vs. 95.32 and 173.20 vs. 148.35 but lower peritumoral CD207+ cells count (17.60 vs. 27.26. Invasive cases with ulceration showed higher intratumoral and peritumoral CD207+ cells count than the ones without ulceration (220.08 vs. 55.67 and 44.17 vs. 9.69. Conclusions : CD207+ cells play a role in both progression and regression of melanoma but their exact role needs further studies.

  6. 33 CFR 207.170 - Federal Dam, Oklawaha River, Moss Bluff, Fla.; pool level.

    Science.gov (United States)

    2010-07-01

    ... Bluff, Fla.; pool level. 207.170 Section 207.170 Navigation and Navigable Waters CORPS OF ENGINEERS..., Moss Bluff, Fla.; pool level. (a) The level of the pool shall normally be maintained at elevation 56.5..., Fla., and subject to such conditions as he may specify. (b) When, in the opinion of the District...

  7. 50 CFR 648.207 - Herring Research Set-Aside (RSA).

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 8 2010-10-01 2010-10-01 false Herring Research Set-Aside (RSA). 648.207 Section 648.207 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE FISHERIES OF THE NORTHEASTERN UNITED STATES Management Measures for the Atlantic Herring Fishery § 64...

  8. 49 CFR 375.207 - What items must be in my advertisements?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false What items must be in my advertisements? 375.207... Services to My Customers General Responsibilities § 375.207 What items must be in my advertisements? (a) You and your agents must publish and use only truthful, straightforward, and honest advertisements. (b...

  9. 8 CFR 207.8 - Physical presence in the United States.

    Science.gov (United States)

    2010-01-01

    ... ADMISSION OF REFUGEES § 207.8 Physical presence in the United States. For the purpose of adjustment of... the United States is computed from the date the applicant entered the United States as a refugee. ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Physical presence in the United States. 207...

  10. 33 CFR 207.360 - Rainy River, Minn.; logging regulations for portions of river within jurisdiction of the United...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Rainy River, Minn.; logging regulations for portions of river within jurisdiction of the United States. 207.360 Section 207.360 Navigation... REGULATIONS § 207.360 Rainy River, Minn.; logging regulations for portions of river within jurisdiction of the...

  11. 48 CFR 6.207 - Set-asides for local firms during a major disaster or emergency.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Set-asides for local firms during a major disaster or emergency. 6.207 Section 6.207 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION ACQUISITION PLANNING COMPETITION REQUIREMENTS Full and Open Competition After Exclusion of Sources 6.207 Set-asides for...

  12. 33 CFR 207.169 - Oklawaha River, navigation lock and dam at Moss Bluff, Fla.; use, administration, and navigation.

    Science.gov (United States)

    2010-07-01

    ... and dam at Moss Bluff, Fla.; use, administration, and navigation. 207.169 Section 207.169 Navigation... REGULATIONS § 207.169 Oklawaha River, navigation lock and dam at Moss Bluff, Fla.; use, administration, and... may be designated by the District Engineer, U.S. Army Engineer District, Jacksonville, Fla., at each...

  13. 33 CFR 207.175a - Carlson's Landing Dam navigation lock, Withlacoochee River, Fla.; use, administration, and...

    Science.gov (United States)

    2010-07-01

    ... lock, Withlacoochee River, Fla.; use, administration, and navigation. 207.175a Section 207.175a... REGULATIONS § 207.175a Carlson's Landing Dam navigation lock, Withlacoochee River, Fla.; use, administration... description as may be designated by the District Engineer, U.S. Army Engineer District, Jacksonville, Fla., at...

  14. 33 CFR 207.170a - Eugene J. Burrell Navigation Lock in Haines Creek near Lisbon, Fla.; use, administration, and...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Eugene J. Burrell Navigation Lock in Haines Creek near Lisbon, Fla.; use, administration, and navigation. 207.170a Section 207.170a... REGULATIONS § 207.170a Eugene J. Burrell Navigation Lock in Haines Creek near Lisbon, Fla.; use...

  15. Recurrence of oropharyngeal carcinoma. A retrospective study of 207 patients

    Energy Technology Data Exchange (ETDEWEB)

    Nigauri, Tomohiko; Kamata, Shin-etsu; Kawabata, Kazuyoshi [Cancer Inst. Hospital, Tokyo (Japan)] [and others

    1999-03-01

    Two hundred seven patients with squamous cell carcinoma of the oropharynx treated at Cancer Institute Hospital, Tokyo from 1971 to 1994 are presented. The patients were 182 males and 25 females, aged from 31 to 87 years (mean: 61 years). One hundred sixteen patients had carcinoma of the lateral wall (tonsillar region), 60 of the anterior wall (base of tongue), 26 of the superior wall (soft palate) and 5 of the posterior wall. Stage distribution was stage I; 12, stage II: 36, stage III: 64, and stage IV: 95. Of these patients, 121 were treated mainly by irradiation and 30 underwent salvage surgery after the failure of primary radiotherapy. The recurrence rate after primary treatment of this group was 43% and the overall local control rate was 70% (T1: 100%, T2: 78%, T3: 61%, T4: 11%). Treatment of advanced oropharyngeal carcinoma remains controversial. Radiation therapy, in our experience, often failed to achieve local control in advanced cases (stage III/IV). Local control rate of another 86 patients treated mainly by surgery was 74% (T1: 100%, T2: 87%, T3: 73%, T4: 50%). The cause-specific survival rate at 5 years for the 207 patients was 59% (stage I: 89%, II: 82%, III: 73%, IV: 36%). (author)

  16. TMC207 becomes bedaquiline, a new anti-TB drug.

    Science.gov (United States)

    Palomino, Juan Carlos; Martin, Anandi

    2013-09-01

    TB still represents a serious public health problem. The latest reports estimate an incidence of 8.7 million cases in 2011 and 1.4 million deaths. Drug resistance contributed an estimated 630,000 cases of multidrug-resistant TB, making control of the disease harder. Recent reports show cases of TB that were almost resistant to all available antibiotics. Therefore, there is an urgent need to develop new anti-TB drugs with the potential of reducing the current length of treatment. Bedaquiline, formerly TMC207, is a new diarylquinoline antibiotic with specific activity against Mycobacterium tuberculosis and several nontuberculous mycobacteria. It acts by inhibiting ATP synthase, interfering with the energy generation needed by the bacterial cell. Based on clinical evaluations for safety, tolerability and efficacy, bedaquiline has recently received accelerated approval for the treatment of pulmonary multidrug-resistant TB in adults. This article will review the main aspects related to the chemistry, microbiology, pharmacology, efficacy and tolerability of bedaquiline.

  17. 9 CFR 203.15 - Trust benefits under sections 206 and 207 of the Act.

    Science.gov (United States)

    2010-01-01

    ... STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE STATEMENTS OF GENERAL POLICY UNDER THE PACKERS AND STOCKYARDS ACT § 203.15 Trust benefits under sections 206 and 207 of the Act...

  18. Prospects for207Pb solid-state NMR studies of lead tetrel bonds.

    Science.gov (United States)

    Southern, Scott A; Errulat, Dylan; Frost, Jamie M; Gabidullin, Bulat; Bryce, David L

    2017-10-13

    The feasibility and value of 207 Pb solid-state NMR experiments on compounds featuring lead tetrel bonds is explored. Although the definition remains to be formalized, lead tetrel bonds may be qualitatively described as existing when there is evidence of a net attractive interaction between an electrophilic region associated with lead in a molecular entity and a nucleophilic region in another, or the same, molecular entity. Unambiguous identification of lead tetrel bonds can be challenging due to the hypervalent tendency of lead. We report here a series of 207 Pb solid-state NMR experiments on five metal-organic frameworks featuring lead coordinated to hydrazone-based ligands. Such frameworks may be held together in part by lead tetrel bonds. The acquisition of 207 Pb solid-state NMR spectra for such materials is feasible and is readily accomplished using a combination of magic-angle spinning and Carr-Purcell-Meiboom-Gill methods in moderate to low applied magnetic fields. The lead centres are characterized by 207 Pb isotropic chemical shifts ranging from -426 to -2591 ppm and chemical shift tensor spans ranging from 910 to 2681 ppm. Careful inspection of the structures of the compounds and the literature 207 Pb NMR data may suggest that a tetrel bond to lead results in chemical shift parameters which are intermediate between those which are characteristic of holodirected and hemidirected lead coordination geometries. Challenges associated with DFT computations of the 207 Pb NMR parameters are discussed. In summary, the 207 Pb data for the compounds studied herein show a marked response to the presence of non-coordinating electron-rich moieties in close contact with the electrophilic surface of formally hemidirectionally coordinated lead compounds.

  19. 49 CFR 229.207 - New locomotive crashworthiness design standards and changes to existing FRA-approved locomotive...

    Science.gov (United States)

    2010-10-01

    ... and changes to existing FRA-approved locomotive crashworthiness design standards. 229.207 Section 229... Design Requirements § 229.207 New locomotive crashworthiness design standards and changes to existing FRA... changes to existing FRA-approved locomotive crashworthiness design standards, including AAR S-580...

  20. 33 CFR 207.200 - Mississippi River below mouth of Ohio River, including South and Southwest Passes; use...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Mississippi River below mouth of Ohio River, including South and Southwest Passes; use, administration, and navigation. 207.200 Section... DEFENSE NAVIGATION REGULATIONS § 207.200 Mississippi River below mouth of Ohio River, including South and...

  1. 5 CFR 2641.207 - One-year restriction on any former private sector assignee under the Information Technology...

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false One-year restriction on any former private sector assignee under the Information Technology Exchange Program representing, aiding, counseling or assisting in representing in connection with any contract with former agency. 2641.207 Section 2641.207 Administrative Personnel OFFICE OF...

  2. 49 CFR 399.207 - Truck and truck-tractor access requirements.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Truck and truck-tractor access requirements. 399... Vehicles § 399.207 Truck and truck-tractor access requirements. (a) General rule. Any person entering or exiting the cab or accessing the rear portion of a high profile COE truck or truck-tractor shall be...

  3. 45 CFR 170.207 - Vocabulary standards for representing electronic health information.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Vocabulary standards for representing electronic... Specifications for Health Information Technology § 170.207 Vocabulary standards for representing electronic... vocabulary standards for the purpose of representing electronic health information: (a) Problems—(1) Standard...

  4. 48 CFR 36.207 - Pricing fixed-price construction contracts.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Pricing fixed-price... Contracting for Construction 36.207 Pricing fixed-price construction contracts. (a) Generally, firm-fixed... methods. (b) Lump-sum pricing shall be used in preference to unit pricing except when— (1) Large...

  5. 42 CFR 441.207 - Drugs and devices and termination of ectopic pregnancies.

    Science.gov (United States)

    2010-10-01

    ... APPLICABLE TO SPECIFIC SERVICES Abortions § 441.207 Drugs and devices and termination of ectopic pregnancies... and for medical procedures necessary for the termination of an ectopic pregnancy. ... 42 Public Health 4 2010-10-01 2010-10-01 false Drugs and devices and termination of ectopic...

  6. Core breaking and octupole low-spin states in $^{207}$ Tl

    CERN Multimedia

    We propose to study the low-spin level structure of the $^{207}$Tl nucleus populated by the $\\beta$- decay of $^{207}$Hg. While $^{207}$Tl is a single-proton hole nucleus, the majority of the observed states will have a three-particle structure thus requiring the breaking of the neutron or proton core, or a collective octupole phonon coupled to the single proton hole. Thus information will be obtained on the single particle orbitals in the vicinity of the N=126 and Z=82 magic numbers, and on the size of the shell gap. The results will be used to improve the predictive power of the shell model for more exotic nuclei as we move to lighter N=126 nuclei.The experiment will use the ISOLDE Decay station, and will take advantage of the $^{207}$Hg beam from the molten lead target. A test on the feasibility to produce an $^{208}$Hg beam from the same target, with the aim to study the $\\beta$-decay into $^{208}$Tl, could be performed at the same time.

  7. 76 FR 5518 - Federal Housing Administration (FHA): Refinancing an Existing Cooperative Under Section 207...

    Science.gov (United States)

    2011-02-01

    ... 223(f) mortgage insurance if the sponsor can demonstrate that there is a definite market demand, and... the [National Housing] Act, or for refinancing the existing debt of an existing nursing home... project under section 207 of the Act, or for refinancing the existing debt of an existing nursing home...

  8. 49 CFR 40.207 - What is the effect of a cancelled drug test?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false What is the effect of a cancelled drug test? 40... TRANSPORTATION WORKPLACE DRUG AND ALCOHOL TESTING PROGRAMS Problems in Drug Tests § 40.207 What is the effect of a cancelled drug test? (a) A cancelled drug test is neither positive nor negative. (1) As an...

  9. 27 CFR 44.207a - To a foreign-trade zone.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false To a foreign-trade zone... of Shipment § 44.207a To a foreign-trade zone. Where tobacco products, and cigarette papers and tubes are removed from a factory or an export warehouse for delivery to a foreign-trade zone, under zone...

  10. 40 CFR 61.207 - Radium-226 sampling and measurement procedures.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Radium-226 sampling and measurement... for Radon Emissions From Phosphogypsum Stacks § 61.207 Radium-226 sampling and measurement procedures... § 61.206, the owner or operator of a phosphogypsum stack shall measure the average radium-226...

  11. Page 1 um- SST measurements with IR radiometer 207 neglect of ...

    Indian Academy of Sciences (India)

    SST measurements with IR radiometer 207 neglect of reflectiºn by assuming unity emissivity would cause an error A.T. --. (T, T, pr where T, is the radiation temperature of the atmosphere, T, is the bulk temperature ºf the scº, * is the reflectivity and p is the atmospheric trans- missivity. ("lºnges in surface temperature ; T range ...

  12. 18 CFR 1304.207 - Channel excavation on TVA-owned residential access shoreland.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 2 2010-04-01 2010-04-01 false Channel excavation on... OF STRUCTURES AND OTHER ALTERATIONS TVA-Owned Residential Access Shoreland § 1304.207 Channel excavation on TVA-owned residential access shoreland. (a) Excavation of individual boat channels shall be...

  13. Laser Spectroscopic Measurements of Isotope Shift and Hyperfine Structure in BISMUTH-207 and BISMUTH-208.

    Science.gov (United States)

    Fang, Zuyun

    1988-12-01

    Measurements of the hyperfine spectra of 38-yr ^{207}Bi and 3.7 times 10^5-yr ^{208}Bi in the 6p^3 ^4S_{3/2} - 6p^27s ^4P_{1/2} 306.7-nm resonance line were made using laser spectroscopic methods. The atomic excitation was produced with use of the frequency doubled output of a tunable ring dye laser. Laser absorption spectroscopy was used for the ^ {208}Bi measurement, while fluorescence spectroscopy, with photon counting detection, was used for ^{208}Bi. The experiments of ^{207}Bi were performed in both zero and high (0.7515 T) magnetic fields. The latter also provided a reliable measurement of the nuclear spin of ^{207}Bi. The results obtained from the ^ {208}Bi spectra are: A(^4P _{1/2}) = 4911(17)MHz and B( ^4S_{3/2}) = -314(92)MHz. These give the values: mu = 4.523(16) mu_{N} and Q = - 0.39(12)b. The measured isotope shift is: IS( ^{208}Bi-^{209 }Bi) = 1870(63)MHz. The results for ^{207} Bi are: I = 9/2, A(^4P_{1/2 }) = 4900.0(8.1)MHz, A(^4S_ {1/2}) = -444.6(1.5)MHz and B(^4S_{1/2}) = -443(17)MHz. These give the values: mu = 4.062(8)mu_ {N} and Q = -0.55(2)b. The measured isotope shift is: IS(^{207 }Bi-^{209}Bi) = 2997(10)MHz. The isotope shift odd-even staggering parameter for ^{208}Bi, gamma = 0.752(43), was derived and used for an isotonic comparison. The measured nuclear magnetic moments are in agreement with theoretical predictions. An improved calculation of the isotope shift constant using a diffuse nuclear charge model is given and a weak, but significant, model dependence of the isotope shifts was found.

  14. LOW-METALLICITY YOUNG CLUSTERS IN THE OUTER GALAXY. I. Sh 2-207

    Energy Technology Data Exchange (ETDEWEB)

    Yasui, Chikako [Department of Astronomy, Graduate School of Science, University of Tokyo, Bunkyo-ku, Tokyo 113-0033 (Japan); Kobayashi, Naoto; Izumi, Natsuko [Institute of Astronomy, School of Science, University of Tokyo, 2-21-1 Osawa, Mitaka, Tokyo 181-0015 (Japan); Tokunaga, Alan T. [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States); Saito, Masao, E-mail: ck.yasui@astron.s.u-tokyo.ac.jp [Nobeyama Radio Observatory, 462-2 Nobeyama, Minamimaki-mura, Minamisaku-gun, Nagano 384-1305 (Japan)

    2016-03-15

    To study star formation in low-metallicity environments ([M/H] ∼ −1 dex), we obtained deep near-infrared (NIR) images of Sh 2-207 (S207), which is an H ii region in the outer Galaxy with a spectroscopically determined metallicity of [O/H] ≃ −0.8 dex. We identified a young cluster in the western region of S207 with a limiting magnitude of K{sub S} = 19.0 mag (10σ) that corresponds to a mass detection limit of ≲0.1 M{sub ⊙} and enables the comparison of star-forming properties under low metallicity with those of the solar neighborhood. From the fitting of the K-band luminosity function (KLF), the age and distance of the S207 cluster are estimated at 2–3 Myr and ∼4 kpc, respectively. The estimated age is consistent with the suggestion of small extinctions of stars in the cluster (A{sub V} ∼ 3 mag) and the non-detection of molecular clouds. The reasonably good fit between the observed KLF and the model KLF suggests that the underlying initial mass function (IMF) of the cluster down to the detection limit is not significantly different from the typical IMFs in the solar metallicity. From the fraction of stars with NIR excesses, a low disk fraction (<10%) in the cluster with a relatively young age is suggested, as we had previously proposed.

  15. Analisis Film Horor Indonesia Produksi Tahun 2014 (Studi Kasus: Mall Klender dan Kamar 207

    Directory of Open Access Journals (Sweden)

    Dedi Sukatno Sembiring Meliala

    2016-02-01

    Full Text Available Abstrak Film horor erat kaitannya dengan tokoh antagonis yang menimbulkan ketakutan pada penonton dalam bentuk makhluk supranatural seperti hantu, roh jahat dan sebagainya. Karakteristik film dengan genre horor membuat penonton terbawa suasana dengan alur ceritanya yang menakutkan. Namun, beberapa dari film horor Indonesia menyajikan adegan-adegan yang kurang sopan bahkan tergolong asusila atau porno. Untuk itu, penelitian ini ingin melihat apakah terdapat konten pornografi pada film Mall Klender dan Kamar 207 yang merupakan film horor Indonesia terlaris di tahun 2014. Analisis dilakukan dengan melihat pandangan dan penilaian 30 responden dengan karakteristik yaitu penonton film horor Indonesia yang berusia 20-40 tahun. Berdasarkan hasil analisis, tidak didapatkan konten pornografi pada film Mall Klender dan Kamar 207. Adegan-adegan yang terindikasi sebagai konten pornografi ternyata masih dapat diterima oleh penonton sebagai adegan yang berada dalam batas kewajaran dan mendukung pembawaan suasana dan kesan dalam cerita yang disampaikan. Kata Kunci: film horror Indonesia, analisis konten, pornografi Abstract The horror film is closely related to the antagonist that causes fear for audience in the form of supernatural creatures such as ghosts, demons and so on. Characteristic of the horor film is to make the audience carried away with the scary plot. However, some of the existing Indonesian horror film presents scenes that classified as obscene or pornographic. Therefore, this study wanted to see if there are any pornographic content on the film Klender Mall and Room 207 is the best-selling Indonesian horror movie in 2014. The analysis was done by looking at the view and assessment of 30 respondents which are Indonesian horror movie goers aged 20-40 years. Based on the analysis, there is no founding of pornographic content on the film Klender Mall and Room 207. The scenes that indicated as pornographic content was still acceptable by the audience

  16. Investigation of 207 nm UV radiation for degradation of organic dye ...

    African Journals Online (AJOL)

    The photo-degradation of organic dye C.I. Acid Red 213 (AR-213) was achieved by 207 nm UV radiation emitted from a planar KrBr* excimer lamp without addition of oxidants at varying initial pH values. Precipitates were found to be generated when the irradiated solution of initial acid pH was adjusted to alkaline pH and ...

  17. The EMSY threonine 207 phospho-site is required for EMSYdriven suppression of DNA damage repair.

    Science.gov (United States)

    Jelinic, Petar; Eccles, Laura A; Tseng, Jill; Cybulska, Paulina; Wielgos, Monicka; Powell, Simon N; Levine, Douglas A

    2017-02-21

    BRCA1 and BRCA2 are essential for the repair of double-strand DNA breaks, and alterations in these genes are a hallmark of breast and ovarian carcinomas. Other functionally related genes may also play important roles in carcinogenesis. Amplification of EMSY, a putative BRCAness gene, has been suggested to impair DNA damage repair by suppressing BRCA2 function. We employed direct repeat GFP (DR-GFP) and RAD51 foci formation assays to show that EMSY overexpression impairs the repair of damaged DNA, suggesting that EMSY belongs to the family of BRCAness proteins. We also identified a novel phospho-site at threonine 207 (T207) and demonstrated its role in EMSY-driven suppression of DNA damage repair. In vitro kinase assays established that protein kinase A (PKA) directly phosphorylates the T207 phospho-site. Immunoprecipitation experiments suggest that EMSY-driven suppression of DNA damage repair is a BRCA2-independent process. The data also suggest that EMSY amplification is a BRCAness feature, and may help to expand the population of patients who could benefit from targeted therapies that are also effective in BRCA1/2-mutant cancers.

  18. Characterization of three new varieties of Vigna unguiculata ('IPA 206' and 'IPA 207' Y 'guariba' in Cuba

    Directory of Open Access Journals (Sweden)

    Yadelys Figueroa Aguila

    2014-04-01

    Full Text Available The research was conducted on a fairly soft Brown soil washing vignas varieties (‘IPA 206’, ‘IPA 207’ and ‘Guariba’ recently introduced in our country. Its main objective is to characterize varieties under our climatic conditions. Having as main results achieved include in the record as the characterization of varieties developed by our institute using two seasons, the indeterminate growth habit with pods distributed throughout the plant stands in the varieties ‘IPA 206’ and ‘IPA 207’, while the ‘Guariba’ is determined by finding these distributed over the plant, as regards the yield, the variety ‘IPA 207 ‘is higher than that obtained by ‘PA 206’ and ‘Guariba’, the weight of 1000 seed varieties ‘Guariba’ and ‘IPA 206’ are greater than the weight of the ‘IPA 207’, the variety ‘Guariba’ is economically more profitable than the ‘IPA 206’ and ‘IPA 207’ by employing a number crop much lower than those above. It can be sown during all seasons, but it is best in cold weather to obtain seed and summer to produce where it is more productive and can replace the common bean. Tolerate water stress and high rainfall regime, except at harvest and does not allow puddling.

  19. Lead 207, 208 (n, xn gamma) reactions for neutron energies up to 200 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Pavlik, A.; Vonach, H. [Univ. Wien (Austria). Inst. fuer Radiumforschung und Kernphysik; Chadwick, M.B.; Haight, R.C.; Nelson, R.O.; Wender, S.A.; Young, P.G. [Los Alamos National Lab., NM (United States)

    1994-07-01

    High-resolution {gamma}-ray spectra from the interaction of neutrons in the energy range from 3 to 200 MeV with {sup 207,208}Pb were measured with the white neutron source at the WNR facility at Los Alamos National Laboratory. From these data, excitation functions for prominent {gamma} transitions in {sup 200,202,204,206,207,208}Pb were derived from threshold to 200 MeV incident neutron energy. These {gamma}-production cross sections represent formation cross sections for excited states of the residual nuclei. The results are compared with the predictions of nuclear reaction calculations based on the exciton model for precompound emission, the Hauser-Feshbach theory for compound nuclear decay, and coupled channels calculations to account for direct excitation of collective levels. Good agreement was obtained over the entire energy range covered in the experiment with reasonable model parameters. The results demonstrate that multiple preequilibrium emission has to be taken into account above about 40 MeV, and that the level density model of Ignatyuk should be used instead of the Gilbert-Cameron and back-shifted Fermi-gas models if excitation energies exceed about 30 MeV.

  20. Interactions of 160 GeV/Nucleon $^{207}$Pb Nuclei in Emulsion Chambers with Copper and Lead Targets

    CERN Multimedia

    2002-01-01

    % EMU13 \\\\ \\\\ Nuclear emulsions will be used as targets and trackers to investigate the interactions of $^{207}$Pb nuclei in emulsion, copper and lead targets; specifically (i) the pseudorapidity distributions of charged particles including analysis of particle fluctuations in pseudorapidity and azimuthal angle distributions, (ii) the transverse momentum distribution of $\\alpha$ fragments from the projectile nucleus. \\\\ \\\\Several emulsion chambers with different geometry and targets will be exposed to the $^{207}$Pb beam. Each chamber will be irradiated with the beam of low density $^{207}$Pb ions (several hundred per cm$^2$). Interactions with small impact parameter, characterized by high multiplicity and disruption of the projectile nucleus will be found with high efficiency. Measurements in the emulsion will include the number and emission angles of charged particles produced and the emission angles of $\\alpha$ fragments from the projectile nucleus.

  1. New radiative neutron capture measurement of 207Pb and 209Bi

    CERN Document Server

    Domingo-Pardo, Cesar

    This new measurement of the (n, ) capture cross sections of 207Pb and 209Bi has been motivated by i) the aim to achieve a better understanding of the s-process stellar nucleosynthesis in its termination region and ii) the design of accelerator driven systems (ADS) based on a lead-bismuth eutectic spallation core. The measurement has been performed using the total energy detector technique, since the lower neutron sensitivity achievable with such a detection system represents a clear advantage versus the alternative total absorption method. However, the former technique has been a source of controversy between experimentalists and therefore, an important part of the present work has been dedicated rst to the review and further development of the so called Pulse Height Weighting Technique (PHWT). Performing dedicated measurements at the CERN n TOF installation we have experimentally validated this technique, determining that a systematic uncertainty better than 2% can be achieved. Once the measuring technique h...

  2. Single-particle parity-nonconserving matrix elements in {sup 207}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Komives, A.; Knott, J.E.; Leuschner, M.; Szymanski, J.J.; Bowman, J.D.; Jamrisk, D.

    1993-10-01

    Measurements of the helicity dependence of neutron scattering off of heavy nuclei by the TRIPLE collaboration have yielded multiple parity-nonconserving asymmetries. The asymmetries are predominantly positive, in contradiction to the zero average asymmetry predicted by the statistical model of neutron- nucleus scattering. Theoretical calculations that explain the non-zero average asymmetry require single-particle parity- nonconserving matrix elements 10-100 times larger than those predicted by meson exchange models. We are determining the single-particle parity non-conserving mixing in {sup 207}Pb by measuring the circular polarization of the 1.064 MeV {gamma} ray. The experiment uses a transmission polarimeter and a fast data acquisition system. Initial results are presented.

  3. VECTOR AND TENSOR ANALYZING POWERS IN THE PB-208(D)OVER-RIGHT-ARROW,T)PB-207 REACTION AT 200 AND 360 MEV

    NARCIS (Netherlands)

    VANDEWIELE, J; LANGEVINJOLIOT, H; GUILLOT, J; ROSIER, LH; WILLIS, A; MORLET, M; DUHAMELCHRETIEN, G; GERLIC, E; TOMASIGUSTAFSSON, E; BLASI, N; MICHELETTI, S; VANDERWERF, SY

    1992-01-01

    Cross sections and vector and tensor analyzing powers for the main levels in Pb-207 have been measured via the Pb-208(d over arrow pointing right, t)Pb-207 reaction at 200 and 360 MeV incident energies. A(y) and A(yy) spin observables allow a clear identification of the valence levels, especially at

  4. 40 CFR 600.207-08 - Calculation and use of vehicle-specific 5-cycle-based fuel economy values for vehicle...

    Science.gov (United States)

    2010-07-01

    ... economy values from the tests performed using gasoline or diesel test fuel. (ii)(A) Calculate the 5-cycle...-specific 5-cycle-based fuel economy values for vehicle configurations. 600.207-08 Section 600.207-08...-specific 5-cycle-based fuel economy values for vehicle configurations. (a) Fuel economy values determined...

  5. 20 CFR 652.207 - How does a State meet the requirement for universal access to services provided under the Act?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false How does a State meet the requirement for universal access to services provided under the Act? 652.207 Section 652.207 Employees' Benefits EMPLOYMENT... Act, on a Statewide basis through: (i) Self-service; (ii) Facilitated self-help service; and (iii...

  6. 33 CFR 207.425 - Calumet River, Ill.; Thomas J. O'Brien Lock and Controlling Works and the use, administration and...

    Science.gov (United States)

    2010-07-01

    ...'Brien Lock and Controlling Works and the use, administration and navigation of the lock. 207.425 Section... DEFENSE NAVIGATION REGULATIONS § 207.425 Calumet River, Ill.; Thomas J. O'Brien Lock and Controlling Works and the use, administration and navigation of the lock. (a) Controlling Works. (1) The controlling...

  7. 33 CFR 207.180 - All waterways tributary to the Gulf of Mexico (except the Mississippi River, its tributaries...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false All waterways tributary to the... DEFENSE NAVIGATION REGULATIONS § 207.180 All waterways tributary to the Gulf of Mexico (except the... apply to: (1) Waterways. All navigable waters of the U.S. tributary to or connected by other waterways...

  8. 33 CFR 207.170c - Kissimmee River, navigation locks between Lake Tohopekaliga and Lake Okeechobee, Fla.; use...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Kissimmee River, navigation locks between Lake Tohopekaliga and Lake Okeechobee, Fla.; use, administration, and navigation. 207.170c Section... Lake Okeechobee, Fla.; use, administration, and navigation. (a) The owner of or agency controlling the...

  9. Structural alteration of mouse P450coh by mutation of glycine-207 to proline: spin equilibrium, enzyme kinetics, and heat sensitivity.

    Science.gov (United States)

    Juvonen, R O; Iwasaki, M; Sueyoshi, T; Negishi, M

    1993-08-15

    Mouse cytochrome P450coh is a high-spin haem protein which specifically catalyses coumarin 7-hydroxylase activity. A mutation of Gly-207 to Pro shifts the P450coh completely to the low-spin form, indicating that the sixth axial position of the haem is hexaco-ordinated with a water molecule in the mutant G207P. Moreover, the G207P mutation increases the Km value for coumarin 7-hydroxylase activity 100-fold and the Kd value for coumarin binding 200-fold. Conversely, the mutation decreases the Ki and Kd values 10- and 20-fold respectively when testosterone, a larger molecule, is used as a substrate. The results, therefore, are consistent with an idea that the substrate pocket may be larger in the mutant G207P than in the wild-type cytochrome P-450. A Gly-207 to Ala mutation (G207A) of P450coh (G207A), on the other hand, affects neither the spectral nor the enzymic properties of P450coh. Pro-207, through cis/trans isomerization or formation of a kink, may confer on the G207P a structural alteration of its substrate-haem pocket. Our previous studies [Iwasaki, Juvonen, Lindberg and Negishi (1991) J. Biol. Chem. 266, 3380-3382; Juvonen, Iwasaki and Negishi (1991) J. Biol. Chem. 266, 16431-16435] show that the residue at position 209 in P450coh resides close to the sixth axial position of the haem, and the spin equilibrium of the cytochrome P-450 shifts toward the high-spin state as residue 209 becomes more hydrophobic and larger. A Gly-207 to Pro mutation, therefore, results in the creation of a larger substrate pocket in the mutant cytochrome P-450 by altering the protein structure around residue 209 so that a water molecule and testosterone can be accommodated.

  10. LZ-207, a Newly Synthesized Flavonoid, Induces Apoptosis and Suppresses Inflammation-Related Colon Cancer by Inhibiting the NF-κB Signaling Pathway.

    Science.gov (United States)

    Sun, Jie; Li, Fanni; Zhao, Yue; Zhao, Li; Qiao, Chen; Li, Zhiyu; Guo, Qinglong; Lu, Na

    2015-01-01

    Flavonoids and flavonoid derivatives, which have significant biological and pharmacological activities, including antitumor and anti-inflammatory activities, have been widely used in human healthcare. To design a more effective flavonoid antitumor agent, we altered the flavonoid backbone with substitutions of piperazine and methoxy groups to synthesize a novel flavonoid derivative, LZ-207. The anticancer effect of LZ-207 against HCT116 colon cancer cells and the underlying mechanism of this effect were explored in this study. Specifically, LZ-207 exhibited inhibitory effects on growth and viability in several human colon cancer cell lines and induced apoptosis in HCT116 cells both in vitro and in vivo. LZ-207 treatment also suppressed the nuclear translocation of NF-κB and the phosphorylation of IκB and IKKα/β in a dose-dependent manner in both HCT116 cells and human acute monocytic leukemia THP-1 cells. Moreover, LZ-207 also reduced the secretion of the pro-inflammatory cytokine interleukin-6 (IL-6) in LPS-induced THP-1 cells, and this effect was confirmed at the transcriptional level. Furthermore, LZ-207 significantly inhibited HCT116 cell proliferation that was elicited by LPS-induced THP-1 cells in a co-culture system. These findings elucidated some potential molecular mechanisms for preventing inflammation-driven colon cancer using the newly synthesized flavonoid LZ-207 and suggested the possibility of further developing novel therapeutic agents derived from flavonoids.

  11. A review of the medical, educational and social needs of 207 handicapped children.

    Science.gov (United States)

    Appleyard, W J; Baird, G

    1975-01-01

    The Mary Sheridan Centre serves the needs of two health districts with a population of over half a million. The assessment of the handicapped child is combined with a Day Nursery and Observation Unit which provides therapeutic, educational and supportive guidance. During the year May 1973-74, 207 children were referred for assessment of whom only 11 were found to have no handicap. One-third of these referrals were from the hospital follow-up baby clinic and two-thirds came from community and general practitioner sources. The average age of referral was two years for girls and two and a half years for boys. Of the 196 handicapped children, 33 had neurological disorders, 30 congenital anomalies and 50 an adverse perinatal history. Social factors were thought to contribute significantly in 72; 35 children came from single parent families. Behaviour problems were noticed in a high proportion (68). Forty-four children regularly attend the Centre's day nursery whose staff include preschool teacher, occupational therapists and trained nurses for play, speech stimulation and specific therapy; 48 attend for speech therapy and 19 for physiotherapy. The prime aim is to help the parents continue with the therapy and care of their child in their own home.

  12. 7P1/2 hyperfine splitting in 206 , 207 , 209 , 213Fr and the hyperfine anomaly

    Science.gov (United States)

    Zhang, J.; Orozco, L. A.; Collister, R.; Gwinner, G.; Tandecki, M.; Behr, J. A.; Pearson, M. R.; Gomez, E.; Aubin, S.

    2013-05-01

    We perform precision measurements on francium, the heaviest alkali with no stable isotopes, at the recently commissioned Francium Trapping Facility at TRIUMF. A combination of RF and optical spectroscopy allows better than 10 ppm (statistical) measurements of the 7P1 / 2 state hyperfine splitting for the isotopes 206 , 207 , 209 , 213Fr, in preparation for weak interaction studies. Together with previous measurements of the ground state hyperfine structure, it is possible to extract the hyperfine anomaly. This is a correction to the point interaction of the nuclear magnetic moment and the electron wavefunction, known as the Bohr Weisskopf effect. Our measurements extend previous measurements to the neutron closed shell isotope (213) as well as further in the neutron deficient isotopes (206, 207). Work supported by NSERC and NRC from Canada, NSF and DOE from USA, CONYACT from Mexico.

  13. DNP-enhanced ultrawideline207Pb solid-state NMR spectroscopy: an application to cultural heritage science.

    Science.gov (United States)

    Kobayashi, Takeshi; Perras, Frédéric A; Murphy, Anna; Yao, Yao; Catalano, Jaclyn; Centeno, Silvia A; Dybowski, Cecil; Zumbulyadis, Nicholas; Pruski, Marek

    2017-03-14

    Dynamic nuclear polarization (DNP) is used to enhance the (ultra)wideline 207 Pb solid-state NMR spectra of lead compounds of relevance in the preservation of cultural heritage objects. The DNP SSNMR experiments enabled, for the first time, the detection of the basic lead carbonate phase of the lead white pigment by 207 Pb SSNMR spectroscopy. Variable-temperature experiments revealed that the short T' 2 relaxation time of the basic lead carbonate phase hinders the acquisition of the NMR signal at room temperature. We additionally observe that the DNP enhancement is twice as large for lead palmitate (a lead soap, which is a degradation product implicated in the visible deterioration of lead-based oil paintings), than it is for the basic lead carbonate. This enhancement has allowed us to detect the formation of a lead soap in an aged paint film by 207 Pb SSNMR spectroscopy; which may aid in the detection of deterioration products in smaller samples removed from works of art.

  14. Draft Assembly of Elite Inbred Line PH207 Provides Insights into Genomic and Transcriptome Diversity in Maize[OPEN

    Science.gov (United States)

    Soifer, Ilya; Barad, Omer; Shem-Tov, Doron; Baruch, Kobi; Lu, Fei; Hernandez, Alvaro G.; Wright, Chris L.; Koehler, Klaus; Buell, C. Robin; de Leon, Natalia

    2016-01-01

    Intense artificial selection over the last 100 years has produced elite maize (Zea mays) inbred lines that combine to produce high-yielding hybrids. To further our understanding of how genome and transcriptome variation contribute to the production of high-yielding hybrids, we generated a draft genome assembly of the inbred line PH207 to complement and compare with the existing B73 reference sequence. B73 is a founder of the Stiff Stalk germplasm pool, while PH207 is a founder of Iodent germplasm, both of which have contributed substantially to the production of temperate commercial maize and are combined to make heterotic hybrids. Comparison of these two assemblies revealed over 2500 genes present in only one of the two genotypes and 136 gene families that have undergone extensive expansion or contraction. Transcriptome profiling revealed extensive expression variation, with as many as 10,564 differentially expressed transcripts and 7128 transcripts expressed in only one of the two genotypes in a single tissue. Genotype-specific genes were more likely to have tissue/condition-specific expression and lower transcript abundance. The availability of a high-quality genome assembly for the elite maize inbred PH207 expands our knowledge of the breadth of natural genome and transcriptome variation in elite maize inbred lines across heterotic pools. PMID:27803309

  15. The EMSY threonine 207 phospho-site is required for EMSY-driven suppression of DNA damage repair

    Science.gov (United States)

    Jelinic, Petar; Eccles, Laura A.; Tseng, Jill; Cybulska, Paulina; Wielgos, Monicka; Powell, Simon N.; Levine, Douglas A.

    2017-01-01

    BRCA1 and BRCA2 are essential for the repair of double-strand DNA breaks, and alterations in these genes are a hallmark of breast and ovarian carcinomas. Other functionally related genes may also play important roles in carcinogenesis. Amplification of EMSY, a putative BRCAness gene, has been suggested to impair DNA damage repair by suppressing BRCA2 function. We employed direct repeat GFP (DR-GFP) and RAD51 foci formation assays to show that EMSY overexpression impairs the repair of damaged DNA, suggesting that EMSY belongs to the family of BRCAness proteins. We also identified a novel phospho-site at threonine 207 (T207) and demonstrated its role in EMSY-driven suppression of DNA damage repair. In vitro kinase assays established that protein kinase A (PKA) directly phosphorylates the T207 phospho-site. Immunoprecipitation experiments suggest that EMSY-driven suppression of DNA damage repair is a BRCA2-independent process. The data also suggest that EMSY amplification is a BRCAness feature, and may help to expand the population of patients who could benefit from targeted therapies that are also effective in BRCA1/2-mutant cancers. PMID:28099152

  16. European isotopic signatures for lead in atmospheric aerosols. A source apportionment based upon 206Pb/207Pb ratios

    Energy Technology Data Exchange (ETDEWEB)

    Flament, Pascal; Deboudt, Karine [Laboratoire de Biogeochimie et Environnement du Littoral (LABEL), Universite du Littoral-Cote d' Opale, CNRS/INSU 8013 ' ELICO' , 32 Avenue Foch, F-62930 Wimereux (France); Bertho, Marie-Laure; Puskaric, Emile [Laboratoire Interdisciplinaire en Sciences de l' Environnement (LISE), Universite du Littoral-Cote d' Opale, CNRS/INSU 8013 ' ELICO' , 32 Avenue Foch, F-62930 Wimereux (France); Veron, Alain [Universite d' Aix-Marseille III, Geosciences de l' Environnement (UMR CNRS 6536) CEREGE, BP 80, F-13545 Cedex 4 Aix en Provence (France)

    2002-09-16

    To investigate the capability of the lead isotope signature technique to support a source apportionment study at a Continental scale, atmospheric particulate matter was collected at Cap Gris-Nez (Eastern Channel, northern France), over one year (1995-1996). Four days retrospective trajectories of air masses were available during each sampling experiment. Twenty-eight samples, for which the origin of aerosols was unambiguously determined, were selected for isotopic measurements. Considering the Enrichment Factors, EF{sub Crust} of lead and its size distribution, we show that lead is mostly from anthropogenic origin and mainly associated with [0.4207Pb<1.172) than air masses coming from the United Kingdom (1.106<{sup 206}Pb/207Pb<1.124). Generally, lead isotopic compositions in aerosols are clearly distinct from the gasoline signatures in European countries, strongly suggesting that automotive lead is no longer the major component of this metal in the air. Gasoline and industrial isotopic signatures could explain the origin of lead in our aerosol samples. A source apportionment based upon 206Pb/207Pb ratios, suggests that the difference between British (206Pb/207Pb=1.122{+-}0.038) and Continental (206Pb/207Pb=1.155{+-}0.022) signatures may be largely explained by

  17. Candida Osteomyelitis: Analysis of 207 Pediatric and Adult Cases (1970–2011)

    Science.gov (United States)

    Gamaletsou, Maria N.; Kontoyiannis, Dimitrios P.; Sipsas, Nikolaos V.; Moriyama, Brad; Alexander, Elizabeth; Roilides, Emmanuel; Brause, Barry; Walsh, Thomas J.

    2012-01-01

    Background. The epidemiology, pathogenesis, clinical manifestations, management, and outcome of Candida osteomyelitis are not well understood. Methods. Cases of Candida osteomyelitis from 1970 through 2011 were reviewed. Underlying conditions, microbiology, mechanisms of infection, clinical manifestations, antifungal therapy, and outcome were studied in 207 evaluable cases. Results. Median age was 30 years (range, ≤ 1 month to 88 years) with a >2:1 male:female ratio. Most patients (90%) were not neutropenic. Localizing pain, tenderness, and/or edema were present in 90% of patients. Mechanisms of bone infection followed a pattern of hematogenous dissemination (67%), direct inoculation (25%), and contiguous infection (9%). Coinciding with hematogenous infection, most patients had ≥2 infected bones. When analyzed by age, the most common distribution of infected sites for adults was vertebra (odds ratio [OR], 0.09; 95% confidence interval [CI], .04–.25), rib, and sternum; for pediatric patients (≤18 years) the pattern was femur (OR, 20.6; 95% CI, 8.4–48.1), humerus, then vertebra/ribs. Non-albicans Candida species caused 35% of cases. Bacteria were recovered concomitantly from 12% of cases, underscoring the need for biopsy and/or culture. Candida septic arthritis occurred concomitantly in 21%. Combined surgery and antifungal therapy were used in 48% of cases. The overall complete response rate of Candida osteomyelitis of 32% reflects the difficulty in treating this infection. Relapsed infection, possibly related to inadequate duration of therapy, occurred among 32% who ultimately achieved complete response. Conclusions. Candida osteomyelitis is being reported with increasing frequency. Localizing symptoms are usually present. Vertebrae are the most common sites in adults vs femora in children. Timely diagnosis of Candida osteomyelitis with extended courses of 6–12 months of antifungal therapy, and surgical intervention, when indicated, may improve

  18. High-precision mass measurements of {sup 203-207}Rn and {sup 213}Ra with SHIPTRAP

    Energy Technology Data Exchange (ETDEWEB)

    Droese, C.; Marx, G.; Schweikhard, L. [Ernst-Moritz-Arndt-Universitaet, Greifswald (Germany); Ackermann, D.; Block, M.; Dworschak, M.; Herfurth, F.; Hofmann, S. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Andersson, L.L. [University of Liverpool, Liverpool (United Kingdom); Johannes Gutenberg-Universitaet, Helmholtz-Institut Mainz, Mainz (Germany); Blaum, K. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Ruprecht-Karls-Universitaet Heidelberg, Heidelberg (Germany); Eibach, M. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Johannes Gutenberg-Universitaet Mainz, Mainz (Germany); Eliseev, S.; Ketelaer, J. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Forsberg, U.; Rudolph, D. [Lund University, Lund (Sweden); Haettner, E.; Plass, W.R.; Scheidenberger, C. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Justus-Liebig-Universitaet Giessen, Giessen (Germany); Hessberger, F.P. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Johannes Gutenberg-Universitaet, Helmholtz-Institut Mainz, Mainz (Germany); Minaya Ramirez, E. [Johannes Gutenberg-Universitaet, Helmholtz-Institut Mainz, Mainz (Germany); Nesterenko, D.; Novikov, Yu.N. [NRC Kurchatov Institute, PNPI, Gatchina (Russian Federation); Rodriguez, D. [Universidad de Granada, Campus de Fuentenueva, Granada (Spain); Stolze, S. [University of Jyvaeskylae, Jyvaeskylae (Finland); Thirolf, P.G.; Weber, C. [Ludwig Maximilians-Universitaet Muenchen, Garching (Germany)

    2013-01-15

    The masses of the nuclides {sup 203-207}Rn and {sup 213}Ra were measured directly for the first time with the Penning-trap mass spectrometer SHIPTRAP at GSI Darmstadt. The results confirm the previously determined mass values. The mass uncertainties for {sup 205}Rn and {sup 213}Ra were significantly reduced. The results are relevant for the investigation of the nuclear shell structure between N=82 and N=126. As an indicator of structural changes the two-neutron separation energies S{sub 2n}(Z,N) have been studied. (orig.)

  19. Caracterización de tres nuevas variedades de vignas (‘IPA 206’ e ‘IPA 207’ y ‘Guariba’ en Cuba.

    Directory of Open Access Journals (Sweden)

    Yadelys Figueroa Aguila

    2012-07-01

    Full Text Available RESUMEN La investigación se desarrolló sobre un suelo Pardo mullido medianamente lavado con las variedades de vignas (‘IPA 206’, ‘IPA 207’ y ‘Guariba’ de reciente introducción en nuestro país. Tiene como principal objetivo caracterizar las variedades (‘IPA 206, ‘IPA 207’ y ‘Guariba’ bajo nuestras condiciones climáticas. Teniendo como principales resultados que se logró incluir en el registro de variedades según la caracterización desarrollada por nuestro instituto utilizando dos épocas de siembra, el hábitos de crecimiento indeterminado con vainas distribuidas por toda la planta se destaca en las variedades ‘IPA 206’ e ‘IPA 207’, mientras que en la ‘Guariba’ es determinado encontrándose estas distribuidas por encima de la planta, en cuanto al rendimiento, la variedad ‘IPA 207’ es superiores que la obtenida por la ‘'PA 206’ y ‘Guariba’, el peso de 1000 semillas en las variedades ‘Guariba’ y ‘IPA 206’ son superiores al peso de la ‘IPA 207’, la variedad ‘Guariba’ es económicamente más rentable que las ‘IPA 206’ y ‘IPA 207’ por emplear un número de cosechas muy inferior a las antes mencionadas. Puede sembrarse durante todas las épocas del año, pero lo más aconsejable es en época de frío para la obtención de semilla y el verano para la producción donde es más productiva y puede sustituir al fríjol común. Tolera estrés hídrico y régimen de abundantes lluvias, excepto en el momento de la cosecha y no admite el encharcamiento. Characterization of three new varieties vignas (' IPA 206' and ' IPA 207' y 'Guariba' in Cuba. ABSTRACT The research was conducted on a fairly soft Brown soil washing vignas varieties ('IPA 206', 'IPA 207' and 'Guariba' recently introduced in our country. Its main objective is to characterize varieties ('IPA 206,' IPA 207 'and' Guariba ' under our climatic conditions. Having as main results achieved include in the record as the

  20. Non-Hodgkin lymphoma in Chile: a review of 207 consecutive adult cases by a panel of five expert hematopathologists.

    Science.gov (United States)

    Cabrera, Maria Elena; Martinez, Virginia; Nathwani, Bharat N; Muller-Hermelink, H Konrad; Diebold, Jacques; Maclennan, Kenneth A; Armitage, James; Weisenburger, Dennis D

    2012-07-01

    The distribution of subtypes of non-Hodgkin lymphoma (NHL) in Latin America is not well known. This Chilean study included 207 consecutive cases of NHL diagnosed at five cancer centers in the capital, Santiago, and one center in Viña del Mar. All cases were reviewed and classified independently by five expert hematopathologists according to the 2001 World Health Organization classification of NHL. A consensus diagnosis of NHL was reached in 195 of the 207 cases (94%). B-cell lymphomas constituted 88% of NHL, and diffuse large B-cell lymphoma (DLBCL, 38.5%) and follicular lymphoma (25.1%) were the most common subtypes. There was a high frequency of marginal zone B-cell lymphoma (10.3%), as well as of extranodal natural killer (NK)/T-cell lymphoma, nasal type (2.6%) and adult T-cell leukemia/lymphoma (0.5%). Extranodal presentation was seen in 74 of the 195 cases (38%) and the most common extranodal presentation was in the stomach (37.6%). The most common gastric lymphoma was DLBCL (54.5%) followed by mucosa-associated lymphoid tissue (MALT) lymphoma (41%). Overall, the frequency of NHL subtypes in Chile is between that reported in Western and Eastern countries, which is probably a reflection of the admixture of ethnicities as well as the environment and socioeconomic status of its population.

  1. Caracterización de tres nuevas variedades de vignas (‘IPA 206’ e ‘IPA 207’ y ‘Guariba’) en Cuba.

    OpenAIRE

    Yadelys Figueroa Aguila; José Ventura Martín; Sergio Rodríguez Morales

    2012-01-01

    RESUMEN La investigación se desarrolló sobre un suelo Pardo mullido medianamente lavado con las variedades de vignas (‘IPA 206’, ‘IPA 207’ y ‘Guariba’) de reciente introducción en nuestro país. Tiene como principal objetivo caracterizar las variedades (‘IPA 206, ‘IPA 207’ y ‘Guariba’) bajo nuestras condiciones climáticas. Teniendo como principales resultados que se logró incluir en el registro de variedades según la caracterización desarrollada por nuestro instituto utilizando dos época...

  2. SPIN DETERMINATION OF VALENCE AND INNER HOLE STATES VIA THE PB-208((D)OVER-RIGHT-ARROW,T)PB-207 REACTION AT ED=200 MEV

    NARCIS (Netherlands)

    LANGEVINJOLIOT, H; VANDEWIELE, J; GUILLOT, J; GERLIC, E; ROSIER, LH; WILLIS, A; MORLET, M; DUHAMELCHRETIEN, G; TOMASIGUSTAFSSON, E; BLASI, N; MICHELETTI, S; VANDERWERF, SY

    Highly excited neutron hole states in Pb-207 have been studied via the (d, over arrow pointing right, t) reaction at E(d) = 200 MeV using for the first time a polarized beam, with both vector and tensor components. The determination of overlapping neutron hole response functions takes advantage of

  3. 33 CFR 207.170b - Apopka-Beauclair Navigation Lock in Apopka-Beauclair Canal in Lake County, Fla.; use...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Apopka-Beauclair Navigation Lock in Apopka-Beauclair Canal in Lake County, Fla.; use, administration, and navigation. 207.170b Section... Lake County, Fla.; use, administration, and navigation. (a) The owner of or agency controlling the lock...

  4. First direct observation of bound-state beta-decay. Measurements of branching and lifetime of {sup 207}Tl{sup 81+} fragments

    Energy Technology Data Exchange (ETDEWEB)

    Boutin, D.

    2005-08-01

    The first experimental observation of bound-state beta-decay showed, that due solely to the electron stripping, a stable nuclide, e.g. {sup 163}Dy, became unstable. Also a drastic modification of the half-life of bare {sup 187}Re, from 4.12(2) x 10{sup 10} years down to 32.9(20) years, could be observed. It was mainly due to the possibility for the mother nuclide to decay into a previously inaccessible nuclear level of the daughter nuclide. It was proposed to study a nuclide where this decay mode was competing with continuum-state beta-decay, in order to measure their respective branchings. The ratio {beta}{sub b}/{beta}{sub c} could also be evaluated for the first time. {sup 207}Tl was chosen due to its high atomic number, and Q-value of about 1.4 MeV, small enough to enhance the {beta}{sub b} probability and large enough to allow the use of time-resolved Schottky Mass Spectrometry (SMS) to study the evolution of mother and bound-state beta-decay daughter ions. The decay properties of the ground state and isomeric state of {sup 207}Tl{sup 81+} have been investigated at the GSI accelerator facility in two separate experiments. For the first time {beta}-decay where the electron could go either to a bound state (atomic orbitals) and lead to {sup 207}Pb{sup 81+} as a daughter nuclide, or to a continuum state and lead to {sup 207}Pb{sup 82+}, has been observed. The respective branchings of these two processes could be measured as well. The deduced total nuclear half-life of 255(17) s for {sup 207}Tl{sup 81+}, was slightly modified with respect to the half-life of the neutral atom of 286(2) s. It was nevertheless in very good agreement with calculations based on the assumption that the beta-decay was following an allowed type of transition. The branching {beta}{sub b}/{beta}{sub c}=0.192(20), was also in very good agreement with the same calculations. The application of stochastic precooling allowed to observe in addition the 1348 keV short-lived isomeric state of {sup

  5. Evaluation of the role of CD207 on Langerhans cells in a murine model of atopic dermatitis by in situ imaging using Cr:forsterite laser-based multimodality nonlinear microscopy

    Science.gov (United States)

    Lee, Jyh-Hong; Tsai, Ming-Rung; Sun, Chi-Kuang; Chiang, Bor-Luen

    2012-11-01

    Atopic dermatitis (AD) is an allergic inflammatory disease of skin. It remains unclear that CD207 of Langerhans cells (LCs) plays a central role in the development of allergic sensitization. There is little data on LCs within the microenviroment in vivo. We used a murine model of epicutaneous (EC) ovalbumin (OVA) sensitization inducing an inflammatory skin resembling AD to explore the role of CD207 in the pathogenesis of AD. Cr:forsterite laser-based multimodality nonlinear microscopy was applied for in situ imaging. Peritoneal injections of Alexa Fluor 647-rat anti-mouse CD207 into mice were performed to specifically trace the LCs. Peritoneal injections of OVA-Alexa Fluor 647 conjugate into mice were performed to specifically trace the OVA. We found that combining Alexa Fluor fluorescent probes with multimodality nonlinear microscopy permitted the unequivocal in situ imaging of CD207-expressing LCs. The relevant time-course, expressional, and functional studies reveal that CD207 of LCs plays an essential role during the induction of EC sensitization. We establish and validate that Cr:forsterite laser-based multimodality nonlinear microscopy is applicable for the specific detection of labeled mAb-bound LCs and labeled antigen. We suggest that CD207-expressing LCs initiate the allergic response through the CD207 mediated epicutaneous sensitization associated with the development of AD.

  6. A Study of $b\\overline{b}$ Production in $e^{+}e^{-}$ Collisions at $\\sqrt{s}$ = 130-207 GeV

    CERN Document Server

    Abdallah, J; Adam, W; Adzic, P; Albrecht, T; Alemany-Fernandez, R; Allmendinger, T; Allport, P.P; Amaldi, U; Amapane, N; Amato, S; Anashkin, E; Andreazza, A; Andringa, S; Anjos, N; Antilogus, P; Apel, W-D; Arnoud, Y; Ask, S; Asman, B; Augustin, J.E; Augustinus, A; Baillon, P; Ballestrero, A; Bambade, P; Barbier, R; Bardin, D; Barker, G.J; Baroncelli, A; Battaglia, M; Baubillier, M; Becks, K-H; Begalli, M; Behrmann, A; Ben-Haim, E; Benekos, N; Benvenuti, A; Berat, C; Berggren, M; Bertrand, D; Besancon, M; Besson, N; Bloch, D; Blom, M; Bluj, M; Bonesini, M; Boonekamp, M; Booth, P.S.L; Borisov, G; Botner, O; Bouquet, B; Bowcock, T.J.V; Boyko, I; Bracko, M; Brenner, R; Brodet, E; Bruckman, P; Brunet, J.M; Buschbeck, B; Buschmann, P; Calvi, M; Camporesi, T; Canale, V; Carena, F; Castro, N; Cavallo, F; Chapkin, M; Charpentier, Ph; Checchia, P; Chierici, R; Chliapnikov, P; Chudoba, J; Chung, S.U; Cieslik, K; Collins, P; Contri, R; Cosme, G; Cossutti, F; Costa, M.J; Crennell, D; Cuevas, J; D'Hondt, J; da Silva, T; Da Silva, W; Della Ricca, G; De Angelis, A; De Boer, W; De Clercq, C; De Lotto, B; De Maria, N; De Min, A; de Paula, L; Di Ciaccio, L; Di Simone, A; Doroba, K; Drees, J; Eigen, G; Ekelof, T; Ellert, M; Elsing, M; Espirito Santo, M.C; Fanourakis, G; Fassouliotis, D; Feindt, M; Fernandez, J; Ferrer, A; Ferro, F; Flagmeyer, U; Foeth, H; Fokitis, E; Fulda-Quenzer, F; Fuster, J; Gandelman, M; Garcia, C; Gavillet, Ph; Gazis, E; Gokieli, R; Golob, B; Gomez-Ceballos, G; Goncalves, P; Graziani, E; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hallgren, A; Hamacher, K; Hamilton, K; Haug, S; Hauler, F; Hedberg, V; Hennecke, M; Hoffman, J; Holmgren, S-O; Holt, P.J; Houlden, M.A; Jackson, J.N; Jarlskog, G; Jarry, P; Jeans, D; Johansson, E.K; Jonsson, P; Joram, C; Jungermann, L; Kapusta, F; Katsanevas, S; Katsoufis, E; Kernel, G; Kersevan, B.P; Kerzel, U; King, B.T; Kjaer, N.J; Kluit, P; Kokkinias, P; Kourkoumelis, C; Kouznetsov, O; Krumstein, Z; Kucharczyk, M; Lamsa, J; Leder, G; Ledroit, F; Leinonen, L; Leitner, R; Lemonne, J; Lepeltier, V; Lesiak, T; Liebig, W; Liko, D; Lipniacka, A; Lopes, J.H; Lopez, J.M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J; Malek, A; Maltezos, S; Mandl, F; Marco, J; Marco, R; Marechal, B; Margoni, M; Marin, J-C; Mariotti, C; Markou, A; Martinez-Rivero, C; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Mazzucato, F; Mazzucato, M; McNulty, R; Meroni, C; Migliore, E; Mitaroff, W; Mjoernmark, U; Moa, T; Moch, M; Monig, Klaus; Monge, R; Montenegro, J; Moraes, D; Moreno, S; Morettini, P; Mueller, U; Muenich, K; Mulders, M; Mundim, L; Murray, W; Muryn, B; Myatt, G; Myklebust, T; Nassiakou, M; Navarria, F; Nawrocki, K; Nemecek, S; Nicolaidou, R; Nikolenko, M; Oblakowska-Mucha, A; Obraztsov, V; Olshevski, A; Onofre, A; Orava, R; Österberg, K; Ouraou, A; Oyanguren, A; Paganoni, M; Paiano, S; Palacios, J.P; Palka, H; Papadopoulou, Th.D; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Peralta, L; Perepelitsa, V; Perrotta, A; Petrolini, A; Piedra, J; Pieri, L; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M.E; Polok, G; Pozdniakov, V; Pukhaeva, N; Pullia, A; Radojicic, D; Rebecchi, P; Rehn, J; Reid, D; Reinhardt, R; Renton, P; Richard, F; Ridky, J; Rivero, M; Rodriguez, D; Romero, A; Ronchese, P; Roudeau, P; Rovelli, T; Ruhlmann-Kleider, V; Ryabtchikov, D; Sadovsky, A; Salmi, L; Salt, J; Sander, C; Savoy-Navarro, A; Schwickerath, U; Sekulin, R; Siebel, M; Sisakian, A; Smadja, G; Smirnova, O; Sokolov, A; Sopczak, A; Sosnowski, R; Spassov, T; Stanitzki, M; Stocchi, A; Strauss, J; Stugu, B; Szczekowski, M; Szeptycka, M; Szumlak, T; Tabarelli, T; Tegenfeldt, F; Timmermans, J; Tkatchev, L; Tobin, M; Todorovova, S; Tome, B; Tonazzo, A; Tortosa, P; Travnicek, P; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M-L; Tyapkin, I.A; Tyapkin, P; Tzamarias, S; Uvarov, V; Valenti, G; Van Dam, P; Van Eldik, J; van Remortel, N; Van Vulpen, I; Vegni, G; Veloso, F; Venus, W; Verdier, P; Verzi, V; Vilanova, D; Vitale, L; Vrba, V; Wahlen, H; Washbrook, A.J; Weiser, C; Wicke, D; Wickens, J; Wilkinson, G; Winter, M; Witek, M; Yushchenko, O; Zalewska, A; Zalewski, P; Zavrtanik, D; Zhuravlov, V; Zimin, N I; Zintchenko, A; Zupan, M

    2009-01-01

    Measurements are presented of R_b, the ratio of the b bbar cross-section to the q qbar cross-section in e+e- collisions, and the forward-backward asymmetry A^b_FB at twelve energy points in the range sqrt(s) = 130-207 GeV. These results are found to be consistent with the Standard Model expectations. The measurements are used to set limits on new physics scenarios involving contact interactions.

  7. Results for the Asymmetry Measurement in Elastic Pion-Proton Scattering at 1.78 and 2.07GeV/c

    Science.gov (United States)

    Alekseev, I. G.; Budkovsky, P. E.; Kanavets, V. P.; Koroleva, L. I.; Morozov, B. V.; Nesterov, V. M.; Ryltsov, V. V.; Sulimov, A. D.; Svirida, D. N.; Zhurkin, V. V.; Beloglazov, Y. A.; Filimonov, E. A.; Kovalev, A. I.; Kruglov, S. P.; Novinsky, D. V.; Shchedrov, V. A.; Sumachev, V. V.; Trautman, V. Y.; Bazhanov, N. A.; Bunyatova, E. I.

    2005-08-01

    New experimental results from the ITEP-PNPI collaboration are presented on the asymmetry in backward elastic scattering of negative pions on polarized protons in the resonance region. The data were obtained in the angular region (150° - 170°) c.m. at initial momenta 1.78 and 2.07 GeV/c. The results are compared to the predictions of partial wave analyses. The measurement was done at the ITEP accelerator.

  8. First direct high-precision energy determination for the 8.4 and 20.7 keV nuclear transitions in {sup 169}Tm

    Energy Technology Data Exchange (ETDEWEB)

    Inoyatov, A.Kh. [JINR, Laboratory of Nuclear Problems, Dubna, Moscow Region (Russian Federation); National University, Institute of Applied Physics, Tashkent (Uzbekistan); Kovalik, A. [JINR, Laboratory of Nuclear Problems, Dubna, Moscow Region (Russian Federation); Nuclear Physics Institute of the ASCR, Rez near Prague (Czech Republic); Filosofov, D.V.; Perevoshchikov, L.L. [JINR, Laboratory of Nuclear Problems, Dubna, Moscow Region (Russian Federation); Rysavy, M. [Nuclear Physics Institute of the ASCR, Rez near Prague (Czech Republic); Gurov, Yu.B. [JINR, Laboratory of Nuclear Problems, Dubna, Moscow Region (Russian Federation); National Research Nuclear University MEPhI, Moscow (Russian Federation)

    2015-06-15

    Energies of 8410.1 ± 0.4, 20743.9 ± 0.3, and 63121.6 ± 1.2 eV were determined for the 8.4 keV M1 + E2, 20.7 keV M1 + E2, and 63.1 keV E1 nuclear transitions in {sup 169}Tm (generated in the EC decay of {sup 169}Yb), respectively, by means of the internal conversion electron spectroscopy. The {sup 169}Yb sources used were prepared by vacuum evaporation deposition on polycrystalline carbon and platinum foils as well as by ion implantation at 30keV into a polycrystalline aluminum foil. The relevant conversion electron spectra were measured by a high-resolution combined electrostatic electron spectrometer at 7 eV instrumental resoluition. Values of 0.0326(14) and 0.0259(17) were derived from our experimental data for the E2 admixture parameter δ (E2/M1) for the 8.4 and 20.7 keV transitions, respectively. A possible effect of nuclear structure on multipolarity of the 20.7 keV transition was also investigated. (orig.)

  9. RX-207, a Small Molecule Inhibitor of Protein Interaction with Glycosaminoglycans (SMIGs), Reduces Experimentally Induced Inflammation and Increases Survival Rate in Cecal Ligation and Puncture (CLP)-Induced Sepsis.

    Science.gov (United States)

    Juhas, Stefan; Harris, Nicholas; Il'kova, Gabriela; Rehák, Pavol; Zsila, Ferenc; Yurgenzon Kogan, Faina; Lahmy, Orly; Zhuk, Regina; Gregor, Paul; Koppel, Juraj

    2018-02-01

    The fused quinazolinone derivative, RX-207, is chemically and functionally related to small molecule inhibitors of protein binding to glycosaminoglycans (SMIGs). Composed of a planar aromatic amine scaffold, it inhibits protein binding to glycosaminoglycans (GAGs). RX-207 reduced neutrophil migration in thioglycollate-induced peritonitis (37%), inhibited carrageenan-induced paw edema (32%) and cerulein-induced pancreatitis (28%), and increased animal survival in the mouse model of cecal ligation and puncture (CLP)-induced sepsis (60%). The mechanism of RX-207 action, analyzed by UV spectroscopy, confirmed that which was elucidated for chemically related anti-inflammatory SMIGs. RX-207 binding to cell surface GAGs can account for the inhibition of neutrophil recruitment via the micro-vasculature and as a consequence, the reduction of neutrophil mediated tissue damage in the animal models of inflammation and improved survival of mice in CLP-induced sepsis.

  10. 204 - 207 Suleiman

    African Journals Online (AJOL)

    DR. AMIN

    2011-12-02

    Dec 2, 2011 ... ABSTRACT. Powders prepared from parts of different plant species indigenous to Nigeria were tested by various Nigerian scientists under laboratory conditions for their insecticidal activities against the common insect pests of maize and cowpea, i.e. Sitophilus zeamais and Callosobruchus maculatus.

  11. Completion Report for Well ER-20-7: Corrective Action Units 101 and 102: Central and Western Pahute Mesa

    Energy Technology Data Exchange (ETDEWEB)

    NSTec Environmental Restoration

    2010-04-28

    Well ER-20-7 was drilled for the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office in support of the Nevada Environmental Restoration Project at the Nevada Test Site, Nye County, Nevada. The well was drilled in June 2009 as part of the Pahute Mesa Phase II drilling program. The primary purpose of the well was to further investigate migration of radionuclides from the nearby, up-gradient TYBO and BENHAM underground nuclear tests, which originally was discovered at Well Cluster ER-20-5. This well also provided detailed hydrogeologic information in the Tertiary volcanic section that will reduce uncertainties within the Pahute Mesa-Oasis Valley hydrostratigraphic framework model. The main 44.45-centimeter hole was drilled to a depth of 681.8 meters and cased with 33.97-centimeter casing to 671.7 meters. The hole diameter was then decreased to 31.12 centimeters, and the well was drilled to total depth of 894.9 meters. The completion string, set to the depth of 890.0 meters, consists of 14.13-centimeter stainless-steel casing hanging from 19.37-centimeter carbon-steel casing. The 14.13-centimeter stainless-steel casing has one continuous slotted interval open to the Topopah Spring aquifer. Data collected during and shortly after hole construction include composite drill cuttings samples collected every 3.0 meters, sidewall core samples from 20 depth intervals, various geophysical logs, water quality (primarily tritium) measurements, and water level measurements. The well penetrated 894.9 meters of Tertiary volcanic rock, including two saturated welded-tuff aquifers. A fluid level measurement was obtained during open-hole geophysical well logging for the upper, Tiva Canyon, aquifer at the depth of 615.7 meters on June 19, 2009. The fluid level measured in the open hole on June 27, 2009,after the total depth was reached and the upper aquifer was cased off, was also at the depth of 615.7 meters. Preliminary field measurements indicated 1

  12. The cross sections and energy spectra of the particle emission in proton induced reaction on 204,206,207,208Pb and 209Bi

    Directory of Open Access Journals (Sweden)

    Zhang Zhengjun

    2017-01-01

    Full Text Available All cross sections of proton induced reactions, angular distributions, energy spectra and double differential cross sections of neutron, proton, deuteron, triton, helium and alpha-particle emissions for p+ 204,206,207,208Pb, 209Bi reactions are consistently calculated and analyzed at incident proton energies below 200 MeV. The optical model, the distorted wave Born approximation theory, the unified Hauser-Feshbach and exciton model which includes the improved Iwamoto-Harada model are used. Theoretically calculated results are compared with the existing experimental data.

  13. Draft Genome Sequence of Four Coccolithoviruses: Emiliania huxleyi Virus EhV-88, EhV-201, EhV-207, and EhV-208

    OpenAIRE

    Nissimov, Jozef I.; Worthy, Charlotte A.; Rooks, Paul; Napier, Johnathan A.; Kimmance, Susan A.; Henn, Matthew R.; Ogata, Hiroyuki; Allen, Michael J.

    2012-01-01

    The Coccolithoviridae are a group of viruses which infect the marine coccolithophorid microalga Emiliania huxleyi. The Emiliania huxleyi viruses (known as EhVs) described herein have 160- to 180-nm diameter icosahedral structures, have genomes of approximately 400 kbp, and consist of more than 450 predicted coding sequences (CDSs). Here, we describe the genomic features of four newly sequenced coccolithoviruses (EhV-88, EhV-201, EhV-207, and EhV-208) together with their draft genome sequences...

  14. Draft genome sequence of four coccolithoviruses: Emiliania huxleyi virus EhV-88, EhV-201, EhV-207, and EhV-208.

    Science.gov (United States)

    Nissimov, Jozef I; Worthy, Charlotte A; Rooks, Paul; Napier, Johnathan A; Kimmance, Susan A; Henn, Matthew R; Ogata, Hiroyuki; Allen, Michael J

    2012-03-01

    The Coccolithoviridae are a group of viruses which infect the marine coccolithophorid microalga Emiliania huxleyi. The Emiliania huxleyi viruses (known as EhVs) described herein have 160- to 180-nm diameter icosahedral structures, have genomes of approximately 400 kbp, and consist of more than 450 predicted coding sequences (CDSs). Here, we describe the genomic features of four newly sequenced coccolithoviruses (EhV-88, EhV-201, EhV-207, and EhV-208) together with their draft genome sequences and their annotations, highlighting the homology and heterogeneity of these genomes to the EhV-86 model reference genome.

  15. Excitation functions of product nuclei from 40 to 2600 MeV proton-irradiated {sup 206,207,208,nat}Pb and {sup 209}Bi

    Energy Technology Data Exchange (ETDEWEB)

    Titarenko, Yury E. [Institute for Theoretical and Experimental Physcis, 117218 Moscow (Russian Federation)]. E-mail: yury.titarenko@itep.ru; Batyaev, Viacheslav F. [Institute for Theoretical and Experimental Physcis, 117218 Moscow (Russian Federation); Mulambetov, Ruslan D. [Institute for Theoretical and Experimental Physcis, 117218 Moscow (Russian Federation); Zhivun, Valery M. [Institute for Theoretical and Experimental Physcis, 117218 Moscow (Russian Federation); Barashenkov, Vladilen S. [Joint Institute for Nuclear Research, 141980 Dubna (Russian Federation); Mashnik, Stepan G. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Shubin, Yury N. [Institute for Physics and Power Engineering, 249020 Obninsk (Russian Federation); Ignatyuk, Anatoly V. [Institute for Physics and Power Engineering, 249020 Obninsk (Russian Federation)

    2006-06-23

    5972 nuclide yields from proton-irradiated {sup 206,207,208,nat}Pb and {sup 209}Bi thin targets have been measured for 11 proton energies within the range 0.04-2.6 GeV. The measured data have been compared with data obtained at other laboratories as well as with theoretical simulations by seven codes. We found that the predictive power of the tested codes is different but is satisfactory for most of the nuclides in the spallation region, though none of the codes agree well with the data in the whole mass region of product nuclides and all should be improved further.

  16. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita

    2011-01-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  17. Production cross section of At radionuclides from 7Li+natPb and 9Be+natTl reactions

    Science.gov (United States)

    Maiti, Moumita; Lahiri, Susanta

    2011-12-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from 6,7Li- and 9Be-induced reactions on natural lead and thallium targets, respectively. The production of astatine radionuclides were investigated experimentally with two heavy-ion-induced reactions: 9Be + natTl and 7Li + natPb. Formation cross sections of the evaporation residues, 207,208,209,210At, produced in the (HI,xn) channel, were measured by the stacked-foil technique followed by off-line γ spectrometry at low incident energies (<50 MeV). Measured excitation functions were interpreted in terms of a compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach models. Measured cross-section values are lower than the respective theoretical predictions.

  18. Optimization of fermentation conditions and properties of an exopolysaccharide from Klebsiella sp. H-207 and application in adsorption of hexavalent chromium.

    Science.gov (United States)

    Qiang, Li; Yumei, Li; Sheng, Han; Yingzi, Liu; Dongxue, Song; Dake, Hao; Jiajia, Wang; Yanhong, Qu; Yuxia, Zheng

    2013-01-01

    The novel exopolysaccharide HZ-7 is produced by Klebsiella sp. H-207, and its fermentation conditions were optimized by response surface methodology (RSM). In this study, the optimized medium consisted of sucrose 31.93 g/L, KNO(3) 2.17 g/L and K(2)HPO(4) 5.47 g/L; while the optimized culture conditions consisted of seed age 13 h, with an inoculum size of 10.6% and incubation temperature of 28.9°C. A maximum HZ-7 yield of about 15.05 g/L was achieved under the optimized conditions using RSM and single-factor experiments. Next the exopolysaccharide HZ-7 was partially purified and characterized. The resulting product showed good properties, such as high concentration of uronic acid (41.67%), low average molecular weight (about 1.94×10(5) Da) and porous surface structure, were very advantageous to biosorption. Therefore HZ-7 was applied to absorb hexavalent chromium (Cr(VI)). The maximum adsorption efficiency (99.2%) which was obtained at an initial pH of 1.0 along with an initial Cr(VI) concentration of 20 mg/L, was not affected by ordinary metal ions and temperature. These data suggest Klebsiella sp. H-207 exopolysaccharide will be promising potential for industrial application.

  19. Study of multi-nucleon transfer reactions in {sup 58,} {sup 64}Ni + {sup 207}Pb collisions at the velocity filter SHIP

    Energy Technology Data Exchange (ETDEWEB)

    Comas, V.F.; Heinz, S.; Ackermann, D.; Heredia, J.A.; Hessberger, F.P.; Khuyagbaatar, J.; Kindler, B.; Lommel, B.; Mann, R. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Hofmann, S. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Goethe-Universitaet Frankfurt, Institut fuer Physik, Frankfurt (Germany)

    2013-09-15

    We investigated multi-nucleon transfer reactions in collisions of {sup 58}Ni + {sup 207}Pb and {sup 64}Ni + {sup 207}Pb at Coulomb barrier energies. The new aspect is that we used a velocity filter (SHIP at GSI) for the separation of the heavy target-like transfer products from background events. The isotopic identification was performed via the {alpha} decay properties of the reaction products. The goal of the experiment was to study the characteristics of multi-nucleon transfer reactions in the region of heavy nuclei and the applicability of existing separation and detection techniques, which are usually used for identification of heavy fusion-evaporation residues, to heavy transfer products. This was motivated by recent theoretical results from macroscopic-microscopic models which suggest deep inelastic transfer reactions in heavy systems as a means to produce new neutron-rich isotopes in the region of N = 126 and in the region of superheavy nuclei. In this paper we present the isotopic yields, the excitation functions and the excitation energies of the heavy transfer products with Z > 82 as well as the influence of shell effects on the reaction products. The influence of the different neutron numbers of the projectiles is also discussed. (orig.)

  20. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  1. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  2. Asymmetry Measurement in the Elastic Pion-Proton Scattering at 1.94 and 2.07 GeV/c

    Science.gov (United States)

    Alekseev, I. G.; Bazhanov, N. A.; Beloglazov, Yu. A.; Budkovsky, P. E.; Bunyatova, E. I.; Filimonov, E. A.; Kanavets, V. P.; Koroleva, L. I.; Kovalev, A. I.; Kruglov, S. P.; Morozov, B. V.; Nesterov, V. M.; Novinsky, D. V.; Ryltsov, V. V.; Shchedrov, V. A.; Sulimov, A. D.; Sumachev, V. V.; Svirida, D. N.; Trautman, V. Yu.; Zhurkin, V. V.; Zolin, L. S.

    2007-06-01

    Latest results by the ITEP-PNPI collaboration on the asymmetry in the π+p elastic scattering are presented. The data were obtained for the first time in the region of backward angles with low cross section, where the predictions of the partial wave analyses are not reliable. The results at 1.94 GeV/c are in favor of the older KH80 analysis and show noticeable deviation from the latest FA06 solution by GWU group. At 2.07 GeV/c very low cross section did not allow to achieve good accuracy. Yet the data do not follow any of the PWA predictions and definitely disagree with SP06 analysis.

  3. Physiological studies of environmental pollutants. Progress report, September 1, 1975--May 31, 1976. [/sup 210/Po, /sup 203/Pb, /sup 201/Tl, /sup 207/Bi, /sup 65/Zn

    Energy Technology Data Exchange (ETDEWEB)

    Lengemann, F W; Wentworth, R A

    1976-01-01

    In the past year we have looked at the transfer of some members of the actinide decay series into milk of goats. These were /sup 210/Po, /sup 203/Pb, /sup 201/Tl and /sup 207/Bi. All of these appeared in milk after oral ingestion but at levels less than 1 percent per liter. In addition we have looked at the transfer of /sup 65/Zn into milk of goats after oral and I.V. doses; the experiments are incomplete at this time. In controlled temperature studies it was found that 6.6 times as much radioiodine was secreted into milk when goats were at 33/sup 0/ as opposed to 5/sup 0/C. When radioiodine is put into the mammary gland the transfer from milk to body is rapid; more rapid than is the case for /sup 65/Zn. The analysis of these data indicate the need for a model capable of handling expansion of a compartment.

  4. Lobophorin K, a New Natural Product with Cytotoxic Activity Produced by Streptomyces sp. M-207 Associated with the Deep-Sea Coral Lophelia pertusa

    Science.gov (United States)

    Braña, Alfredo F.; Sarmiento-Vizcaíno, Aida; Osset, Miguel; Pérez-Victoria, Ignacio; Martín, Jesús; de Pedro, Nuria; de la Cruz, Mercedes; Díaz, Caridad; Vicente, Francisca; Reyes, Fernando; García, Luis A.; Blanco, Gloria

    2017-01-01

    The present article describes the isolation of a new natural product of the lobophorin family, designated as lobophorin K (1), from cultures of the marine actinobacteria Streptomyces sp. M-207, previously isolated from the cold-water coral Lophelia pertusa collected at 1800 m depth during an expedition to the submarine Avilés Canyon. Its structure was determined using a combination of spectroscopic techniques, mainly ESI-TOF MS and 1D and 2D NMR. This new natural product displayed cytotoxic activity against two human tumor cell lines, such as pancreatic carcinoma (MiaPaca-2) and breast adenocarcinoma (MCF-7). Lobophorin K also displayed moderate and selective antibiotic activity against pathogenic Gram-positive bacteria such as Staphylococcus aureus. PMID:28534807

  5. Lobophorin K, a New Natural Product with Cytotoxic Activity Produced by Streptomyces sp. M-207 Associated with the Deep-Sea Coral Lophelia pertusa.

    Science.gov (United States)

    Braña, Alfredo F; Sarmiento-Vizcaíno, Aida; Osset, Miguel; Pérez-Victoria, Ignacio; Martín, Jesús; de Pedro, Nuria; de la Cruz, Mercedes; Díaz, Caridad; Vicente, Francisca; Reyes, Fernando; García, Luis A; Blanco, Gloria

    2017-05-19

    The present article describes the isolation of a new natural product of the lobophorin family, designated as lobophorin K (1), from cultures of the marine actinobacteria Streptomyces sp. M-207, previously isolated from the cold-water coral Lophelia pertusa collected at 1800 m depth during an expedition to the submarine Avilés Canyon. Its structure was determined using a combination of spectroscopic techniques, mainly ESI-TOF MS and 1D and 2D NMR. This new natural product displayed cytotoxic activity against two human tumor cell lines, such as pancreatic carcinoma (MiaPaca-2) and breast adenocarcinoma (MCF-7). Lobophorin K also displayed moderate and selective antibiotic activity against pathogenic Gram-positive bacteria such as Staphylococcus aureus.

  6. Vildagliptin and its metabolite M20.7 induce the expression of S100A8 and S100A9 in human hepatoma HepG2 and leukemia HL-60 cells.

    Science.gov (United States)

    Asakura, Mitsutoshi; Karaki, Fumika; Fujii, Hideaki; Atsuda, Koichiro; Itoh, Tomoo; Fujiwara, Ryoichi

    2016-10-19

    Vildagliptin is a potent, orally active inhibitor of dipeptidyl peptidase-4 (DPP-4) for the treatment of type 2 diabetes mellitus. It has been reported that vildagliptin can cause hepatic dysfunction in patients. However, the molecular-mechanism of vildagliptin-induced liver dysfunction has not been elucidated. In this study, we employed an expression microarray to determine hepatic genes that were highly regulated by vildagliptin in mice. We found that pro-inflammatory S100 calcium-binding protein (S100) a8 and S100a9 were induced more than 5-fold by vildagliptin in the mouse liver. We further examined the effects of vildagliptin and its major metabolite M20.7 on the mRNA expression levels of S100A8 and S100A9 in human hepatoma HepG2 and leukemia HL-60 cells. In HepG2 cells, vildagliptin, M20.7, and sitagliptin - another DPP-4 inhibitor - induced S100A9 mRNA. In HL-60 cells, in contrast, S100A8 and S100A9 mRNAs were significantly induced by vildagliptin and M20.7, but not by sitagliptin. The release of S100A8/A9 complex in the cell culturing medium was observed in the HL-60 cells treated with vildagliptin and M20.7. Therefore, the parental vildagliptin- and M20.7-induced release of S100A8/A9 complex from immune cells, such as neutrophils, might be a contributing factor of vildagliptin-associated liver dysfunction in humans.

  7. Experiments on multi-nucleon transfer reactions with the systems {sup 58,64}Ni+{sup 207}Pb at SHIP

    Energy Technology Data Exchange (ETDEWEB)

    Fernandovich Comas Lijachev, Victor

    2012-07-01

    This work presents experimental results on multi-nucleon transfer reactions in the collision systems {sup 58}Ni+{sup 207}Pb and {sup 64}Ni+{sup 207}Pb which were measured at the velocity filter SHIP at GSI. The reactions were performed at beam energies below and up to 10% above the Coulomb barrier. The work was motivated by theoretical predictions to apply multi-nucleon transfer reactions in heavy systems to synthesize new neutron-rich isotopes in the region of superheavy nuclei with Z>100 and in the region of the closed neutron shell N=126. The expected cross-sections for the production of these nuclei in transfer reactions are small and reach typically nanobarn and below. Therefore, efficient separation techniques have to be applied and the detection system must allow for the identification of single nuclei. A dedicated experimental setup to study such rare transfer products does not exist presently. But already existing facilities which are used for the synthesis of superheavy fusion products meet the requirements for the detection of rare reaction products. In this context, the velocity filter SHIP offers the possibility to separate heavy target-like transfer products from projectiles and projectile-like reaction products before they reach the detection system where the particles are identified by their alpha-decay properties. At SHIP, a cross-section limit of 10 pb can be reached at usual beam intensities. In the present work on collisions of {sup 58,64}Ni+{sup 207}Pb the influence of the projectile neutron number on the cross-sections, isotopic distributions and excitation energies of the transfer products was studied. Especially with the more neutron-rich {sup 64}Ni projectiles a transfer of up to seven protons and eight neutrons to the target nucleus was observed. The largest cross-sections for the most neutron-rich isotopes were reached at the beam energies around the Coulomb barrier. The transfer was accompanied by the full dissipation of the available

  8. Pahute Mesa Well Development and Testing Analyses for Wells ER-20-7, ER-20-8 #2, and ER-EC-11, Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    Greg Ruskauff

    2011-12-01

    This report analyzes the following data collected from ER-20-7, ER-20-8 No.2, and ER-EC-11 during WDT operations: (1) Chemical indicators of well development (Section 2.0); (2) Static hydraulic head (Section 3.0); (3) Radiochemistry and geochemistry (Section 4.0); (4) Drawdown observed at locations distal to the pumping well (Section 5.0); and (5) Drilling water production, flow logs, and temperature logs (Section 6.0). The new data are further considered with respect to existing data as to how they enhance or change interpretations of groundwater flow and transport, and an interim small-scale conceptual model is also developed and compared to Phase I concepts. The purpose of well development is to remove drilling fluids and drilling-associated fines from the formation adjacent to a well so samples reflecting ambient groundwater water quality can be collected, and to restore hydraulic properties near the well bore. Drilling fluids can contaminate environmental samples from the well, resulting in nonrepresentative measurements. Both drilling fluids and preexisting fines in the formation adjacent to the well can impede the flow of water from the formation to the well, creating artifacts in hydraulic response data measured in the well.

  9. Oral lipoma extending superiorly from mandibular gingivobuccal fold to gingiva: a case report and analysis of 207 patients with oral lipoma in Japan.

    Science.gov (United States)

    Taira, Yukio; Yasukawa, Kazuo; Yamamori, Iku; Iino, Mitsuyoshi

    2012-01-01

    Lipoma is relatively uncommon in the oral cavity. Among the intraoral regions, lipoma involving the gingiva or gingivobuccal fold is relatively infrequent. We report the case of a patient with lipoma extending superiorly from the mandibular gingivobuccal fold to the gingiva. In addition to the case report, we retrospectively reviewed 207 patients with intraoral lipoma reported in Japan from 1987 to 2004. The most frequent site of development was the buccal mucosa (40.6%), followed by the tongue (17.9%), lip (12.6%), gingiva (8.7%), oral floor (6.8%), gingivobuccal fold and palate (4.8%), and others (3.9%). Occurrence tended to be more frequent in males (57.5%) than in females (42.5%). Relative to age, frequency peaked among patients in the 7th (27.3%) and 6th decades (25.1%), respectively, followed in descending order by the 5th (14.8%) and 8th decades (13.1%). The majority of patients (86.3%) were at least 40 years. The most frequent size was 10-19 mm (37.5%), followed by 0-9 mm (27.8%) and 20-29 mm (14.6%), and tumors 30 mm or larger were relatively infrequent. Histopathological types in order of descending frequency were lipomas (69.0%), fibrolipomas (27.4%), and others (3.5%). The male:female ratio was 1.7:1 for lipoma and 1:1.6 for fibrolipoma.

  10. Influência de abelhas africanizadas na concentração de açúcares no néctar de soja (Glycine max L. Merrill var. Coodetec 207 = Influence of africanized honeybees on sugar concentration in the nectar of soybean (Glycine max L. Merrill var. Coodetec 207

    Directory of Open Access Journals (Sweden)

    Eloi Machado Alves

    2010-04-01

    Full Text Available O objetivo foi avaliar a concentração de açúcares no néctar de soja (Glycine max L. Merrill em áreas com ou sem a presença de abelhas Apis mellifera L. Foi utilizada a variedade Coodetec 207 em quatro tratamentos: área de 24 m2 coberta com colônia de abelhas africanizadas em seu interior; área semicoberta com livre acesso para insetos visitantes; área livre e área coberta sem abelhas. As flores foram coletadas durante três dias, a cada 2h. e a concentração dos açúcares totais por flor foi determinada por espectrofotometria. A área coberta com abelha apresentou maior concentração de açúcares totais em relação à área coberta sem abelhas e livre, contudo, aconcentração de açúcares totais na área livre não diferiu da concentração observada na área coberta sem abelhas. Houve redução na concentração média de sacarose na área livre, diferindo das concentrações nas demais áreas. A concentração média de glicose não diferiu entre os tratamentos, enquanto que a de frutose não apresentou diferença entre as áreas cobertas com abelhas, semicoberta e livre. A variedade Coodetec 207 da soja apresentou maior concentração total de açúcares e de frutose nas áreas cobertas com abelhas. Contudo, a presença de Apis mellifera não interferiu nesta concentração de açúcares no néctar das flores de soja desta variedade.This research was carried out to evaluate the sugar concentration in soybean nectar in areas with Africanized honeybee colonies. The var. Coodetec 207 was used in four treatments: 24 m2 covered area with Africanized honeybee colony inside, semi-covered area for free insect visitation, uncovered area, and covered area without insect visitation. Flowers were harvested for three days at two-hour intervals, and the total sugar concentration per flower was determined by spectrophotometry. The covered area with Africanized honeybee colony presented higher sugar concentration than the covered area

  11. Improvement in the Outcomes of MELD ≥ 40 Liver Transplantation: An Analysis of 207 Consecutive Transplants in a Highly Competitive DSA.

    Science.gov (United States)

    Nekrasov, Victor; Matsuoka, Lea; Kaur, Navpreet; Pita, Alejandro; Whang, Gilbert; Cao, Shu; Groshen, Susan; Alexopoulos, Sophoclis

    2017-10-01

    Organ donor shortages continue to persist, especially in regions of the United States where competition is highest and recipients frequently attain a Model for End-Stage Liver Disease (MELD) score of 40 or higher before transplantation. The benefits of Share 35 in highly competitive regions may be underestimated when examining the collective national experience. The purpose of this study was to examine the outcomes of liver transplantation in recipients with a MELD of 40 or higher after implementation of Share 35 in a single center located in region 5. The method used in this study was single-center retrospective analysis of 207 liver transplant recipients who achieved MELD score of 40 or higher from April 21, 2002, to May 15, 2015. Multivariable analysis identified implementation of Share 35 as the strongest predictor of graft survival in MELD of 40 or higher liver transplantation. The post-Share 35, 1-year graft survival was 94% compared with 75% pre-Share 35 (P = 0.002). Post-Share 35 recipients waited significantly less time until transplantation (10 vs 16 days, P = 0.015), and fewer were hospitalized for more than 28 days before their transplant (6% vs 18%, P = 0.05). Multivariable analysis identified recipients with diabetes at the time of listing as the strongest predictor of posttransplant patient mortality. Implementation of the Share 35 allocation policy has a significant effect on outcomes by improving organ access and minimizing candidate waiting times. Recipients achieving a MELD of 40 or higher at our center post-Share 35 had an improved 1-year graft survival. However, nearly 40% remained hospitalized for more than 4 weeks posttransplant, and 20% were discharged to an acute care facility.

  12. 49 CFR 571.207 - Standard No. 207; Seating systems.

    Science.gov (United States)

    2010-10-01

    ....1Seat adjustment. Except for vertical movement of nonlocking suspension type occupant seats in trucks or... seat whose center of gravity is in a horizontal plane that is above the seat adjuster or that passes... horizontal plane that is below the seat adjuster, use S5.1.1(c). (4) For all other seats whose seat back and...

  13. Adane 207-213.pmd

    African Journals Online (AJOL)

    Prof. Adipala Ekwamu

    (Spiegel et al., 1993). Thus, research and development efforts to test and clean up propagule-borne viruses from germplasm resources have concentrated on these groups ... The symptoms included stunting, yellowing, mottling, leaf distortion and deformation. The number of sweetpotato genotypes evaluated, the presence.

  14. Sports injury and illness incidence in the Rio de Janeiro 2016 Olympic Summer Games: A prospective study of 11274 athletes from 207 countries.

    Science.gov (United States)

    Soligard, Torbjørn; Steffen, Kathrin; Palmer, Debbie; Alonso, Juan Manuel; Bahr, Roald; Lopes, Alexandre Dias; Dvorak, Jiri; Grant, Marie-Elaine; Meeuwisse, Willem; Mountjoy, Margo; Pena Costa, Leonardo Oliveira; Salmina, Natalia; Budgett, Richard; Engebretsen, Lars

    2017-09-01

    To describe the pattern of injuries and illnesses sustained during the Games of the XXXI Olympiad, hosted by Rio de Janeiro from 5 to 21 August 2016. We recorded the daily incidence of athlete injuries and illnesses (1) through the reporting of all National Olympic Committee (NOC) medical teams and (2) in the polyclinic and medical venues by the Rio 2016 medical staff. In total, 11 274 athletes (5089 women, 45%; 6185 men, 55%) from 207 NOCs participated in the study. NOC and Rio 2016 medical staff reported 1101 injuries and 651 illnesses, equalling 9.8 injuries and 5.4 illnesses per 100 athletes over the 17-day period. Altogether, 8% of the athletes incurred at least one injury and 5% at least one illness. The injury incidence was highest in BMX cycling (38% of the athletes injured), boxing (30%), mountain bike cycling (24%), taekwondo (24%), water polo (19%) and rugby (19%), and lowest in canoe slalom, rowing, shooting, archery, swimming, golf and table tennis (0%-3%). Of the 1101 injuries recorded, 40% and 20% were estimated to lead to ≥1 and >7 days of absence from sport, respectively. Women suffered 40% more illnesses than men. Illness was generally less common than injury, with the highest incidence recorded in diving (12%), open-water marathon (12%), sailing (12%), canoe slalom (11%), equestrian (11%) and synchronised swimming (10%). Illnesses were also less severe; 18% were expected to result in time loss. Of the illnesses, 47% affected the respiratory system and 21% the gastrointestinal system. The anticipated problem of infections in the Rio Olympic Games did not materialise, as the proportion of athletes with infectious diseases mirrored that of recent Olympic Games (3%). Overall, 8% of the athletes incurred at least one injury during the Olympic Games, and 5% an illness, which is slightly lower than in the Olympic Summer Games of 2008 and 2012. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2017. All

  15. In vitro anticancer activity of Betulinic acid and derivatives thereof on equine melanoma cell lines from grey horses and in vivo safety assessment of the compound NVX-207 in two horses.

    Science.gov (United States)

    Liebscher, G; Vanchangiri, K; Mueller, Th; Feige, K; Cavalleri, J-M V; Paschke, R

    2016-02-25

    Betulinic acid, a pentacyclic triterpene, and its derivatives are promising compounds for cancer treatment in humans. Melanoma is not only a problem for humans but also for grey horses as they have a high potential of developing melanoma lesions coupled to the mutation causing their phenotype. Current chemotherapeutic treatment carries the risk of adverse health effects for the horse owner or the treating veterinarian by exposure to antineoplastic compounds. Most treatments have low prospects for systemic tumor regression. Thus, a new therapy is needed. In this in vitro study, Betulinic acid and its two derivatives B10 and NVX-207, both with an improved water solubility compared to Betulinic acid, were tested on two equine melanoma cell lines (MelDuWi and MellJess/HoMelZh) and human melanoma (A375) cell line. We could demonstrate that all three compounds especially NVX-207 show high cytotoxicity on both equine melanoma cell lines. The treatment with these compounds lead to externalization of phosphatidylserines on the cell membrane (AnnexinV-staining), DNA-fragmentation (cell cycle analysis) and activation of initiator and effector caspases (Caspase assays). Our results indicate that the apoptosis is induced in the equine melanoma cells by all three compounds. Furthermore, we succeed in encapsulating the most active compound NVX-207 in 2-Hydroxyprolyl-β-cyclodextrine without a loss of its activity. This formulation can be used as a promising antitumor agent for treating grey horse melanoma. In a first tolerability evaluation in vivo the formulation was administered every one week for 19 consecutive weeks and well tolerated in two adult melanoma affected horses. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  16. micrOMEGAs 2.0.7: a program to calculate the relic density of dark matter in a generic model

    Science.gov (United States)

    Bélanger, G.; Boudjema, F.; Pukhov, A.; Semenov, A.

    2007-12-01

    micrOMEGAs2.0.7 is a code which calculates the relic density of a stable massive particle in an arbitrary model. The underlying assumption is that there is a conservation law like R-parity in supersymmetry which guarantees the stability of the lightest odd particle. The new physics model must be incorporated in the notation of CalcHEP, a package for the automatic generation of squared matrix elements. Once this is done, all annihilation and coannihilation channels are included automatically in any model. Cross-sections at v=0, relevant for indirect detection of dark matter, are also computed automatically. The package includes three sample models: the minimal supersymmetric standard model (MSSM), the MSSM with complex phases and the NMSSM. Extension to other models, including non supersymmetric models, is described. Program summaryTitle of program:micrOMEGAs2.0.7 Catalogue identifier:ADQR_v2_1 Program summary URL:http://cpc.cs.qub.ac.uk/summaries/ADQR_v2_1.html Program obtainable from: CPC Program Library, Queen's University of Belfast, N. Ireland Licensing provisions:Standard CPC licence, http://cpc.cs.qub.ac.uk/licence/licence.html No. of lines in distributed program, including test data, etc.:216 529 No. of bytes in distributed program, including test data, etc.:1 848 816 Distribution format:tar.gz Programming language used:C and Fortran Computer:PC, Alpha, Mac, Sun Operating system:UNIX (Linux, OSF1, SunOS, Darwin, Cygwin) RAM:17 MB depending on the number of processes required Classification:1.9, 11.6 Catalogue identifier of previous version:ADQR_v2_0 Journal version of previous version:Comput. Phys. Comm. 176 (2007) 367 Does the new version supersede the previous version?:Yes Nature of problem:Calculation of the relic density of the lightest stable particle in a generic new model of particle physics. Solution method:In numerically solving the evolution equation for the density of dark matter, relativistic formulae for the thermal average are used. All tree

  17. Structural variation in ethylenediamine and -diphosphine adducts of (2,6-Me2C6H3S)2Pb: a single crystal X-ray diffraction and 207Pb solid-state NMR spectroscopy study.

    Science.gov (United States)

    Rossini, Aaron J; Macgregor, Alan W; Smith, Anita S; Schatte, Gabriele; Schurko, Robert W; Briand, Glen G

    2013-07-14

    Coordination complexes of (2,6-Me2C6H3S)2Pb (1) with flexible bidentate ligands have been prepared to explore new bonding environments for Pb(II) thiolates. The reaction of 1 with a series of ethylenediamine and ethylenediphosphine ligands resulted in isolation of the adducts [(2,6-Me2C6H3S)2Pb]2(tmeda) (9), [(2,6-Me2C6H3S)2Pb]3(dmpe) (10) and [(2,6-Me2C6H3S)2Pb]2(dppe) (11) [tmeda = N,N,N',N'-tetramethylethylenediamine; dmpe = bis(dimethylphosphino)ethane; dppe = bis(diphenylphosphino)ethane]. The X-ray crystal structure of 9 shows a dinuclear species in which tmeda is chelating a ψ-trigonal bipyramidal S2N2 Pb centre via axial and equatorial sites. The structure of 10 displays a trinuclear structural unit in which dmpe is chelating a ψ-trigonal bipyramidal S2P2 Pb centre via equatorial sites. Compounds 9 and 10 also contain a second unique metal centre with ψ-tetrahedral S3Pb bonding motifs. The structure of 11 shows the dppe ligand bridging two Pb ψ-tetrahedral S2P metal bonding environments. Static (207)Pb solid-state NMR (SSNMR) spectra of 9-11 and [Ph4As][(PhS)3Pb] (12) were acquired with cross polarization (CP)-CPMG and frequency swept pulse (WURST)-CPMG pulse sequences, and the efficiencies of these pulse sequences are compared. The (207)Pb SSNMR spectra reveal that the lead chemical shift anisotropies (CSA) vary greatly between the different Pb sites, and are generally large in magnitude. DFT calculations are utilized to relate the orientations of the (207)Pb nuclear magnetic shielding tensors to the molecular structures, and to aid in spectral assignment where multiple Pb centres are present. The combination of X-ray diffraction, (207)Pb SSNMR and DFT is shown to be invaluable for the structural characterization of these important structural motifs, and should find wide-ranging application to numerous lead coordination compounds.

  18. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  19. Rationale and Design of a Phase 1 Clinical Trial to Evaluate HSV G207 Alone or with a Single Radiation Dose in Children with Progressive or Recurrent Malignant Supratentorial Brain Tumors.

    Science.gov (United States)

    Waters, Alicia M; Johnston, James M; Reddy, Alyssa T; Fiveash, John; Madan-Swain, Avi; Kachurak, Kara; Bag, Asim K; Gillespie, G Yancey; Markert, James M; Friedman, Gregory K

    2017-03-01

    Primary central nervous system tumors are the most common solid neoplasm of childhood and the leading cause of cancer-related death in pediatric patients. Survival rates for children with malignant supratentorial brain tumors are poor despite aggressive treatment with combinations of surgery, radiation, and chemotherapy, and survivors often suffer from damaging lifelong sequelae from current therapies. Novel innovative treatments are greatly needed. One promising new approach is the use of a genetically engineered, conditionally replicating herpes simplex virus (HSV) that has shown tumor-specific tropism and potential efficacy in the treatment of malignant brain tumors. G207 is a genetically engineered HSV-1 lacking genes essential for replication in normal brain cells. Safety has been established in preclinical investigations involving intracranial inoculation in the highly HSV-sensitive owl monkey (Aotus nancymai), and in three adult phase 1 trials in recurrent/progressive high-grade gliomas. No dose-limiting toxicities were seen in the adult studies and a maximum tolerated dose was not reached. Approximately half of the 35 treated adults had radiographic or neuropathologic evidence of response at a minimum of one time point. Preclinical studies in pediatric brain tumor models indicate that a variety of pediatric tumor types are highly sensitive to killing by G207. This clinical protocol outlines a first in human children study of intratumoral inoculation of an oncolytic virus via catheters placed directly into recurrent or progressive supratentorial malignant tumors.

  20. The impact of langerin (CD207)+ dendritic cells and FOXP3+ Treg cells in the small bowel mucosa of children with celiac disease and atopic dermatitis in comparison to children with functional gastrointestinal disorders.

    Science.gov (United States)

    Vorobjova, Tamara; Ress, Krista; Luts, Katrin; Uibo, Oivi; Uibo, Raivo

    2016-08-01

    In the present study we aimed to evaluate the impact of langerin (CD207)+ dendritic cells (DCs) and FOXP3+ Treg cells in the intestinal mucosa of children with celiac disease (CD) and atopic dermatitis (AD) in comparison to children with functional gastrointestinal disorders (FGD). Seventy-five children (37 male, mean age 8.4 ± 4.8 years), who randomly underwent small bowel biopsy, were studied. The CD was diagnosed in 14 children, including five persons with concomitant AD (all positive for anti-tissue transglutaminase IgA antibodies and with small bowel atrophy). Normal small bowel mucosa was found in eight patients with AD and in 53 patients with FGD. The sera of all patients were tested for total and specific IgE antibodies to food allergen panels. Staining for CD11c+, langerin (CD207+) DCs, CD4+, and FOXP3+ Treg cells was performed on paraffin-embedded sections of bioptates using immunohistochemistry. The density of CD11c+ DCs, CD4+, and FOXP3+ Treg cells was higher in the CD patients compared to the AD and FGD patients (p = 0.02; p = 0.001). In AD, significantly higher density of CD11c+ DCs was detected in patients positive for specific IgE to food allergen panels (p = 0.02). The FGD patients with elevated total IgE had increased density of langerin (CD207)+ DCs compared to the patients with normal total IgE levels (p = 0.01). The increased density of FOXP3+ Treg cells, CD4+, cells and CD11c+ DCs was associated with CD but not with AD. The elevated level of total IgE or specific IgE to food allergens was associated with more pronounced expression of DCs, indicating a possible link between the presence of these cells in small bowel mucosa with elevated level of serum IgE. © 2016 APMIS. Published by John Wiley & Sons Ltd.

  1. High resolution neutron (n,xn) cross-section measurements for {sup 206,207,208}Pb and {sup 209}Bi from threshold up to 20 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Mihailescu, L.C.; Borcea, C.; Plompen, A.J.M. [European Commission, Joint Research Center, Institute for Reference Materials and Measurements, Geel (Belgium); Baumann, P.; Dessagne, P.; Kerveno, M.; Lukic, S.; Rudolf, G. [IReS, IN2P3, 67 - Strasbourg (France); Jericha, E.; Pavlik, A. [Wien Technische Univ. (Austria); Koning, A.J. [Nuclear Research Group Petten (Netherlands)

    2008-07-01

    Gamma production cross sections for neutron inelastic scattering reactions (n,xn) (x = 1, 2, 3) were measured for three different highly enriched targets of {sup 206}Pb, {sup 207}Pb and {sup 208}Pb and for {sup 209}Bi. Using the known decay schemes of these isotopes, the total inelastic cross sections and level inelastic cross sections were determined. The measurements are continuous in neutron energy and cover a wide interval (from threshold energy up to about 20 MeV). The experiments were performed at the GELINA white neutron source, at the 200 m flight path station with a time resolution of 8 ns, resulting in an unprecedented neutron energy resolution of 1.1 keV at 1 MeV (36 keV at 10 MeV). (authors)

  2. Multijet-Produktion in der $e^+e^--$Annihilation von $\\sqrt{s}=$89 GeV bis 207 GeV Messung der starken Kopplung $\\alpha_s$ aus der Vierjetrate

    CERN Document Server

    Flagmeyer, Uwe

    2001-01-01

    Hadronic events from the data collected with the DELPHI detector at LEP within an energy range from 89 GeV to 207 GeV are selected and their jet rates are determined. The measurement of jet rates give no indication for an excess of multi jet events at high energies. The four jet rate is compared to next to leading order calculations. Studies on the influence of the renormalisation scale μ are performed confirming previous DELPHI results on optimised scales. Applying scale optimisation methods allows a precise measurement of the strong coupling αs from LEP1 data. The final result is obtained by the CAMBRIDGE algorithm: = 0:1175 ± 0:0010(exp:) ± 0:0017(hadr:) ± 0:0007(scale) . The comparison of αs as measured at the Z and at higher energies gives access to the energy dependence (running) of the strong coupling. The logarithmic energy slope, again obtained from Cambridge, is measured to be = 1:14 ± 0:25(stat:) ± 0:25(sys:) , while the QCD prediction for this quantity is 1.28. The results in are in good ...

  3. Rb-Sr and single - zircon grain 207Pb / 206Pb chronology of the Monesterio granodiorite and related migmatites. Evidence of a Late Cambrian melting event in the Ossa-Morena Zone, Iberian Massif

    Directory of Open Access Journals (Sweden)

    Bea, F.

    1999-04-01

    Full Text Available The Monesterio granodiorite, a small granodioritic body placed in a migmatitic complex in the SW of the Olivenza-Monesterio antiform, is a key plutonic body to understanding the relationships among the magmatism, metamorphism, and deformation in the Ossa-Morena Zone, SW Iberian Massif. We dated the granodiorite with the single zircon stepwise-evaporation 207Pb/206Pb method, and the related migmatization event with the Rb-Sr method on leucosomes. Our results indicate that the Monesterio granodiorite crystallised at 510 ± 7 Ma and its protolith had a component with Upper Proterozoic zircons with a minimum age of 1696 Ma. Leucosomes give a Rb-Sr age of 511 ± 40 Ma (MSWD =1,7 with initial 87Sr/86Sr =0.70914 ± 0.00048. The lower initial 87Sr/86Sr of the granodiorite and its calc-alkaline chemistry precludes it from having derived from the same protolith as the migmatites. The existence of different magmatic bodies in the Ossa-Morena Zone with ages clustering around 500-510 Ma reveals the existence of a significant melting event during the Late Cambrian that involved protoliths with very different geochemical and isotopic signatures.La granodiorita de Monesterio es un pequeño cuerpo emplazado en un complejo migmatítico en el SO del antiforme Olivenza-Monesterio, importante para entender las relaciones entre magmatismo, metamorfismo y deformación en la Zona de Ossa-Morena. Se ha datado la granodiorita por el método de evaporación secuencial de 207Pb/206Pb en cristal único de circón y los leucosomes de las migmatitas circundantes por el método Rb-Sr. Los datos indican una edad de cristalización de la granodiorita de 510 ± 4 Ma y un posible protolito Proterozoico Superior con una edad mínima de ∼1.700 Ma, obtenida a partir de núcleos heredados de los circones analizados. Los leucosomes dan una edad Rb-Sr de 511 ± 40 Ma, con una relación 87Sr/86Sr=0,70914 ± 0,00048. La relación inicial de 87Sr/86Sr en la granodiorita (

  4. Genetic polymorphisms of CYP1A2, CYP3A4, CYP3A5, pregnane/steroid X receptor and constitutive androstane receptor in 207 healthy Spanish volunteers.

    Science.gov (United States)

    Oliver, Paloma; Lubomirov, Rubin; Carcas, Antonio

    2010-05-01

    Variability of cytochrome P450 (CYP) in humans is largely related to the pharmacological and toxicological effects of drugs and chemicals. Identification of single nucleotide polymorphisms (SNPs) could be important for knowing their involvement in many drugs metabolism. The goal of this study was to analyze the genotype frequency of 10 SNPs related to mirtazapine metabolism [CYP3A4*17, CYP3A4*18, CYP3A5*3A, CYP1A2*1F, pregnane/steroid X receptor (PXR) (rs3814055, rs38114057, rs3814058) and constitutive androstane receptor (CAR) (rs4073054, rs2307424, rs2502815)]. The study was carried out in 207 healthy Spanish volunteers that had participated in phase I clinical trials. Other studies were performed: Hardy-Weinberg equilibrium, haplotype estimation and linkage disequilibrium. No mutation related to CYP3A4*17 and CYP3A4*18 was found. Therefore, we analyzed data for the other eight SNPs. Allele frequencies were in equilibrium with the Hardy-Weinberg equation. Six haplotypes were determined for three PXR SNPs, and four for CAR SNPs. Tests for linkage disequilibrium showed a high association between PXR (rs38114057) and PXR (rs3814058) (p= 0.001), and between the three CAR SNPs (p=0.001), which could be useful for identification of tag SNPs. In the present study, the genotype frequencies of some SNPs related to mirtazapine metabolism in Spaniards were analyzed and showed that our study population is representative of HapMap European population. The results obtained could be analyzed with pharmacokinetic parameters of mirtazapine to elucidate the genotype-phenotype relationship, the involvement of these SNPs in metabolic reactions, drug interactions, and prediction of treatment response.

  5. 10 CFR 207.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ..., exploration, extraction, and energy resources (including petrochemical feedstocks) wherever located; (2) production, distribution, and consumption of energy and fuels, wherever carried on; and (3) matters relating... natural person, corporation, partnership, association, consortium, or any entity organized for a common...

  6. 23 CFR 645.207 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS UTILITIES... shielding. In all cases full consideration shall be given to sound engineering principles and economic... under the direct administration of the Federal Highway Administration (FHWA) Federal-aid highway...

  7. May2007 East African Medical Journal 207

    African Journals Online (AJOL)

    2007-05-01

    May 1, 2007 ... MD, Senior Lecturer, Department of Human Pathology, College of Health Sciences, University of Nairobi, P.O. Box. 19676-00202, Nairobi, Kenya. Request for reprints to: Prof. J.C. Mukuria, Department of Biochemistry, College of Health Sciences, University of. Nairobi, P.O. Box 30197-00100, Nairobi, ...

  8. 7 CFR 1951.207 - State supplements.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS...) PROGRAM REGULATIONS (CONTINUED) SERVICING AND COLLECTIONS Servicing of Community and Direct Business... (available in any FmHA or its successor agency under Public Law 103-354 office) and applicable State laws and...

  9. 19 CFR 207.65 - Prehearing briefs.

    Science.gov (United States)

    2010-04-01

    ... WHETHER INJURY TO DOMESTIC INDUSTRIES RESULTS FROM IMPORTS SOLD AT LESS THAN FAIR VALUE OR FROM SUBSIDIZED... review may submit a prehearing brief to the Commission on the date specified in the scheduling notice. A...

  10. 19 CFR 207.25 - Posthearing briefs.

    Science.gov (United States)

    2010-04-01

    ... WHETHER INJURY TO DOMESTIC INDUSTRIES RESULTS FROM IMPORTS SOLD AT LESS THAN FAIR VALUE OR FROM SUBSIDIZED... the Secretary within a time specified in the notice of scheduling or by the presiding official at the...

  11. 19 CFR 207.66 - Hearing.

    Science.gov (United States)

    2010-04-01

    ... INJURY TO DOMESTIC INDUSTRIES RESULTS FROM IMPORTS SOLD AT LESS THAN FAIR VALUE OR FROM SUBSIDIZED... a hearing in each full review. The date of the hearing shall be specified in the scheduling notice...

  12. 19 CFR 207.23 - Prehearing brief.

    Science.gov (United States)

    2010-04-01

    ... WHETHER INJURY TO DOMESTIC INDUSTRIES RESULTS FROM IMPORTS SOLD AT LESS THAN FAIR VALUE OR FROM SUBSIDIZED... days prior to the date of the hearing specified in the notice of scheduling, a prehearing brief...

  13. 47 CFR 20.7 - Mobile services.

    Science.gov (United States)

    2010-10-01

    ... fixed services such as call box operations and meter reading; (c) Mobile satellite services (part 25 of... meeting the definition of commercial mobile radio service in § 20.3, such as the resale of commercial...

  14. 44 CFR 207.2 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... at § 206.434(d) of this chapter for HMGP. Project Worksheet (PW) refers to FEMA Form 90-91, or any...) of this part. Chief Financial Officer (CFO) is the Chief Financial Officer of FEMA, or his/her... declaration. HMGP project narrative refers to the request submitted for HMGP funding. Indian tribal government...

  15. 77 FR 207 - National Mentoring Month, 2012

    Science.gov (United States)

    2012-01-03

    ... next generation, and we recommit to expanding mentorship opportunities across our country. At school... with a mentor. Last January, we partnered with businesses across America to launch the Corporate... with positive role models, foster leadership skills, and put them on the path to success in school and...

  16. 48 CFR 207.171-3 - Policy.

    Science.gov (United States)

    2010-10-01

    ... break out components of weapons systems or other major end items under certain circumstances. (a) When...) Breakout action will not jeopardize the quality, reliability, performance, or timely delivery of the end... will result from— (1) Greater quantity acquisitions; or (2) Such factors as improved logistics support...

  17. 14 CFR 67.207 - Mental.

    Science.gov (United States)

    2010-01-01

    ... any of the following: (1) A personality disorder that is severe enough to have repeatedly manifested... in which: (i) The individual has manifested delusions, hallucinations, grossly bizarre or disorganized behavior, or other commonly accepted symptoms of this condition; or (ii) The individual may...

  18. Publications | Page 207 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Kebijakan kawasan tanpa rokok : peluang dan hambatan (restricted access). Background: Currently, there are 1.2 billion smokers in the world, 80 percent of whom live in low-income countries and medium. Without prevention efforts in reducing cigarette consumption, the WHO predicts in 2025 the number of smokers will ...

  19. Publications | Page 207 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... semiarid regions of Argentina (restricted access). This analysis includes appropriate technologies as well as the characteristics specific to rural communities that will allow for successful implementation of renewable energy technologies (RETs). The degree of socioeconomic development, organizational and training level, ...

  20. Publications | Page 207 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Global Entrepreneurship Monitor 2011 : Jamaica report (restricted access) ... Indeed, much status is accorded to successful Jamaican entrepreneurs. ... The content and materials in this teaching manual grew out of four years of collaborative teaching of a graduate short-course in ecosystem approaches to health by the ...

  1. 29 CFR 1603.207 - Intervention.

    Science.gov (United States)

    2010-07-01

    ... STATE AND LOCAL GOVERNMENT EMPLOYEE COMPLAINTS OF EMPLOYMENT DISCRIMINATION UNDER SECTION 304 OF THE... permitted to intervene. (c) Any party may file a response to a motion to intervene within 15 days after the...

  2. 50 CFR 223.207 - Approved TEDs.

    Science.gov (United States)

    2010-10-01

    ... to this part). (4) Space between bars. The space between deflector bars and the deflector bars and... water, expressed in grams or kilograms, and must include the metric unit of measure. The marking may..., expressed in grams or kilograms, and must include the metric unit of measure. The marking may additionally...

  3. 49 CFR 372.207 - Charleston, WV.

    Science.gov (United States)

    2010-10-01

    ... commercially a part of Charleston, W. Va., within which transportation by motor vehicle in interstate or... Transportation Other Regulations Relating to Transportation (Continued) FEDERAL MOTOR CARRIER SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION FEDERAL MOTOR CARRIER SAFETY REGULATIONS EXEMPTIONS, COMMERCIAL...

  4. Publications | Page 207 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Even those who consider themselves experts on IP will benefit immensely from this book and the broader ACA2K project's work. — Sisule Musungu, President of IQsensato, Geneva. The emergence of the Internet and the digital world has changed the way people access, produce and share... Knowledge to Policy: Making ...

  5. 48 CFR 212.207 - Contract type.

    Science.gov (United States)

    2010-10-01

    ... OF DEFENSE ACQUISITION PLANNING ACQUISITION OF COMMERCIAL ITEMS Special Requirements for the... Defense Authorization Act for Fiscal Year 2008 (Pub. L. 110-181), use of time-and-materials and labor-hour... through use of time-and-materials or labor-hour contracts; and (D) The use of a time-and-materials or...

  6. No. 207-Genital Herpes: Gynaecological Aspects.

    Science.gov (United States)

    Money, Deborah; Steben, Marc

    2017-07-01

    The purpose of this guideline is to provide recommendations to gynaecology health care providers on optimal management of genital herpes. More effective prevention of complications and transmission of genital herpes. Medline was searched for articles published in French and English related to genital herpes and gynaecology. Additional articles were identified through the references of these articles. All study types and recommendation reports were reviewed. Copyright © 2017. Published by Elsevier Inc.

  7. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  8. U/Pb (SHRIMP), {sup 207}Pb/{sup 206}Pb, Rb/Sr, Sm/Nd e K/Ar geochronology of granite-greenstone terrains of Gaviao Block: implications for the Proterozoic and Archean evolution of Sao Francisco Craton, Brazil; Geocronologia U/Pb (SHRIMP), {sup 207}Pb/{sup 206}Pb, Rb/Sr, Sm/Nd e K/Ar dos terrenos granito-greenstone do Bloco do Gaviao: implicacoes para a evolucao arqueana e proterozoica do craton do Sao Francisco, Brasil

    Energy Technology Data Exchange (ETDEWEB)

    Leal, Luiz Rogerio Bastos

    1998-07-01

    The Gaviao Block (GB) in the northern portion of the Sao Francisco Craton-Northeast of Brazil, constitutes one of the oldest Archean fragments of the South American Platform Archean crust. GB underwent several events of juvenile accretion and reworking of continental crust along its evolutionary history, notably between the Archean and the Paleoproterozoic. {sup 207}Pb/{sup 206}Pb isotopic analyses were carried out in two zircons populations from strongly migmatized TTG terranes found in the proximity of Brumado: the first population (7 crystals) is taken as representative of the crystallization period of the TTG terranes at 3300 {+-} 45 Ma; the second (2 crystals) represents the age of the first even of metamorphism/migmatization at 2910 {+-} 10 Ma. {sup 207} Pb/{sup 206} Pb analyses in zircons from an outcrop of non-migmatized TTG in the area yielded a 3202 {+-} 15 Ma age (4 crystals), interpreted to be the crystallization period of the gneiss protolith. Sm/Nd analyses on the TTG rocks of the Brumado region yielded T{sub DM} model ages varying between 3.26 and 3.36 Ga and {epsilon}{sub Nd}{sup (t)} between -3.5 and +0.7. These data suggest the occurrence of juvenile accretions to the continental crust during the Archean, with differential involvement of crustal materials. The geochemical data of rare earth elements corresponding to the TTG terranes revealed moderate LRRE contents (La{sub N}=83,5), low HREE contents (La{sub N}=2,5) and a fairly fractionated pattern (La/Yb){sub N}=34, besides lack of negative Eu anomaly, showing that these rocks have similar compositions to those TTG terranes of cratonic continents, as well as some Archean rocks from CSF (e.g. Sete Voltas, Boa Vista). Finally, the youngest ages present in GB rocks (ca. 1.2-0.45 Ga) represent the role played by tectono thermal events, which produced partial or total rejuvenation of the Rb/Sr and K/Ar isotopic systems during the Espinhaco and Brasiliano cycles. In particular, K/Ar ages illustrate the

  9. Discussion of 'Geomorphology, internal structure, and successive development of a glacier foreland in the semiarid Chilean Andes (Cerro Tapado, upper Elqui Valley, 30°08‧ S, 69°55‧ W.)', by S. Monnier, C. Kinnard, A. Surazakov and W. Bossy, Geomorphology 207 (2014), 126-140

    Science.gov (United States)

    Nobes, David C.

    2015-12-01

    Recently, Monnier et al. (2014, Geomorphology 207, 126-140) suggested that diffraction events with air-wave velocities along profile CD were caused by an air-filled void at depth within one of the glaciers of the Cerro Tapado, Chile. This is not physically possible. The velocity at which radar travels to and from the scattering feature that causes a diffraction is at the velocity that surrounds and overlies the scatterer. Thus, their air-wave velocity features are on the surface of the glacier, not at depth. Their three-layer model for profile CD, therefore, is more appropriately a two-layer model, with a lower density layer, with more air and debris, overlying a denser layer, likely corresponding to the firn-ice transition. In addition, they carried out common mid-point (CMP) velocity profiles. While it is encouraging that they have made such an attempt, the results will be affected significantly by the surface and subsurface topography, truncated beds, unconformities, etc., because CMP profiles inherently assume flat-lying surface and subsurface boundaries. The CMP results, while useful, must therefore be treated with caution and assumed to be highly inaccurate and only be used as general guides to vertical velocity variations.

  10. Dicty_cDB: AFI207 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 101350.1 Vorticella microstoma alpha-tubulin gene, partial cds. 86 4e-64 11 X12365 |X12365.1 Stylonychia lem...e-75 9 X81049 |X81049.1 N.gruberi mRNA for alpha-tubulin. 92 4e-74 8 AY101350 |AY

  11. Dicty_cDB: SFJ207 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available QQQQQQQQQQ QQEKEKEEEEEVNLRYTLKDLEREIEEERKREEAEEAEVYEDDDQEDDLDIEEEELDELD DIEKTKEEIDDIIKSPPQPTSSSLSTSSSSSSTTLKDKNK...QQQQQQQQQQ QQEKEKEEEEEVNLRYTLKDLEREIEEERKREEAEEAEVYEDDDQEDDLDIEEEELDELD DIEKTKEEIDDIIKSPPQPTSSSLSTSSSSSSTTLKDKNK

  12. All projects related to | Page 207 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Centre for Global Development Visiting Fellowship Program. Project. The Center for Global Development (CGD), located in Washington DC, is a globally preeminent think tank with unique networking and reach. Topic: LOW INCOME GROUPS, MIDDLE CLASS, RESEARCH NETWORKS, RESEARCH CENTRES, Capacity ...

  13. 24 CFR 207.256a - Reinstatement of defaulted mortgage.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Reinstatement of defaulted mortgage... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MULTIFAMILY HOUSING MORTGAGE INSURANCE Contract Rights and Obligations Rights and Duties of...

  14. MO-AB-207-02: ACR Update in MR

    Energy Technology Data Exchange (ETDEWEB)

    Price, R. [Vanderbilt Medical Center (United States)

    2015-06-15

    A goal of an imaging accreditation program is to ensure adequate image quality, verify appropriate staff qualifications, and to assure patient and personnel safety. Currently, more than 35,000 facilities in 10 modalities have been accredited by the American College of Radiology (ACR), making the ACR program one of the most prolific accreditation options in the U.S. In addition, ACR is one of the accepted accreditations required by some state laws, CMS/MIPPA insurance and others. Familiarity with the ACR accreditation process is therefore essential to clinical diagnostic medical physicists. Maintaining sufficient knowledge of the ACR program must include keeping up-to-date as the various modality requirements are refined to better serve the goals of the program and to accommodate newer technologies and practices. This session consists of presentations from authorities in four ACR accreditation modality programs, including magnetic resonance imaging, computed tomography, nuclear medicine, and mammography. Each speaker will discuss the general components of the modality program and address any recent changes to the requirements. Learning Objectives: To understand the requirements of the ACR MR Accreditation program. The discussion will include accreditation of whole-body general purpose magnets, dedicated extremity systems well as breast MRI accreditation. Anticipated updates to the ACR MRI Quality Control Manual will also be reviewed. To understand the requirements of the ACR CT accreditation program, including updates to the QC manual as well as updates through the FAQ process. To understand the requirements of the ACR nuclear medicine accreditation program, and the role of the physicist in annual equipment surveys and the set up and supervision of the routine QC program. To understand the current ACR MAP Accreditation requirement and present the concepts and structure of the forthcoming ACR Digital Mammography QC Manual and Program.

  15. MO-AB-207-01: ACR Update in CT

    Energy Technology Data Exchange (ETDEWEB)

    McNitt-Gray, M. [UCLA School of Medicine (United States)

    2015-06-15

    A goal of an imaging accreditation program is to ensure adequate image quality, verify appropriate staff qualifications, and to assure patient and personnel safety. Currently, more than 35,000 facilities in 10 modalities have been accredited by the American College of Radiology (ACR), making the ACR program one of the most prolific accreditation options in the U.S. In addition, ACR is one of the accepted accreditations required by some state laws, CMS/MIPPA insurance and others. Familiarity with the ACR accreditation process is therefore essential to clinical diagnostic medical physicists. Maintaining sufficient knowledge of the ACR program must include keeping up-to-date as the various modality requirements are refined to better serve the goals of the program and to accommodate newer technologies and practices. This session consists of presentations from authorities in four ACR accreditation modality programs, including magnetic resonance imaging, computed tomography, nuclear medicine, and mammography. Each speaker will discuss the general components of the modality program and address any recent changes to the requirements. Learning Objectives: To understand the requirements of the ACR MR Accreditation program. The discussion will include accreditation of whole-body general purpose magnets, dedicated extremity systems well as breast MRI accreditation. Anticipated updates to the ACR MRI Quality Control Manual will also be reviewed. To understand the requirements of the ACR CT accreditation program, including updates to the QC manual as well as updates through the FAQ process. To understand the requirements of the ACR nuclear medicine accreditation program, and the role of the physicist in annual equipment surveys and the set up and supervision of the routine QC program. To understand the current ACR MAP Accreditation requirement and present the concepts and structure of the forthcoming ACR Digital Mammography QC Manual and Program.

  16. 19 CFR 207.67 - Posthearing briefs and statements.

    Science.gov (United States)

    2010-04-01

    ... INVESTIGATIONS OF WHETHER INJURY TO DOMESTIC INDUSTRIES RESULTS FROM IMPORTS SOLD AT LESS THAN FAIR VALUE OR FROM... concerning the information adduced at or after the hearing within a time specified in the scheduling notice...

  17. 44 CFR 207.9 - Declarations before November 13, 2007.

    Science.gov (United States)

    2010-10-01

    ... form or HMGP project narrative, respectively, whichever is sooner. (2) For emergency declarations, FEMA..., 2007. (a) General. This section describes how FEMA provides administrative and management cost funding... categories as follows: (1) Grantee. (i) Statutory administrative costs. FEMA may provide funds to the grantee...

  18. 44 CFR 206.207 - Administrative and audit requirements.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF HOMELAND SECURITY DISASTER ASSISTANCE FEDERAL DISASTER ASSISTANCE Public Assistance Project... procedures, program eligibility guidance and program deadlines; (C) Assisting FEMA in determining applicant eligibility; (D) Participating with FEMA in conducting damage surveys to serve as a basis for obligations of...

  19. 49 CFR 1544.207 - Screening of individuals and property.

    Science.gov (United States)

    2010-10-01

    ... SECURITY ADMINISTRATION, DEPARTMENT OF HOMELAND SECURITY CIVIL AVIATION SECURITY AIRCRAFT OPERATOR SECURITY... conducting screening. Each aircraft operator must use the measures in its security program and in subpart E...

  20. RCT: Module 2.07, Respiratory Protection, Course 8773

    Energy Technology Data Exchange (ETDEWEB)

    Hillmer, Kurt T. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-08-10

    Internal dosimetry controls require the use of engineering controls to prevent the internal deposition of radioactive and nonradiological contaminants. However, when engineering and administrative controls are not available or feasible, respiratory protection may be necessary. The radiation control technician (RCT) should know and apply the considerations used in determining the respiratory protection equipment that is most appropriate for the job. The inappropriate use of or the use of the wrong respiratory protection equipment may result in undesirable health effects. This course will prepare the student with the skills necessary for RCT qualification by passing quizzes, tests, and the RCT Comprehensive Phase 1, Unit 2 Examination (TEST 27566) and will provide in-the-field skills.

  1. 14 CFR 16.207 - Intervention and other participation.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Intervention and other participation. 16... Intervention and other participation. (a) A person may submit a motion for leave to intervene as a party... after the notice of hearing and hearing order. (b) If the hearing officer finds that intervention will...

  2. 40 CFR 180.207 - Trifluralin; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ..., field, grain 0.05 Corn, field, stover 0.05 Cotton, gin byproducts 0.05 Cotton, undelinted seed 0.05 Endive 0.05 Flax, seed 0.05 Fruit, citrus, group 10 0.05 Fruit, stone, group 12 0.05 Grape 0.05 Hop... Peppermint, oil 2.0 Peppermint, tops 0.05 Rapeseed, seed 0.05 Safflower, seed 0.05 Sorghum, grain, forage 0...

  3. 42 CFR 408.207 - Billing and payment procedures.

    Science.gov (United States)

    2010-10-01

    ... terminates, or the month of the enrollee's death, whichever comes first. (b) Payment and grace period... be transmitted as often as once a day. (2) CMS will not add or remove enrollees retroactively, except for removals upon the death of an enrollee. (3) The State or local government agency must pay the SMI...

  4. 48 CFR 207.106 - Additional requirements for major systems.

    Science.gov (United States)

    2010-10-01

    ... analysis of the total value, in terms of innovative design, life-cycle costs, and other pertinent factors... performance-based logistics arrangements as well as to weapon systems and subsystems that are to be supported... include, but are not limited to, cost-effective measures intended to achieve the following: (i...

  5. 40 CFR 6.207 - Environmental impact statements.

    Science.gov (United States)

    2010-07-01

    ... distribution of population including altering the character of existing residential areas. (4) An EIS must be... with a population greater than 100,000. (ii) Expansions of existing wastewater treatment facilities... as wetlands, significant agricultural lands, aquifer recharge zones, coastal zones, barrier islands...

  6. 38 CFR 3.207 - Void or annulled marriage.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Void or annulled marriage... Void or annulled marriage. Proof that a marriage was void or has been annulled should consist of: (a... marriage void, together with such other evidence as may be required for a determination. (b) Annulled. A...

  7. Dicty_cDB: SSE207 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GFYYINQAGRNARFHLDEFIYNSL YGNNSYEYATNSTLACASNMATYMCSYTFVGTTPPCNALW*xhvqmdllmevklfhlhlf qtvnxkvqvhpdcsainmkglm...LAEEYIVRDVVGGFYYINQAGRNARFHLDEFIYNSL YGNNSYEYATNSTLACASNMATYMCSYTFVGTTPPCNALW*xhvqmdllmevklfhlhlf qtvnxkvqvhpdc

  8. Dicty_cDB: SHI207 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available f query: 148 length of database: 80,480,566 effective HSP length: 17 effective length of query: 131 effective... length of database: 78,821,179 effective search space: 10325574449 effective se...er of sequences better than 10.0: 0 length of query: 148 length of database: 61,296,806,322 effective HSP length: 22 effective... length of query: 126 effective length of database: 60,048,944,916 effective search space: 7566167059416 effective

  9. 24 CFR 983.207 - Condition of contract units.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Condition of contract units. 983... Condition of contract units. (a) Owner maintenance and operation. (1) The owner must maintain and operate the contract units and premises in accordance with the HQS, including performance of ordinary and...

  10. TU-EF-207-00: Advances in Breast Imaging

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2015-06-15

    Breast imaging technology is advancing on several fronts. In digital mammography, the major technological trend has been on optimization of approaches for performing combined mammography and tomosynthesis using the same system. In parallel, photon-counting slot-scan mammography is now in clinical use and more efforts are directed towards further development of this approach for spectral imaging. Spectral imaging refers to simultaneous acquisition of two or more energy-windowed images. Depending on the detector and associated electronics, there are a number of ways this can be accomplished. Spectral mammography using photon-counting detectors can suppress electronic noise and importantly, it enables decomposition of the image into various material compositions of interest facilitating quantitative imaging. Spectral imaging can be particularly important in intravenously injected contrast mammography and eventually tomosynthesis. The various approaches and applications of spectral mammography are discussed. Digital breast tomosynthesis relies on the mechanical movement of the x-ray tube to acquire a number of projections in a predefined arc, typically from 9 to 25 projections over a scan angle of +/−7.5 to 25 degrees depending on the particular system. The mechanical x-ray tube motion requires relatively long acquisition time, typically between 3.7 to 25 seconds depending on the system. Moreover, mechanical scanning may have an effect on the spatial resolution due to internal x-ray filament or external mechanical vibrations. New x-ray source arrays have been developed and they are aimed at replacing the scanned x-ray tube for improved acquisition time and potentially for higher spatial resolution. The potential advantages and challenges of this approach are described. Combination of digital mammography and tomosynthesis in a single system places increased demands on certain functional aspects of the detector and overall performance, particularly in the tomosynthesis mode due to lower photon fluence per projection. This may require fast-frame acquisition and symmetric or asymmetric pixel binning in some systems. Recent studies investigated the performance of increased conversion layer thickness for contrast-enhanced imaging of the breast in dual-energy acquisition mode. In other direct conversion detectors operating in the avalanche mode, sensitivities close to the single photon response are also explored for mammography and breast tomosynthesis. The potential advantages and challenges of this approach are described. Dedicated breast CT brings x-ray imaging of the breast to true tomographic 3D imaging. It can eliminate the tissue superposition problem and does not require physical compression of the breast. Using cone beam geometry and a flat-panel detector, several hundred projections are acquired and reconstructed to near isotropic voxels. Multiplanar reconstruction facilitates viewing the breast volume in any desired orientation. Ongoing clinical studies, the current state-of-the art, and research to advance the technology are described. Learning Objectives: To understand the ongoing developments in x-ray imaging of the breast To understand the approaches and applications of spectral mammography To understand the potential advantages of distributed x-ray source arrays for digital breast tomosynthesis To understand the ongoing developments in detector technology for digital mammography and breast tomosynthesis To understand the current state-of-the-art for dedicated cone-beam breast CT and research to advance the technology. Research collaboration with Koning Corporation.

  11. Dicty_cDB: VFO207 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 598422. 1197 0.0 1 ( BD092935 ) Methods and compositions for synthesis of long ch... 1197 0.0 1 ( BD082645 ) Methods and composition...s for synthesis of long ch... 1197 0.0 1 ( BD082630 ) Methods and composition

  12. 207 series solution for the complete golden dynamical equation of ...

    African Journals Online (AJOL)

    DR. AMINU

    ABSTRACTS. In a paper (Howusu, 2004) the complete Golden Dynamical Equation of motion for photon in the gravitational field of a massive body was published. In this paper the series method is used to solve this equation for comparison with the solutions of Einstein Equation for the photon in the same gravitational field.

  13. Translating cultural transition in Kgebetli Moele’s Room 207

    Directory of Open Access Journals (Sweden)

    S.S. Ibinga

    2010-07-01

    Full Text Available This article deals with the issue of cultural translation in a postapartheid text through the analysis of language, setting and discourse to highlight cultural transition in a society where socio-political mutations elicit new literary codes and symbols. The discussion is developed around concepts such as gender and ethnic identity or citizenship in a geographical environment where multi- and transcultural identities are endlessly being contested. The concept of translation is explored to show how Moele’s text represents cultural transition within a postapartheid urban context by analysing the authorial transposition of everyday experience into the textual fabric. The article also examines how the narrative voice negotiates across the current multicultural divide in order to highlight cultural change both in South African literature and in society as a whole. This article addresses in the discussion the controversial debate raised by Michael Titlestad’s (2007 review of the book published in the “Sunday times” on 25 March in which the critic evinces a negative reception of the book. This is used as a point of departure in order to explore a wide range of possibilities that fiction can offer by means of textual representation of the daily experience of black people in a postapartheid urban context.

  14. 48 CFR 415.207 - Handling proposals and information.

    Science.gov (United States)

    2010-10-01

    ... CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Solicitation and Receipt of Proposals and... Proposals RFP Offeror 1. To the best of my knowledge and belief, no conflict of interest exists that may... otherwise result in a biased opinion or an unfair advantage. If a potential conflict of interest arises or...

  15. 48 CFR 1415.207-71 - Confidentiality of proposal evaluation.

    Science.gov (United States)

    2010-10-01

    ... THE INTERIOR CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Solicitation and... evaluators and advisors shall sign a Conflict of Interest Certificate and a Confidentiality Certificate in a... outside the Government shall take into consideration requirements for avoiding individual conflicts of...

  16. Dicty_cDB: SLC207 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VAAKISDSDKSTIESETESVLKWLESNQTAEK DEYEDKMKALEAVVNPIMSKLYQEGGMPQGGGMPGGMSNDSPKSSNNKVDELD*rnfsee nisik*...VAAKISDSDKSTIESETESVLKWLESNQTAEK DEYEDKMKALEAVVNPIMSKLYQEGGMPQGGGMPGGMSNDSPKSSNNKVDELD*rnfsee nisik*

  17. 46 CFR 502.207 - Requests for admission.

    Science.gov (United States)

    2010-10-01

    ... may apply to the presiding officer for an order requiring the other party to pay the reasonable... paragraph (a) of this section, or (2) The admission sought was of no substantial importance, or (3) The...

  18. 23 CFR 650.207 - Plans, specifications and estimates.

    Science.gov (United States)

    2010-04-01

    ... highway project designs for the control of erosion and sedimentation and the protection of water quality... OPERATIONS BRIDGES, STRUCTURES, AND HYDRAULICS Erosion and Sediment Control on Highway Construction Projects...

  19. Dicty_cDB: VHQ207 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rvetltnhlcsssnesfyl ssnntdaslrelviraqaqrnarntktlkgleemktlvgkeigtseyfkitqdrvnsfae stgdfqwihidperaksespfggpiah...etltnhlcsssnesfyl ssnntdaslrelviraqaqrnarntktlkgleemktlvgkeigtseyfkitqdrvnsfae st

  20. WE-A-207-01: Memorial Lecturer

    Energy Technology Data Exchange (ETDEWEB)

    Muller-Runkel, R [St. Margaret Mercy Healthcare Centers, Hammond, IN (United States)

    2015-06-15

    The Medical Physics community lost one of its early pioneers in radiation oncology physics, Jacques Ovadia, who passed away in April of 2014 at the age of 90. Jacques received his Ph.D. in Nuclear Physics from the University of Illinois at Urbana in 1951. Subsequently, under the guidance of John Laughlin, he was introduced to the field of Medical Physics. When John moved to Memorial Sloan Kettering, Jacques followed him. There he gained clinical experience and expertise in the then cutting-edge field of high energy electron beam therapy. In 1956, Jacques joined Dr. Erich Uhlmann at Michael Reese Hospital in Chicago where one of the country’s first high energy medical linear accelerators had just been installed. During his 35 year tenure, Dr. Ovadia built a strong Medical Physics department that merged in 1984 with that of the University of Chicago. Jacques pioneered the use of high energy electron beams to treat deep seated tumors, multiple-field chest wall irradiation with variable electron energies, and even anticipated the current interest in high energy electron beam grid-therapy. At an early stage, he introduced a simulator, computerized treatment planning and in-house developed record and verify software. He retired in 1990 as Professor emeritus in Radiation and Cellular Biology at the University of Chicago. Dr. Ovadia was an early and strong supporter of AAPM. He was present at the Chicago ROMPS meeting where the decision was made to form an independent professional society for medical physics. He served as AAPM president in 1976. Jacques Ovadia is survived by his wife of 58 years, Florence, their daughter Corinne Graefe and son Marc Ovadia, MD, as well as four grandchildren and one great-grandchild. Jacques’ dynamic and ever enthusiastic personality inspired all who collaborated with him. He will be greatly missed.

  1. Dicty_cDB: VHJ207 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NDPTRXSDNXLPYKLVQHTHELEVSHQLGSPXYFMPHVGQFFQGITLTISMELKYPMTKE QVVERYQKFYQNEPLIKIDKDGIPEVKSNSGKHTVT Translated Amino...NDPTRXSDNXLPYKLVQHTHELEVSHQLGSPXYFMPHVGQFFQGITLTISMELKYPMTKE QVVERYQKFYQNEPLIKIDKDGIPEVKSNSGKHTVT Frame C: ---rnqs

  2. 207 EFFECTS OF HOT AND COLD WATER PRE- TREATMENTS ...

    African Journals Online (AJOL)

    no significant difference in the number of seeds that emerged from the cold water treatment (á = 0.05), while treatment with hot water showed significant differences among the treatment times. (á =0.05). Treatment of a. senegal seeds with hot water for 10 minutes gave the highest number of emerged seeds (mean, 7.50) ...

  3. 41 CFR 101-39.207 - Reimbursement for services.

    Science.gov (United States)

    2010-07-01

    ... VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.2-GSA Interagency Fleet Management System Services... using agency will be billed for GSA Interagency Fleet Management System (IFMS) services provided for... from a GSA Maintenance Control Center, or approval from a GSA fleet management center, per instructions...

  4. 48 CFR 207.170-3 - Policy and procedures.

    Science.gov (United States)

    2010-10-01

    ... $6 million unless the acquisition strategy includes— (1) The results of market research; (2) Identification of any alternative contracting approaches that would involve a lesser degree of consolidation; and... justified if the benefits of the acquisition strategy substantially exceed the benefits of each of the...

  5. 33 CFR 207.460 - Fox River, Wis.

    Science.gov (United States)

    2010-07-01

    ... secured. (17) Neenah dam outlet works. (i) During periods of high water, when determined to be necessary... regulate the passage of water through said outlet works. (ii) The outlet works of said dam shall be opened... use great care not to strike any part of the locks or sluice walls, or any gate or appurtenance...

  6. 33 CFR 207.750 - Puget Sound Area, Wash.

    Science.gov (United States)

    2010-07-01

    ... States or the City of Seattle and passenger vessels operating on a regular schedule shall have precedence... structures. The sides and corners of all vessels and rafts passing through the locks should be free from... to entering lock. Tank barges with open hatch or hatches will be denied lockage. (viii) No smoking...

  7. 24 CFR 207.252 - First, second and third premiums.

    Science.gov (United States)

    2010-04-01

    ... one percent nor more than one percent as the Secretary shall determine of the original face amount of... premium equal to not less than one-fourth of one percent nor more than one percent as the Secretary shall... mortgagee shall pay a third premium equal to not less than one-fourth of one percent nor more than one...

  8. 47 CFR 73.207 - Minimum distance separation between stations.

    Science.gov (United States)

    2010-10-01

    ... kW ERP and 100 meters antenna HAAT (or equivalent lower ERP and higher antenna HAAT based on a class... which have been notified internationally as Class A are limited to a maximum of 3.0 kW ERP at 100 meters... internationally as Class AA are limited to a maximum of 6.0 kW ERP at 100 meters HAAT, or the equivalent; (iii) U...

  9. 47 CFR 90.207 - Types of emissions.

    Science.gov (United States)

    2010-10-01

    ... 25 MHz. (d) Except for Traveler's Information stations in the Public Safety Pool authorized in... stations in the Public Safety and Industrial/Business Pools utilizing digital voice modulation, in either...

  10. Dicty_cDB: VHB207 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Tetrahymena thermophila cDNA clone TT1C849, mRNA sequence. 68 1e-11 2 CF445056 |CF445056.1 EST681401 normalized cDNA library of onio...1 3 CF439652 |CF439652.1 EST675997 normalized cDNA library of onion Allium cepa cDNA clone ACAAS01, mRNA seq

  11. 207 EFFECTS OF HOT AND COLD WATER PRE- TREATMENTS ...

    African Journals Online (AJOL)

    temperature) for 8, 12 and 24 hours and hot water at 100 C for 5, 10 and 15 minutes . The research seeks to find the best pre germination time to be used for each of the two pre- treatments used in the experiment. Completely randomized design (CRD) of analysis of variance (ANOVA) was used in analysis of obtained data ...

  12. 29 CFR 20.7 - Review of the obligation.

    Science.gov (United States)

    2010-07-01

    ... the Secretary of Labor FEDERAL CLAIMS COLLECTION Disclosure of Information to Credit Reporting... information to be disclosed to a credit reporting agency is not accurate, timely, relevant or complete, such... delinquent consumer debt to a consumer credit reporting agency until such time as a final decision is made on...

  13. Dicty_cDB: CFF207 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hspfspqikrwyanfcqnphw*dyytrs*rf**h*ec*sqnprqrrystrsttshfrr*t iggwsysl*lqhskgihspfssqikrwyanfcknshw*nhytrs*r**qh*ecknknsrq...hspfspqikrwyanfcqnphw*dyytrs*rf**h*ec*sqnprqrrystrsttshfrr*t iggwsysl*lqhskgihspfssqikrwyanfcknshw*nhytrs*r**qh*ecknknsrq

  14. 48 CFR 5.207 - Preparation and transmittal of synopses.

    Science.gov (United States)

    2010-10-01

    ... Preparation and transmittal of synopses. (a) Content. Each synopsis transmitted to the GPE must address the... of manufacture. (6) Quantity, including any options for additional quantities. (7) Unit of issue. (8...) If the technical data required to respond to the solicitation will not be furnished as part of such...

  15. 47 CFR 80.207 - Classes of emission.

    Science.gov (United States)

    2010-10-01

    ... radiotelephone and radiotelegraph emissions by ship and coast stations includes the use of digital selective... uses another type of digital emission, it must comply with the emission mask requirements of § 90.210... Aids section of the printed volume and on GPO Access. ...

  16. المصطلح النحوي عند الفرّاء ت(207هـ)مصطلحات الجملة أنموذجا

    OpenAIRE

    ABDULLAH, Abdulhalim

    2014-01-01

    يقوم هذا البحث على تأصيل المصطلحالنحوي لدى الفراء ت: 207هـ ، نظرًا إلى أنه أول النحاة تصريحا بمصطلح الجملةوبمحليتها، وقد وقف البحث على المصطلحات التي استخدمها الفراء في الدلالة علىالجملة، وقسمتها إلى ثلاثة أقسام: 1. مصطلحاتدالة على الجملة وهي: مصطلح الجملة،  مصطلحالكلام، ومصطلح الفعل 2. مصطلحات دالة على المحل، وهي: مصطلحالموضع، ومصطلح المعنى، ومصطلح التأويل 3. مصطلحات دالة على أسماء الجمل، وهي: مصطلحا القول والحكاية (الجملةالمحكية)، ومصطلح الصلة (جملة الصلة وجملة الصفة)، ومصطلح القطع (جمل...

  17. TU-CD-207-11: Patient-Driven Automatic Exposure Control for Dedicated Breast CT

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez, A; Gazi, P [Biomedical Engineering Graduate Group, University of California Davis, Davis, CA (United States); Department of Radiology, UC Davis Medical Center, Sacramento, CA (United States); Seibert, J; Boone, J [Department of Radiology, UC Davis Medical Center, Sacramento, CA (United States); Department of Biomedical Engineering, University of California Davis, Davis, CA (United States)

    2015-06-15

    Purpose: To implement automatic exposure control (AEC) in dedicated breast CT (bCT) on a patient-specific basis using only the pre-scan scout views. Methods: Using a large cohort (N=153) of bCT data sets, the breast effective diameter (D) and width in orthogonal planes (Wa,Wb) were calculated from the reconstructed bCT image and pre-scan scout views, respectively. D, Wa, and Wb were measured at the breast center-of-mass (COM), making use of the known geometry of our bCT system. These data were then fit to a second-order polynomial “D=F(Wa,Wb)” in a least squares sense in order to provide a functional form for determining the breast diameter. The coefficient of determination (R{sup 2}) and mean percent error between the measured breast diameter and fit breast diameter were used to evaluate the overall robustness of the polynomial fit. Lastly, previously-reported bCT technique factors derived from Monte Carlo simulations were used to determine the tube current required for each breast diameter in order to match two-view mammographic dose levels. Results: F(Wa,Wb) provided fitted breast diameters in agreement with the measured breast diameters resulting in R{sup 2} values ranging from 0.908 to 0.929 and mean percent errors ranging from 3.2% to 3.7%. For all 153 bCT data sets used in this study, the fitted breast diameters ranged from 7.9 cm to 15.7 cm corresponding to tube current values ranging from 0.6 mA to 4.9 mA in order to deliver the same dose as two-view mammography in a 50% glandular breast with a 80 kV x-ray beam and 16.6 second scan time. Conclusion: The present work provides a robust framework for AEC in dedicated bCT using only the width measurements derived from the two orthogonal pre-scan scout views. Future work will investigate how these automatically chosen exposure levels affect the quality of the reconstructed image.

  18. 33 CFR 207.441 - St. Marys Falls Canal and Locks, Mich.; security.

    Science.gov (United States)

    2010-07-01

    ..., gasoline, crude oil or other flammable liquids in bulk, including vessels that are not certified gas free...) Restrictions on transit of vessels. The following classes of vessels will not be permitted to transit the U.S... material. Cleaning and gas freeing of tanks on all hazardous material cargo vessels (as defined in 49 CFR...

  19. 33 CFR 207.187 - Gulf Intracoastal Waterway, Tex.; special floodgate, lock and navigation regulations.

    Science.gov (United States)

    2010-07-01

    ... vessel to determine whether a safe passage can be effected, give due consideration to the vessel's power... Channels 12, 13, 14 and 16. Call letters for the floodgates are WUI 411 and for the locks are WUI 412. (ii... steel tower 85 feet high located on the northeast point of land at the Gulf Intracoastal Waterway...

  20. WE-D-207-00: CT Lung Cancer Screening and the Medical Physicist: Moving Forward

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2015-06-15

    In the United States, Lung Cancer is responsible for more cancer deaths than the next four cancers combined. In addition, the 5 year survival rate for lung cancer patients has not improved over the past 40 to 50 years. To combat this deadly disease, in 2002 the National Cancer Institute launched a very large Randomized Control Trial called the National Lung Screening Trial (NLST). This trial would randomize subjects who had substantial risk of lung cancer (due to age and smoking history) into either a Chest X-ray arm or a low dose CT arm. In November 2010, the National Cancer Institute announced that the NLST had demonstrated 20% fewer lung cancer deaths among those who were screened with low-dose CT than with chest X-ray. In December 2013, the US Preventive Services Task Force recommended the use of Lung Cancer Screening using low dose CT and a little over a year later (Feb. 2015), CMS announced that Medicare would also cover Lung Cancer Screening using low dose CT. Thus private and public insurers are required to provide Lung Cancer Screening programs using CT to the appropriate population(s). The purpose of this Symposium is to inform medical physicists and prepare them to support the implementation of Lung Screening programs. This Symposium will focus on the clinical aspects of lung cancer screening, requirements of a screening registry for systematically capturing and tracking screening patients and results (such as required Medicare data elements) as well as the role of the medical physicist in screening programs, including the development of low dose CT screening protocols. Learning Objectives: To understand the clinical basis and clinical components of a lung cancer screening program, including eligibility criteria and other requirements. To understand the data collection requirements, workflow, and informatics infrastructure needed to support the tracking and reporting components of a screening program. To understand the role of the medical physicist in implementing Lung Cancer Screening protocols for CT, including utilizing resources such as the AAPM Protocols and the ACR Designated Lung Screening Center program. UCLA Department of Radiology has an Institutional research agreement with Siemens Healthcare; Dr. McNitt-Gray has been a recipient of Research Support from Siemens Healthcare in the past. Dr. Aberle has been a Member of Advisory Boards for the LUNGevity Foundation (2011-present) and Siemens Medical Solutions. (2013)

  1. WE-D-207-01: Background and Clinical Implementation of a Screening Program

    Energy Technology Data Exchange (ETDEWEB)

    Aberle, D. [UCLA, Los Angeles, CA (United States)

    2015-06-15

    In the United States, Lung Cancer is responsible for more cancer deaths than the next four cancers combined. In addition, the 5 year survival rate for lung cancer patients has not improved over the past 40 to 50 years. To combat this deadly disease, in 2002 the National Cancer Institute launched a very large Randomized Control Trial called the National Lung Screening Trial (NLST). This trial would randomize subjects who had substantial risk of lung cancer (due to age and smoking history) into either a Chest X-ray arm or a low dose CT arm. In November 2010, the National Cancer Institute announced that the NLST had demonstrated 20% fewer lung cancer deaths among those who were screened with low-dose CT than with chest X-ray. In December 2013, the US Preventive Services Task Force recommended the use of Lung Cancer Screening using low dose CT and a little over a year later (Feb. 2015), CMS announced that Medicare would also cover Lung Cancer Screening using low dose CT. Thus private and public insurers are required to provide Lung Cancer Screening programs using CT to the appropriate population(s). The purpose of this Symposium is to inform medical physicists and prepare them to support the implementation of Lung Screening programs. This Symposium will focus on the clinical aspects of lung cancer screening, requirements of a screening registry for systematically capturing and tracking screening patients and results (such as required Medicare data elements) as well as the role of the medical physicist in screening programs, including the development of low dose CT screening protocols. Learning Objectives: To understand the clinical basis and clinical components of a lung cancer screening program, including eligibility criteria and other requirements. To understand the data collection requirements, workflow, and informatics infrastructure needed to support the tracking and reporting components of a screening program. To understand the role of the medical physicist in implementing Lung Cancer Screening protocols for CT, including utilizing resources such as the AAPM Protocols and the ACR Designated Lung Screening Center program. UCLA Department of Radiology has an Institutional research agreement with Siemens Healthcare; Dr. McNitt-Gray has been a recipient of Research Support from Siemens Healthcare in the past. Dr. Aberle has been a Member of Advisory Boards for the LUNGevity Foundation (2011-present) and Siemens Medical Solutions. (2013)

  2. WE-D-207-02: Capturing Data Elements and the Role of Imaging Informatics

    Energy Technology Data Exchange (ETDEWEB)

    Hsu, W. [University of California, Los Angeles (United States)

    2015-06-15

    In the United States, Lung Cancer is responsible for more cancer deaths than the next four cancers combined. In addition, the 5 year survival rate for lung cancer patients has not improved over the past 40 to 50 years. To combat this deadly disease, in 2002 the National Cancer Institute launched a very large Randomized Control Trial called the National Lung Screening Trial (NLST). This trial would randomize subjects who had substantial risk of lung cancer (due to age and smoking history) into either a Chest X-ray arm or a low dose CT arm. In November 2010, the National Cancer Institute announced that the NLST had demonstrated 20% fewer lung cancer deaths among those who were screened with low-dose CT than with chest X-ray. In December 2013, the US Preventive Services Task Force recommended the use of Lung Cancer Screening using low dose CT and a little over a year later (Feb. 2015), CMS announced that Medicare would also cover Lung Cancer Screening using low dose CT. Thus private and public insurers are required to provide Lung Cancer Screening programs using CT to the appropriate population(s). The purpose of this Symposium is to inform medical physicists and prepare them to support the implementation of Lung Screening programs. This Symposium will focus on the clinical aspects of lung cancer screening, requirements of a screening registry for systematically capturing and tracking screening patients and results (such as required Medicare data elements) as well as the role of the medical physicist in screening programs, including the development of low dose CT screening protocols. Learning Objectives: To understand the clinical basis and clinical components of a lung cancer screening program, including eligibility criteria and other requirements. To understand the data collection requirements, workflow, and informatics infrastructure needed to support the tracking and reporting components of a screening program. To understand the role of the medical physicist in implementing Lung Cancer Screening protocols for CT, including utilizing resources such as the AAPM Protocols and the ACR Designated Lung Screening Center program. UCLA Department of Radiology has an Institutional research agreement with Siemens Healthcare; Dr. McNitt-Gray has been a recipient of Research Support from Siemens Healthcare in the past. Dr. Aberle has been a Member of Advisory Boards for the LUNGevity Foundation (2011-present) and Siemens Medical Solutions. (2013)

  3. Graduate Student Report: First-Year Physics and Astronomy Students, 2004. R-207.35

    Science.gov (United States)

    Mulvey, Patrick J.; Tesfaye, Casey Langer

    2006-01-01

    This report will document the changes in the number and citizenship of incoming graduate physics and astronomy students. It will provide student characteristics, such as gender, age, and the type of program in which they are enrolled. It will also discuss the educational backgrounds of the incoming students, highlighting differences between US and…

  4. Afl. .i Yi'éld. CAM(2.0()7)

    African Journals Online (AJOL)

    Cdte d'Ivoire, bLaboratoire dc Botanique, UFR Bioscicnces. Université de Cocody, 22 B. P. 582, Abidjan, Cote cl'Ivoire. cCentre Suisse dc Reeherchcs Seientitiques (CSRS), til HP. 1303 Abidjan, Cétc d'lvoire. fllik'matternent de Baetériologie-Virologie, Institut Pasteur de Cote d'Ivoire, 01 B.P. 490. Abidjan? Cote d'Ivoire.

  5. Tank 241-T-105, cores 205 and 207 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Esch, R. A.

    1997-10-21

    This document is the final laboratory report for tank 241-T-105 push mode core segments collected between June 24, 1997 and June 30, 1997. The segments were subsampled and analyzed in accordance with the {ital Tank Push Mode Core Sampling and Analysis Plan} (TSAP) (Field,1997), the {ital Tank Safety Screening Data Quality Objective} (Safety DQO) (Dukelow, et al., 1995) and {ital Tank 241-T-105 Sample Analysis} (memo) (Field, 1997a). The analytical results are included in Table 1. None of the subsamples submitted for the differential scanning calorimetry (DSC) analysis or total alpha activity (AT) exceeded the notification limits as stated in the TSAP (Field, 1997). The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems (TWRS) Technical Basis Group in accordance with the Memorandum of Understanding (Schreiber, 1997) and not considered in this report.

  6. 19 CFR 207.7 - Limited disclosure of certain business proprietary information under administrative protective...

    Science.gov (United States)

    2010-04-01

    ... INTERNATIONAL TRADE COMMISSION NONADJUDICATIVE INVESTIGATIONS INVESTIGATIONS OF WHETHER INJURY TO DOMESTIC... corresponding information about a competitor (pricing, product design, etc.). (4) Forms and determinations. (i... International Trade under section 777(c)(2) of the Act. (ii) Should the Secretary determine pursuant to this...

  7. 33 CFR 207.50 - Hudson River Lock at Troy, N.Y.; navigation.

    Science.gov (United States)

    2010-07-01

    ...) Authority of lockmaster. The lockmaster shall be charged with the immediate control and management of the... entering or leaving the lock. Masters and pilots will be held to a strict accountability in this matter...

  8. SU-E-T-207: Flatness and Symmetry Threshold Detection Using Statistical Process Control.

    Science.gov (United States)

    Able, C; Hampton, C; Baydush, A

    2012-06-01

    AAPM TG-142 guidelines state that beam uniformity (flatness and symmetry) should maintain a constancy of 1 % relative to baseline. The focus of this study is to determine if statistical process control (SPC) methodology using process control charts (PCC) of steering coil currents (SCC) can detect changes in beam uniformity prior to exceeding the 1% constancy criteria. SCCs for the transverse and radial planes are adjusted such that a reproducibly useful photon or electron beam is available. Transverse and radial - positioning and angle SCC are routinely documented in the Morning Check file during daily warm-up. The 6 MV beam values for our linac were analyzed using average and range (Xbar/R) PCC. Using this data as a baseline, an experiment was performed in which each SCC was changed from its mean value (steps of 0.01 or 0.02 Ampere) while holding the other SCC constant. The effect on beam uniformity was measured using a beam scanning system. These experimental SCC values were plotted in the PCC to determine if they would exceed the predetermined limits. The change in SCC required to exceed the 1% constancy criteria was detected by the PCC for 3 out of the 4 steering coils. The reliability of the result in the one coil not detected (transverse position coil) is questionable because the SCC slowly drifted during the experiment (0.05 A) regardless of the servo control setting. X-bar/R charts of SCC can detect exceptional variation prior to exceeding the beam uniformity criteria set forth in AAPM TG-142. The high level of PCC sensitivity to change may result in an alarm when in fact minimal change in beam uniformity has occurred. Further study is needed to determine if a combination of individual SCC alarms would reduce the false positive rate for beam uniformity intervention. This project was supoorted by a grant from Varian Medical Systems, Inc. © 2012 American Association of Physicists in Medicine.

  9. 33 CFR 207.440 - St. Marys Falls Canal and Locks, Mich.; use, administration, and navigation.

    Science.gov (United States)

    2010-07-01

    ...) Vessels with non-friction winches or lack of both bow and stern thrusters. Four vessel-supplied line... bow/stern thrusters. Bow and/or stern thruster use shall be kept to a minimum while transiting the Soo... with bow or stern thrusters, may cause control difficulties for certain classes of vessels. Therefore...

  10. 33 CFR 207.9 - Mystic River, Mass.; dam of Commonwealth of Massachusetts, Metropolitan District Commission.

    Science.gov (United States)

    2010-07-01

    ... accurately and distinctly marked at bow and stern showing the exact draft of water at such portions of the... for this purpose. (6) Equipment of each craft shall include a sufficient bow line and stern line. (j...

  11. 33 CFR 207.20 - Cape Cod Canal, Mass.; use, administration, and navigation.

    Science.gov (United States)

    2010-07-01

    ... is equipped with a rudder or a ship shaped bow, one tow line may be used. All tow lines of hawsers... exceeding 200 feet in length will be required to have an additional tug on the stern to insure that the tow... loaded firearms, ammunition, projectile firing devices, bows and arrows, crossbows, and explosives of any...

  12. 33 CFR 207.10 - Charles River, Mass.; dam of Charles River Basin Commission.

    Science.gov (United States)

    2010-07-01

    ... accurately and distinctly marked at the bow and stern, showing the exact draft of water at such portions of... propellers on entering the lock after the bow of the vessel has entered, but will be drawn in by means of...

  13. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (207b-0613-272217)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  14. MO-AB-207-03: ACR Update in Nuclear Medicine

    Energy Technology Data Exchange (ETDEWEB)

    Harkness, B. [Henry Ford Hospital System (United States)

    2015-06-15

    A goal of an imaging accreditation program is to ensure adequate image quality, verify appropriate staff qualifications, and to assure patient and personnel safety. Currently, more than 35,000 facilities in 10 modalities have been accredited by the American College of Radiology (ACR), making the ACR program one of the most prolific accreditation options in the U.S. In addition, ACR is one of the accepted accreditations required by some state laws, CMS/MIPPA insurance and others. Familiarity with the ACR accreditation process is therefore essential to clinical diagnostic medical physicists. Maintaining sufficient knowledge of the ACR program must include keeping up-to-date as the various modality requirements are refined to better serve the goals of the program and to accommodate newer technologies and practices. This session consists of presentations from authorities in four ACR accreditation modality programs, including magnetic resonance imaging, computed tomography, nuclear medicine, and mammography. Each speaker will discuss the general components of the modality program and address any recent changes to the requirements. Learning Objectives: To understand the requirements of the ACR MR Accreditation program. The discussion will include accreditation of whole-body general purpose magnets, dedicated extremity systems well as breast MRI accreditation. Anticipated updates to the ACR MRI Quality Control Manual will also be reviewed. To understand the requirements of the ACR CT accreditation program, including updates to the QC manual as well as updates through the FAQ process. To understand the requirements of the ACR nuclear medicine accreditation program, and the role of the physicist in annual equipment surveys and the set up and supervision of the routine QC program. To understand the current ACR MAP Accreditation requirement and present the concepts and structure of the forthcoming ACR Digital Mammography QC Manual and Program.

  15. MO-AB-207-00: ACR Update in MR, CT, Nuclear Medicine, and Mammography

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2015-06-15

    A goal of an imaging accreditation program is to ensure adequate image quality, verify appropriate staff qualifications, and to assure patient and personnel safety. Currently, more than 35,000 facilities in 10 modalities have been accredited by the American College of Radiology (ACR), making the ACR program one of the most prolific accreditation options in the U.S. In addition, ACR is one of the accepted accreditations required by some state laws, CMS/MIPPA insurance and others. Familiarity with the ACR accreditation process is therefore essential to clinical diagnostic medical physicists. Maintaining sufficient knowledge of the ACR program must include keeping up-to-date as the various modality requirements are refined to better serve the goals of the program and to accommodate newer technologies and practices. This session consists of presentations from authorities in four ACR accreditation modality programs, including magnetic resonance imaging, computed tomography, nuclear medicine, and mammography. Each speaker will discuss the general components of the modality program and address any recent changes to the requirements. Learning Objectives: To understand the requirements of the ACR MR Accreditation program. The discussion will include accreditation of whole-body general purpose magnets, dedicated extremity systems well as breast MRI accreditation. Anticipated updates to the ACR MRI Quality Control Manual will also be reviewed. To understand the requirements of the ACR CT accreditation program, including updates to the QC manual as well as updates through the FAQ process. To understand the requirements of the ACR nuclear medicine accreditation program, and the role of the physicist in annual equipment surveys and the set up and supervision of the routine QC program. To understand the current ACR MAP Accreditation requirement and present the concepts and structure of the forthcoming ACR Digital Mammography QC Manual and Program.

  16. 19 CFR 207.62 - Rulings on adequacy and nature of Commission review.

    Science.gov (United States)

    2010-04-01

    ... INVESTIGATIONS INVESTIGATIONS OF WHETHER INJURY TO DOMESTIC INDUSTRIES RESULTS FROM IMPORTS SOLD AT LESS THAN... inches. Comments containing new factual information shall be disregarded. (c) Notice of scheduling of... scheduling pertaining to subsequent procedures in the review. (d) Procedures for expedited reviews. (1) If...

  17. 40 CFR 91.207 - Credit calculation and manufacturer compliance with emission standards.

    Science.gov (United States)

    2010-07-01

    ... section; and (3) The FEL(s) of the family or families produced by the manufacturer are no higher than... emission standards. (a) For each engine family, certification emission credits (positive or negative) are... of nitrogen credit status for an engine family, whether generating positive credits or negative...

  18. 40 CFR 90.207 - Credit calculation and manufacturer compliance with emission standards.

    Science.gov (United States)

    2010-07-01

    ... credit deficit for a given model year, it must obtain sufficient credits from engine families produced by... calculation and manufacturer compliance with emission standards. (a) For each engine family, HC+NOX... as specified in § 90.205(b). FEL = the family emission limit for the engine family in grams per...

  19. MO-DE-207-04: Imaging educational program on solutions to common pediatric imaging challenges

    Energy Technology Data Exchange (ETDEWEB)

    Krishnamurthy, R. [Texas Children’s Hospital: Pediatric MRI Quality, Artifacts, and Safety (United States)

    2015-06-15

    This imaging educational program will focus on solutions to common pediatric imaging challenges. The speakers will present collective knowledge on best practices in pediatric imaging from their experience at dedicated children’s hospitals. The educational program will begin with a detailed discussion of the optimal configuration of fluoroscopes for general pediatric procedures. Following this introduction will be a focused discussion on the utility of Dual Energy CT for imaging children. The third lecture will address the substantial challenge of obtaining consistent image post -processing in pediatric digital radiography. The fourth and final lecture will address best practices in pediatric MRI including a discussion of ancillary methods to reduce sedation and anesthesia rates. Learning Objectives: To learn techniques for optimizing radiation dose and image quality in pediatric fluoroscopy To become familiar with the unique challenges and applications of Dual Energy CT in pediatric imaging To learn solutions for consistent post-processing quality in pediatric digital radiography To understand the key components of an effective MRI safety and quality program for the pediatric practice.

  20. 19 CFR 207.93 - Protection of proprietary information during panel and committee proceedings.

    Science.gov (United States)

    2010-04-01

    ... Government of Mexico who the Canadian Minister of Trade or the Mexican Secretary of Economia, as the case may... corresponding provisions of Canadian and Mexican law on disclosure undertakings concerning proprietary...

  1. : tous les projets | Page 207 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Les réseaux sociaux sont d'importantes sources de conseils pour les entrepreneurs du Moyen-Orient et de l'Afrique du Nord (région MOAN) et ils contribuent à leur ... L'épidémie de tabagisme qui touche le Panama met en évidence l'importance de se doter de mesures fiscales rigoureuses et d'autres mesures de lutte ...

  2. MO-FG-207-00: Technological Advances in PET/MR Imaging

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2015-06-15

    The use of integrated PET/MRI systems in clinical applications can best benefit from understanding their technological advances and limitations. The currently available clinical PET/MRI systems have their own characteristics. Thorough analyses of existing technical data and evaluation of necessary performance metrics for quality assurances could be conducted to optimize application-specific PET/MRI protocols. This Symposium will focus on technical advances and limitations of clinical PET/MRI systems, and how this exciting imaging modality can be utilized in applications that can benefit from both PET and MRI. Learning Objectives: To understand the technological advances of clinical PET/MRI systems To correctly identify clinical applications that can benefit from PET/MRI To understand ongoing work to further improve the current PET/MRI technology Floris Jansen is a GE Healthcare employee.

  3. PS2-07: The Association of Cyberbullying with Cardiovascular Health in Adolescents: A Preliminary Analysis

    Science.gov (United States)

    Cassidy-Bushrow, Andrea; Johnson, Dayna; Joseph, Christine

    2011-01-01

    Background/Aims With increasing access to the internet and other technology, adolescents may become victims of online harassment, referred to as cyberbullying. Cyberbullying may cause worry, fear, and distress among youth, all which increase cardiovascular disease (CVD) risk in adults. To our knowledge, no study has examined the potential association of cyberbullying with CVD risk factors in adolescents. We examined the association of cyberbullying with overweight/obesity and elevated blood pressure (BP) among healthy adolescents. Methods Adolescents age 14–17 years and parent/guardian were invited to a research visit between November, 2009 and present. Height, weight, and BP were measured by trained staff and internet experiences quantified by questionnaire. Race was defined as African-American or other race. Cyberbullying was defined as self-report in the past year of being worried or threatened because of being bothered or harassed online or of being embarrassed by others online. Overweight/ obesity was defined as BMI >=85th percentile for gender and age. Elevated BP was defined as a SBP or DBP >=90th percentile for gender, age and height. Logistic regression models were fit to estimate the association of cyberbulling with overweight/obesity or elevated BP. Results As of October, 2010, 190 adolescents with complete data have been recruited into the study. Mean age was 16.5±1.0 years; 76 (40%) were male and 112 (59.0%) were African-American. Mean BMI of adolescents was 24.2±6.4 kg/m^2 and mean SBP and DBP were 117.7±11.3 mmHg and 63.9±7.1mmHg, respectively; 62 (32.6%) were classified as overweight/obese and 28 (14.7%) had an elevated BP. A total of 29 (15.3%) adolescents reported being cyberbullied; older adolescents (P=0.061) were more likely and African-Americans (P=0.040) were less likely to report being cyberbullied. Gender was not associated with cyberbullying (P=0.143). Cyberbullying was not associated with overweight/obesity (P=0.951) or elevated BP (P=0.701), after adjustment for other risk factors. Conclusions CVD risk factors in youth track into adulthood, thus early-life experiences represent important and potentially modifiable predictors of adult disease. In this study, self-reported experiences of cyberbullying were not associated with being overweight/obese or with elevated BP. Continued study of psychosocial risk factors, including cyberbullying, with adolescent CVD health is warranted.

  4. 76 FR 207 - Intent To Prepare an Environmental Impact Statement for Proposed Transit Improvements to the...

    Science.gov (United States)

    2011-01-03

    ... language translation, such as a sign language interpreter, to participate in the scoping meeting should... times, improving access to job markets, responding to shifts in travel demand, better utilizing existing...

  5. 21 CFR 207.35 - Notification of registrant; drug establishment registration number and drug listing number.

    Science.gov (United States)

    2010-04-01

    ... intended for use in the manufacture of an animal feed, FDA assigns a separate Product Code only for each... supplemental new drug application, supplemental new animal drug application, or a modification to an index... ingredient(s); strength or concentration of active ingredient(s); dosage form; route of administration, if it...

  6. 12 CFR 303.207 - Restricted activities for critically undercapitalized institutions.

    Science.gov (United States)

    2010-01-01

    ... institution is required to provide notice to the appropriate federal banking agency. Materiality will be... liabilities at a rate that would increase the institution's weighted average cost of funds to a level...

  7. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (207a-0613-332211)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  8. 24 CFR 982.207 - Waiting list: Local preferences in admission to program.

    Science.gov (United States)

    2010-04-01

    ..., color, ethnic origin, gender, religion, disability, or age of any member of an applicant family. (iv) A... preference area. (v) Applicants who are working or who have been notified that they are hired to work in a... graduates of, or active participants in, education and training programs in a residency preference area as...

  9. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (207b-0613-332211)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  10. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (207a-0613-272217)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  11. 78 FR 40194 - Proposed Information Collection Request of the ETA 207, Nonmonetary Determination Activities...

    Science.gov (United States)

    2013-07-03

    ... Determination Activities Report; Comment Request on Extension Without Change (OMB 1205-0150) AGENCY: Employment..., Office of Unemployment Insurance, 200 Constitution Avenue NW., Frances Perkins Bldg. Room S- 4524... Activities, contains state data on the number and types of issues that are adjudicated when unemployment...

  12. TU-EF-207-05: Dedicated Cone-beam Breast CT

    Energy Technology Data Exchange (ETDEWEB)

    Vedantham, S. [Univ. of Massachusetts Medical School (United States)

    2015-06-15

    Breast imaging technology is advancing on several fronts. In digital mammography, the major technological trend has been on optimization of approaches for performing combined mammography and tomosynthesis using the same system. In parallel, photon-counting slot-scan mammography is now in clinical use and more efforts are directed towards further development of this approach for spectral imaging. Spectral imaging refers to simultaneous acquisition of two or more energy-windowed images. Depending on the detector and associated electronics, there are a number of ways this can be accomplished. Spectral mammography using photon-counting detectors can suppress electronic noise and importantly, it enables decomposition of the image into various material compositions of interest facilitating quantitative imaging. Spectral imaging can be particularly important in intravenously injected contrast mammography and eventually tomosynthesis. The various approaches and applications of spectral mammography are discussed. Digital breast tomosynthesis relies on the mechanical movement of the x-ray tube to acquire a number of projections in a predefined arc, typically from 9 to 25 projections over a scan angle of +/−7.5 to 25 degrees depending on the particular system. The mechanical x-ray tube motion requires relatively long acquisition time, typically between 3.7 to 25 seconds depending on the system. Moreover, mechanical scanning may have an effect on the spatial resolution due to internal x-ray filament or external mechanical vibrations. New x-ray source arrays have been developed and they are aimed at replacing the scanned x-ray tube for improved acquisition time and potentially for higher spatial resolution. The potential advantages and challenges of this approach are described. Combination of digital mammography and tomosynthesis in a single system places increased demands on certain functional aspects of the detector and overall performance, particularly in the tomosynthesis mode due to lower photon fluence per projection. This may require fast-frame acquisition and symmetric or asymmetric pixel binning in some systems. Recent studies investigated the performance of increased conversion layer thickness for contrast-enhanced imaging of the breast in dual-energy acquisition mode. In other direct conversion detectors operating in the avalanche mode, sensitivities close to the single photon response are also explored for mammography and breast tomosynthesis. The potential advantages and challenges of this approach are described. Dedicated breast CT brings x-ray imaging of the breast to true tomographic 3D imaging. It can eliminate the tissue superposition problem and does not require physical compression of the breast. Using cone beam geometry and a flat-panel detector, several hundred projections are acquired and reconstructed to near isotropic voxels. Multiplanar reconstruction facilitates viewing the breast volume in any desired orientation. Ongoing clinical studies, the current state-of-the art, and research to advance the technology are described. Learning Objectives: To understand the ongoing developments in x-ray imaging of the breast To understand the approaches and applications of spectral mammography To understand the potential advantages of distributed x-ray source arrays for digital breast tomosynthesis To understand the ongoing developments in detector technology for digital mammography and breast tomosynthesis To understand the current state-of-the-art for dedicated cone-beam breast CT and research to advance the technology. Research collaboration with Koning Corporation.

  13. TU-EF-207-04: Advances in Detector Technology for Breast Tomosynthesis

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, W. [SUNY Stony Brook (United States)

    2015-06-15

    Breast imaging technology is advancing on several fronts. In digital mammography, the major technological trend has been on optimization of approaches for performing combined mammography and tomosynthesis using the same system. In parallel, photon-counting slot-scan mammography is now in clinical use and more efforts are directed towards further development of this approach for spectral imaging. Spectral imaging refers to simultaneous acquisition of two or more energy-windowed images. Depending on the detector and associated electronics, there are a number of ways this can be accomplished. Spectral mammography using photon-counting detectors can suppress electronic noise and importantly, it enables decomposition of the image into various material compositions of interest facilitating quantitative imaging. Spectral imaging can be particularly important in intravenously injected contrast mammography and eventually tomosynthesis. The various approaches and applications of spectral mammography are discussed. Digital breast tomosynthesis relies on the mechanical movement of the x-ray tube to acquire a number of projections in a predefined arc, typically from 9 to 25 projections over a scan angle of +/−7.5 to 25 degrees depending on the particular system. The mechanical x-ray tube motion requires relatively long acquisition time, typically between 3.7 to 25 seconds depending on the system. Moreover, mechanical scanning may have an effect on the spatial resolution due to internal x-ray filament or external mechanical vibrations. New x-ray source arrays have been developed and they are aimed at replacing the scanned x-ray tube for improved acquisition time and potentially for higher spatial resolution. The potential advantages and challenges of this approach are described. Combination of digital mammography and tomosynthesis in a single system places increased demands on certain functional aspects of the detector and overall performance, particularly in the tomosynthesis mode due to lower photon fluence per projection. This may require fast-frame acquisition and symmetric or asymmetric pixel binning in some systems. Recent studies investigated the performance of increased conversion layer thickness for contrast-enhanced imaging of the breast in dual-energy acquisition mode. In other direct conversion detectors operating in the avalanche mode, sensitivities close to the single photon response are also explored for mammography and breast tomosynthesis. The potential advantages and challenges of this approach are described. Dedicated breast CT brings x-ray imaging of the breast to true tomographic 3D imaging. It can eliminate the tissue superposition problem and does not require physical compression of the breast. Using cone beam geometry and a flat-panel detector, several hundred projections are acquired and reconstructed to near isotropic voxels. Multiplanar reconstruction facilitates viewing the breast volume in any desired orientation. Ongoing clinical studies, the current state-of-the art, and research to advance the technology are described. Learning Objectives: To understand the ongoing developments in x-ray imaging of the breast To understand the approaches and applications of spectral mammography To understand the potential advantages of distributed x-ray source arrays for digital breast tomosynthesis To understand the ongoing developments in detector technology for digital mammography and breast tomosynthesis To understand the current state-of-the-art for dedicated cone-beam breast CT and research to advance the technology. Research collaboration with Koning Corporation.

  14. TU-EF-207-01: Introductory Remarks on Recent Advances in Breast Imaging

    Energy Technology Data Exchange (ETDEWEB)

    Karellas, A. [University of Massachusetts Medical School (United States)

    2015-06-15

    Breast imaging technology is advancing on several fronts. In digital mammography, the major technological trend has been on optimization of approaches for performing combined mammography and tomosynthesis using the same system. In parallel, photon-counting slot-scan mammography is now in clinical use and more efforts are directed towards further development of this approach for spectral imaging. Spectral imaging refers to simultaneous acquisition of two or more energy-windowed images. Depending on the detector and associated electronics, there are a number of ways this can be accomplished. Spectral mammography using photon-counting detectors can suppress electronic noise and importantly, it enables decomposition of the image into various material compositions of interest facilitating quantitative imaging. Spectral imaging can be particularly important in intravenously injected contrast mammography and eventually tomosynthesis. The various approaches and applications of spectral mammography are discussed. Digital breast tomosynthesis relies on the mechanical movement of the x-ray tube to acquire a number of projections in a predefined arc, typically from 9 to 25 projections over a scan angle of +/−7.5 to 25 degrees depending on the particular system. The mechanical x-ray tube motion requires relatively long acquisition time, typically between 3.7 to 25 seconds depending on the system. Moreover, mechanical scanning may have an effect on the spatial resolution due to internal x-ray filament or external mechanical vibrations. New x-ray source arrays have been developed and they are aimed at replacing the scanned x-ray tube for improved acquisition time and potentially for higher spatial resolution. The potential advantages and challenges of this approach are described. Combination of digital mammography and tomosynthesis in a single system places increased demands on certain functional aspects of the detector and overall performance, particularly in the tomosynthesis mode due to lower photon fluence per projection. This may require fast-frame acquisition and symmetric or asymmetric pixel binning in some systems. Recent studies investigated the performance of increased conversion layer thickness for contrast-enhanced imaging of the breast in dual-energy acquisition mode. In other direct conversion detectors operating in the avalanche mode, sensitivities close to the single photon response are also explored for mammography and breast tomosynthesis. The potential advantages and challenges of this approach are described. Dedicated breast CT brings x-ray imaging of the breast to true tomographic 3D imaging. It can eliminate the tissue superposition problem and does not require physical compression of the breast. Using cone beam geometry and a flat-panel detector, several hundred projections are acquired and reconstructed to near isotropic voxels. Multiplanar reconstruction facilitates viewing the breast volume in any desired orientation. Ongoing clinical studies, the current state-of-the art, and research to advance the technology are described. Learning Objectives: To understand the ongoing developments in x-ray imaging of the breast To understand the approaches and applications of spectral mammography To understand the potential advantages of distributed x-ray source arrays for digital breast tomosynthesis To understand the ongoing developments in detector technology for digital mammography and breast tomosynthesis To understand the current state-of-the-art for dedicated cone-beam breast CT and research to advance the technology. Research collaboration with Koning Corporation.

  15. TU-EF-207-02: Spectral Mammography Based on Photon Counting Detectors

    Energy Technology Data Exchange (ETDEWEB)

    Molloi, S. [University of California (United States)

    2015-06-15

    Breast imaging technology is advancing on several fronts. In digital mammography, the major technological trend has been on optimization of approaches for performing combined mammography and tomosynthesis using the same system. In parallel, photon-counting slot-scan mammography is now in clinical use and more efforts are directed towards further development of this approach for spectral imaging. Spectral imaging refers to simultaneous acquisition of two or more energy-windowed images. Depending on the detector and associated electronics, there are a number of ways this can be accomplished. Spectral mammography using photon-counting detectors can suppress electronic noise and importantly, it enables decomposition of the image into various material compositions of interest facilitating quantitative imaging. Spectral imaging can be particularly important in intravenously injected contrast mammography and eventually tomosynthesis. The various approaches and applications of spectral mammography are discussed. Digital breast tomosynthesis relies on the mechanical movement of the x-ray tube to acquire a number of projections in a predefined arc, typically from 9 to 25 projections over a scan angle of +/−7.5 to 25 degrees depending on the particular system. The mechanical x-ray tube motion requires relatively long acquisition time, typically between 3.7 to 25 seconds depending on the system. Moreover, mechanical scanning may have an effect on the spatial resolution due to internal x-ray filament or external mechanical vibrations. New x-ray source arrays have been developed and they are aimed at replacing the scanned x-ray tube for improved acquisition time and potentially for higher spatial resolution. The potential advantages and challenges of this approach are described. Combination of digital mammography and tomosynthesis in a single system places increased demands on certain functional aspects of the detector and overall performance, particularly in the tomosynthesis mode due to lower photon fluence per projection. This may require fast-frame acquisition and symmetric or asymmetric pixel binning in some systems. Recent studies investigated the performance of increased conversion layer thickness for contrast-enhanced imaging of the breast in dual-energy acquisition mode. In other direct conversion detectors operating in the avalanche mode, sensitivities close to the single photon response are also explored for mammography and breast tomosynthesis. The potential advantages and challenges of this approach are described. Dedicated breast CT brings x-ray imaging of the breast to true tomographic 3D imaging. It can eliminate the tissue superposition problem and does not require physical compression of the breast. Using cone beam geometry and a flat-panel detector, several hundred projections are acquired and reconstructed to near isotropic voxels. Multiplanar reconstruction facilitates viewing the breast volume in any desired orientation. Ongoing clinical studies, the current state-of-the art, and research to advance the technology are described. Learning Objectives: To understand the ongoing developments in x-ray imaging of the breast To understand the approaches and applications of spectral mammography To understand the potential advantages of distributed x-ray source arrays for digital breast tomosynthesis To understand the ongoing developments in detector technology for digital mammography and breast tomosynthesis To understand the current state-of-the-art for dedicated cone-beam breast CT and research to advance the technology. Research collaboration with Koning Corporation.

  16. Acta Theologica 2015: 2 207 M. Nel Identity-driven churches: Who ...

    African Journals Online (AJOL)

    , priest, bishop, denominational executives, “apostle”, and church leader in South Africa. In fact, I suggest that it become an essential tool in helping leaders develop missional churches. It is not always an easy read, but neither is it obscure, ...

  17. 49 CFR 232.207 - Class IA brake tests-1,000-mile inspection.

    Science.gov (United States)

    2010-10-01

    ... examine and observe the functioning of all moving parts of the brake system on each car in order to make... RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION BRAKE SYSTEM SAFETY STANDARDS FOR FREIGHT AND OTHER... Class IA brake test. The most restrictive car or block of cars in the train shall determine the location...

  18. 48 CFR 915.207-70 - Handling proposals and information during evaluation.

    Science.gov (United States)

    2010-10-01

    ... OF ENERGY CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Solicitation and Receipt... FAR 3.104; with requirements to prevent the potential for personal conflicts of interest; or, where a..., with requirements to prevent the potential for organizational conflicts of interest. (6) Non-Federal...

  19. WE-EF-207-10: Striped Ratio Grids: A New Concept for Scatter Estimation

    Energy Technology Data Exchange (ETDEWEB)

    Hsieh, S [Stanford University, Stanford, CA (United States)

    2015-06-15

    Purpose: To propose a new method for estimating scatter in x-ray imaging. We propose the “striped ratio grid,” an anti-scatter grid with alternating stripes of high scatter rejection (attained, for example, by high grid ratio) and low scatter rejection. To minimize artifacts, stripes are oriented parallel to the direction of the ramp filter. Signal discontinuities at the boundaries between stripes provide information on local scatter content, although these discontinuities are contaminated by variation in primary radiation. Methods: We emulated a striped ratio grid by imaging phantoms with two sequential CT scans, one with and one without a conventional grid, and processed them together to mimic a striped ratio grid. Two phantoms were scanned with the emulated striped ratio grid and compared with a conventional anti-scatter grid and a fan-beam acquisition, which served as ground truth. A nonlinear image processing algorithm was developed to mitigate the problem of primary variation. Results: The emulated striped ratio grid reduced scatter more effectively than the conventional grid alone. Contrast is thereby improved in projection imaging. In CT imaging, cupping is markedly reduced. Artifacts introduced by the striped ratio grid appear to be minimal. Conclusion: Striped ratio grids could be a simple and effective evolution of conventional anti-scatter grids. Unlike several other approaches currently under investigation for scatter management, striped ratio grids require minimal computation, little new hardware (at least for systems which already use removable grids) and impose few assumptions on the nature of the object being scanned.

  20. Page 1 Bull. Mater, Sci, Vol. 14, No. 2, April 1991, pp. 207-209. (C ...

    Indian Academy of Sciences (India)

    initial compounds Bi, Os, SrCOs, CaCO, CuO and PbO were weighed in a certain ratio, mixed, annealed in air at 815-830C for 12-24 hr, pressed into pellets and sintered in air at room temperatures from 845 C to premelting ones for 12-360 hr. The samples were either quenched in air or cooled together in the furnace.

  1. WE-FG-207B-08: Dual-Energy CT Iodine Accuracy Across Vendors and Platforms

    Energy Technology Data Exchange (ETDEWEB)

    Jacobsen, M; Wood, C; Cody, D [UT MD Anderson Cancer Center, Houston, TX (United States)

    2016-06-15

    Purpose: Although a major benefit of dual-energy CT is its quantitative capabilities, it is critical to understand how results vary by scanner manufacturer and/or model before making clinical patient management decisions. Each manufacturer utilizes a specific dual-energy CT approach; cross-calibration may be required for facilities with more than one dual-energy CT scanner type. Methods: A solid dual-energy quality control phantom (Gammex, Inc.; Appleton, WI) representing a large body cross-section containing three Iodine inserts (2mg/ml, 5mg/ml, 15 mg/ml) was scanned on these CT systems: GE HD-750 (80/140kVp), prototype GE Revolution CT with GSI (80/140kVp), Siemens Flash (80/140kVp and 100/140kVp), and Philips IQon (120kVp and 140kVp). Iodine content was measured in units of concentration (mg/ml) from a single 5mm-thick central image. Three to five acquisitions were performed on each scanner platform in order to compute standard deviation. Scan acquisitions were approximately dose-matched (∼25mGy CTDIvol) and image parameters were as consistent as possible (thickness, kernel, no noise reduction applied). Results: Iodine measurement error ranges were −0.24-0.16 mg/ml for the 2mg/ml insert (−12.0 − 8.0%), −0.28–0.26 mg/ml for the 5mg/ml insert (−5.6 − 5.2%), and −1.16−0.99 mg/ml for the 15mg/ml insert (−7.7 − 6.6%). Standard deviations ranged from 0 to 0.19 mg/ml for the repeated acquisitions from each scanner. The average iodine measurement error and standard deviation across all systems and inserts was −0.21 ± 0.48 mg/ml (−1.5 ± 6.48%). The largest absolute measurement error was found in the 15mg/ml iodine insert. Conclusion: There was generally good agreement in Iodine quantification across 3 dual-energy CT manufacturers and 4 scanner models. This was unexpected given the widely different underlying dual-energy CT mechanisms employed. Future work will include additional scanner platforms, independent verification of the Iodine insert standard concentrations (especially the 15 mg/ml insert), and how much measurement variability can be clinically tolerated. This research has been supported by funds from Dr. William Murphy, Jr., the John S. Dunn, Sr. Distinguished Chair in Diagnostic Imaging at MD Anderson Cancer Center.

  2. 49 CFR 236.207 - Electric lock on hand-operated switch; control.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Electric lock on hand-operated switch; control... switch; control. Electric lock on hand-operated switch shall be controlled so that it cannot be unlocked until control circuits of signals governing movements over such switch have been opened. Approach or...

  3. 49 CFR 180.207 - Requirements for requalification of UN pressure receptacles.

    Science.gov (United States)

    2010-10-01

    ... be rejected or condemned in accordance with the applicable ISO requalification standard. (c... in § 180.205(g). Alternative methods (e.g., acoustic emission) or requalification procedures may be... requalified in accordance with ISO 6406 (IBR, see § 171.7 of this subchapter). However, UN cylinders with a...

  4. DE0823-49 is a juvenile binary brown dwarf at 20.7 pc

    Science.gov (United States)

    Sahlmann, J.; Burgasser, A. J.; Martín, E. L.; Lazorenko, P. F.; Bardalez Gagliuffi, D. C.; Mayor, M.; Ségransan, D.; Queloz, D.; Udry, S.

    2015-07-01

    Astrometric monitoring of the nearby early-L dwarf DE0823-49 has revealed a low-mass companion in a 248-day orbit that was announced in an earlier work. Here, we present new astrometric and spectroscopic observations that allow us to characterise the system in detail. The optical spectrum shows Li i-absorption indicative of a young age and/or substellar mass for the primary component. The near-infrared spectrum is best reproduced by a binary system of brown dwarfs with spectral types of L1.5 + L5.5 and effective temperatures of 2150 ± 100 K and 1670 ± 140 K. To conform with the photocentric orbit size measured with astrometry and the current understanding of substellar evolution, the system must have an age in the 80-500 Myr range. Evolutionary models predict component masses in the ranges of M1 ≃ 0.028-0.063 M⊙ and M2 ≃ 0.018-0.045 M⊙ with a mass ratio of q ≃ 0.64-0.74. Multi-epoch radial velocity measurements unambiguously establish the three-dimensional orbit of the system and allow us to investigate its kinematic properties. DE0823-49 emerges as a rare example of a nearby brown dwarf binary with orbit, component properties, and age that are characterised well. It is a juvenile resident of the solar neighbourhood, but does not appear to belong to a known young association or moving group. Based on observations made with ESO telescopes at the La Silla Paranal Observatory under programme IDs 086.C-0680, 088.C-0679, 090.C-0786, and 092.C-0202.

  5. Estudo retrospectivo de 207 casos de tumores mamários em gatas

    Directory of Open Access Journals (Sweden)

    Monique Togni

    2013-03-01

    Full Text Available Este estudo teve como objetivos determinar os tumores mais prevalentes em gatos e relacionar os tumores mamários a alguns de seus fatores prognósticos. Os arquivos do Laboratório de Patologia Veterinária (LPV da Universidade Federal de Santa Maria (UFSM foram revisados e um total de 1.427 protocolos de biopsias e necropsias de felinos, entre 2000 e 2011, foi encontrado. Com base nas informações dos arquivos, foi estabelecida a relação entre os tumores e alguns fatores como sexo, idade, raça, estado reprodutivo, uso de contraceptivos, número e localização das glândulas afetadas, ulcerações, tamanho do neoplasma, metástases distantes e para os linfonodos. Assim, observou-se que os tumores de mama foram o segundo diagnóstico mais prevalente, após os tumores de pele. Todos os gatos com tumores mamários eram fêmeas, sendo os sem raça definida e os idosos os mais afetados. Os neoplasmas malignos foram diagnosticados com maior frequência, seguidos pelos tumores não neoplásicos e pelos neoplasmas benignos. Os tumores menores eram, na sua maioria, carcinomas. Ulcerações estavam presentes não só em neoplasmas malignos, mas também em alterações não neoplásicas. Metástases distantes foram encontradas principalmente nos pulmões e na pele.

  6. Afl. .i Yi'éld. CAM(2.0()7)

    African Journals Online (AJOL)

    , many of whom, even it“ ... et at, l985; Dosso ct Faye Kette, 1995), (2) a liquid medium mierodilution method (Dosso et Faye Kette, 1995). ... The inhibitory (Kim) and bactericidal concentrations (B.C.) were assessed by microdilution in liquid.

  7. 33 CFR 207.480 - Lake Huron, Mich.; Harbor of refuge, Harbor Beach; use and navigation.

    Science.gov (United States)

    2010-07-01

    ...) Passenger boats will, in general, have the preference as to location and attention by the officer in charge... floating property making fast to the breakwater must at once place such fenders between themselves and the... piece of floating property made fast to the breakwater, or anchored in the harbor, must keep outboard...

  8. Creative Accounting Model for Increasing Banking Industries’ Competitive Advantage in Indonesia (P.197-207

    Directory of Open Access Journals (Sweden)

    Supriyati Supriyati

    2017-01-01

    Full Text Available Bank Indonesia demands that the national banks should improve their transparency of financial condition and performance for public in line with the development of their products and activities. Furthermore, the banks’ financial statements of Bank Indonesia have become the basis for determining the status of their soundness. In fact, they tend to practice earnings management in order that they can meet the criteria required by Bank Indonesia. For internal purposes, the initiative of earning management has a positive impact on the performance of management. However, for the users of financial statements, it may differ, for example for the value of company, length of time the financial audit, and other aspects of tax evasion by the banks. This study tries to find out 1 the effect of GCG on Earnings Management, 2 the effect of earning management on Company value, the Audit Report Lag, and Taxation, and 3 the effect of Audit Report Lag on Corporate Value and Taxation. This is a quantitative research with the data collected from the bank financial statements, GCG implementation report, and the banks’ annual reports of 2003-2013. There were 41 banks taken using purposive sampling, as listed on the Indonesia Stock Exchange. The results showed that the implementation of GCG affects the occurrence of earning management. Accounting policy flexibility through earning management is expected to affect the length of the audit process and the accuracy of the financial statements presentation on public side. This research is expected to provide managerial implications in order to consider the possibility of earnings management practices in the banking industry. In the long term, earning management is expected to improve the banks’ competitiveness through an increase in the value of the company. Explicitly, earning management also affects the tax avoidance; therefore, the banks intend to pay lower taxes without breaking the existing legislation Taxation Provisions.Keywords: Good Corporate Governance (GCG, earning management, Audit Report lag, Company value, and tax avoidance

  9. TU-CD-207-01: Characterization of Breast Tissue Composition Using Spectral Mammography

    Energy Technology Data Exchange (ETDEWEB)

    Ding, H; Cho, H; Kumar, N; Sennung, D; Ng, A Lam; Molloi, S [Department of radiological scicens, University of California, Irvine, CA (United States)

    2015-06-15

    Purpose: To investigate the feasibility of characterizing the chemical composition of breast tissue, in terms of water and lipid, by using spectral mammography in simulation and postmortem studies. Methods: Analytical simulations were performed to obtain low- and high-energy signals of breast tissue based on previously reported water, lipid, and protein contents. Dual-energy decomposition was used to characterize the simulated breast tissue into water and lipid basis materials and the measured water density was compared to the known value. In experimental studies, postmortem breasts were imaged with a spectral mammography system based on a scanning multi-slit Si strip photon-counting detector. Low- and high-energy images were acquired simultaneously from a single exposure by sorting the recorded photons into the corresponding energy bins. Dual-energy material decomposition of the low- and high-energy images yielded individual pixel measurements of breast tissue composition in terms of water and lipid thicknesses. After imaging, each postmortem breast was chemically decomposed into water, lipid and protein. The water density calculated from chemical analysis was used as the reference gold standard. Correlation of the water density measurements between spectral mammography and chemical analysis was analyzed using linear regression. Results: Both simulation and postmortem studies showed good linear correlation between the decomposed water thickness using spectral mammography and chemical analysis. The slope of the linear fitting function in the simulation and postmortem studies were 1.15 and 1.21, respectively. Conclusion: The results indicate that breast tissue composition, in terms of water and lipid, can be accurately measured using spectral mammography. Quantitative breast tissue composition can potentially be used to stratify patients according to their breast cancer risk.

  10. New high spin states and isomers in the {sup 208}Pb and {sup 207}Pb nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Broda, R.; Wrzesinski, J.; Pawlat, T. [and others

    1996-12-31

    The two most prominent examples of the heavy doubly closed shell (DCS) nuclei, {sup 208}Pb and {sup 132}Sn, are not accessible by conventional heavy-ion fusion processes populating high-spin states. This experimental difficulty obscured for a long time the investigation of yrast high-spin states in both DCS and neighboring nuclei and consequently restricted the study of the shell model in its most attractive regions. Recent technical development of multidetector gamma arrays opened new ways to exploit more complex nuclear processes which populate the nuclei of interest with suitable yields for gamma spectroscopy and involve population of moderately high spin states. This new possibility extended the range of accessible spin values and is a promising way to reach new yrast states. Some of these states are expected to be of high configurational purity and can be a source of important shell model parameters which possibly can be used later to check the validity of the spherical shell model description at yet higher spin and higher excitation energy. The nuclei in the closest vicinity of {sup 132}Sn are produced in spontaneous fission and states with spin values up to I=14 can be reached in fission gamma spectroscopy studies with the presently achieved sensitivity of gamma arrays. New results on yrast states in the {sup 134}Te and {sup 135}I nuclei populated in fission of the {sup 248}Cm presented at this conference illustrate such application of the resolving power offered by modern gamma techniques.

  11. 20 CFR 416.207 - You do not give us permission to contact financial institutions.

    Science.gov (United States)

    2010-04-01

    ... consider a deemor's income and resources available to you ends, e.g. when spouses separate or divorce or a... payments. (h) You may be eligible for SSI payments if there is good cause for your being unable to obtain....1204). (1) Good cause exists if permission cannot be obtained from the individual and there is evidence...

  12. Derivation of Soil Screening Guidelines for Gross Alpha/Beta Radioactivity for United States Air Force Deployment Sites

    Science.gov (United States)

    2007-04-19

    the emission of 7 alpha particles and 4 beta particles. Three radionuclides ( francium -223, astatine-215, and polonium-211) are not listed below...no no Uranium-233 159,200 y alpha yes no Thorium-229 7,300 y alpha yes no Radium-225 14.9 d beta no no Actinium-225 10.0 d alpha no no Francium

  13. δ37Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine.

  14. δ³⁷Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine. This thesis presents the first chlorine

  15. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  16. WE-D-207-03: CT Protocols for Screening and the ACR Designated Lung Screening Program

    Energy Technology Data Exchange (ETDEWEB)

    McNitt-Gray, M. [UCLA School of Medicine (United States)

    2015-06-15

    In the United States, Lung Cancer is responsible for more cancer deaths than the next four cancers combined. In addition, the 5 year survival rate for lung cancer patients has not improved over the past 40 to 50 years. To combat this deadly disease, in 2002 the National Cancer Institute launched a very large Randomized Control Trial called the National Lung Screening Trial (NLST). This trial would randomize subjects who had substantial risk of lung cancer (due to age and smoking history) into either a Chest X-ray arm or a low dose CT arm. In November 2010, the National Cancer Institute announced that the NLST had demonstrated 20% fewer lung cancer deaths among those who were screened with low-dose CT than with chest X-ray. In December 2013, the US Preventive Services Task Force recommended the use of Lung Cancer Screening using low dose CT and a little over a year later (Feb. 2015), CMS announced that Medicare would also cover Lung Cancer Screening using low dose CT. Thus private and public insurers are required to provide Lung Cancer Screening programs using CT to the appropriate population(s). The purpose of this Symposium is to inform medical physicists and prepare them to support the implementation of Lung Screening programs. This Symposium will focus on the clinical aspects of lung cancer screening, requirements of a screening registry for systematically capturing and tracking screening patients and results (such as required Medicare data elements) as well as the role of the medical physicist in screening programs, including the development of low dose CT screening protocols. Learning Objectives: To understand the clinical basis and clinical components of a lung cancer screening program, including eligibility criteria and other requirements. To understand the data collection requirements, workflow, and informatics infrastructure needed to support the tracking and reporting components of a screening program. To understand the role of the medical physicist in implementing Lung Cancer Screening protocols for CT, including utilizing resources such as the AAPM Protocols and the ACR Designated Lung Screening Center program. UCLA Department of Radiology has an Institutional research agreement with Siemens Healthcare; Dr. McNitt-Gray has been a recipient of Research Support from Siemens Healthcare in the past. Dr. Aberle has been a Member of Advisory Boards for the LUNGevity Foundation (2011-present) and Siemens Medical Solutions. (2013)

  17. SU-D-207B-03: A PET-CT Radiomics Comparison to Predict Distant Metastasis in Lung Adenocarcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Coroller, T; Yip, S; Lee, S; Mak, R; Aerts, H [Dana Farber Cancer Institute, Brigham and Women’s Hospital, Havard Medical School, Boston, MA (United States); Kim, J [Brigham and Women’s Hospital, Children’s hospital, Harvard Medical School, Boston, MA (United States)

    2016-06-15

    Purpose: Early prediction of distant metastasis may provide crucial information for adaptive therapy, subsequently improving patient survival. Radiomic features that extracted from PET and CT images have been used for assessing tumor phenotype and predicting clinical outcomes. This study investigates the values of radiomic features in predicting distant metastasis (DM) in non-small cell lung cancer (NSCLC). Methods: A total of 108 patients with stage II–III lung adenocarcinoma were included in this retrospective study. Twenty radiomic features were selected (10 from CT and 10 from PET). Conventional features (metabolic tumor volume, SUV, volume and diameter) were included for comparison. Concordance index (CI) was used to evaluate features prognostic value. Noether test was used to compute p-value to consider CI significance from random (CI = 0.5) and were adjusted for multiple testing using false rate discovery (FDR). Results: A total of 70 patients had DM (64.8%) with a median time to event of 8.8 months. The median delivered dose was 60 Gy (range 33–68 Gy). None of the conventional features from PET (CI ranged from 0.51 to 0.56) or CT (CI ranged from 0.57 to 0.58) were significant from random. Five radiomics features were significantly prognostic from random for DM (p-values < 0.05). Four were extracted from CT (CI = 0.61 to 0.63, p-value <0.01) and one from PET which was also the most prognostic (CI = 0.64, p-value <0.001). Conclusion: This study demonstrated significant association between radiomic features and DM for patients with locally advanced lung adenocarcinoma. Moreover, conventional (clinically utilized) metrics were not significantly associated with DM. Radiomics can potentially help classify patients at higher risk of DM, allowing clinicians to individualize treatment, such as intensification of chemotherapy) to reduce the risk of DM and improve survival. R.M. has consulting interests with Amgen.

  18. SU-C-207B-04: Automated Segmentation of Pectoral Muscle in MR Images of Dense Breasts

    Energy Technology Data Exchange (ETDEWEB)

    Verburg, E; Waard, SN de; Veldhuis, WB; Gils, CH van; Gilhuijs, KGA [University Medical Center Utrecht, Utrecht (Netherlands)

    2016-06-15

    Purpose: To develop and evaluate a fully automated method for segmentation of the pectoral muscle boundary in Magnetic Resonance Imaging (MRI) of dense breasts. Methods: Segmentation of the pectoral muscle is an important part of automatic breast image analysis methods. Current methods for segmenting the pectoral muscle in breast MRI have difficulties delineating the muscle border correctly in breasts with a large proportion of fibroglandular tissue (i.e., dense breasts). Hence, an automated method based on dynamic programming was developed, incorporating heuristics aimed at shape, location and gradient features.To assess the method, the pectoral muscle was segmented in 91 randomly selected participants (mean age 56.6 years, range 49.5–75.2 years) from a large MRI screening trial in women with dense breasts (ACR BI-RADS category 4). Each MR dataset consisted of 178 or 179 T1-weighted images with voxel size 0.64 × 0.64 × 1.00 mm3. All images (n=16,287) were reviewed and scored by a radiologist. In contrast to volume overlap coefficients, such as DICE, the radiologist detected deviations in the segmented muscle border and determined whether the result would impact the ability to accurately determine the volume of fibroglandular tissue and detection of breast lesions. Results: According to the radiologist’s scores, 95.5% of the slices did not mask breast tissue in such way that it could affect detection of breast lesions or volume measurements. In 13.1% of the slices a deviation in the segmented muscle border was present which would not impact breast lesion detection. In 70 datasets (78%) at least 95% of the slices were segmented in such a way it would not affect detection of breast lesions, and in 60 (66%) datasets this was 100%. Conclusion: Dynamic programming with dedicated heuristics shows promising potential to segment the pectoral muscle in women with dense breasts.

  19. SU-D-207A-03: Potential Role of BOLD MRI in Discrimination of Aggressive Tumor Habitat in Prostate Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Ford, J; Lopez, C; Tschudi, Y; Breto, A; Padgett, K; Pollack, A; Stoyanova, R [University of Miami Miller School of Medicine, Miami, FL (United States)

    2016-06-15

    Purpose: To determine whether blood oxygenation level dependent (BOLD) MRI signal measured in prostate cancer patients, in addition to quantitative diffusion and perfusion parameters from multiparametric (mp)MRI exams, can help discriminate aggressive and/or radioresistant lesions. Methods: Several ongoing clinical trials in our institution require mpMRI exam to determine eligibility (presence of identifiable tumor lesion on mpMRI) and prostate volumes for dose escalation. Upon consent, patients undergo fiducial markers placement and a T2*-weighted imaging at the time of CT sim to facilitate the fusion. In a retrospective analysis eleven clinical trial patients were identified who had undergone mpMRI on GE 3T magnet, followed by T2*-weighted imaging (time-period mean±SD = 48±20 days) using a consistent protocol (gradient echo, TR/TE=30/11.8ms, flip angle=12, matrix=256×256×75, voxel size=1.25×1.25×2.5mm). ROIs for prostate tumor lesions were automatically determined using ADC threshold ≤1200 µm2/s. Although the MR protocol was not intended for BOLD analysis, we utilized the T2*-weighted signal normalized to that in nearby muscle; likewise, T2-weighted lesion signal was normalized to muscle, following rigid registration of the T2 to T2* images. The ratio of these normalized signals, T2*/T2, is a measure of BOLD effect in the prostate tumors. Perfusion parameters (Ktrans, ve, kep) were also calculated. Results: T2*/T2 (mean±SE) was found to be substantially lower for Gleason score (GS) 8&9 (0.82±0.04) compared to GS 7 (1.08±0.07). A k-means cluster analysis of T2*/T2 versus kep = Ktrans/ve revealed two distinct clusters, one with higher T2*/T2 and lower kep, containing only GS 7 lesions, and another with lower T2*/T2 and higher kep, associated with tumor aggressiveness. This latter cluster contained all GS 8&9 lesions, as well as some GS 7. Conclusion: BOLD MRI, in addition to ADC and kep, may play a role (perhaps orthogonal to Gleason score) in identifying prostate lesions that would benefit from more aggressive radiotherapy.

  20. 33 CFR 207.160 - All waterways tributary to the Atlantic Ocean south of Chesapeake Bay and all waterways tributary...

    Science.gov (United States)

    2010-07-01

    ...) Locks. All Government owned or operated locks and hurricane gate chambers and appurtenant structures in... District Engineers. The use, administration, and navigation of these waterways, Federal locks and hurricane... least six inches less than the depth on miter sills or breast walls, or which have projections or sharp...

  1. Oahu Hyperspectral Imagery 2000 (207a-0613-272217) - Visual Interpretation from Remote Sensing Imagery Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...

  2. SU-D-207A-06: Pediatric Abdominal Organ Motion Quantified Via a Novel 4D MRI Method

    Energy Technology Data Exchange (ETDEWEB)

    Uh, J; Krasin, MJ; Lucas, JT; Tinkle, C; Merchant, TE; Hua, C [St. Jude Children’s Research Hospital, Memphis, TN (United States)

    2016-06-15

    Purpose: To develop a 4D MRI method for assessing respiration-induced abdominal organ motion in children receiving radiation therapy. Methods: A 4D MRI using internal image-based respiratory surrogate has been developed and implemented on a clinical scanner (1.5T Siemens Avanto). Ten patients (younger group: N=6, 2–5 years, anesthetized; older group: N=4, 11–15 years) with neuroblastoma, Wilm’s tumor rhabdomyosarcoma, or desmoplastic small round cell tumor received free breathing 4D MRI scans for treatment planning. Coronal image slices of the entire abdomen were retrospectively constructed in 10 respiratory phases. A B-spline deformable registration (Metz et al. 2011) was performed on 4D datasets to automatically derive motion trajectories of selected anatomical landmarks, including the dome and the center of the liver, and the superior edges of kidneys and spleen. The extents of the motion in three dimensions (anteroposterior, AP; mediolateral, ML; superoinferior, SI) and the correlations between organ motion trajectories were quantified. Results: The 4D MRI scans were successfully performed in <20 minutes for all patients without the use of any external device. Organ motion extents were larger in adolescents (kidneys: 3–13 mm SI, liver and spleen: 6–18 mm SI) than in younger children (kidneys:<3mm in all directions; liver and spleen: 1–8 mm SI, 1–5 mm ML and AP). The magnitude of respiratory motion in some adolescents may warrant special motion management. Motion trajectories were not synchronized across selected anatomical landmarks, particularly in the ML and AP directions, indicating inter- and intra-organ variations of the respiratory-induced motion. Conclusion: The developed 4D MRI acquisition and motion analysis methods provide a non-ionizing, non-invasive approach to automatically measure the organ motion trajectory in the pediatric abdomen. It is useful for defining ITV and PRV, monitoring changes in target motion patterns during the treatment course, and studying interplay effects in proton scanning.

  3. 33 CFR 207.640 - Sacramento Deep Water Ship Channel Barge Lock and Approach Canals; use, administration, and...

    Science.gov (United States)

    2010-07-01

    ... lock. All boats, when in the lock, shall be moored to the fastenings provided for that purpose, by bow and stern lines and other spring lines as may be necessary, and the lines shall not be let go until...

  4. 33 CFR 207.275 - McClellan-Kerr Arkansas River navigation system: use, administration, and navigation.

    Science.gov (United States)

    2010-07-01

    ... deckhand, or more if the lockmaster so directs, shall be stationed at the bow and stern of tows. These... tend the lines at the bow and stern of each section of a tow that transits a lock or moors to the river... lockmaster. Vessels shall be moored with bow and stern lines leading in opposite directions to prevent the...

  5. 33 CFR 207.300 - Ohio River, Mississippi River above Cairo, Ill., and their tributaries; use, administration, and...

    Science.gov (United States)

    2010-07-01

    ... with bow and stern lines leading in opposite directions to prevent the vessel from “running” in the... of their bow waves and propeller washes on river banks; submerged or partially submerged structures...

  6. 33 CFR 207.420 - Chicago River, Ill.; Sanitary District controlling works, and the use, administration, and...

    Science.gov (United States)

    2010-07-01

    ..., have at least one line out when entering the lock and shall be moored in the lock with two bow and two stern lines, which shall lead forward and aft at each end of the vessel or tow. When the gates are...

  7. Oahu Hyperspectral Imagery 2000 (207b-0613-332211) - Visual Interpretation from Remote Sensing Imagery Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...

  8. SU-C-207B-07: Deep Convolutional Neural Network Image Matching for Ultrasound Guidance in Radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, N; Najafi, M; Hancock, S; Hristov, D [Stanford University Cancer Center, Palo Alto, CA (United States)

    2016-06-15

    Purpose: Robust matching of ultrasound images is a challenging problem as images of the same anatomy often present non-trivial differences. This poses an obstacle for ultrasound guidance in radiotherapy. Thus our objective is to overcome this obstacle by designing and evaluating an image blocks matching framework based on a two channel deep convolutional neural network. Methods: We extend to 3D an algorithmic structure previously introduced for 2D image feature learning [1]. To obtain the similarity between two 3D image blocks A and B, the 3D image blocks are divided into 2D patches Ai and Bi. The similarity is then calculated as the average similarity score of Ai and Bi. The neural network was then trained with public non-medical image pairs, and subsequently evaluated on ultrasound image blocks for the following scenarios: (S1) same image blocks with/without shifts (A and A-shift-x); (S2) non-related random block pairs; (S3) ground truth registration matched pairs of different ultrasound images with/without shifts (A-i and A-reg-i-shift-x). Results: For S1 the similarity scores of A and A-shift-x were 32.63, 18.38, 12.95, 9.23, 2.15 and 0.43 for x=ranging from 0 mm to 10 mm in 2 mm increments. For S2 the average similarity score for non-related block pairs was −1.15. For S3 the average similarity score of ground truth registration matched blocks A-i and A-reg-i-shift-0 (1≤i≤5) was 12.37. After translating A-reg-i-shift-0 by 0 mm, 2 mm, 4 mm, 6 mm, 8 mm, and 10 mm, the average similarity scores of A-i and A-reg-i-shift-x were 11.04, 8.42, 4.56, 2.27, and 0.29 respectively. Conclusion: The proposed method correctly assigns highest similarity to corresponding 3D ultrasound image blocks despite differences in image content and thus can form the basis for ultrasound image registration and tracking.[1] Zagoruyko, Komodakis, “Learning to compare image patches via convolutional neural networks', IEEE CVPR 2015,pp.4353–4361.

  9. SU-C-207A-02: Proton Radiography Using Pencil Beam Scanning and a Novel, Low-Cost Range Telescope

    Energy Technology Data Exchange (ETDEWEB)

    Dolney, D; Mayers, G; Newcomer, M; Bollinger, D; Desai, N; Maughan, R; Solberg, T; Hollebeek, R [University of Pennsylvania, Philadelphia, PA (United States); Weiss, D [Tufts University, Medford, MA (United States); Meekins, E [James Madison University, Harrisonburg, VA (United States)

    2016-06-15

    Purpose: While the energy of therapeutic proton beams can be adjusted to penetrate to any given depth in water, range uncertainties arise in patients due in part to imprecise knowledge of the stopping power of protons in human tissues [1]. Proton radiography is one approach to reduce the beam range uncertainty [2], thereby allowing for a reduction in treatment margins and dose escalation. Methods: The authors have adapted a novel detector technology based on Micromesh Gaseous Structure (“Micromegas”) for proton therapy beams and have demonstrated fine spatial and time resolution of magnetically scanned proton pencil beams, as well as wide dynamic range for dosimetry [3]. The authors have constructed a prototype imaging system comprised of 5 Micromegas layers. Proton radiographs were obtained downstream of solid water assemblies. The position-sensitive monitor chambers in the IBA proton delivery nozzle provide the beam entrance position. Results: Our technique achieves spatial resolution as low as 300 µm and water-equivalent thickness (WET) resolution as good as 0.02% (60 µm out of 31 cm total thickness). The dose delivered to the patient is kept below 2 cGy. The spatial resolution as a function of sample rate and number of delivered protons is found to be near the theoretical Cramer-Rao lower bound. By extrapolating the CR bound, we argue that the imaging dose could be further lowered to 1 mGy, while still achieving submillimeter spatial resolution, by achievable instrumentation and beam delivery modifications. Conclusion: For proton radiography, high spatial and WET resolution can be achieved, with minimal additional dose to patient, by using magnetically scanned proton pencil beams and Micromegas detectors.

  10. 33 CFR 207.476 - The Inland Route-lock in Crooked River, Alanson, Mich.; use, administration, and navigation.

    Science.gov (United States)

    2010-07-01

    ... States or other local government entities, such as state, county, or municipality. Arrival posts may be..., both to the employees of the Government and to any and every person within the limits of the lock area... securely moored until the exit lock gate is fully open and the lock horn sounds one blast. (7) When the...

  11. SU-D-207A-01: Female Pelvic Synthetic CT Generation Based On Joint Shape and Intensity Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Liu, L; Jolly, S; Cao, Y; Vineberg, K; Fessler, J; Balter, J [University Michigan, Ann Arbor, MI (United States)

    2016-06-15

    Purpose: To develop a method for generating female pelvic synthetic CT (MRCT) images from a single MR scan and evaluate its utility in radiotherapy. Methods: Under IRB-approval, an imaging sequence (T1-VIBE-Dixon) was acquired for 10 patients. This sequence yields 3 useful image volumes of different contrast (“in-phase” T1-weighted, fat and water). A previously published pelvic bone shape model was used to generate a rough bone mask for each patient. A modified fuzzy c-means classification was performed on the multi spectral MR data, with a regularization term that utilizes the prior knowledge provided by the bone mask and addresses the intensity overlap between different tissue types. A weighted sum of classification probabilities with attenuation values yielded MRCT volumes. The mean absolute error (MAE) between MRCT and real CT on various regions was calculated following deformable alignment (Velocity). Intensity modulated Treatment plans based on actual CT and MRCT were made and compared. Results: The average/standard deviation of MAE across 10 patients was 10.1/6.7 HU for muscle, 6.7/4.6 HU for fat, 136.9/53.5 HU for bony tissues under 850 HU (97% of total bone volume), 188.9/119.3 HU for bony tissues above 850 HU and 17.3/13.3 HU for intrapelvic soft tissues. Calculated doses were comparable for plans generated on CT and calculated using MRCT densities or vice versa, with differences in PTV D99% (mean/σ) of (–0.1/0.2 Gy) and (0.3/0.2 Gy), PTV D0.5cc of (–0.3/0.2 Gy) and (–0.4/1.7 Gy). OAR differences were similarly small for comparable structures, with differences in bowel V50Gy of (–0.3/0.2%) and (0.0/0.2%), femur V30Gy of (0.7/1.2%) and (0.2/1.2%), sacrum V20GY of (0.0/0.1%) and (–0.1/1.1%) and mean pelvic V20Gy of (0.0/0.1%) and (0.6/1.8%). Conclusion: MRCT based on a single imaging sequence in the female pelvis is feasible, with acceptably small variations in attenuation estimates and calculated doses to target and critical organs. Work supported by NIHR01EB016079.

  12. SU-C-207B-06: Comparison of Registration Methods for Modeling Pathologic Response of Esophageal Cancer to Chemoradiation Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Riyahi, S; Choi, W; Bhooshan, N; Tan, S; Zhang, H; Lu, W [University of Maryland School of Medicine, Baltimore, MD (United States)

    2016-06-15

    Purpose: To compare linear and deformable registration methods for evaluation of tumor response to Chemoradiation therapy (CRT) in patients with esophageal cancer. Methods: Linear and multi-resolution BSpline deformable registration were performed on Pre-Post-CRT CT/PET images of 20 patients with esophageal cancer. For both registration methods, we registered CT using Mean Square Error (MSE) metric, however to register PET we used transformation obtained using Mutual Information (MI) from the same CT due to being multi-modality. Similarity of Warped-CT/PET was quantitatively evaluated using Normalized Mutual Information and plausibility of DF was assessed using inverse consistency Error. To evaluate tumor response four groups of tumor features were examined: (1) Conventional PET/CT e.g. SUV, diameter (2) Clinical parameters e.g. TNM stage, histology (3)spatial-temporal PET features that describe intensity, texture and geometry of tumor (4)all features combined. Dominant features were identified using 10-fold cross-validation and Support Vector Machine (SVM) was deployed for tumor response prediction while the accuracy was evaluated by ROC Area Under Curve (AUC). Results: Average and standard deviation of Normalized mutual information for deformable registration using MSE was 0.2±0.054 and for linear registration was 0.1±0.026, showing higher NMI for deformable registration. Likewise for MI metric, deformable registration had 0.13±0.035 comparing to linear counterpart with 0.12±0.037. Inverse consistency error for deformable registration for MSE metric was 4.65±2.49 and for linear was 1.32±2.3 showing smaller value for linear registration. The same conclusion was obtained for MI in terms of inverse consistency error. AUC for both linear and deformable registration was 1 showing no absolute difference in terms of response evaluation. Conclusion: Deformable registration showed better NMI comparing to linear registration, however inverse consistency of transformation was lower in linear registration. We do not expect to see significant difference when warping PET images using deformable or linear registration. This work was supported in part by the National Cancer Institute Grants R01CA172638.

  13. Physical therapy in relation to gait and balance in elderly women - doi:10.5020/18061230.2011.p207

    Directory of Open Access Journals (Sweden)

    Anniele Martins Silva

    2012-01-01

    Full Text Available Objective: To determine if there is a benefit of physical therapy intervention in relation to balance and gait in the elderly. Methods: An interventional study held in 2009 in Caruaru-PE, Brazil, evaluated elderly women aged 60 and 82 years, randomly divided into two groups, control and intervention, undergoing physical therapy assessment (posture, balance and mobility through Timed Get Up and Go Test scorings- TUG, analysis of socio-demographic profile (age, sex, history of falls, fear of falling, physical activity, smoking and drinking and physical therapy intervention for 10 weeks. Statistical analysis included chi-square test, Fisher’s exact and ANOVA. Results: We found that the risk of falls was more evident in the control group (p <0.05 regarding to the scores and rankings obtained in the TUG test. After the intervention, no participant in the experimental group reported fear of falling, and no longer reported the presence of pain. Conclusion: Physical therapy achieved through stretching exercises and training of balance and strength brought benefits to both the balance and the gait of the studied sample.

  14. 28 CFR 16.207 - Public access to nonexempt transcripts and minutes of closed Commission meetings-Documents used...

    Science.gov (United States)

    2010-07-01

    .... Copies of nonexempt transcripts, or minutes, or a transcription of such recording disclosing the identity of each speaker, shall be furnished to any person at the actual cost of duplication or transcription... verbatim copy of the transcript, or a complete copy of the minutes, or a complete electronic recording of...

  15. 33 CFR 207.590 - Black Rock Canal and Lock at Buffalo, N.Y.; use, administration, and navigation.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Black Rock Canal and Lock at... Black Rock Canal and Lock at Buffalo, N.Y.; use, administration, and navigation. (a) The term “canal” when used in this section will mean all of the Black Rock Waterway, including Black Rock Lock, and all...

  16. 33 CFR 207.680 - Willamette River, Oreg.; use, administration, and navigation of canal and locks at Willamette...

    Science.gov (United States)

    2010-07-01

    ... district engineer. In case of emergency, however, the lockmaster shall have authority to take such steps as... the lockmaster's office. Notice to vessels desiring lockage will be given by red and green traffic lights. Vessels may enter locks on green lights, but must await green signal when lights are red...

  17. 33 CFR 207.718 - Navigation locks and approach channels, Columbia and Snake Rivers, Oreg. and Wash.

    Science.gov (United States)

    2010-07-01

    ... schedule and any changes to the schedule will be issued at least 30 days prior to implementation. Prior to... subject to falling overboard. (t) Handling valves, gates, bridges, and machinery. No person, unless authorized by the Lock Master, shall open or close any bridge, gate, valve, or operate any machinery in...

  18. SU-C-207B-03: A Geometrical Constrained Chan-Vese Based Tumor Segmentation Scheme for PET

    Energy Technology Data Exchange (ETDEWEB)

    Chen, L; Zhou, Z; Wang, J [UT Southwestern Medical Center, Dallas, TX (United States)

    2016-06-15

    Purpose: Accurate segmentation of tumor in PET is challenging when part of tumor is connected with normal organs/tissues with no difference in intensity. Conventional segmentation methods, such as thresholding or region growing, cannot generate satisfactory results in this case. We proposed a geometrical constrained Chan-Vese based scheme to segment tumor in PET for this special case by considering the similarity between two adjacent slices. Methods: The proposed scheme performs segmentation in a slice-by-slice fashion where an accurate segmentation of one slice is used as the guidance for segmentation of rest slices. For a slice that the tumor is not directly connected to organs/tissues with similar intensity values, a conventional clustering-based segmentation method under user’s guidance is used to obtain an exact tumor contour. This is set as the initial contour and the Chan-Vese algorithm is applied for segmenting the tumor in the next adjacent slice by adding constraints of tumor size, position and shape information. This procedure is repeated until the last slice of PET containing tumor. The proposed geometrical constrained Chan-Vese based algorithm was implemented in Matlab and its performance was tested on several cervical cancer patients where cervix and bladder are connected with similar activity values. The positive predictive values (PPV) are calculated to characterize the segmentation accuracy of the proposed scheme. Results: Tumors were accurately segmented by the proposed method even when they are connected with bladder in the image with no difference in intensity. The average PPVs were 0.9571±0.0355 and 0.9894±0.0271 for 17 slices and 11 slices of PET from two patients, respectively. Conclusion: We have developed a new scheme to segment tumor in PET images for the special case that the tumor is quite similar to or connected to normal organs/tissues in the image. The proposed scheme can provide a reliable way for segmenting tumors.

  19. SU-D-207B-02: Early Grade Classification in Meningioma Patients Combining Radiomics and Semantics Data

    Energy Technology Data Exchange (ETDEWEB)

    Coroller, T; Bi, W; Abedalthagafi, M; Aizer, A; Wu, W; Greenwald, N; Beroukhim, R; Al-Mefty, O; Santagata, S; Dunn, I; Alexander, B; Huang, R; Aerts, H [Dana Farber Cancer Institute, Brigham and Womens Hospital, Harvard Medical School (United States)

    2016-06-15

    Purpose: The clinical management of meningioma is guided by its grade and biologic behavior. Currently, diagnosis of tumor grade follows surgical resection and histopathologic review. Reliable techniques for pre-operative determination of tumor behavior are needed. We investigated the association between imaging features extracted from preoperative gadolinium-enhanced T1-weighted MRI and meningioma grade. Methods: We retrospectively examined the pre-operative MRI for 139 patients with de novo WHO grade I (63%) and grade II (37%) meningiomas. We investigated the predictive power of ten semantic radiologic features as determined by a neuroradiologist, fifteen radiomic features, and tumor location. Conventional (volume and diameter) imaging features were added for comparison. AUC was computed for continuous and χ{sup 2} for discrete variables. Classification was done using random forest. Performance was evaluated using cross validation (1000 iterations, 75% training and 25% validation). All p-values were adjusted for multiple testing. Results: Significant association was observed between meningioma grade and tumor location (p<0.001) and two semantic features including intra-tumoral heterogeneity (p<0.001) and overt hemorrhage (p=0.01). Conventional (AUC 0.61–0.67) and eleven radiomic (AUC 0.60–0.70) features were significant from random (p<0.05, Noether test). Median AUC values for classification of tumor grade were 0.57, 0.71, 0.72 and 0.77 respectively for conventional, radiomic, location, and semantic features after using random forest. By combining all imaging data (semantic, radiomic, and location), the median AUC was 0.81, which offers superior predicting power to that of conventional imaging descriptors for meningioma as well as radiomic features alone (p<0.05, permutation test). Conclusion: We demonstrate a strong association between radiologic features and meningioma grade. Pre-operative prediction of tumor behavior based on imaging features offers promise for guiding personalized medicine and improving patient management.

  20. Sodium oxide and uranium oxide aerosol experiments: NSPP Tests 106-108 and Tests 204-207, data record report

    Energy Technology Data Exchange (ETDEWEB)

    Adams, R.E.; Kress, T.S.; Tobias, M.L.

    1981-03-01

    This data record report describes three sodium oxide aerosol tests and four uranium oxide aerosol tests conducted in the Nuclear Safety Pilot Plant project at Oak Ridge National Laboratory. The goal of this project is to establish the validity (or level of conservatism) of the aerosol behavioral code, HAARM-3, and follow-on codes under development at the Battelle Columbus Laboratories for the US Nuclear Regulatory Commission. Descriptions of the seven tests with tables and graphs summarizing the results are included. 92 figs.

  1. 33 CFR 207.100 - Inland waterway from Delaware River to Chesapeake Bay, Del. and Md. (Chesapeake and Delaware...

    Science.gov (United States)

    2010-07-01

    ... or pass through the waterway. Vessels carrying rods, poles, or other gear extending above the top of the vessel's mast will be required to lower such equipment to a level with the top of the mast before...

  2. Disruption of the langerin/CD207 Gene Abolishes Birbeck Granules without a Marked Loss of Langerhans Cell Function

    Science.gov (United States)

    Kissenpfennig, Adrien; Aït-Yahia, Smina; Clair-Moninot, Valérie; Stössel, Hella; Badell, Edgar; Bordat, Yann; Pooley, Joanne L.; Lang, Thierry; Prina, Eric; Coste, Isabelle; Gresser, Olivia; Renno, Toufic; Winter, Nathalie; Milon, Geneviève; Shortman, Ken; Romani, Nikolaus; Lebecque, Serge; Malissen, Bernard; Saeland, Sem; Douillard, Patrice

    2005-01-01

    Langerin is a C-type lectin expressed by a subset of dendritic leukocytes, the Langerhans cells (LC). Langerin is a cell surface receptor that induces the formation of an LC-specific organelle, the Birbeck granule (BG). We generated a langerin−/− mouse on a C57BL/6 background which did not display any macroscopic aberrant development. In the absence of langerin, LC were detected in normal numbers in the epidermis but the cells lacked BG. LC of langerin−/− mice did not present other phenotypic alterations compared to wild-type littermates. Functionally, the langerin−/− LC were able to capture antigen, to migrate towards skin draining lymph nodes, and to undergo phenotypic maturation. In addition, langerin−/− mice were not impaired in their capacity to process native OVA protein for I-Ab-restricted presentation to CD4+ T lymphocytes or for H-2Kb-restricted cross-presentation to CD8+ T lymphocytes. langerin−/− mice inoculated with mannosylated or skin-tropic microorganisms did not display an altered pathogen susceptibility. Finally, chemical mutagenesis resulted in a similar rate of skin tumor development in langerin−/− and wild-type mice. Overall, our data indicate that langerin and BG are dispensable for a number of LC functions. The langerin−/− C57BL/6 mouse should be a valuable model for further functional exploration of langerin and the role of BG. PMID:15601833

  3. Oahu Hyperspectral Imagery 2000 (207b-0613-272217) - Visual Interpretation from Remote Sensing Imagery Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...

  4. 5 CFR Appendix B to Part 2641 - Agency Components for Purposes of 18 U.S.C. 207(c)

    Science.gov (United States)

    2010-01-01

    ... Disability Employment Policy (effective January 30, 2003). Parent: Department of State Component: Foreign... (formerly Agency for Health Care Policy and Research) (effective May 16, 1997). Agency for Toxic Substances..., 1997). Indian Health Service (effective May 16, 1997). National Institutes of Health (effective May 16...

  5. TU-CD-207-08: Intrinsic Image Quality Comparison of Synthesized 2-D and FFDM Images

    Energy Technology Data Exchange (ETDEWEB)

    Nelson, J; Wells, J; Samei, E [Clinical Imaging Physics Group, Duke University Medical Center, Durham, NC (United States)

    2015-06-15

    Purpose: With the combined interest of managing patient dose, maintaining or improving image quality, and maintaining or improving the diagnostic utility of mammographic data, this study aims to compare the intrinsic image quality of Hologic’s synthesized 2-D (C-View) and 2-D FFDM images in terms of resolution, contrast, and noise. Methods: This study utilized a novel 3-D printed anthropomorphic breast phantom in addition to the American College of Radiology (ACR) mammography accreditation phantom. Analysis of the 3-D anthropomorphic phantom included visual assessment of resolution and analysis of the normalized noise power spectrum. Analysis of the ACR phantom included both visual inspection and objective automated analysis using in-house software. The software incorporates image- and object-specific CNR visibility thresholds which account for image characteristics such as noise texture which affect object visualization. T- test statistical analysis was also performed on ACR phantom scores. Results: The spatial resolution of C-View images is markedly lower (at least 50% worse) than that of FFDM. And while this is generally associated with the benefit of reduced relative noise magnitude, the noise in C-View images tends to have a more mottled (predominantly low-frequency) texture. In general, for high contrast objects, C-View provides superior visualization over FFDM; however this benefit diminishes for low contrast objects and is applicable only to objects that are sufficiently larger than the spatial resolution threshold. Based on both observer and automated ACR phantom analysis, between 50–70% of C-View images failed to meet ACR minimum accreditation requirements – primarily due to insufficient (unbroken) fiber visibility. Conclusion: Compared to FFDM, C-View offers better depiction of objects of certain size and contrast, but provides poorer overall resolution and noise properties. Based on these findings, the utilization of C-View images in the clinical setting requires careful consideration, especially if considering the discontinuation of FFDM imaging.

  6. TU-EF-207-03: Advances in Stationary Breast Tomosynthesis Using Distributed X-Ray Sources

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, O. [The University of North Carolina at Chapel Hill (United States)

    2015-06-15

    Breast imaging technology is advancing on several fronts. In digital mammography, the major technological trend has been on optimization of approaches for performing combined mammography and tomosynthesis using the same system. In parallel, photon-counting slot-scan mammography is now in clinical use and more efforts are directed towards further development of this approach for spectral imaging. Spectral imaging refers to simultaneous acquisition of two or more energy-windowed images. Depending on the detector and associated electronics, there are a number of ways this can be accomplished. Spectral mammography using photon-counting detectors can suppress electronic noise and importantly, it enables decomposition of the image into various material compositions of interest facilitating quantitative imaging. Spectral imaging can be particularly important in intravenously injected contrast mammography and eventually tomosynthesis. The various approaches and applications of spectral mammography are discussed. Digital breast tomosynthesis relies on the mechanical movement of the x-ray tube to acquire a number of projections in a predefined arc, typically from 9 to 25 projections over a scan angle of +/−7.5 to 25 degrees depending on the particular system. The mechanical x-ray tube motion requires relatively long acquisition time, typically between 3.7 to 25 seconds depending on the system. Moreover, mechanical scanning may have an effect on the spatial resolution due to internal x-ray filament or external mechanical vibrations. New x-ray source arrays have been developed and they are aimed at replacing the scanned x-ray tube for improved acquisition time and potentially for higher spatial resolution. The potential advantages and challenges of this approach are described. Combination of digital mammography and tomosynthesis in a single system places increased demands on certain functional aspects of the detector and overall performance, particularly in the tomosynthesis mode due to lower photon fluence per projection. This may require fast-frame acquisition and symmetric or asymmetric pixel binning in some systems. Recent studies investigated the performance of increased conversion layer thickness for contrast-enhanced imaging of the breast in dual-energy acquisition mode. In other direct conversion detectors operating in the avalanche mode, sensitivities close to the single photon response are also explored for mammography and breast tomosynthesis. The potential advantages and challenges of this approach are described. Dedicated breast CT brings x-ray imaging of the breast to true tomographic 3D imaging. It can eliminate the tissue superposition problem and does not require physical compression of the breast. Using cone beam geometry and a flat-panel detector, several hundred projections are acquired and reconstructed to near isotropic voxels. Multiplanar reconstruction facilitates viewing the breast volume in any desired orientation. Ongoing clinical studies, the current state-of-the art, and research to advance the technology are described. Learning Objectives: To understand the ongoing developments in x-ray imaging of the breast To understand the approaches and applications of spectral mammography To understand the potential advantages of distributed x-ray source arrays for digital breast tomosynthesis To understand the ongoing developments in detector technology for digital mammography and breast tomosynthesis To understand the current state-of-the-art for dedicated cone-beam breast CT and research to advance the technology. Research collaboration with Koning Corporation.

  7. TU-CD-207-04: Radiation Exposure Comparisons of CESM with 2D FFDM and 3D Tomosynthesis Mammography

    Energy Technology Data Exchange (ETDEWEB)

    James, J; Boltz, T; Pavlicek, W [Mayo Clinic Arizona, Scottsdale, AZ (United States)

    2015-06-15

    Purpose: While mammography is considered the standard for front-line breast cancer screening, image sensitivity and specificity can be affected by factors like dense breast tissue. Contrast-enhanced spectral mammography (CESM) shows promising initial results for dense breasts but comes at the cost of increased dose compared with full-field-digital-mammography (FFDM). The goal of this study is to quantitatively assess the dose increase of CESM in comparison with 2D-FFDM and 3D-Tomo at varying breast thickness. Methods: The experiments were conducted on a Hologic-Selenia-Dimensions system that performed 2D-FFDM, 3D-Tomo and CESM (high and low energies) on regular (50/50) and dense (70/30) breast tissue-mimicking phantoms. Both the phantoms had 6, 1-cm thick slabs (total thickness 6cm), compressed at 20-lbs using an 18×24 paddle. A single exposure was performed for each of the 3 mammo techniques with the following settings: AEC-Auto; Focal Spot-Large; kVp-Auto; mAs- Auto, Target/Filter combination-Auto; AEC Sensor/Exposure compensation Step-2/0. Average glandular dose (AGD) in mGy was obtained and compared as a function of breast thickness (1 – 6 cm) for both the phantom types. Results: The study shows that dose from the total CESM from 50/50 phantom at a breast thickness of a) 4.5 cm was 37.5% higher than 2D-FFDM and 30% higher than 3D-Tomo, b) 6 cm was 36.2% higher than 2D-FFDM and 41% higher than 3D-Tomo. For a dense breast tissue of 70/30 phantom, it was found that CESM dose at a breast thickness of: a) 4.5 cm was 33.3% higher than 2D-FFDM and 28.8% higher than 3D-Tomo, b) 6 cm was 35.4% higher than 2D-FFDM and 48.0% higher than 3D-Tomo. The overall CESM dose for the dense breast phantom was 12.5% higher at 4.5cm and 35% higher at 6 cm compared to the 50/50 phantom. Conclusion: This quantitative comparison study showed that CESM technique has an increased radiation dose compared to conventional 2D-FFDM and 3D-Tomo.

  8. WE-G-207-05: Relationship Between CT Image Quality, Segmentation Performance, and Quantitative Image Feature Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Lee, J; Nishikawa, R [University of Pittsburgh, Pittsburgh, PA (United States); Reiser, I [The University of Chicago, Chicago, IL (United States); Boone, J [UC Davis Medical Center, Sacramento, CA (United States)

    2015-06-15

    Purpose: Segmentation quality can affect quantitative image feature analysis. The objective of this study is to examine the relationship between computed tomography (CT) image quality, segmentation performance, and quantitative image feature analysis. Methods: A total of 90 pathology proven breast lesions in 87 dedicated breast CT images were considered. An iterative image reconstruction (IIR) algorithm was used to obtain CT images with different quality. With different combinations of 4 variables in the algorithm, this study obtained a total of 28 different qualities of CT images. Two imaging tasks/objectives were considered: 1) segmentation and 2) classification of the lesion as benign or malignant. Twenty-three image features were extracted after segmentation using a semi-automated algorithm and 5 of them were selected via a feature selection technique. Logistic regression was trained and tested using leave-one-out-cross-validation and its area under the ROC curve (AUC) was recorded. The standard deviation of a homogeneous portion and the gradient of a parenchymal portion of an example breast were used as an estimate of image noise and sharpness. The DICE coefficient was computed using a radiologist’s drawing on the lesion. Mean DICE and AUC were used as performance metrics for each of the 28 reconstructions. The relationship between segmentation and classification performance under different reconstructions were compared. Distributions (median, 95% confidence interval) of DICE and AUC for each reconstruction were also compared. Results: Moderate correlation (Pearson’s rho = 0.43, p-value = 0.02) between DICE and AUC values was found. However, the variation between DICE and AUC values for each reconstruction increased as the image sharpness increased. There was a combination of IIR parameters that resulted in the best segmentation with the worst classification performance. Conclusion: There are certain images that yield better segmentation or classification performance. The best segmentation Result does not necessarily lead to the best classification Result. This work has been supported in part by grants from the NIH R21-EB015053. R Nishikawa is receives royalties form Hologic, Inc.

  9. WE-EF-207-05: Monte Carlo Dosimetry for a Dedicated Cone-Beam CT Head Scanner

    Energy Technology Data Exchange (ETDEWEB)

    Sisniega, A; Zbijewski, W; Xu, J; Dang, H; Stayman, J W; Aygun, N; Koliatsos, V E; Siewerdsen, J H [Johns Hopkins University, Balitmore, MD (United States); Wang, X; Foos, D H [Carestream Health, Rochester, NY (United States)

    2015-06-15

    Purpose: Cone-Beam CT (CBCT) is an attractive platform for point-of-care imaging of traumatic brain injury and intracranial hemorrhage. This work implements and evaluates a fast Monte-Carlo (MC) dose estimation engine for development of a dedicated head CBCT scanner, optimization of acquisition protocols, geometry, bowtie filter designs, and patient-specific dosimetry. Methods: Dose scoring with a GPU-based MC CBCT simulator was validated on an imaging bench using a modified 16 cm CTDI phantom with 7 ion chamber shafts along the central ray for 80–100 kVp (+2 mm Al, +0.2 mm Cu). Dose distributions were computed in a segmented CBCT reconstruction of an anthropomorphic head phantom with 4×10{sup 5} tracked photons per scan (5 min runtime). Circular orbits with angular span ranging from short scan (180° + fan angle) to full rotation (360°) were considered for fixed total mAs per scan. Two aluminum filters were investigated: aggressive bowtie, and moderate bowtie (matched to 16 cm and 32 cm water cylinder, respectively). Results: MC dose estimates showed strong agreement with measurements (RMSE<0.001 mGy/mAs). A moderate (aggressive) bowtie reduced the dose, per total mAs, by 20% (30%) at the center of the head, by 40% (50%) at the eye lens, and by 70% (80%) at the posterior skin entrance. For the no bowtie configuration, a short scan reduced the eye lens dose by 62% (from 0.08 mGy/mAs to 0.03 mGy/mAs) compared to full scan, although the dose to spinal bone marrow increased by 40%. For both bowties, the short scan resulted in a similar 40% increase in bone marrow dose, but the reduction in the eye lens was more pronounced: 70% (90%) for the moderate (aggressive) bowtie. Conclusions: Dose maps obtained with validated MC simulation demonstrated dose reduction in sensitive structures (eye lens and bone marrow) through combination of short-scan trajectories and bowtie filters. Xiaohui Wang and David Foos are employees of Carestream Health.

  10. 77 FR 71200 - Submission for Review: 3206-0140, Representative Payee Application (RI 20-7) and Information...

    Science.gov (United States)

    2012-11-29

    .... L. 104-13, 44 U.S.C. chapter 35) as amended by the Clinger-Cohen Act (Pub. L. 104-106), OPM is... other technological collection techniques or other forms of information technology, e.g., permitting...

  11. 78 FR 28007 - Submission for Review: Representative Payee Application (RI 20-7) and Information Necessary for a...

    Science.gov (United States)

    2013-05-13

    ....S.C. chapter 35) as amended by the Clinger-Cohen Act (Pub. L. 104-106), OPM is soliciting comments... collection techniques or other forms of information technology, e.g., permitting electronic submissions of...

  12. Draft assembly of elite inbred line PH207 provides insights into genomic and transcriptome diversity in maize

    Science.gov (United States)

    Intense artificial selection over the last 100 years has produced elite maize (Zea mays) inbred lines that combine to produce high-yielding hybrids. To further our understanding of how genome and transcriptome variation contribute to the production of high-yielding hybrids, we generated a draft geno...

  13. MO-DE-207A-12: Toward Patient-Specific 4DCT Reconstruction Using Adaptive Velocity Binning

    Energy Technology Data Exchange (ETDEWEB)

    Morris, E.D.; Glide-Hurst, C. [Henry Ford Health System, Detroit, MI (United States); Wayne State University, Detroit, MI (United States); Klahr, P. [Philips Healthcare, Cleveland, Ohio (United States)

    2016-06-15

    Purpose: While 4DCT provides organ/tumor motion information, it often samples data over 10–20 breathing cycles. For patients presenting with compromised pulmonary function, breathing patterns can change over the acquisition time, potentially leading to tumor delineation discrepancies. This work introduces a novel adaptive velocity-modulated binning (AVB) 4DCT algorithm that modulates the reconstruction based on the respiratory waveform, yielding a patient-specific 4DCT solution. Methods: AVB was implemented in a research reconstruction configuration. After filtering the respiratory waveform, the algorithm examines neighboring data to a phase reconstruction point and the temporal gate is widened until the difference between the reconstruction point and waveform exceeds a threshold value—defined as percent difference between maximum/minimum waveform amplitude. The algorithm only impacts reconstruction if the gate width exceeds a set minimum temporal width required for accurate reconstruction. A sensitivity experiment of threshold values (0.5, 1, 5, 10, and 12%) was conducted to examine the interplay between threshold, signal to noise ratio (SNR), and image sharpness for phantom and several patient 4DCT cases using ten-phase reconstructions. Individual phase reconstructions were examined. Subtraction images and regions of interest were compared to quantify changes in SNR. Results: AVB increased signal in reconstructed 4DCT slices for respiratory waveforms that met the prescribed criteria. For the end-exhale phases, where the respiratory velocity is low, patient data revealed a threshold of 0.5% demonstrated increased SNR in the AVB reconstructions. For intermediate breathing phases, threshold values were required to be >10% to notice appreciable changes in CT intensity with AVB. AVB reconstructions exhibited appreciably higher SNR and reduced noise in regions of interest that were photon deprived such as the liver. Conclusion: We demonstrated that patient-specific velocity-based 4DCT reconstruction is feasible. Image noise was reduced with AVB, suggesting potential applications for low-dose acquisitions and to improve 4DCT reconstruction for irregular breathing patients. The submitting institution holds research agreements with Philips Healthcare.

  14. FCJ-207 Game On: A Creative Enquiry into Agency and the Nature of Cognition in Distributed Systems

    Directory of Open Access Journals (Sweden)

    Michaela Davies

    2016-12-01

    Full Text Available Game On is a participatory installation where people use joysticks to control the movement of two (human boxers via a MIDI-controlled electric muscle stimulation device. This device sends electrical impulses to specific muscle points on the boxers via electrodes connected to their arms, causing each boxer to punch their opponent involuntarily. The work is a creative enquiry into the nature of agency within a system where cognition is distributed across people, objects and environment through technologies of connection. Game On explores what happens in a system where embodied experience and sense of agency is disrupted or extended, and the implications for locating a responsible agent within this system.

  15. SU-C-207-01: Four-Dimensional Inverse Geometry Computed Tomography: Concept and Its Validation

    Energy Technology Data Exchange (ETDEWEB)

    Kim, K; Kim, D; Kim, T; Kang, S; Cho, M; Shin, D; Suh, T [The Catholic University of Korea, Seoul (Korea, Republic of)

    2015-06-15

    Purpose: In past few years, the inverse geometry computed tomography (IGCT) system has been developed to overcome shortcomings of a conventional computed tomography (CT) system such as scatter problem induced from large detector size and cone-beam artifact. In this study, we intend to present a concept of a four-dimensional (4D) IGCT system that has positive aspects above all with temporal resolution for dynamic studies and reduction of motion artifact. Methods: Contrary to conventional CT system, projection data at a certain angle in IGCT was a group of fractionated narrow cone-beam projection data, projection group (PG), acquired from multi-source array which have extremely short time gap of sequential operation between each of sources. At this, for 4D IGCT imaging, time-related data acquisition parameters were determined by combining multi-source scanning time for collecting one PG with conventional 4D CBCT data acquisition sequence. Over a gantry rotation, acquired PGs from multi-source array were tagged time and angle for 4D image reconstruction. Acquired PGs were sorted into 10 phase and image reconstructions were independently performed at each phase. Image reconstruction algorithm based upon filtered-backprojection was used in this study. Results: The 4D IGCT had uniform image without cone-beam artifact on the contrary to 4D CBCT image. In addition, the 4D IGCT images of each phase had no significant artifact induced from motion compared with 3D CT. Conclusion: The 4D IGCT image seems to give relatively accurate dynamic information of patient anatomy based on the results were more endurable than 3D CT about motion artifact. From this, it will be useful for dynamic study and respiratory-correlated radiation therapy. This work was supported by the Industrial R&D program of MOTIE/KEIT [10048997, Development of the core technology for integrated therapy devices based on real-time MRI guided tumor tracking] and the Mid-career Researcher Program (2014R1A2A1A10050270) through the National Research Foundation of Korea funded by the Ministry of Science, ICT&Future Planning.

  16. SU-C-207A-01: A Novel Maximum Likelihood Method for High-Resolution Proton Radiography/proton CT

    Energy Technology Data Exchange (ETDEWEB)

    Collins-Fekete, C [Universite Laval, Quebec, Quebec (Canada); Centre Hospitalier University de Quebec, Quebec, QC (Canada); Mass General Hospital (United States); Harvard Medical, Boston MA (United States); Schulte, R [Loma Linda University, Loma Linda, CA (United States); Beaulieu, L [Universite Laval, Quebec, Quebec (Canada); Centre Hospitalier University de Quebec, Quebec, QC (Canada); Seco, J [Mass General Hospital (United States); Harvard Medical, Boston MA (United States); Department of Medical Physics in Radiooncology, DKFZ German Cancer Research Center, Heidelberg (Germany)

    2016-06-15

    Purpose: Multiple Coulomb scattering is the largest contributor to blurring in proton imaging. Here we tested a maximum likelihood least squares estimator (MLLSE) to improve the spatial resolution of proton radiography (pRad) and proton computed tomography (pCT). Methods: The object is discretized into voxels and the average relative stopping power through voxel columns defined from the source to the detector pixels is optimized such that it maximizes the likelihood of the proton energy loss. The length spent by individual protons in each column is calculated through an optimized cubic spline estimate. pRad images were first produced using Geant4 simulations. An anthropomorphic head phantom and the Catphan line-pair module for 3-D spatial resolution were studied and resulting images were analyzed. Both parallel and conical beam have been investigated for simulated pRad acquisition. Then, experimental data of a pediatric head phantom (CIRS) were acquired using a recently completed experimental pCT scanner. Specific filters were applied on proton angle and energy loss data to remove proton histories that underwent nuclear interactions. The MTF10% (lp/mm) was used to evaluate and compare spatial resolution. Results: Numerical simulations showed improvement in the pRad spatial resolution for the parallel (2.75 to 6.71 lp/cm) and conical beam (3.08 to 5.83 lp/cm) reconstructed with the MLLSE compared to averaging detector pixel signals. For full tomographic reconstruction, the improved pRad were used as input into a simultaneous algebraic reconstruction algorithm. The Catphan pCT reconstruction based on the MLLSE-enhanced projection showed spatial resolution improvement for the parallel (2.83 to 5.86 lp/cm) and conical beam (3.03 to 5.15 lp/cm). The anthropomorphic head pCT displayed important contrast gains in high-gradient regions. Experimental results also demonstrated significant improvement in spatial resolution of the pediatric head radiography. Conclusion: The proposed MLLSE shows promising potential to increase the spatial resolution (up to 244%) in proton imaging.

  17. 33 CFR 207.380 - Red Lake River, Minn.; logging regulations for portion of river above Thief River Falls.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Red Lake River, Minn.; logging... Red Lake River, Minn.; logging regulations for portion of river above Thief River Falls. (a) Parties wishing to run logs on Red Lake River must provide storage booms near the head of the river to take care...

  18. SU-C-207A-03: Development of Proton CT Imaging System Using Thick Scintillator and CCD Camera

    Energy Technology Data Exchange (ETDEWEB)

    Tanaka, S; Uesaka, M [The University of Tokyo, Tokyo (Japan); Nishio, T; Tsuneda, M [Hiroshima University, Hiroshima (Japan); Matsushita, K [Rikkyo University, Tokyo (Japan); Kabuki, S [Tokai University, Isehara (Japan)

    2016-06-15

    Purpose: In the treatment planning of proton therapy, Water Equivalent Length (WEL), which is the parameter for the calculation of dose and the range of proton, is derived by X-ray CT (xCT) image and xCT-WEL conversion. However, about a few percent error in the accuracy of proton range calculation through this conversion has been reported. The purpose of this study is to construct a proton CT (pCT) imaging system for an evaluation of the error. Methods: The pCT imaging system was constructed with a thick scintillator and a cooled CCD camera, which acquires the two-dimensional image of integrated value of the scintillation light toward the beam direction. The pCT image is reconstructed by FBP method using a correction between the light intensity and residual range of proton beam. An experiment for the demonstration of this system was performed with 70-MeV proton beam provided by NIRS cyclotron. The pCT image of several objects reconstructed from the experimental data was evaluated quantitatively. Results: Three-dimensional pCT images of several objects were reconstructed experimentally. A finestructure of approximately 1 mm was clearly observed. The position resolution of pCT image was almost the same as that of xCT image. And the error of proton CT pixel value was up to 4%. The deterioration of image quality was caused mainly by the effect of multiple Coulomb scattering. Conclusion: We designed and constructed the pCT imaging system using a thick scintillator and a CCD camera. And the system was evaluated with the experiment by use of 70-MeV proton beam. Three-dimensional pCT images of several objects were acquired by the system. This work was supported by JST SENTAN Grant Number 13A1101 and JSPS KAKENHI Grant Number 15H04912.

  19. Page 1 Sådhanā, Vol. 8, Part 2, March 1985, pp. 207–221 (C ...

    Indian Academy of Sciences (India)

    show that it is advantageous to divert as much water from the Beas to the Sutlej as possible. Keywords. Integrated reservoir operation; conjunctive use. 1. Introduction. To study the conventional operation of a reservoir system in a multiobjective framework in order to evaluate the trade-offs between irrigation and power ...

  20. MO-DE-207B-03: Improved Cancer Classification Using Patient-Specific Biological Pathway Information Via Gene Expression Data

    Energy Technology Data Exchange (ETDEWEB)

    Young, M; Craft, D [Massachusetts General Hospital and Harvard Medical School, Boston, MA (United States)

    2016-06-15

    Purpose: To develop an efficient, pathway-based classification system using network biology statistics to assist in patient-specific response predictions to radiation and drug therapies across multiple cancer types. Methods: We developed PICS (Pathway Informed Classification System), a novel two-step cancer classification algorithm. In PICS, a matrix m of mRNA expression values for a patient cohort is collapsed into a matrix p of biological pathways. The entries of p, which we term pathway scores, are obtained from either principal component analysis (PCA), normal tissue centroid (NTC), or gene expression deviation (GED). The pathway score matrix is clustered using both k-means and hierarchical clustering, and a clustering is judged by how well it groups patients into distinct survival classes. The most effective pathway scoring/clustering combination, per clustering p-value, thus generates various ‘signatures’ for conventional and functional cancer classification. Results: PICS successfully regularized large dimension gene data, separated normal and cancerous tissues, and clustered a large patient cohort spanning six cancer types. Furthermore, PICS clustered patient cohorts into distinct, statistically-significant survival groups. For a suboptimally-debulked ovarian cancer set, the pathway-classified Kaplan-Meier survival curve (p = .00127) showed significant improvement over that of a prior gene expression-classified study (p = .0179). For a pancreatic cancer set, the pathway-classified Kaplan-Meier survival curve (p = .00141) showed significant improvement over that of a prior gene expression-classified study (p = .04). Pathway-based classification confirmed biomarkers for the pyrimidine, WNT-signaling, glycerophosphoglycerol, beta-alanine, and panthothenic acid pathways for ovarian cancer. Despite its robust nature, PICS requires significantly less run time than current pathway scoring methods. Conclusion: This work validates the PICS method to improve cancer classification using biological pathways. Patients are classified with greater specificity and physiological relevance as compared to current gene-specific approaches. Focus now moves to utilizing PICS for pan-cancer patient-specific treatment response prediction.

  1. SU-F-207-06: CT-Based Assessment of Tumor Volume in Malignant Pleural Mesothelioma

    Energy Technology Data Exchange (ETDEWEB)

    Qayyum, F; Armato, S; Straus, C; Husain, A; Vigneswaran, W; Kindler, H [The University of Chicago, Chicago, IL (United States)

    2015-06-15

    Purpose: To determine the potential utility of computed tomography (CT) scans in the assessment of physical tumor bulk in malignant pleural mesothelioma patients. Methods: Twenty-eight patients with malignant pleural mesothelioma were used for this study. A CT scan was acquired for each patient prior to surgical resection of the tumor (median time between scan and surgery: 27 days). After surgery, the ex-vivo tumor volume was measured by a pathologist using a water displacement method. Separately, a radiologist identified and outlined the tumor boundary on each CT section that demonstrated tumor. These outlines then were analyzed to determine the total volume of disease present, the number of sections with outlines, and the mean volume of disease per outlined section. Subsets of the initial patient cohort were defined based on these parameters, i.e. cases with at least 30 sections of disease with a mean disease volume of at least 3mL per section. For each subset, the R- squared correlation between CT-based tumor volume and physical ex-vivo tumor volume was calculated. Results: The full cohort of 28 patients yielded a modest correlation between CT-based tumor volume and the ex-vivo tumor volume with an R-squared value of 0.66. In general, as the mean tumor volume per section increased, the correlation of CT-based volume with the physical tumor volume improved substantially. For example, when cases with at least 40 CT sections presenting a mean of at least 2mL of disease per section were evaluated (n=20) the R-squared correlation increased to 0.79. Conclusion: While image-based volumetry for mesothelioma may not generally capture physical tumor volume as accurately as one might expect, there exists a set of conditions in which CT-based volume is highly correlated with the physical tumor volume. SGA receives royalties and licensing fees through the University of Chicago for computer-aided diagnosis technology.

  2. SU-C-207B-05: Tissue Segmentation of Computed Tomography Images Using a Random Forest Algorithm: A Feasibility Study

    Energy Technology Data Exchange (ETDEWEB)

    Polan, D [University of Michigan, Ann Arbor, MI (United States); Brady, S; Kaufman, R [St. Jude Children’s Research Hospital, Memphis, TN (United States)

    2016-06-15

    Purpose: Develop an automated Random Forest algorithm for tissue segmentation of CT examinations. Methods: Seven materials were classified for segmentation: background, lung/internal gas, fat, muscle, solid organ parenchyma, blood/contrast, and bone using Matlab and the Trainable Weka Segmentation (TWS) plugin of FIJI. The following classifier feature filters of TWS were investigated: minimum, maximum, mean, and variance each evaluated over a pixel radius of 2n, (n = 0–4). Also noise reduction and edge preserving filters, Gaussian, bilateral, Kuwahara, and anisotropic diffusion, were evaluated. The algorithm used 200 trees with 2 features per node. A training data set was established using an anonymized patient’s (male, 20 yr, 72 kg) chest-abdomen-pelvis CT examination. To establish segmentation ground truth, the training data were manually segmented using Eclipse planning software, and an intra-observer reproducibility test was conducted. Six additional patient data sets were segmented based on classifier data generated from the training data. Accuracy of segmentation was determined by calculating the Dice similarity coefficient (DSC) between manual and auto segmented images. Results: The optimized autosegmentation algorithm resulted in 16 features calculated using maximum, mean, variance, and Gaussian blur filters with kernel radii of 1, 2, and 4 pixels, in addition to the original CT number, and Kuwahara filter (linear kernel of 19 pixels). Ground truth had a DSC of 0.94 (range: 0.90–0.99) for adult and 0.92 (range: 0.85–0.99) for pediatric data sets across all seven segmentation classes. The automated algorithm produced segmentation with an average DSC of 0.85 ± 0.04 (range: 0.81–1.00) for the adult patients, and 0.86 ± 0.03 (range: 0.80–0.99) for the pediatric patients. Conclusion: The TWS Random Forest auto-segmentation algorithm was optimized for CT environment, and able to segment seven material classes over a range of body habitus and CT protocol parameters with an average DSC of 0.86 ± 0.04 (range: 0.80–0.99).

  3. Page 1 The Kinetics of the Oeſin-ſ}romine Keaction—ſ 207 The ...

    Indian Academy of Sciences (India)

    is necessary, a more detailed study is needed before any correct Scheme can be postulated. Further, in a study of additive reactivity of ethylene deriva- lives, the premises have to be examined before a comparison can be made. Using the common equations in reaction kinetics. | kº (a - A], [Bri" ſky, (cat)" || ky, (cats)". . . . . dy k ...

  4. Oahu Hyperspectral Imagery 2000 (207a-0613-332211) - Visual Interpretation from Remote Sensing Imagery Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...

  5. 5 CFR Appendix A to Part 2641 - Positions Waived From 18 U.S.C. 207(c) and (f)

    Science.gov (United States)

    2010-01-01

    ...) and (f) A Appendix A to Part 2641 Administrative Personnel OFFICE OF GOVERNMENT ETHICS GOVERNMENT ETHICS POST-EMPLOYMENT CONFLICT OF INTEREST RESTRICTIONS Pt. 2641, App. A Appendix A to Part 2641... effective as of the date indicated. Agency: Department of Justice Positions: United States Trustee (21...

  6. 5 CFR 1304.4608 - Administrative Enforcement Procedures (18 U.S.C. 207(j); 5 CFR 737.27).

    Science.gov (United States)

    2010-01-01

    ... promulgated thereunder by the Office of Government Ethics or by OMB, the allegation and any supporting... appropriate comments, and copies of applicable agency regulations to the director, Office of Government Ethics, and to the Criminal Division, Department of Justice. Unless the Department of Justice informs OMB that...

  7. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  8. TU-H-207A-08: Estimating Radiation Dose From Low-Dose Lung Cancer Screening CT Exams Using Tube Current Modulation

    Energy Technology Data Exchange (ETDEWEB)

    Hardy, A; Bostani, M [University of California, Los Angeles, Los Angeles, CA (United States); McMillan, K [Mayo Clinic, Rochester, MN (United States); Zankl, M [Helmholtz Zentrum Munchen, Neuherberg (Germany); Cagnon, C [UCLA Medical Center, Los Angeles, CA (United States); McNitt-Gray, M [UCLA School of Medicine, Los Angeles, CA (United States)

    2016-06-15

    Purpose: The purpose of this work is to estimate effective and lung doses from a low-dose lung cancer screening CT protocol using Tube Current Modulation (TCM) across patient models of different sizes. Methods: Monte Carlo simulation methods were used to estimate effective and lung doses from a low-dose lung cancer screening protocol for a 64-slice CT (Sensation 64, Siemens Healthcare) that used TCM. Scanning parameters were from the AAPM protocols. Ten GSF voxelized patient models were used and had all radiosensitive organs identified to facilitate estimating both organ and effective doses. Predicted TCM schemes for each patient model were generated using a validated method wherein tissue attenuation characteristics and scanner limitations were used to determine the TCM output as a function of table position and source angle. The water equivalent diameter (WED) was determined by estimating the attenuation at the center of the scan volume for each patient model. Monte Carlo simulations were performed using the unique TCM scheme for each patient model. Lung doses were tallied and effective doses were estimated using ICRP 103 tissue weighting factors. Effective and lung dose values were normalized by scanspecific 32 cm CTDIvol values based upon the average tube current across the entire simulated scan. Absolute and normalized doses were reported as a function of WED for each patient. Results: For all ten patients modeled, the effective dose using TCM protocols was below 1.5 mSv. Smaller sized patient models experienced lower absolute doses compared to larger sized patients. Normalized effective and lung doses showed some dependence on patient size (R2 = 0.77 and 0.78, respectively). Conclusion: Effective doses for a low-dose lung screening protocol using TCM were below 1.5 mSv for all patient models used in this study. Institutional research agreement, Siemens Healthcare; Past recipient, research grant support, Siemens Healthcare; Consultant, Toshiba America Medical Systems; Consultant, Samsung Electronics.

  9. CENER/NREL Collaboration in Testing Facility and Code Development: Cooperative Research and Development Final Report, CRADA Number CRD-06-207

    Energy Technology Data Exchange (ETDEWEB)

    Moriarty, P.

    2014-11-01

    Under the funds-in CRADA agreement, NREL and CENER will collaborate in the areas of blade and drivetrain testing facility development and code development. The project shall include NREL assisting in the review and instruction necessary to assist in commissioning the new CENER blade test and drivetrain test facilities. In addition, training will be provided by allowing CENER testing staff to observe testing and operating procedures at the NREL blade test and drivetrain test facilities. CENER and NREL will exchange blade and drivetrain facility and equipment design and performance information. The project shall also include exchanging expertise in code development and data to validate numerous computational codes.

  10. MO-DE-207B-05: Predicting Gene Mutations in Renal Cell Carcinoma Based On CT Imaging Features: Validation Using TCGA-TCIA Datasets

    Energy Technology Data Exchange (ETDEWEB)

    Chen, X; Zhou, Z; Thomas, K; Wang, J [UT Southwestern Medical Center, Dallas, TX (United States)

    2016-06-15

    Purpose: The goal of this work is to investigate the use of contrast enhanced computed tomographic (CT) features for the prediction of mutations of BAP1, PBRM1, and VHL genes in renal cell carcinoma (RCC). Methods: For this study, we used two patient databases with renal cell carcinoma (RCC). The first one consisted of 33 patients from our institution (UT Southwestern Medical Center, UTSW). The second one consisted of 24 patients from the Cancer Imaging Archive (TCIA), where each patient is connected by a unique identi?er to the tissue samples from the Cancer Genome Atlas (TCGA). From the contrast enhanced CT image of each patient, tumor contour was first delineated by a physician. Geometry, intensity, and texture features were extracted from the delineated tumor. Based on UTSW dataset, we completed feature selection and trained a support vector machine (SVM) classifier to predict mutations of BAP1, PBRM1 and VHL genes. We then used TCIA-TCGA dataset to validate the predictive model build upon UTSW dataset. Results: The prediction accuracy of gene expression of TCIA-TCGA patients was 0.83 (20 of 24), 0.83 (20 of 24), and 0.75 (18 of 24) for BAP1, PBRM1, and VHL respectively. For BAP1 gene, texture feature was the most prominent feature type. For PBRM1 gene, intensity feature was the most prominent. For VHL gene, geometry, intensity, and texture features were all important. Conclusion: Using our feature selection strategy and models, we achieved predictive accuracy over 0.75 for all three genes under the condition of using patient data from one institution for training and data from other institutions for testing. These results suggest that radiogenomics can be used to aid in prognosis and used as convenient surrogates for expensive and time consuming gene assay procedures.

  11. SU-D-207B-04: Morphological Features of MRI as a Correlate of Capsular Contracture in Breast Cancer Patients with Implant-Based Reconstructions

    Energy Technology Data Exchange (ETDEWEB)

    Tyagi, N; Sutton, E; Hunt, M; Apte, A; Zhang, J; Oh, J; Mechalakos, J; Mehrara, B; Matros, E; Ho, A [Mem Sloan-Kettering Cancer Ctr, New York, NY (United States)

    2016-06-15

    Purpose: Capsular contracture (CC) is a serious complication in patients receiving implant-based reconstruction for breast cancer. The goal of this study was to identify image-based correlates of CC using MRI imaging in breast cancer patients who received both MRI and clinical evaluation following reconstructive surgery. Methods: We analyzed a retrospective dataset of 50 patients who had both a diagnostic MR and a plastic surgeon’s evaluations of CC score (Baker’s score) within a six month period following mastectomy and reconstructive surgery. T2w sagittal MRIs (TR/TE = 3500/102 ms, slice thickness = 4 mm) were used for morphological shape features (roundness, eccentricity, solidity, extent and ratio-length) and histogram features (median, skewness and kurtosis) of the implant and the pectoralis muscle overlying the implant. Implant and pectoralis muscles were segmented in 3D using Computation Environment for Radiological Research (CERR) and shape and histogram features were calculated as a function of Baker’s score. Results: Shape features such as roundness and eccentricity were statistically significant in differentiating grade 1 and grade 2 (p = 0.009; p = 0.06) as well as grade 1 and grade 3 CC (p = 0.001; p = 0.006). Solidity and extent were statistically significant in differentiating grade 1 and grade 3 CC (p = 0.04; p = 0.04). Ratio-length was statistically significant in differentiating all grades of CC except grade 2 and grade 3 that showed borderline significance (p = 0.06). The muscle thickness, median intensity and kurtosis were significant in differentiating between grade 1 and grade 3 (p = 0.02), grade 1 and grade 2 (p = 0.03) and grade 1 and grade 3 (p = 0.01) respectively. Conclusion: Morphological shape features described on MR images were associated with the severity of CC. MRI may be important in objectively evaluating outcomes in breast cancer patients who undergo implant reconstruction.

  12. Performance Analysis of Wavelet Channel Coding in COST207-based Channel Models on Simulated Radio-over-Fiber Systems at the W-Band

    DEFF Research Database (Denmark)

    Cavalcante, Lucas Costa Pereira; Silveira, Luiz F. Q.; Rommel, Simon

    2016-01-01

    , such systems use diversity schemes in combination with digital signal processing (DSP) techniques to overcome effects such as fading and inter-symbol interference (ISI). Wavelet Channel Coding (WCC) has emerged as a technique to minimize the fading effects of wireless channels, which is a mayor challenge...

  13. Pb isotope analysis of ng size samples by TIMS equipped with a 1013 Ω resistor using a 207Pb-204Pb double spike

    NARCIS (Netherlands)

    Klaver, M.; Smeets, R.J.; Koornneef, J.M.; Davies, G.R.; Vroon, P.Z.

    2016-01-01

    The use of the double spike technique to correct for instrumental mass fractionation has yielded high precision results for lead isotope measurements by thermal ionisation mass spectrometry (TIMS), but the applicability to ng size Pb samples is hampered by the small size of the

  14. WE-G-207-02: Full Sequential Projection Onto Convex Sets (FS-POCS) for X-Ray CT Reconstruction

    Energy Technology Data Exchange (ETDEWEB)

    Liu, L; Han, Y [Tianjin University, Tianjin (China); Jin, M [University of Texas at Arlington, Arlington, TX (United States)

    2015-06-15

    Purpose: To develop an iterative reconstruction method for X-ray CT, in which the reconstruction can quickly converge to the desired solution with much reduced projection views. Methods: The reconstruction is formulated as a convex feasibility problem, i.e. the solution is an intersection of three convex sets: 1) data fidelity (DF) set – the L2 norm of the difference of observed projections and those from the reconstructed image is no greater than an error bound; 2) non-negativity of image voxels (NN) set; and 3) piecewise constant (PC) set - the total variation (TV) of the reconstructed image is no greater than an upper bound. The solution can be found by applying projection onto convex sets (POCS) sequentially for these three convex sets. Specifically, the algebraic reconstruction technique and setting negative voxels as zero are used for projection onto the DF and NN sets, respectively, while the projection onto the PC set is achieved by solving a standard Rudin, Osher, and Fatemi (ROF) model. The proposed method is named as full sequential POCS (FS-POCS), which is tested using the Shepp-Logan phantom and the Catphan600 phantom and compared with two similar algorithms, TV-POCS and CP-TV. Results: Using the Shepp-Logan phantom, the root mean square error (RMSE) of reconstructed images changing along with the number of iterations is used as the convergence measurement. In general, FS- POCS converges faster than TV-POCS and CP-TV, especially with fewer projection views. FS-POCS can also achieve accurate reconstruction of cone-beam CT of the Catphan600 phantom using only 54 views, comparable to that of FDK using 364 views. Conclusion: We developed an efficient iterative reconstruction for sparse-view CT using full sequential POCS. The simulation and physical phantom data demonstrated the computational efficiency and effectiveness of FS-POCS.

  15. 207. Terapia de resincronización cardíaca en la práctica clínica diaria. seguimiento a medio plazo

    Directory of Open Access Journals (Sweden)

    N. Miranda

    2012-04-01

    Conclusiones: La TRC es una terapia eficaz en el tratamiento de los pacientes con insuficiencia cardíaca refractaria al tratamiento convencional en nuestro medio. Es fundamental una correcta selección de los pacientes que van a ser sometidos a dicha terapia con vistas a mejorar la efectividad de ésta.

  16. SU-D-207A-04: Use of Gradient Echo Plural Contrast Imaging (GEPCI) in MR-Guided Radiation Therapy: A Feasibility Study Targeting Brain Treatment

    Energy Technology Data Exchange (ETDEWEB)

    Cai, B; Rao, Y; Tsien, C; Huang, J; Green, O; Mutic, S; Gach, H [Department of Radiation Oncology, Washington University School of Medicine, St. Louis, MO (United States); Wen, J; Yablonskiy, D [Department of Radiology, Washington University School of Medicine, St Louis, MO (United States)

    2016-06-15

    Purpose: To implement the Gradient Echo Plural Contrast Imaging(GEPCI) technique in MRI-simulation for radiation therapy and assess the feasibility of using GEPCI images with advanced inhomogeneity correction in MRI-guided radiotherapy for brain treatment. Methods: An optimized multigradient-echo GRE sequence (TR=50ms;TE1=4ms;delta-TE=4ms;flip angle=300,11 Echoes) was developed to generate both structural (T1w and T2*w) and functional MRIs (field and susceptibility maps) from a single acquisition. One healthy subject (Subject1) and one post-surgical brain cancer patient (Subject2) were scanned on a Philips Ingenia 1.5T MRI used for radiation therapy simulation. Another healthy subject (Subject3) was scanned on a 0.35T MRI-guided radiotherapy (MR-IGRT) system (ViewRay). A voxel spread function (VSF) was used to correct the B0 inhomogeneities caused by surgical cavities and edema for Subject2. GEPCI images and standard radiotherapy planning MRIs for this patient were compared focusing the delineation of radiotherapy target region. Results: GEPCI brain images were successfully derived from all three subjects with scan times of <7 minutes. The images derived for Subjects1&2 demonstrated that GEPCI can be applied and combined into radiotherapy MRI simulation. Despite low field, T1-weighted and R2* images were successfully reconstructed for Subject3 and were satisfactory for contour and target delineation. The R2* distribution of grey matter (center=12,FWHM=4.5) and white matter (center=14.6, FWHM=2) demonstrated the feasibility for tissue segmentation and quantification. The voxel spread function(VSF) corrected surgical site related inhomogeneities for Subject2. R2* and quantitative susceptibility map(QSM) images for Subject2 can be used to quantitatively assess the brain structure response to radiation over the treatment course. Conclusion: We implemented the GEPCI technique in MRI-simulation and in MR-IGRT system for radiation therapy. The images demonstrated that it is feasible to adopt this technique in radiotherapy for structural delineation. The preliminary data also enable the opportunity for quantitative assessment of radiation response of the target region and normal tissue.

  17. SU-F-207-02: Use of Postmortem Subjects for Subjective Image Quality Assessment in Abdominal CT Protocols with Iterative Reconstruction

    Energy Technology Data Exchange (ETDEWEB)

    Mench, A [Salem Hospital, Salem, OR (United States); Lipnharski, I; Carranza, C; Lamoureux, R; Smajdor, L; Cormack, B; Mohammed, T; Rill, L; Arreola, M [University of Florida, Gainesville, FL (United States); Sinclair, L [Oregon Health & Science University, Portland, OR (United States)

    2015-06-15

    Purpose: New radiation dose reduction technologies are emerging constantly in the medical imaging field. The latest of these technologies, iterative reconstruction (IR) in CT, presents the ability to reduce dose significantly and hence provides great opportunity for CT protocol optimization. However, without effective analysis of image quality, the reduction in radiation exposure becomes irrelevant. This work explores the use of postmortem subjects as an image quality assessment medium for protocol optimizations in abdominal CT. Methods: Three female postmortem subjects were scanned using the Abdomen-Pelvis (AP) protocol at reduced minimum tube current and target noise index (SD) settings of 12.5, 17.5, 20.0, and 25.0. Images were reconstructed using two strengths of iterative reconstruction. Radiologists and radiology residents from several subspecialties were asked to evaluate 8 AP image sets including the current facility default scan protocol and 7 scans with the parameters varied as listed above. Images were viewed in the soft tissue window and scored on a 3-point scale as acceptable, borderline acceptable, and unacceptable for diagnosis. The facility default AP scan was identified to the reviewer while the 7 remaining AP scans were randomized and de-identified of acquisition and reconstruction details. The observers were also asked to comment on the subjective image quality criteria they used for scoring images. This included visibility of specific anatomical structures and tissue textures. Results: Radiologists scored images as acceptable or borderline acceptable for target noise index settings of up to 20. Due to the postmortem subjects’ close representation of living human anatomy, readers were able to evaluate images as they would those of actual patients. Conclusion: Postmortem subjects have already been proven useful for direct CT organ dose measurements. This work illustrates the validity of their use for the crucial evaluation of image quality during CT protocol optimization, especially when investigating the effects of new technologies.

  18. MO-DE-207B-01: JACK FOWLER JUNIOR INVESTIGATOR COMPETITION WINNER: Between Somatic Mutations and PET-Based Radiomic Features in Non-Small Cell Lung Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Yip, S; Coroller, T; Rios Velazquez, E; Parmar, C; Mak, R; Aerts, H [Brigham and Women’s Hospital, Dana Farber Cancer Institute, and Harvard Medical School, Boston, MA (United States); Kim, J [Brigham and Women’s Hospital, Boston Children’s Hospital and Harvard Medical School, Boston, MA (United States)

    2016-06-15

    Purpose: Although PET-based radiomic features have been proposed to quantify tumor heterogeneity and shown promise in outcome prediction, little is known about their relationship with tumor genetics. This study assessed the association of [{sup 18}F]fluorodeoxyglucose (FDG)-PET-based radiomic features with non-small cell lung cancer (NSCLC) mutations. Methods: 348 NSCLC patients underwent FDG-PET/CT scans before treatment and were tested for genetic mutations. 13% (44/348) and 28% (96/348) patients were found to harbor EGFR (EGFR+) and KRAS (KRAS+) mutations, respectively. We evaluated nineteen PET-based radiomic features quantifying phenotypic traits, and compared them with conventional PET features (metabolic tumor volume (MTV) and maximum-SUV). The association between the feature values and mutation status was evaluated using the Wilcoxcon-rank-sum-test. The ability of each measure to predict mutations was assessed by the area under the receiver operating curve (AUC). Noether’s test was used to determine if the AUCs were significantly from random (AUC=0.50). All p-values were corrected for multiple testing by controlling the false discovery rate (FDR{sub Wilcoxon} and FDR{sub Noether}) of 10%. Results: Eight radiomic features, MTV, and maximum-SUV, were significantly associated with the EGFR mutation (FDR{sub Wilcoxon}=0.01–0.10). However, KRAS+ demonstrated no significantly distinctive imaging features compared to KRAS− (FDR{sub Wilcoxon}≥0.92). EGFR+ and EGFR− were significantly discriminated by conventional PET features (AUC=0.61, FDR{sub Noether}=0.04 for MTV and AUC=0.64, FDR{sub Noether}=0.01 for maximum-SUV). Eight radiomic features were significantly predictive for EGFR+ compared to EGFR− (AUC=0.59–0.67, FDR{sub Noether}=0.0032–0.09). Normalized-inverse-difference-moment outperformed all features in predicting EGFR mutation (AUC=0.67, FDR{sub Noether}=0.0032). Moreover, only the radiomic feature normalized-inverse-difference-moment could significantly predict KRAS+ from EGFR+ (AUC=0.65, FDR{sub Noether}=0.05). All measures failed to predict KRAS+ from KRAS− (AUC=0.50–0.54, FDR{sub Noether}≥0.92). Conclusion: PET imaging features were strongly associated with EGFR mutations in NSCLC. Radiomic features have great potential in predicting EGFR mutations. Our study may help develop a non-invasive imaging biomarker for EGFR mutation. R.M. has consulting interests with Amgen.

  19. TU-CD-207-12: Impact of Anatomical Noise On Detection Performance of Microcalcifications in Multi-Contrast Breast Imaging

    Energy Technology Data Exchange (ETDEWEB)

    Garrett, J; Ge, Y; Li, K; Chen, G [University of Wisconsin, Madison, WI (United States)

    2015-06-15

    Purpose: The anatomical noise power spectra (NPS) for differential phase contrast (DPC) and dark field (DF) imaging have recently been characterized using a power-law model with two parameters, alpha and beta, an innovative extension to the methodology used in x-ray attenuation based breast imaging such as mammography, DBT, or cone-beam CT. Beta values of 3.6, 2.6, and 1.3 have been measured for absorption, DPC, and DF respectively for cadaver breasts imaged in the coronal plane; these dramatic differences should be reflected in their detection performance. The purpose of this study was to determine the impact of anatomical noise on breast calcification detection and compare the detection performance of the three contrast mechanisms of a multi-contrast x-ray imaging system. Methods: In our studies, a calcification image object was segmented out of the multi-contrast images of a cadaver breast specimen. 50 measured total NPS were measured from breast cadavers directly. The ideal model observer detectability was calculated for a range of doses (5–100%) and a range of calcification sizes (diameter = 0.25–2.5 mm). Results: Overall we found the highest average detectability corresponded to DPC imaging (7.4 for 1 mm calc.), with DF the next highest (3.8 for 1 mm calc.), and absorption the lowest (3.2 for 1 mm calc.). However, absorption imaging also showed the slowest dependence on dose of the three modalities due to the significant anatomical noise. DPC showed a peak detectability for calcifications ∼1.25 mm in diameter, DF showed a peak for calcifications around 0.75 mm in diameter, and absorption imaging had no such peak in the range explored. Conclusion: Understanding imaging performance for DPC and DF is critical to transition these modalities to the clinic. The results presented here offer new insight into how these modalities complement absorption imaging to maximize the likelihood of detecting early breast cancers. J. Garrett, Y. Ge, K. Li: Nothing to disclose. G.-H. Chen: Research funded, GE Healthcare; Research funded, Siemens AX.

  20. WE-AB-207A-01: BEST IN PHYSICS (IMAGING): High-Resolution Cone-Beam CT of the Extremities and Cancellous Bone Architecture with a CMOS Detector

    Energy Technology Data Exchange (ETDEWEB)

    Cao, Q; Brehler, M; Sisniega, A; Marinetto, E; Stayman, J; Siewerdsen, J; Zbijewski, W [Johns Hopkins University, Baltimore, MD (United States); Zyazin, A; Peters, I [Teledyne DALSA, Eindhoven (Netherlands); Yorkston, J [Carestream Health, Inc, Penfield, NY (United States)

    2016-06-15

    Purpose: Extremity cone-beam CT (CBCT) with an amorphous silicon (aSi) flat-panel detector (FPD) provides low-dose volumetric imaging with high spatial resolution. We investigate the performance of the newer complementary metal-oxide semiconductor (CMOS) detectors to enhance resolution of extremities CBCT to ∼0.1 mm, enabling morphological analysis of trabecular bone. Quantitative in-vivo imaging of bone microarchitecture could present an important advance for osteoporosis and osteoarthritis diagnosis and therapy assessment. Methods: Cascaded systems models of CMOS- and FPD-based extremities CBCT were implemented. Performance was compared for a range of pixel sizes (0.05–0.4 mm), focal spot sizes (0.3–0.6 FS), and x-ray techniques (0.05–0.8 mAs/projection) using detectability of high-, low-, and all-frequency tasks for a nonprewhitening observer. Test-bench implementation of CMOS-based extremity CBCT involved a Teledyne DALSA Xineos3030HR detector with 0.099 mm pixels and a compact rotating anode x-ray source with 0.3 FS (IMD RTM37). Metrics of bone morphology obtained using CMOS-based CBCT were compared in cadaveric specimens to FPD-based system using a Varian PaxScan4030 (0.194 mm pixels). Results: Finer pixel size and reduced electronic noise for CMOS (136 e compared to 2000 e for FPD) resulted in ∼1.9× increase in detectability for high-frequency tasks and ∼1.1× increase for all-frequency tasks. Incorporation of the new x-ray source with reduced focal spot size (0.3 FS vs. 0.5 FS used on current extremities CBCT) improved detectability for CMOS-based CBCT by ∼1.7× for high-frequency tasks. Compared to FPD CBCT, the CMOS detector yielded improved agreement with micro-CT in measurements of trabecular thickness (∼1.7× reduction in relative error), bone volume (∼1.5× reduction), and trabecular spacing (∼3.5× reduction). Conclusion: Imaging performance modelling and experimentation indicate substantial improvements for high-frequency imaging tasks through adoption of the CMOS detector and small FS x-ray source, motivating the use of these components in a new system for quantitative in-vivo imaging of trabecular bone. Financial Support: US NIH grant R01EB018896. Qian Cao is a Howard Hughes Medical Institute International Student Research Fellow. Disclosures: W Zbijewski, J Siewerdsen and A Sisniega receive research funding from Carestream Health.

  1. WE-EF-207-01: FEATURED PRESENTATION and BEST IN PHYSICS (IMAGING): Task-Driven Imaging for Cone-Beam CT in Interventional Guidance

    Energy Technology Data Exchange (ETDEWEB)

    Gang, G; Stayman, J; Ouadah, S; Siewerdsen, J [Johns Hopkins University, Baltimore, MD (United States); Ehtiati, T [Siemens Healthcare AX Division, Erlangen, DE (Germany)

    2015-06-15

    Purpose: This work introduces a task-driven imaging framework that utilizes a patient-specific anatomical model, mathematical definition of the imaging task, and a model of the imaging system to prospectively design acquisition and reconstruction techniques that maximize task-based imaging performance. Utility of the framework is demonstrated in the joint optimization of tube current modulation and view-dependent reconstruction kernel in filtered-backprojection reconstruction and non-circular orbit design in model-based reconstruction. Methods: The system model is based on a cascaded systems analysis of cone-beam CT capable of predicting the spatially varying noise and resolution characteristics as a function of the anatomical model and a wide range of imaging parameters. Detectability index for a non-prewhitening observer model is used as the objective function in a task-driven optimization. The combination of tube current and reconstruction kernel modulation profiles were identified through an alternating optimization algorithm where tube current was updated analytically followed by a gradient-based optimization of reconstruction kernel. The non-circular orbit is first parameterized as a linear combination of bases functions and the coefficients were then optimized using an evolutionary algorithm. The task-driven strategy was compared with conventional acquisitions without modulation, using automatic exposure control, and in a circular orbit. Results: The task-driven strategy outperformed conventional techniques in all tasks investigated, improving the detectability of a spherical lesion detection task by an average of 50% in the interior of a pelvis phantom. The non-circular orbit design successfully mitigated photon starvation effects arising from a dense embolization coil in a head phantom, improving the conspicuity of an intracranial hemorrhage proximal to the coil. Conclusion: The task-driven imaging framework leverages a knowledge of the imaging task within a patient-specific anatomical model to optimize image acquisition and reconstruction techniques, thereby improving imaging performance beyond that achievable with conventional approaches. 2R01-CA-112163; R01-EB-017226; U01-EB-018758; Siemens Healthcare (Forcheim, Germany)

  2. TU-CD-207-03: Time Evolution of Texture Parameters of Subtracted Images Obtained by Contrast-Enhanced Digital Mammography (CEDM)

    Energy Technology Data Exchange (ETDEWEB)

    Mateos, M-J; Brandan, M-E [Instituto de Fisica, Universidad Nacional Autonom de Mexico, Mexico, Distrito Federal (Mexico); Gastelum, A; Marquez, J [Centro de Ciencias Aplicadas y Desarrollo Tecnologico Universidad Nacional Autonoma de Mexico, Mexico, Distrito Federal (Mexico)

    2015-06-15

    Purpose: To evaluate the time evolution of texture parameters, based on the gray level co-occurrence matrix (GLCM), in subtracted images of 17 patients (10 malignant and 7 benign) subjected to contrast-enhanced digital mammography (CEDM). The goal is to determine the sensitivity of texture to iodine uptake at the lesion, and its correlation (or lack of) with mean-pixel-value (MPV). Methods: Acquisition of clinical images followed a single-energy CEDM protocol using Rh/Rh/48 kV plus external 0.5 cm Al from a Senographe DS unit. Prior to the iodine-based contrast medium (CM) administration a mask image was acquired; four CM images were obtained 1, 2, 3, and 5 minutes after CM injection. Temporal series were obtained by logarithmic subtraction of registered CM minus mask images.Regions of interest (ROI) for the lesion were drawn by a radiologist and the texture was analyzed. GLCM was evaluated at a 3 pixel distance, 0° angle, and 64 gray-levels. Pixels identified as registration errors were excluded from the computation. 17 texture parameters were chosen, classified according to similarity into 7 groups, and analyzed. Results: In all cases the texture parameters within a group have similar dynamic behavior. Two texture groups (associated to cluster and sum mean) show a strong correlation with MPV; their average correlation coefficient (ACC) is r{sup 2}=0.90. Other two groups (contrast, homogeneity) remain constant with time, that is, a low-sensitivity to CM uptake. Three groups (regularity, lacunarity and diagonal moment) are sensitive to CM uptake but less correlated with MPV; their ACC is r{sup 2}=0.78. Conclusion: This analysis has shown that, at least groups associated to regularity, lacunarity and diagonal moment offer dynamical information additional to the mean pixel value due to the presence of CM at the lesion. The next step will be the analysis in terms of the lesion pathology. Authors thank PAPIIT-IN105813 for support. Consejo Nacional de Ciencia Y Tecnologia, PAPIIT-IN105813.

  3. MO-DE-207A-06: ECG-Gated CT Reconstruction for a C-Arm Inverse Geometry X-Ray System

    Energy Technology Data Exchange (ETDEWEB)

    Slagowski, JM; Dunkerley, DAP [MA Speidel, University of Wisconsin - Madison, Madison, WI (United States)

    2016-06-15

    Purpose: To obtain ECG-gated CT images from truncated projection data acquired with a C-arm based inverse geometry fluoroscopy system, for the purpose of cardiac chamber mapping in interventional procedures. Methods: Scanning-beam digital x-ray (SBDX) is an inverse geometry fluoroscopy system with a scanned multisource x-ray tube and a photon-counting detector mounted to a C-arm. In the proposed method, SBDX short-scan rotational acquisition is performed followed by inverse geometry CT (IGCT) reconstruction and segmentation of contrast-enhanced objects. The prior image constrained compressed sensing (PICCS) framework was adapted for IGCT reconstruction to mitigate artifacts arising from data truncation and angular undersampling due to cardiac gating. The performance of the reconstruction algorithm was evaluated in numerical simulations of truncated and non-truncated thorax phantoms containing a dynamic ellipsoid to represent a moving cardiac chamber. The eccentricity of the ellipsoid was varied at frequencies from 1–1.5 Hz. Projection data were retrospectively sorted into 13 cardiac phases. Each phase was reconstructed using IGCT-PICCS, with a nongated gridded FBP (gFBP) prior image. Surface accuracy was determined using Dice similarity coefficient and a histogram of the point distances between the segmented surface and ground truth surface. Results: The gated IGCT-PICCS algorithm improved surface accuracy and reduced streaking and truncation artifacts when compared to nongated gFBP. For the non-truncated thorax with 1.25 Hz motion, 99% of segmented surface points were within 0.3 mm of the 15 mm diameter ground truth ellipse, versus 1.0 mm for gFBP. For the truncated thorax phantom with a 40 mm diameter ellipse, IGCT-PICCS surface accuracy measured 0.3 mm versus 7.8 mm for gFBP. Dice similarity coefficient was 0.99–1.00 (IGCT-PICCS) versus 0.63–0.75 (gFBP) for intensity-based segmentation thresholds ranging from 25–75% maximum contrast. Conclusions: The PICCS algorithm was successfully applied to reconstruct truncated IGCT projection data with angular undersampling resulting from simulated cardiac gating. Research supported by the National Heart, Lung, and Blood Institute of the NIH under award number R01HL084022. The content is solely the responsibility of the authors and does not necessarily represent the official views of the NIH.

  4. SU-F-207-07: Dual-Energy Computed Tomography Detection Limit of Various Radiopaque Contrast Agents That Can Be Infused Within Absorbable Inferior Vena Cava Filters

    Energy Technology Data Exchange (ETDEWEB)

    Melancon, A; Jacobsen, M; Salatan, F; Jones, A; Cody, D; Nute, J; Melancon, M [U.T.M.D Anderson Cancer Center, Houston, TX (United States)

    2015-06-15

    Purpose: Absorbable IVC filters are shown to be safe and efficacious in preventing pulmonary embolism. These absorbable filters disappear from the body after their required duration, alleviating costly removal procedures and downstream complications. Monitoring the positioning and integrity of absorbable devices using dual-energy computed tomography (DECT) would improve treatment efficacy. The purpose of this study is to determine the limit of detection and the energy dependence of DECT for various contrast agents that may be infused within the IVC filters including gold nanoparticles (AuNP) having diameters of 2 and 4 nm. Methods: All imaging studies were performed on a GE Discovery CT750 system in Gemstone Spectral Imaging (GSI) mode. Plastic vials containing the contrast agent solutions of water and blood were placed in a water bath, and images were acquired with the GSI-5 preset. The images were reformatted into the coronal plane and 5mm diameter ROIs were placed within each solution on a GE Advantage Workstation. Monoenergetic reconstructions were generated from 40 – 140 keV. Results: Mass attenuation (contrast per unit density) for AuNPs was greater than iron, but less than barium and iodine. Contrast was 10.2 (± 3.6) HU for 4 nm AuNP at 0.72 mg/ml and 12.1 (± 4.2) for 2 nm AuNP at 0.31 mg/ml at 70 keV suggesting reasonable chance of visualization at these concentrations for 70 keV reconstruction. The contrast as a function of CT energy is similar in both water and blood. Iodine is most dependent, followed closely by barium and iron, and trailed by a large margin by the AuNP. This was unexpected given Au’s large atomic number and the predominance of photoelectric effect at low energy. Conclusion: Infusion of IVC filters with AuNP is feasible. Discrimination of AuNP-infused IVC filters from surrounding anatomy warrants further investigation.

  5. WE-EF-207-04: An Inter-Projection Sensor Fusion (IPSF) Approach to Estimate Missing Projection Signal in Synchronized Moving Grid (SMOG) System

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, H; Kong, V; Jin, J [Georgia Regents University Cancer Center, Augusta, GA (Georgia); Ren, L; Zhang, Y; Giles, W [Duke University Medical Center, Durham, NC (United States)

    2015-06-15

    Purpose: A synchronized moving grid (SMOG) has been proposed to reduce scatter and lag artifacts in cone beam computed tomography (CBCT). However, information is missing in each projection because certain areas are blocked by the grid. A previous solution to this issue is acquiring 2 complimentary projections at each position, which increases scanning time. This study reports our first Result using an inter-projection sensor fusion (IPSF) method to estimate missing projection in our prototype SMOG-based CBCT system. Methods: An in-house SMOG assembling with a 1:1 grid of 3 mm gap has been installed in a CBCT benchtop. The grid moves back and forth in a 3-mm amplitude and up-to 20-Hz frequency. A control program in LabView synchronizes the grid motion with the platform rotation and x-ray firing so that the grid patterns for any two neighboring projections are complimentary. A Catphan was scanned with 360 projections. After scatter correction, the IPSF algorithm was applied to estimate missing signal for each projection using the information from the 2 neighboring projections. Feldkamp-Davis-Kress (FDK) algorithm was applied to reconstruct CBCT images. The CBCTs were compared to those reconstructed using normal projections without applying the SMOG system. Results: The SMOG-IPSF method may reduce image dose by half due to the blocked radiation by the grid. The method almost completely removed scatter related artifacts, such as the cupping artifacts. The evaluation of line pair patterns in the CatPhan suggested that the spatial resolution degradation was minimal. Conclusion: The SMOG-IPSF is promising in reducing scatter artifacts and improving image quality while reducing radiation dose.

  6. WE-A-207-00: In Memoriam of Jacques Ovadia - Reinvigorating Scientific Excellence: Electron Beam Therapy - Past, Present and Future

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2015-06-15

    The Medical Physics community lost one of its early pioneers in radiation oncology physics, Jacques Ovadia, who passed away in April of 2014 at the age of 90. Jacques received his Ph.D. in Nuclear Physics from the University of Illinois at Urbana in 1951. Subsequently, under the guidance of John Laughlin, he was introduced to the field of Medical Physics. When John moved to Memorial Sloan Kettering, Jacques followed him. There he gained clinical experience and expertise in the then cutting-edge field of high energy electron beam therapy. In 1956, Jacques joined Dr. Erich Uhlmann at Michael Reese Hospital in Chicago where one of the country’s first high energy medical linear accelerators had just been installed. During his 35 year tenure, Dr. Ovadia built a strong Medical Physics department that merged in 1984 with that of the University of Chicago. Jacques pioneered the use of high energy electron beams to treat deep seated tumors, multiple-field chest wall irradiation with variable electron energies, and even anticipated the current interest in high energy electron beam grid-therapy. At an early stage, he introduced a simulator, computerized treatment planning and in-house developed record and verify software. He retired in 1990 as Professor emeritus in Radiation and Cellular Biology at the University of Chicago. Dr. Ovadia was an early and strong supporter of AAPM. He was present at the Chicago ROMPS meeting where the decision was made to form an independent professional society for medical physics. He served as AAPM president in 1976. Jacques Ovadia is survived by his wife of 58 years, Florence, their daughter Corinne Graefe and son Marc Ovadia, MD, as well as four grandchildren and one great-grandchild. Jacques’ dynamic and ever enthusiastic personality inspired all who collaborated with him. He will be greatly missed.

  7. Introduction to Modern EW Systems. Edited by Andrea De Martino, Artech House, 2012; 417 pages. Price: £119.00, ISBN 978-1-60807-207-1

    Directory of Open Access Journals (Sweden)

    Shu-Kun Lin

    2013-01-01

    Full Text Available Master the latest electronic warfare (EW techniques and technologies related to on-board military platforms with this authoritative resource. You gain expert design guidance on technologies and equipment used to detect and identify emitter threats, giving you an advantage in the never-ending chess game between sensor guided weapons and EW systems. This unique book offers you deeper insight into EW systems principles of operation and their mathematical descriptions, arming you with better knowledge for your specific design applications.

  8. Antitumor agents. 207. Design, synthesis, and biological testing of 4beta-anilino-2-fluoro-4'-demethylpodophyllotoxin analogues as cytotoxic and antiviral agents.

    Science.gov (United States)

    VanVliet, D S; Tachibana, Y; Bastow, K F; Huang, E S; Lee, K H

    2001-04-26

    2-Fluoropodophyllotoxin (11) and several 4beta-anilino-2-fluoro-4'-O-demethyl analogues were synthesized and evaluated in both antineoplastic and antiviral assays. These compounds were moderately active against some cancer cell lines, but they were less active than the corresponding nonfluorinated analogues. Compound 11 exhibited the best activity against KB carcinoma with a GI(50) of approximately 30 nM. Most compounds exhibited moderate activity against HCMV with ID(50) and ID(90) values in the range of 1 microM and 4 microM, respectively. Both 9 and 11 showed an unusual 10-fold selectivity for HSV-2 compared to HSV-1.

  9. UGT2B17 genotype and the pharmacokinetic serum profile of testosterone during substitution therapy with testosterone undecanoate. A retrospective experience from 207 men with hypogonadism

    DEFF Research Database (Denmark)

    Bang, Anne Kirstine; Jørgensen, Niels; Rajpert-De Meyts, Ewa

    2013-01-01

    Background: Testosterone (T) is mainly excreted in the urine as testosterone glucuronide (TG). This glucuronidation is partly dependent on the UGT2B17 genotype, and TG excretion is therefore lower in men having the UGT2B17 deletion. However, the possible influence of UGT2B17 genotype on serum T...... during androgen therapy is unknown. We retrospectively investigated the possible association between the UGT2B17 gene polymorphism and serum T levels in hypogonadal men during Testosterone undecanoate (TU) substitution therapy. Subjects and Methods: Two hundred and seven patients treated with TU (Nebido...

  10. WE-G-207-04: Non-Local Total-Variation (NLTV) Combined with Reweighted L1-Norm for Compressed Sensing Based CT Reconstruction

    Energy Technology Data Exchange (ETDEWEB)

    Kim, H; Chen, J; Pouliot, J [University of California San Francisco, San Francisco, CA (United States)

    2015-06-15

    Purpose: Compressed sensing (CS) has been used for CT (4DCT/CBCT) reconstruction with few projections to reduce dose of radiation. Total-variation (TV) in L1-minimization (min.) with local information is the prevalent technique in CS, while it can be prone to noise. To address the problem, this work proposes to apply a new image processing technique, called non-local TV (NLTV), to CS based CT reconstruction, and incorporate reweighted L1-norm into it for more precise reconstruction. Methods: TV minimizes intensity variations by considering two local neighboring voxels, which can be prone to noise, possibly damaging the reconstructed CT image. NLTV, contrarily, utilizes more global information by computing a weight function of current voxel relative to surrounding search area. In fact, it might be challenging to obtain an optimal solution due to difficulty in defining the weight function with appropriate parameters. Introducing reweighted L1-min., designed for approximation to ideal L0-min., can reduce the dependence on defining the weight function, therefore improving accuracy of the solution. This work implemented the NLTV combined with reweighted L1-min. by Split Bregman Iterative method. For evaluation, a noisy digital phantom and a pelvic CT images are employed to compare the quality of images reconstructed by TV, NLTV and reweighted NLTV. Results: In both cases, conventional and reweighted NLTV outperform TV min. in signal-to-noise ratio (SNR) and root-mean squared errors of the reconstructed images. Relative to conventional NLTV, NLTV with reweighted L1-norm was able to slightly improve SNR, while greatly increasing the contrast between tissues due to additional iterative reweighting process. Conclusion: NLTV min. can provide more precise compressed sensing based CT image reconstruction by incorporating the reweighted L1-norm, while maintaining greater robustness to the noise effect than TV min.

  11. SU-F-207-09: Evaluating the Dosimetric Accuracy of Extended Field-Of-View CT Reconstructions Using Clinical Data with Real Patient Geometries

    Energy Technology Data Exchange (ETDEWEB)

    Shugard, E; Cheung, J; Pouliot, J; Chen, J [University of California San Francisco, San Francisco (United States); Mistry, N [Siemens Healthcare USA, Malvern, PA (United States)

    2015-06-15

    Purpose: To determine the accuracy of dose calculations performed with CT images reconstructed using extended field of view (FOV) algorithms. Methods: In this study we selected 6 radiotherapy patients (3 head and neck & 3 chest/pelvis) whose body circumferences extended past the 50 cm scan FOV in the treatment planning CT. Images acquired on a Siemens Sensation Open scanner, were reconstructed using the standard FOV (sFOV) and two different extended FOV algorithms, eFOV and HDFOV. A physician and dosimetrist identified the radiation target, critical organs, and external patient contour. A benchmark CT was created for each patient, consisting of an average of the 3 CT reconstructions with a density override applied to regions containing truncation artifacts, and was used to create an optimal radiation treatment plan. The plan was copied onto each reconstruction without density override and dose was recalculated. Results: The native sFOV dose calculations had the largest deviation from the benchmark (0.4 – 6.0%). Both the HDFOV and eFOV calculations showed improvement over the sFOV. For patients with a smooth patient contour, the HDFOV calculation had the least deviation from the benchmark (0.1–0.5%) compared to eFOV (0.4–1.8%). In cases with large amounts of tissue and irregular skin folds, the eFOV deviated the least from the benchmark (0.2–0.6%) compared to HDFOV (1.3–1.8%). It was observed that the eFOV scan has large image artifact in air with an average HU of −600 compared to the ideal of −1000. In these cases, the artifact in air appears to attenuate the dose and compensate for the missing tissue density. The HDFOV demonstrated minimal artifact in air. Conclusion: Both eFOV and HDFOV provide improved dose calculation accuracy. The HDFOV reconstruction provides a clearer patient border than the eFOV allowing for well-defined density overrides to be applied with minimal air artifact. This research was supported by Siemens Medical Solutions.

  12. Non-Destructive Assessment of Concrete Structures Reliability and Limits of Single and Combined Techniques State-of-the-Art Report of the RILEM Technical Committee 207-INR

    CERN Document Server

    2012-01-01

    This book gives information on non destructive techniques for assessment of concrete structures. It synthesizes the best of international knowledge about what techniques can be used for assessing material properties (strength) and structural properties (geometry, defects...). It describes how the techniques can be used so as to answer a series of usual questions, highlighting their capabilities and limits, and providing advices for a better use of techniques. It also focuses on possible combinations of techniques so as to improve the assessment. It is based on many illustrative examples and give in each case references to standards and guidelines.

  13. SU-D-207B-05: Robust Intra-Tumor Partitioning to Identify High-Risk Subregions for Prognosis in Lung Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Wu, J; Gensheimer, M; Dong, X; Rubin, D; Napel, S; Diehn, M; Loo, B; Li, R [Stanford University, Palo Alto, CA (United States)

    2016-06-15

    Purpose: To develop an intra-tumor partitioning framework for identifying high-risk subregions from 18F-fluorodeoxyglucose positron emission tomography (FDG-PET) and CT imaging, and to test whether tumor burden associated with the high-risk subregions is prognostic of outcomes in lung cancer. Methods: In this institutional review board-approved retrospective study, we analyzed the pre-treatment FDG-PET and CT scans of 44 lung cancer patients treated with radiotherapy. A novel, intra-tumor partitioning method was developed based on a two-stage clustering process: first at patient-level, each tumor was over-segmented into many superpixels by k-means clustering of integrated PET and CT images; next, tumor subregions were identified by merging previously defined superpixels via population-level hierarchical clustering. The volume associated with each of the subregions was evaluated using Kaplan-Meier analysis regarding its prognostic capability in predicting overall survival (OS) and out-of-field progression (OFP). Results: Three spatially distinct subregions were identified within each tumor, which were highly robust to uncertainty in PET/CT co-registration. Among these, the volume of the most metabolically active and metabolically heterogeneous solid component of the tumor was predictive of OS and OFP on the entire cohort, with a concordance index or CI = 0.66–0.67. When restricting the analysis to patients with stage III disease (n = 32), the same subregion achieved an even higher CI = 0.75 (HR = 3.93, logrank p = 0.002) for predicting OS, and a CI = 0.76 (HR = 4.84, logrank p = 0.002) for predicting OFP. In comparison, conventional imaging markers including tumor volume, SUVmax and MTV50 were not predictive of OS or OFP, with CI mostly below 0.60 (p < 0.001). Conclusion: We propose a robust intra-tumor partitioning method to identify clinically relevant, high-risk subregions in lung cancer. We envision that this approach will be applicable to identifying useful imaging biomarkers in many cancer types.

  14. SU-D-207B-07: Development of a CT-Radiomics Based Early Response Prediction Model During Delivery of Chemoradiation Therapy for Pancreatic Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Klawikowski, S; Christian, J; Schott, D; Zhang, M; Li, X [Medical College of Wisconsin, Milwaukee, WI (United States)

    2016-06-15

    Purpose: Pilot study developing a CT-texture based model for early assessment of treatment response during the delivery of chemoradiation therapy (CRT) for pancreatic cancer. Methods: Daily CT data acquired for 24 pancreatic head cancer patients using CT-on-rails, during the routine CT-guided CRT delivery with a radiation dose of 50.4 Gy in 28 fractions, were analyzed. The pancreas head was contoured on each daily CT. Texture analysis was performed within the pancreas head contour using a research tool (IBEX). Over 1300 texture metrics including: grey level co-occurrence, run-length, histogram, neighborhood intensity difference, and geometrical shape features were calculated for each daily CT. Metric-trend information was established by finding the best fit of either a linear, quadratic, or exponential function for each metric value verses accumulated dose. Thus all the daily CT texture information was consolidated into a best-fit trend type for a given patient and texture metric. Linear correlation was performed between the patient histological response vector (good, medium, poor) and all combinations of 23 patient subgroups (statistical jackknife) determining which metrics were most correlated to response and repeatedly reliable across most patients. Control correlations against CT scanner, reconstruction kernel, and gated/nongated CT images were also calculated. Euclidean distance measure was used to group/sort patient vectors based on the data of these trend-response metrics. Results: We found four specific trend-metrics (Gray Level Coocurence Matrix311-1InverseDiffMomentNorm, Gray Level Coocurence Matrix311-1InverseDiffNorm, Gray Level Coocurence Matrix311-1 Homogeneity2, and Intensity Direct Local StdMean) that were highly correlated with patient response and repeatedly reliable. Our four trend-metric model successfully ordered our pilot response dataset (p=0.00070). We found no significant correlation to our control parameters: gating (p=0.7717), scanner (p=0.9741), and kernel (p=0.8586). Conclusion: We have successfully created a CT-texture based early treatment response prediction model using the CTs acquired during the delivery of chemoradiation therapy for pancreatic cancer. Future testing is required to validate the model with more patient data.

  15. MO-DE-207A-02: A Feature-Preserving Image Reconstruction Method for Improved Pancreaticlesion Classification in Diagnostic CT Imaging

    Energy Technology Data Exchange (ETDEWEB)

    Xu, J; Tsui, B [Johns Hopkins University, Baltimore, MD (United States); Noo, F [University of Utah, Salt Lake City, UT (United States)

    2016-06-15

    Purpose: To develop a feature-preserving model based image reconstruction (MBIR) method that improves performance in pancreatic lesion classification at equal or reduced radiation dose. Methods: A set of pancreatic lesion models was created with both benign and premalignant lesion types. These two classes of lesions are distinguished by their fine internal structures; their delineation is therefore crucial to the task of pancreatic lesion classification. To reduce image noise while preserving the features of the lesions, we developed a MBIR method with curvature-based regularization. The novel regularization encourages formation of smooth surfaces that model both the exterior shape and the internal features of pancreatic lesions. Given that the curvature depends on the unknown image, image reconstruction or denoising becomes a non-convex optimization problem; to address this issue an iterative-reweighting scheme was used to calculate and update the curvature using the image from the previous iteration. Evaluation was carried out with insertion of the lesion models into the pancreas of a patient CT image. Results: Visual inspection was used to compare conventional TV regularization with our curvature-based regularization. Several penalty-strengths were considered for TV regularization, all of which resulted in erasing portions of the septation (thin partition) in a premalignant lesion. At matched noise variance (50% noise reduction in the patient stomach region), the connectivity of the septation was well preserved using the proposed curvature-based method. Conclusion: The curvature-based regularization is able to reduce image noise while simultaneously preserving the lesion features. This method could potentially improve task performance for pancreatic lesion classification at equal or reduced radiation dose. The result is of high significance for longitudinal surveillance studies of patients with pancreatic cysts, which may develop into pancreatic cancer. The Senior Author receives financial support from Siemens GmbH Healthcare.

  16. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    Energy Technology Data Exchange (ETDEWEB)

    Koziorowski, J

    1998-10-01

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on {sup 211}At and {sup 124}I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[{sup 211}At]astato-2`-deoxyuridine (AUdR) and N-succinimidyl-4-[{sup 211}At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [{sup 124}I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[{sup 124}I]iodo-2`-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for

  17. Semente residual do urucum na alimentação de poedeiras comerciais: desempenho e características dos ovos - DOI: 10.4025/actascianimsci.v29i2.207 Annato seed byproduct used as a source of pigment in laying hen diets - DOI: 10.4025/actascianimsci.v29i2.207

    Directory of Open Access Journals (Sweden)

    Rafaele Ferreira Moreira

    2007-11-01

    Full Text Available O experimento foi conduzido para avaliar o efeito da inclusão da semente residual de urucum (SRU sobre o desempenho e qualidade dos ovos de poedeiras comerciais alimentadas com rações contendo sorgo. Cento e quarenta e quatro poedeiras comerciais foram distribuídas em um delineamento inteiramente ao acaso com seis tratamentos e seis repetições de quatro aves. Os tratamentos consistiram em uma ração � base de milho e, as demais, � base de sorgo com a inclusão de 0,0; 0,5; 1,0;1,5 e 2,0% de SRU. As variáveis: consumo de ração, percentagem de postura, peso e massa de ovo, conversão alimentar, percentagem de gema, albúmem e casca e unidades Haugh não foram afetadas significativamente pelos níveis de inclusão de SRU. Entretanto, a pigmentação da gema aumentou linearmente com o aumento de SRU na ração. A inclusão de 2% de SRU em rações contendo sorgo foi capaz de pigmentar as gemas em, aproximadamente, 61,4% da pigmentação obtida em rações compostas por milho.This experiment was conducted to evaluate the effect of inclusion of annatto (Bixa orellana L. seed byproduct (ASB in diets with sorghum on laying hens performance and eggs characteristics. A hundred and forty-four laying hens were randomly allotted to six treatments and six replications with four birds each. Treatments consisted of one diet based on corn and the five others based on sorghum with the inclusion of 0.0; 0.5; 1.0; 1.5 and 2.0% of ASB. Feed intake, egg production, egg weight, egg mass, feed conversion, yolk, albumen and shell percentages and Haugh units were not affected by the inclusion levels of ASB. However, yolk colour increased linearly as ASB increased in diet. The inclusion of 2% of annatto seed byproduct on laying hens diets based on sorghum improves egg yolk colour nearly 61.4% of that obtained with birds fed diet based on yellow corn.

  18. A new sisorid catfish of the genus Gagata Bleeker from India

    NARCIS (Netherlands)

    Tilak, R.

    1970-01-01

    CONTENTS Introduction .................. 207 Description................... 207 Sexual dimorphism................. 211 Relationships .................. 211 A key to the species of the allied genera, Gagata Bleeker etc....... 213 Acknowledgements................. 215 References................... 215

  19. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...

  20. ORF Alignment: NC_006347 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available FLMLNTHFDHVGTEARRNSALLIIDKIKEIAGTHPAMMTGDFNVSEEWEAYKT 207 ... DKTTGKEFLMLNTHFDHVGTEARRNSALLIIDKIKEIAGTHPAM...MTGDFNVSEEWEAYKT Sbjct: 121 DKTTGKEFLMLNTHFDHVGTEARRNSALLIIDKIKEIAGTHPAMMTGD

  1. SU-D-207A-07: The Effects of Inter-Cycle Respiratory Motion Variation On Dose Accumulation in Single Fraction MR-Guided SBRT Treatment of Renal Cell Carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Stemkens, B; Glitzner, M; Kontaxis, C; Prins, F; Crijns, SPM; Kerkmeijer, L; Lagendijk, J; Berg, CAT van den; Tijssen, RHN [Department of Radiotherapy, University Medical Center Utrecht, Utrecht (Netherlands); Denis de Senneville, B [Imaging Division, University Medical Center Utrecht, Utrecht (Netherlands); IMB, UMR 5251 CNRS/University of Bordeaux (France)

    2016-06-15

    Purpose: To assess the dose deposition in simulated single-fraction MR-Linac treatments of renal cell carcinoma, when inter-cycle respiratory motion variation is taken into account using online MRI. Methods: Three motion characterization methods, with increasing complexity, were compared to evaluate the effect of inter-cycle motion variation and drifts on the accumulated dose for an SBRT kidney MR-Linac treatment: 1) STATIC, in which static anatomy was assumed, 2) AVG-RESP, in which 4D-MRI phase-volumes were time-weighted, based on the respiratory phase and 3) PCA, in which 3D volumes were generated using a PCA-model, enabling the detection of inter-cycle variations and drifts. An experimental ITV-based kidney treatment was simulated in a 1.5T magnetic field on three volunteer datasets. For each volunteer a retrospectively sorted 4D-MRI (ten respiratory phases) and fast 2D cine-MR images (temporal resolution = 476ms) were acquired to simulate MR-imaging during radiation. For each method, the high spatio-temporal resolution 3D volumes were non-rigidly registered to obtain deformation vector fields (DVFs). Using the DVFs, pseudo-CTs (generated from the 4D-MRI) were deformed and the dose was accumulated for the entire treatment. The accuracies of all methods were independently determined using an additional, orthogonal 2D-MRI slice. Results: Motion was most accurately estimated using the PCA method, which correctly estimated drifts and inter-cycle variations (RMSE=3.2, 2.2, 1.1mm on average for STATIC, AVG-RESP and PCA, compared to the 2DMRI slice). Dose-volume parameters on the ITV showed moderate changes (D99=35.2, 32.5, 33.8Gy for STATIC, AVG-RESP and PCA). AVG-RESP showed distinct hot/cold spots outside the ITV margin, which were more distributed for the PCA scenario, since inter-cycle variations were not modeled by the AVG-RESP method. Conclusion: Dose differences were observed when inter-cycle variations were taken into account. The increased inter-cycle randomness in motion as captured by the PCA model mitigates the local (erroneous) hotspots estimated by the AVG-RESP method.

  2. SU-D-207A-02: Possible Characterization of the Brain Tumor Vascular Environment by a Novel Strategy of Quantitative Analysis in Dynamic Contrast Enhanced MR Imaging: A Combination of Both Patlak and Logan Analyses

    Energy Technology Data Exchange (ETDEWEB)

    Yee, S; Chinnaiyan, P; Wloch, J; Pirkola, M; Yan, D [Beaumont Health System, Royal Oak, MI (United States)

    2016-06-15

    Purpose: The majority of quantitative analyses involving dynamic contrast enhanced (DCE) MRI have been performed to obtain kinetic parameters such as Ktrans and ve. Such analyses are generally performed assuming a “reversible” tissue compartment, where the tracer is assumed to be rapidly equilibrated between the plasma and tissue compartments. However, some tumor vascular environments may be more suited for a “non-reversible” tissue compartment, where, as with FDG PET imaging, the tracer is continuously deposited into the tissue compartment (or the return back to the plasma compartment is very slow in the imaging time scale). Therefore, Patlak and Logan analyses, which represent tools for the “non-reversible” and “reversible” modeling, respectively, were performed to better characterize the brain tumor vascular environment. Methods: A voxel-by-voxel analysis was performed to generate both Patlak and Logan plots in two brain tumor patients, one with grade III astrocytoma and the other with grade IV astrocytoma or glioblastoma. The slopes of plots and the r-square were then obtained by linear fitting and compared for each voxel. Results: The 2-dimensional scatter plots of Logan (Y-axis) vs. Patlak slopes (X-axis) clearly showed increased Logan slopes for glioblastoma (Figure 3A). The scatter plots of goodness-of-fit (Figure 3B) also suggested glioblastoma, relative to grade III astrocytoma, might consist of more voxels that are kinetically Logan-like (i.e. rapidly equilibrated extravascular space and active vascular environment). Therefore, the enhanced Logan-like behavior (and the Logan slope) in glioblastoma may imply an increased fraction of active vascular environment, while the enhanced Patlak-like behavior implies the vascular environment permitting a relatively slower washout of the tracer. Conclusion: Although further verification is required, the combination of Patlak and Logan analyses in DCE MRI may be useful in characterizing the tumor vascular environment, and thus, may have implications in tumor grading and monitoring response to anti-vascular therapy.

  3. Multibeam collection for KN207-02: Multibeam data collected aboard Knorr from 2012-05-09 to 2012-06-11, departing from St. George's, Bermuda and returning to Ponta Delgada, Azores

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  4. MO-DE-207B-11: Reliability of PET/CT Radiomics Features in Functional and Morphological Components of NSCLC Lesions: A Repeatability Analysis in a Prospective Multicenter Cohort

    Energy Technology Data Exchange (ETDEWEB)

    Desseroit, M [INSERM, LaTIM UMR 1101, Brest (France); EE DACTIM, CHU de Poitiers, Poitiers (France); Tixier, F; Cheze Le Rest, C [EE DACTIM, CHU de Poitiers, Poitiers (France); Majdoub, M; Visvikis, D; Hatt, M [INSERM, LaTIM UMR 1101, Brest (France); Weber, W [Memorial Sloan Kettering Cancer Center, New-york, NY (United States); Siegel, B [Washington University School of Medicine, St Louis, MO (United States)

    2016-06-15

    Purpose: The goal of this study was to evaluate the repeatability of radiomics features (intensity, shape and heterogeneity) in both PET and low-dose CT components of test-retest FDG-PET/CT images in a prospective multicenter cohort of 74 NSCLC patients from ACRIN 6678 and a similar Merck trial. Methods: Seventy-four patients with stage III-IV NCSLC were prospectively included. The primary tumor and up to 3 additional lesions per patient were analyzed. The Fuzzy Locally Adaptive Bayesian algorithm was used to automatically delineate metabolically active volume (MAV) in PET. The 3D SlicerTM software was exploited to delineate anatomical volumes (AV) in CT. Ten intensity first-order features, as well as 26 textural features and four 3D shape descriptors were calculated from tumour volumes in both modalities. The repeatability of each metric was assessed by Bland-Altman analysis. Results: One hundred and five lesions (primary tumors and nodal or distant metastases) were delineated and characterized. The MAV and AV determination had a repeatability of −1.4±11.0% and −1.2±18.7% respectively. Several shape and heterogeneity features were found to be highly or moderately repeatable (e.g., sphericity, co-occurrence entropy or intensity size-zone matrix zone percentage), whereas others were confirmed as unreliable with much higher variability (more than twice that of the corresponding volume determination). Conclusion: Our results in this large multicenter cohort with more than 100 measurements confirm the PET findings in previous studies (with <30 lesions). In addition, our study is the first to explore the repeatability of radiomics features in the low-dose CT component of PET/CT acquisitions (previous studies considered dosimetry CT, CE-CT or CBCT). Several features were identified as reliable in both PET and CT components and could be used to build prognostic models. This work has received a French government support granted to the CominLabs excellence laboratory and managed by the National Research Agency in the “Investing for the Future” program under reference ANR-10-LABX-07-01, and support from the city of Brest.

  5. EVALUACIÓN DE LA MATERIA ORGÁNICA EN EL RÍO FRÍO SOPORTADA EN EL QUAL2K Versión 2.07

    Directory of Open Access Journals (Sweden)

    JORGE VIRGILIO RIVERA GUTIRREZ

    2011-01-01

    Full Text Available El presente artículo estudia el comportamiento de la materia orgánica como carga contaminante en la zona más impactada del río Frío ubicada al sur occidente del Departamento de Santander. El modelamiento condiciona una calibración para minimizar el error paramétrico de las variables que soportan la degradación de la carga orgánica. La información del sistema hidrogeométrico, oxígeno disuelto, carbono, nitrógeno, patógenos y variables meteorológicas son necesarias para el modelamiento. El error paramétrico es calculado aplicando el algoritmo de Monte Carlo y la probabilidad de incertidumbre generalizada, GLUE, sigla inglesa que signifi ca (Generalized Likelihood Uncertainty Estimation. Los parámetros o tasas cinéticas presentan un coefi ciente de determinación (R2 promedio de 0.88 y las variables 0.92. El estudio de la simulación muestra como 61.9 ton.d-1 de carga orgánica vertidas por 38,3000 habitantes de Floridablanca y Bucaramanga, acumulan en el río 16.85 ton.d-1 generando cambios en el balance del oxígeno disuelto como resultado del aumento del carbono y nitrógeno orgánico.

  6. RX-207, a Small Molecule Inhibitor of Protein Interaction with Glycosaminoglycans (SMIGs), Reduces Experimentally Induced Inflammation and Increases Survival Rate in Cecal Ligation and Puncture (CLP)-Induced Sepsis

    Czech Academy of Sciences Publication Activity Database

    Juhás, Štefan; Harris, N.; Ilková, G.; Rehák, P.; Zsila, F.; Kogan, F. Y.; Lahmy, O.; Zhuk, R.; Gregor, P.; Koppel, J.

    2018-01-01

    Roč. 41, č. 1 (2018), s. 307-314 ISSN 0360-3997 Institutional support: RVO:67985904 Keywords : heparin binding protein * glycosaminoglycan * neutrophil Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.955, year: 2016

  7. Multibeam collection for KN207-01: Multibeam data collected aboard Knorr from 2012-04-21 to 2012-05-04, Woods Hole, MA to St. George's, Bermuda

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  8. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC207 (Link to dictyBase) - - - - VFC207P (Link to Original site) VFC207F 245 VFC207Z...to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb...factor 1 alpha. 498 0.0 5 AF016242 |AF016242.1 Dictyostelium discoideum protein synthesis elongation...cytoskeletal 4.0 %: vesicles of secretory system >> prediction for VFC207 is nuc 5' end seq. ID VFC207F 5' end

  9. Gclust Server: 33526 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Cluster Sequences Related Sequences(4) 207 curli production assembly/transport component CsgG, putative 3...Sequence length 207 Representative annotation curli production assembly/transport component CsgG, putative Number

  10. ORF Alignment: NC_003228 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available VATFNIRYDNPGDSLNSWKYRKEKVCEFIREKHPDVLGMQEVLNHQLKDLLSGLPDYAY 60 ... Query: 148 DKTTGKEFLMLNTHFDHVGTEARRNSALLIIDKIKEIAGTHPAM...MTGDFNVSEEWEAYKT 207 ... DKTTGKEFLMLNTHFDHVGTEARRNSALLIIDKIKEIAGTHPAM...MTGDFNVSEEWEAYKT Sbjct: 121 DKTTGKEFLMLNTHFDHVGTEARRNSALLIIDKIKEIAGTHPAMMTGDFNVSEEWEAYKT 180 ... Query: 2

  11. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    Directory of Open Access Journals (Sweden)

    Ali BAYRAM

    1998-03-01

    Full Text Available In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 10, 50 and 259 mm/min. Strength properties of dual-phase steels were investigated depending on annealing temperature, ratio of martensite and loading rate.

  12. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  13. Nuclear and in-source laser spectroscopy with the ISAC yield station

    Energy Technology Data Exchange (ETDEWEB)

    Kunz, Peter, E-mail: pkunz@triumf.ca; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning [TRIUMF, 4004 Wesbrook Mall, Vancouver, British Columbia V6T 2A3 (Canada); Andreoiu, Corina; Wong, Fiona [Department of Chemistry, Simon Fraser University, Burnaby, British Columbia V5A 1S6 (Canada)

    2014-05-15

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10{sup 11} ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of {sup 46}K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  14. Nuclear and in-source laser spectroscopy with the ISAC yield station.

    Science.gov (United States)

    Kunz, Peter; Andreoiu, Corina; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning; Wong, Fiona

    2014-05-01

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10(11) ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of (46)K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  15. Radiopharmaceutical chemistry of targeted radiotherapeutics, part 4: Strategies for211At labeling at high activities and radiation doses of211At α-particles.

    Science.gov (United States)

    Pozzi, Oscar R; Zalutsky, Michael R

    2017-03-01

    Alpha particles are radiation of high energy and short range, properties that can lead to radiolysis-mediated complications in labeling chemistry at the high radioactivity levels required for clinical application. In previous papers in this series, we have shown that radiation dose has a profound effect on the astatine species that are present in the labeling reaction and their suitability for the synthesis of N-succinimidyl 3-[ 211 At]astatobenzoate. The purpose of this study was to evaluate the effects of adding N-chlorosuccinimide (NCS) to the methanol solution used for initial isolation of 211 At after distillation, a process referred to as 211 At stabilization, on 211 At chemistry after exposure to high radiation doses. High performance liquid chromatography was used to evaluate the distribution of 211 At species present in methanol in the 500-65,000Gy radiation dose range and the synthesis of SAB from N-succinimidyl 3-(tri-n-butylstannyl)benzoate in the 500-120,000Gy radiation dose range using different 211 At timeactivity combinations under conditions with/without 211 At stabilization. In the absence of NCS stabilization, a reduced form of astatine, At(2), increased with increasing radiation dose, accounting for about half the total activity by about 15,000Gy, while with stabilization, At(2) accounted for 60,000Gy. SAB yields without stabilization rapidly declined with increasing dose, falling to ~20% at about 5000Gy while with stabilization, yields >80% were obtained with 211 At solutions stored for more than 23h and receiving radiation doses >100,000Gy. Adding NCS to the methanol solution used for initial isolation of 211 At is a promising strategy for countering the deleterious effects of radiolysis on 211 At chemistry. This strategy could facilitate the ability to perform 211 At labeling at sites remote from its production and at the high activity levels required for clinical applications. Copyright © 2016 Elsevier Inc. All rights reserved.

  16. Novel Transgenic Mouse Model of Polycystic Kidney Disease.

    Science.gov (United States)

    Kito, Yusuke; Saigo, Chiemi; Takeuchi, Tamotsu

    2017-09-01

    Transmembrane protein 207 (TMEM207) is characterized as an important molecule for invasiveness of gastric signet-ring cell carcinoma cells. To clarify the pathobiological effects of TMEM207, we generated 13 transgenic mouse strains, designated C57BL/6-transgenic (Tg) (ITF-TMEM207), where the mouse Tmem207 is ectopically expressed under the proximal promoter of the murine intestinal trefoil factor gene. A C57BL/6-Tg (ITF-TMEM207) mouse strain unexpectedly exhibited a high incidence of spontaneous kidney cysts with histopathological features resembling human polycystic kidney disease, which were found in approximately all mice within 1 year. TMEM207 immunoreactivity was found in noncystic kidney tubules and in renal cysts of the transgenic mice. The ITF-TMEM207 construct was inserted into Mitf at chromosome 6. Cystic kidney was not observed in other C57BL/6-Tg (ITF-TMEM207) transgenic mouse strains. Although several genetically manipulated animal models exist, this mouse strain harboring a genetic mutation in Mitf and overexpression of Tmem207 protein was not reported as a model of polycystic kidney disease until now. This study demonstrates that the C57BL/6-Tg (ITF-TMEM207) mouse may be a suitable model for understanding human polycystic kidney disease. Copyright © 2017 American Society for Investigative Pathology. Published by Elsevier Inc. All rights reserved.

  17. Scholars in International Relations Cite Books More Frequently than Journals: More Research is Needed to Better Understand Research Behaviour and Use. A Review of: Zhang, Li. ʺCitation Analysis for Collection Development: A Study of International Relations Journal Literature.ʺ Library Collections, Acquisitions, and Technical Services 31.3‐4 (2007: 195‐207.

    Directory of Open Access Journals (Sweden)

    Megan von Isenburg

    2009-09-01

    Full Text Available Objective – To determine primary type, format, language and subject category of research materials used by U.S. scholars of international relations. Also, to investigate whether research method, qualitative or quantitative, can be correlated with the type and age of sources that scholars use.Design – Citation analysis.Setting – Research articles published in three journals on international relations with high impact factors: International Organization, International Studies Quarterly, and World Politics.Subjects – A random sample of cited references taken from the 410 full‐length research articles published in these journals from 2000 to 2005. Cited references of articles written by authors of foreign institutions (i.e., non‐American institutions, as well as cited references of editorial and research notes, comments, responses, and review essays were excluded.Methods – Cited references were exported from ISI’s Social Science Citation Index (SSCI to MS Excel spreadsheets for analysis. Data was verified against original reference lists. Citations were numbered and identified by source format, place of publication (foreign or domestic, age, and language used, if other than English. The author used a random number generator to select a random sample of 651 from a total of 29,862 citations. Citations were randomly drawn from each journal according to the proportion of the journals’ citations to the total. These citations were analyzed by material type and language. The author also used the Library of Congress Classification Outline to identify the subject category of each book and journal citation in the sample. A separate sampling method was used to investigate if there is a relationship between research methodology and citation behaviour. Each of the original 410 articles was categorized according to research method: quantitative, qualitative or a combination of the two. Two articles representing qualitative research and two representing quantitative research were randomly selected from each of the three journals for each of the six years. Subsequently, five citations from each of the resulting pool of 72 articles were randomly selected to create a sample of 360 citations. These citations were analyzed by material type and age of source.Main Results – Analysis of the citation data showed that books (including monographs, edited books, book chapters and dictionaries made up 48.2% of the total citations; journals (including scholarly and non‐scholarly titles made up 38.4% of the citations; and government publications made up 4.5% of the citations. Electronic resources, which primarily refer to Web sites and digital collections in this study, represented 1.7% of the citations. Other sources of citations included magazines (1.1%, newspapers (1.1%, working papers (1.1%, theses (0.9%, conference papers not yet published as articles (0.6%, and a miscellaneous category, which included items such as committee minutes, radio broadcasts, unpublished materials and personal communications (2.5%. The average age of book citations was 14.3 years and the median age was 8 years. Foreign language citations represented 3.7% of the 651 total citations. The top ranked foreign languages were German (7, French (5, Russian (4, Spanish (3, Korean (2 and Swedish (number not given. Subject analysis of the citations revealed that 38% of all citations were from international relations and two related disciplines, political science, political theory, and public administration. Subject areas outside international relations included social sciences (23.4% ‐ including economics, commerce, industries and finance, history (16.3%, sociology (6.2%, and law (5.9%. Citations from philosophy, psychology, military science and general works together made up 7.3% of the total citations. Citations from science, linguistics, literature, geography and medicine made up less than 2% of the total.Authors of qualitative research articles were more likely to cite books (56.7% than journals (29.4% while authors of quantitative research articles were more likely to cite journals (58.3% than books (28.9%. Authors of qualitative research articles were also more likely to cite government publications and electronic resources than those of quantitative articles. However, authors of quantitative research articles were more likely to cite other materials, such as dissertations, conference papers, working papers and unpublished materials.The age of cited materials for both qualitative and quantitative research articles is similar. Citations to recent materials up to 5 years old were most frequent, followed by materials 6 to 10 years old, materials 11 to 15 years old, and those 26 or more years old. The least frequently cited materials were 16 to 20 and 21 to 25 years old.Conclusion – Scholars in international relations primarily cite books, followed by journals and government publications. Citations to electronic resources such as Web sites and digital collections, and to other materials are far less common. Scholars primarily cite English‐language materials on international relations and related subjects. Authors of qualitative research articles are more likely to cite books than journals, while authors of quantitative research articles are more likely to cite journals than books. Recent materials are more frequently cited than older materials, though materials that are more than 26 years old are still being cited regularly.

  18. ORF Alignment: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available AEIARRSGLSAQTASVIMRSLEADGLLVRGAPVRGRVGQ 60 ... Query: 148 KLEGQLGPGERGRIAGVGIATPFELWNWSEEVGAPREEMDR...WRDFDLQAAVASRIRHPVF 207 ... KLEGQLGPGERGRIAGVGIATPFELWNWSEEVGAPREEMDRWRDFDLQAAVASRIRHP...VF Sbjct: 121 KLEGQLGPGERGRIAGVGIATPFELWNWSEEVGAPREEMDRWRDFDLQAAVASRIRHPVF 180 ... Query: 268 GKDGKSTQLLKIASVFV

  19. 42 CFR Appendix A to Part 81 - Glossary of ICD-9 Codes and Their Cancer Descriptions 1

    Science.gov (United States)

    2010-10-01

    ... leukemia 205 Myeloid leukemia. 206 Monocytic leukemia. 207 Other specified leukemia. 208 Leukemia of unspecified cell type. 1 The International Classification of Diseases Clinical Modification (9th Revision...

  20. Fishery potential of the Thana - Bassein creek system

    Digital Repository Service at National Institute of Oceanography (India)

    Jyothi, E.A.; Nair, V.R.

    stream_size 4 stream_content_type text/plain stream_name J_Indian_Fish_Assoc_20_7.pdf.txt stream_source_info J_Indian_Fish_Assoc_20_7.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  1. The decorin sequence SYIRIADTNIT binds collagen type I

    DEFF Research Database (Denmark)

    Kalamajski, Sebastian; Aspberg, Anders; Oldberg, Ake

    2007-01-01

    -directed mutagenesis of this 54-residue-long collagen-binding sequence identifies Arg-207 and Asp-210 in leucine-rich repeat 6 as crucial for the binding to collagen. The synthetic peptide SYIRIADTNIT, which includes Arg-207 and Asp-210, inhibits the binding of full-length recombinant decorin to collagen in vitro...

  2. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana; Volume 37; Issue 2. Issue front cover thumbnail. Volume 37, Issue 2. April 2012, pages 207-318. pp 207-222. Enhancement of cell characteristics via baffle blocks in a proton exchange membrane fuel cell · Atilla Biyikoglu Hülya Oztoprak · More Details Abstract Fulltext PDF. In this study, the effects ...

  3. EPA STANDARDS NETWORK FACT SHEET: ISO 14000: INTERNATIONAL ENVIRONMENTAL MANAGEMENT STANDARDS

    Science.gov (United States)

    This flyer provides an overview of the ISO 14000 series of International standards, supplying a brief history, structure of the Technical Committee (TC) 207, structure of the U.S. Technical Advisory Group (TAG) to ISO TC-207, status of the Standards development as of June 1997, w...

  4. Protoplasting impact on polyketide activity and characterization of ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-09-03

    Sep 3, 2008 ... biosynthesis encoding genes in local Streptomyces spp. CN207 was studied. The frequency of ... antibiotics cluster genes by fusion and provide a starting point for genetic and biochemical investigations of CN207 ... recombination studies on Streptomyces using Strepto- myce coelicolor. The protoplast ...

  5. 75 FR 69363 - HUD Multifamily Rental Projects: Regulatory Revisions

    Science.gov (United States)

    2010-11-12

    ...; ] DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT 24 CFR Parts 200 and 207 RIN 2502-AI95 HUD Multifamily Rental... Refinancing of Existing Multifamily Housing Projects is 14.155. List of Subjects 24 CFR Part 200... aggregate monthly payment. PART 207--MULTIFAMILY HOUSING MORTGAGE INSURANCE 4. The authority citation for...

  6. Case studies of some major oil spills around India

    Digital Repository Service at National Institute of Oceanography (India)

    SenGupta, R.

    stream_size 11 stream_content_type text/plain stream_name I.O_21_Century_Linkage_Networking_1998_207.pdf.txt stream_source_info I.O_21_Century_Linkage_Networking_1998_207.pdf.txt Content-Encoding ISO-8859-1 Content-Type text...

  7. The Toxicity of Inhaled Sulphur Mustard

    Science.gov (United States)

    2012-03-01

    isodesmosine in biological fluids. J Chromatog B 1995; 668: 199-207. Reagents; 1. Desmosine– egg albumin (DEA) conjugate (EPC # DA855) 2. Desmosine...isodesmosine in biological fluids. J Chromatog B 1995; 668: 199-207. Reagents 1. Desmosine- egg albumin (DEA) conjugate. 2. Desmosine standard. 3

  8. 78 FR 49061 - Valuation of Federal Coal for Advance Royalty Purposes and Information Collection Applicable to...

    Science.gov (United States)

    2013-08-12

    ... 1920 (MLA). ONRR also proposes to add information collection requirements that are applicable to all...-EPAct Statutory Provisions and Current Regulations Under the MLA at 30 U.S.C. 207(b), Federal coal...,'' amended the MLA, 30 U.S.C. 207(b). Section 434 of the EPAct amends the process for payment of advance...

  9. Full Article: Stoichiometry, Vibrational Modes and Structure of Molten Nb2O5-K2S2O7 Mixtures

    DEFF Research Database (Denmark)

    Boghosian, S.; Borup, F.; Berg, Rolf W.

    1998-01-01

    The dissolution reaction of Nb205 in pure molten K2S207 has been studied and high temperature Raman spectroscopy has been used for determining the vibrational and structural properties of the Nb(V) complex(es) formed according to the reaction Nb205 + n S207(2-) -> complex. By means of a recently ...

  10. Dollar Summary of Prime Contract Awards by State, Place, and Contractor, FY84, Part 5, (Ashton, Rhode Island-Sinclair, Wyoming).

    Science.gov (United States)

    1984-01-01

    COMPANY 207 207 SAN CARLOS RIGHT AWAY FOODS CORP 2,814 2,814 SANGER CRONEY MANUFACTURING CO 33 33 LONE STAR GAS CO TX INC 411 411 OSWALD WILLIAM REAL EST... MOSLEY ELECTRIC MANUFACTURING 61 61 TOTAL - MARION 77,015 44,088 20,535 12,331 61 MARSHALL BLUE RIDGE SECURITY GRD AGENCY 47 47 MARTINSVILLE AMERICAN

  11. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 207 of 207 ... Vol 9, No 2 (2010), The Use of Parkia Husk and Melon Wastes as Soil Amendments, Abstract ... Vol 10, No 1 (2011), Towards the Implementation of Precision Agriculture in Cocoa Production in Ghana: Evidence from the Cocoa High Technology Programme in the Eastern Region of Ghana, Abstract.

  12. The Determination of 11B/10B and 87Sr/86Sr Isotope Ratios by ...

    African Journals Online (AJOL)

    NICO

    'boron memory effect', interference of the large 12C at mass 11, and matrix interferences peculiar to wine and digested wine. RESEARCH ARTICLE. C. Vorster, L. Greeff and P.P. Coetzee,. 207. S. Afr. J. Chem., 2010, 63, 207–214,. . *To whom all correspondence should be addressed.

  13. 27 CFR 479.101 - Registration of firearms.

    Science.gov (United States)

    2010-04-01

    ... period established under section 207 of the Gun Control Act of 1968 (82 Stat. 1235). (c) A person shown... the possessors thereof under the provisions of section 207 of the Gun Control Act of 1968. (e) A..., AND EXPLOSIVES, DEPARTMENT OF JUSTICE FIREARMS AND AMMUNITION MACHINE GUNS, DESTRUCTIVE DEVICES, AND...

  14. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 117; Issue 3. Volume 117, Issue 3. May 2005, pages 207-282. Recent Advances in Bio-Inorganic Chemistry. pp 207-218. Underpotential deposition of metals - Progress and prospects in modelling · V Sudha M V Sangaranarayanan · More Details Abstract Fulltext PDF.

  15. Say ‘no’ to carcinogen as contraception alternative

    Directory of Open Access Journals (Sweden)

    Karen Malec

    2012-07-01

    Full Text Available A response to Correspondence to ‘Dienye PO, Gbeneol PK. Contraception as a risk factor for urinary tract infection in Port Harcourt, Nigeria: A case control study. Afr J Prm Health Care Fam Med. 2011;3(1, Art. #207, 4 pages. doi:10.4102/phcfm.v3i1.207

  16. 77 FR 65712 - Circular Welded Carbon-Quality Steel Pipe From Vietnam; Termination of Investigation

    Science.gov (United States)

    2012-10-30

    ... COMMISSION Circular Welded Carbon-Quality Steel Pipe From Vietnam; Termination of Investigation AGENCY... subsidies in connection with the subject investigation (77 FR 64471). Accordingly, pursuant to section 207.40(a) of the Commission's Rules of Practice and Procedure (19 CFR 207.40(a)), the countervailing duty...

  17. Alpha particle emitters in medicine

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, D.R.

    1989-09-01

    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ({sup 211}At) and natural bismuth-212 ({sup 212}Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ({sup 223}Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs.

  18. α decay of the very neutron-deficient isotopes 197-199Fr

    Science.gov (United States)

    Kalaninová, Z.; Andreyev, A. N.; Antalic, S.; Heßberger, F. P.; Ackermann, D.; Andel, B.; Drummond, M. C.; Hofmann, S.; Huyse, M.; Kindler, B.; Lane, J. F. W.; Liberati, V.; Lommel, B.; Page, R. D.; Rapisarda, E.; Sandhu, K.; Šáro, Š.; Thornthwaite, A.; Van Duppen, P.

    2013-04-01

    Decay properties of the very neutron-deficient isotopes 197-199Fr were studied at the velocity filter Separator for Heavy Ion reaction Products (SHIP) at GSI in Darmstadt. The isotopes were produced in the 2n-4n evaporation channels of the fusion-evaporation reaction 60Ni+141Pr → 201Fr*. Improved α-decay properties of 199Fr were determined and the possible existence of two α-decaying states in this nucleus is discussed. For the isotope 198Fr a broad α-decay energy distribution was detected in the range of (7470-7930) keV and two α-decaying states were observed with half-lives of 1.1(7) and 15(3) ms. The new isotope 197Fr was identified based on the observation of one α-decay chain yielding Eα=7728(15) keV and T1/2=0.6-0.3+3.0 ms. The systematics of reduced α-decay widths are presented for neutron-deficient francium, radon, and astatine isotopes.

  19. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Directory of Open Access Journals (Sweden)

    Sherif S Nafee

    Full Text Available Thallium (81(217Tl, Bismuth (83(217Bi, Astatine (85(217At, Francium (87(217Fr, Actinium (89(217Ac and Protactinium (91(217Pa are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221Fr-, (221Ac- and (221Pa-α-decays.

  20. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Science.gov (United States)

    Nafee, Sherif S; Shaheen, Salem A; Al-Ramady, Amir M

    2016-01-01

    Thallium (81(217)Tl, Bismuth (83(217)Bi), Astatine (85(217)At), Francium (87(217)Fr), Actinium (89(217)Ac) and Protactinium (91(217)Pa) are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α) has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF) calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221)Fr-, (221)Ac- and (221)Pa-α-decays.

  1. On the theory of time dilation in chemical kinetics

    Science.gov (United States)

    Baig, Mirza Wasif

    2017-10-01

    The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.

  2. SPECT assay of radiolabeled monoclonal antibodies. Progress report, September 1, 1992--August 24, 1993

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1993-08-20

    The overall goal of this project is to improve the effectiveness of single photon emission computed tomography (SPECT) to image and quantify radiolabeled monoclonal antibodies. During the past year, we have made significant progress toward this goal, and this report summarizes that work. Our efforts have been mainly directed along three fronts. First, we have developed and tested new reconstruction methods including three-dimensional iterative algorithms that model non-uniform attenuation and distance-dependent detector response. Both fan beam and parallel beam collimator geometries have been modeled and novel ways of improving the efficiency of the computationally intensive methods have been introduced. Second, an ultra-high resolution, small field-of-view pinhole collimator has been constructed and evaluated. Reconstructed spatial resolution of 1 to 3 mm (FWHM) has been achieved in phantom scans with a useful field-of-view of 9 to 10 cm. Finally, we have investigated the ability of SPECT to image and quantify astatine-211 distributions. Reconstructed images of phantom data demonstrated quantitative accuracy to within 10% with proper attenuation and scatter compensation.

  3. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    Science.gov (United States)

    Marsh, B. A.; Andel, B.; Andreyev, A. N.; Antalic, S.; Atanasov, D.; Barzakh, A. E.; Bastin, B.; Borgmann, Ch.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Dehairs, M.; Derkx, X.; De Witte, H.; Fedorov, D. V.; Fedosseev, V. N.; Focker, G. J.; Fink, D. A.; Flanagan, K. T.; Franchoo, S.; Ghys, L.; Huyse, M.; Imai, N.; Kalaninova, Z.; Köster, U.; Kreim, S.; Kesteloot, N.; Kudryavtsev, Yu.; Lane, J.; Lecesne, N.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Molkanov, P. L.; Nicol, T.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Schweikhard, L.; Seliverstov, M. D.; Sels, S.; Sjödin, A. M.; Truesdale, V.; Van Beveren, C.; Van Duppen, P.; Wendt, K.; Wienholtz, F.; Wolf, R. N.; Zemlyanoy, S. G.

    2013-12-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar free ionization using the Laser Ion Source Trap, LIST (Po); isobar selective particle identification using the multi-reflection time-of-flight mass separator (MR-ToF MS) of ISOLTRAP (Au, At). These are summarized as part of an overview of the current status of the in-source resonance ionization spectroscopy setup at ISOLDE.

  4. Studies of Stable Octupole Deformations in the Radium Region

    CERN Multimedia

    2002-01-01

    The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

  5. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  6. Evaluating 99mTc Auger electrons for targeted tumor radiotherapy by computational methods.

    Science.gov (United States)

    Tavares, Adriana Alexandre S; Tavares, João Manuel R S

    2010-07-01

    Technetium-99m (99mTc) has been widely used as an imaging agent but only recently has been considered for therapeutic applications. This study aims to analyze the potential use of 99mTc Auger electrons for targeted tumor radiotherapy by evaluating the DNA damage and its probability of correct repair and by studying the cellular kinetics, following 99mTc Auger electron irradiation in comparison to iodine-131 (131I) beta minus particles and astatine-211 (211At) alpha particle irradiation. Computational models were used to estimate the yield of DNA damage (fast Monte Carlo damage algorithm), the probability of correct repair (Monte Carlo excision repair algorithm), and cell kinetic effects (virtual cell radiobiology algorithm) after irradiation with the selected particles. The results obtained with the algorithms used suggested that 99mTc CKMMX (all M-shell Coster-Kroning--CK--and super-CK transitions) electrons and Auger MXY (all M-shell Auger transitions) have a therapeutic potential comparable to high linear energy transfer 211At alpha particles and higher than 131I beta minus particles. All the other 99mTc electrons had a therapeutic potential similar to 131I beta minus particles. 99mTc CKMMX electrons and Auger MXY presented a higher probability to induce apoptosis than 131I beta minus particles and a probability similar to 211At alpha particles. Based on the results here, 99mTc CKMMX electrons and Auger MXY are useful electrons for targeted tumor radiotherapy.

  7. Radiobromination of humanized anti-HER2 monoclonal antibody trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate, a potential label for immunoPET

    Energy Technology Data Exchange (ETDEWEB)

    Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail: vladimir.tolmachev@bms.uu.se

    2005-08-01

    Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.

  8. Development and radiotherapeutic application of /sup 211/At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    Energy Technology Data Exchange (ETDEWEB)

    Adelstein, S.J.; Zalutsky, M.; Bloomer, W.

    1981-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.

  9. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  10. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  11. Identification of TROP2 (TACSTD2), an EpCAM-like molecule, as a specific marker for TGF-β1-dependent human epidermal Langerhans cells.

    Science.gov (United States)

    Eisenwort, Gregor; Jurkin, Jennifer; Yasmin, Nighat; Bauer, Thomas; Gesslbauer, Bernhard; Strobl, Herbert

    2011-10-01

    Langerin (CD207) expression is a hallmark of epidermal Langerhans cells (LCs); however, CD207(+) cells comprise several functional subsets. Murine studies showed that epidermal, but not dermal, CD207(+) cells require transforming growth factor-β 1 (TGF-β1) for development, whereas human data are lacking. Using gene profiling, we found that the surface molecule TROP2 (TACSTD2) is strongly and rapidly induced during TGF-β1-dependent LC commitment of human CD34(+) hematopoietic progenitor cells or monocytes. TROP2 is conserved between mouse and human, and shares substantial amino-acid identity with EpCAM, a marker for murine epidermal LCs. To our knowledge, neither TROP2 nor EpCAM expression has been analyzed in human dendritic cell (DC) subsets. We found that (i) all human epidermal LCs are TROP2(+)EpCAM(+); (ii) human dermis lacks CD207(+)EpCAM(-) or CD207(+)TROP2(-) DCs, i.e., equivalents of murine dermal CD207(+) DCs; and (iii) pulmonary CD207(+) cells are TROP2(-)EpCAM(-). Moreover, although EpCAM was broadly expressed by pulmonary and intestinal epithelial cells, as well as by bone marrow erythroid progenitor cells, these cells lacked TROP2. However, although TROP2 is expressed by human LCs as well as by human and murine keratinocytes, most murine LCs, except of a small subset, lacked TROP2. Therefore, TROP2 is a marker for human TGF-β1-dependent epidermal LCs.

  12. Synthesis and Evaluation of Methyl 4-(7-Hydroxy-4,4,8-Trimethyl-3-Oxabicyclo[3.3.1]Nonan-2-yl)Benzoate as an Antileishmanial Agent and Its Synergistic Effect with Miltefosine.

    Science.gov (United States)

    Bhalla, Prachi; Sultana, Sabera; Chiranjivi, Adarsh Kumar; Saikia, Anil K; Dubey, Vikash Kumar

    2018-02-01

    In our interest in oxabicyclic compounds as potent antileishmanial agents, the present work deals with the chemical synthesis of a new oxabicyclic derivative, methyl 4-(7-hydroxy-4,4,8-trimethyl-3-oxabicyclo[3.3.1]nonan-2-yl)benzoate (PS-207). This oxabicyclic derivative showed a good antileishmanial effect on the parasite, on both the promastigote and the amastigote. The mode of parasitic death from PS-207 seemed to be apoptosis-like. Interestingly, the combination of PS-207 with a low dose of miltefosine showed a synergistic effect against the parasite. Copyright © 2018 American Society for Microbiology.

  13. The alpha-galactosidase type A gene aglA from Aspergillus niger encodes a fully functional alpha-N-acetylgalactosaminidase

    Czech Academy of Sciences Publication Activity Database

    Kulik, Natallia; Weignerová, L.; Filipi, Tomáš; Pompach, Petr; Novák, Petr; Mrázek, H.; Slámová, Kristýna; Bezouška, K.; Křen, Vladimír; Ettrich, Rüdiger

    2010-01-01

    Roč. 20, č. 11 (2010), s. 1410-1419 ISSN 0959-6658 R&D Projects: GA MŠk(CZ) LC06010; GA ČR GAP207/10/1934; GA ČR GAP207/10/1040; GA ČR GA303/09/0477; GA ČR GAP207/10/0321 Institutional research plan: CEZ:AV0Z60870520; CEZ:AV0Z50200510; CEZ:AV0Z10750506 Keywords : α-N-acetylgalactosaminidase * α-galactosidase * Aspergillus niger * substrate binding * molecular modeling Subject RIV: CE - Biochemistry Impact factor: 3.791, year: 2010

  14. Gaia Data Release 1. Summary of the astrometric, photometric, and survey properties

    National Research Council Canada - National Science Library

    ...; Collaboration, Gaia; Brown, A. G. A; Vallenari, A; Prusti, T; de Bruijne, J. H. J; Mignard, F; mmel, R; Babusiaux, C; Bailer-Jones, C. A. L; Bastian, U; Biermann, M; Evans, D. W; Eyer, L; Jansen, F; Jordi, C; Katz, D; Klioner, S. A; Lammers, U; Lindegren, L; Luri, X; O'Mullane, W; Panem, C; Pourbaix, D; Randich, S; Sartoretti, P; Siddiqui, H. I; Soubiran, C; Valette, V; van Leeuwen, F; Walton, N. A; Aerts, C; Arenou, F; Cropper, M; Høg, E; Lattanzi, M. G; Grebel, E. K; Holland, A. D; Huc, C; Passot, X; Perryman, M; Bramante, L; Cacciari, C; Castañeda, J; Chaoul, L; Cheek, N; De Angeli, F; Fabricius, C; Guerra, R; Hernández, J; Jean-Antoine-Piccolo, A; Masana, E; Messineo, R; Mowlavi, N; Nienartowicz, K; Ordóñez-Blanco, D; Panuzzo, P; Portell, J; Richards, P. J; Riello, M; Seabroke, G. M; Tanga, P; Thévenin, F; Torra, J; Els, S. G; Gracia-Abril, G; Comoretto, G; Garcia-Reinaldos, M; Lock, T; Mercier, E; Altmann, M; Anae, R; Astraatmadja, T. L; Bellas-Velidis, I; Benson, K; Berthier, J; Blomme, R; Busso, G; Carry, B; Cellino, A; Clementini, G; Cowell, S; Creevey, O; Cuypers, J; Davidson, M; De Ridder, J; de Torres, A; Delchambre, L; Dell'Oro, A; Ducourant, C; Frémat, Y; García-Torres, M; Gosset, E; Halbwachs, J. -L; Hambly, N. C; Harrison, D. L; Hauser, M; Hestroffer, D; Hodgkin, S. T; Huckle, H. E; Hutton, A

    2016-01-01

    Context. At about 1000 days after the launch of Gaia we present the first Gaia data release, Gaia DR1, consisting of astrometry and photometry for over 1 billion sources brighter than magnitude 20.7. Aims...

  15. 77 FR 49601 - Endangered and Threatened Wildlife and Plants; Endangered Status for Six West Texas Aquatic...

    Science.gov (United States)

    2012-08-16

    ... Diamond Y Spring. Recent genetic research has confirmed that the species is endemic to Diamond Y Spring...; Lysne et al. 2007, p. 649). Dundee and Dundee (1969, p. 207) found diatoms (a group of single-celled...

  16. The Theory of Global Governance, Constitutionalization and Comparative Constitutional Law

    Czech Academy of Sciences Publication Activity Database

    Blahož, Josef

    2013-01-01

    Roč. 3, č. 3 (2013), s. 195-207 ISSN 1805-8396 Institutional support: RVO:68378122 Keywords : globalization of political culture * global constitutionalism * comparative constitutional law Subject RIV: AG - Legal Sciences

  17. Channel centerline for the Tillamook, Trask, Wilson, Kilchis, and Miami Rivers, Oregon in 2009

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — The Tillamook Bay subbasins and Nehalem River basins encompass 1,369 and 2,207 respective square kilometers of northwestern Oregon and drain to the Pacific Ocean....

  18. Aerial photo mosaic of the Nehalem River, Oregon in 1939

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — The Tillamook Bay subbasins and Nehalem River basins encompass 1,369 and 2,207 respective square kilometers of northwestern Oregon and drain to the Pacific Ocean....

  19. 76 FR 16043 - Agency Information Collection (Department of Veterans Affairs Acquisition Regulations Clause 852...

    Science.gov (United States)

    2011-03-22

    ... care services. It requires the bidder/offeror prior to contract award to furnish evidence of....207-3, Right of First Refusal of Employment. An agency may not conduct or sponsor, and a person is not...

  20. 76 FR 2761 - Proposed Information Collection (Department of Veterans Affairs Acquisition Regulations Clause...

    Science.gov (United States)

    2011-01-14

    ... acquisition of non-personal health care services. It requires the bidder/offeror prior to contract award to....207-3, Right of First Refusal of Employment. Affected Public: Business or other for-profit and Not-for...