WorldWideScience

Sample records for astatine 206

  1. Radiochemistry of astatine

    Energy Technology Data Exchange (ETDEWEB)

    Ruth, T J; Dombsky, M; D' Auria, J M; Ward, T E

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs. (DLC)

  2. Discovery of the astatine, radon, francium, and radium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-09-15

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  3. Discovery of the astatine, radon, francium, and radium isotopes

    CERN Document Server

    Fry, C

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Discovery of the astatine, radon, francium, and radium isotopes

    Science.gov (United States)

    Fry, C.; Thoennessen, M.

    2013-09-01

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  5. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Energy Technology Data Exchange (ETDEWEB)

    Uusitalo, J.; Jakobsson, U. [Department of Physics, University of Jyvaeskylae (Finland); Collaboration: RITU-Gamma Gollaboration

    2011-11-30

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  6. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Science.gov (United States)

    Uusitalo, J.; Jakobsson, U.

    2011-11-01

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  7. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  8. Measurement of the first ionization potential of astatine by laser ionization spectroscopy.

    Science.gov (United States)

    Rothe, S; Andreyev, A N; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yuri; Köster, U; Lane, J F W; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt, K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine.

  9. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Jakobsson, U., E-mail: ulrjak@kth.se; Cederwall, B. [KTH, The Division of Nuclear Physics, AlbaNova University Center, SE-10691 Stockholm (Sweden); Uusitalo, J.; Auranen, K.; Badran, H.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; Herzáň, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J. [University of Jyvaskyla, Department of Physics, P.O. Box 35, FI-40014 University of Jyvaskyla (Finland); and others

    2015-10-15

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2{sup +} state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2{sup +} state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2{sup +} state and the spherical 9/2{sup −} ground state in {sup 203}Fr and {sup 205}Fr.

  10. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Science.gov (United States)

    Jakobsson, U.; Uusitalo, J.; Auranen, K.; Badran, H.; Cederwall, B.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; HerzáÅ, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J.; Scholey, C.; Sorri, J.; Stolze, S.

    2015-10-01

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2+ state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2+ state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2+ state and the spherical 9/2- ground state in 203Fr and 205Fr.

  11. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...

  12. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    NARCIS (Netherlands)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Koester, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjoedin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical

  13. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  14. 44 CFR 206.206 - Appeals.

    Science.gov (United States)

    2010-10-01

    ... SECURITY DISASTER ASSISTANCE FEDERAL DISASTER ASSISTANCE Public Assistance Project Administration § 206.206... 1, 1997). (3) The decision of the FEMA official at the next higher appeal level shall be the final administrative decision of FEMA. ...

  15. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even sing...... of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies....

  16. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  17. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  18. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  19. Adsorption of the astatine species on a gold surface: A relativistic density functional theory study

    Science.gov (United States)

    Demidov, Yuriy; Zaitsevskii, Andréi

    2018-01-01

    We report first-principle based studies of the adsorption interaction of astatine species on a gold surface. These studies are aimed primarily at the support and interpretation of gas chromatographic experiments with superheavy elements, tennessine (Ts, Z = 117), a heavier homologue of At, and possibly its pseudo-homologue nihonium (Nh, Z = 113). We use gold clusters with up to 69 atoms to simulate the adsorption sites and estimate the desorption energies of At & AtOH from a stable gold (1 1 1) surface. To describe the electronic structure of At -Aun and AtOH -Aun complexes, we combine accurate shape-consistent relativistic pseudopotentials and non-collinear two-component relativistic density functional theory. The predicted desorption energies of At and AtOH on gold are 130 ± 10 kJ/mol and 90 ± 10 kJ/mol, respectively. These results confirm the validity of the estimates derived from chromatographic data (147 ± 15 kJ/mol for At, and 100-10+20 kJ/mol for AtOH).

  20. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  1. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  2. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  3. 48 CFR 1417.206 - Evaluation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Evaluation. 1417.206 Section 1417.206 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 1417.206 Evaluation. The determination in FAR 17.206(b...

  4. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  5. 20 CFR 206.2 - Computation.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Computation. 206.2 Section 206.2 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT ACCOUNT BENEFITS RATIO § 206.2 Computation. (a) On or before November 1, 2003, the Railroad Retirement Board shall: (1) Compute...

  6. 24 CFR 206.41 - Counseling.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Counseling. 206.41 Section 206.41... CONVERSION MORTGAGE INSURANCE Eligibility; Endorsement Eligible Mortgagors § 206.41 Counseling. (a) List... receive counseling. (b) Information to be provided. A counselor must discuss with the mortgagor: (1) The...

  7. 14 CFR 206.1 - Emergency transportation.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Emergency transportation. 206.1 Section 206.1 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS... EXEMPTIONS § 206.1 Emergency transportation. Notwithstanding the provisions of section 41101 of the Statute...

  8. 48 CFR 206.303-2 - Content.

    Science.gov (United States)

    2000-10-01

    ... 48 Federal Acquisition Regulations System 3 2000-10-01 2000-10-01 false Content. 206.303-2 Section 206.303-2 Federal Acquisition Regulations System DEPARTMENT OF DEFENSE ACQUISITION PLANNING COMPETITION REQUIREMENTS Other Than Full and Open Competition 206.303-2 Content. (a) Include sufficient...

  9. 40 CFR 91.206 - Trading.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Trading. 91.206 Section 91.206... EMISSIONS FROM MARINE SPARK-IGNITION ENGINES Averaging, Banking, and Trading Provisions § 91.206 Trading. (a... manufacturers in trading. These credits must be used in the same averaging set as generated. (b) Credits for...

  10. 40 CFR 90.206 - Trading.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Trading. 90.206 Section 90.206... Trading Provisions § 90.206 Trading. (a) An engine manufacturer may exchange emission credits with other engine manufacturers in trading, subject to the trading restriction specified in § 90.207(c)(2). (b...

  11. 40 CFR 89.206 - Trading.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Trading. 89.206 Section 89.206... EMISSIONS FROM NEW AND IN-USE NONROAD COMPRESSION-IGNITION ENGINES Averaging, Banking, and Trading Provisions § 89.206 Trading. (a) Requirements for Tier 1 engines rated at or above 37 kW. (1) A nonroad...

  12. 44 CFR 206.17 - Effective date.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Effective date. 206.17 Section 206.17 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF HOMELAND SECURITY DISASTER ASSISTANCE FEDERAL DISASTER ASSISTANCE General § 206.17 Effective date. These...

  13. 10 CFR 72.206 - Representation.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Representation. 72.206 Section 72.206 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) LICENSING REQUIREMENTS FOR THE INDEPENDENT STORAGE OF SPENT NUCLEAR FUEL... Information to State Governments and Indian Tribes § 72.206 Representation. Any person who acts under this...

  14. 7 CFR 3550.206 - Protective advances.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Protective advances. 3550.206 Section 3550.206... AGRICULTURE DIRECT SINGLE FAMILY HOUSING LOANS AND GRANTS Special Servicing § 3550.206 Protective advances... Governments interest. (a) Advances for taxes and insurance. RHS may advance funds to pay real estate taxes...

  15. 48 CFR 206.303-2 - Content.

    Science.gov (United States)

    2016-10-01

    ... 48 Federal Acquisition Regulations System 3 2016-10-01 2016-10-01 false Content. 206.303-2 Section 206.303-2 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF... Content. (b)(i) Include the information required by PGI 206.303-2(b)(i) in justifications citing the...

  16. 31 CFR 206.7 - Compliance.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Compliance. 206.7 Section 206.7 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT..., AND OPERATION OF THE CASH MANAGEMENT IMPROVEMENTS FUND § 206.7 Compliance. (a) The Service will...

  17. 27 CFR 41.206 - Reports.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Reports. 41.206 Section 41.206 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE... TOBACCO Tobacco Products Importers Filing and Retention of Records and Reports § 41.206 Reports. (a...

  18. 24 CFR 206.21 - Interest rate.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Interest rate. 206.21 Section 206... CONVERSION MORTGAGE INSURANCE Eligibility; Endorsement Eligible Mortgages § 206.21 Interest rate. (a) Fixed interest rate. A fixed interest rate is agreed upon by the mortgagor and mortgagee. (b) Adjustable interest...

  19. 24 CFR 206.15 - Insurance.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance. 206.15 Section 206.15... MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES HOME EQUITY CONVERSION MORTGAGE INSURANCE Eligibility; Endorsement § 206.15 Insurance. Mortgages originated under this...

  20. 47 CFR 25.206 - Station identification.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Station identification. 25.206 Section 25.206... Technical Standards § 25.206 Station identification. The requirement for transmission of station identification is waived for all radio stations licensed under this part with the exception of satellite uplinks...

  1. Dicty_cDB: VHP206 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP206 (Link to dictyBase) - - - Contig-U16260-1 VHP206P (Link to Original site) VHP...206F 616 VHP206Z 744 VHP206P 1340 - - Show VHP206 Library VH (Link to library) Clone ID VHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP2-A/VHP206Q.Seq.d/ Representative seq. ID VHP...206P (Link to Original site) Representative DNA sequence >VHP206 (VHP206Q) /CSM/VH/VHP2-A/VHP...rqqsrsflirtpikh* rslslfp*sy*irqchcw*h*--- ---hpkmiqklvltislittngikmmp*tfglsvqkvtvpisssmspkvfni*mklkils lvlsn

  2. 44 CFR 206.438 - Project management.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Project management. 206.438 Section 206.438 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF... Project management. (a) General. The State serving as grantee has primary responsibility for project...

  3. 9 CFR 206.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Definitions. 206.1 Section 206.1 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND... account. Further, the contract specifies how the balance in the account affects producer and packer rights...

  4. 24 CFR 206.205 - Property charges.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Property charges. 206.205 Section... CONVERSION MORTGAGE INSURANCE Servicing Responsibilities § 206.205 Property charges. (a) General. The mortgagor shall pay all property charges consisting of taxes, ground rents, flood and hazard insurance...

  5. 24 CFR 206.27 - Mortgage provisions.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgage provisions. 206.27 Section... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES HOME EQUITY CONVERSION MORTGAGE INSURANCE Eligibility; Endorsement Eligible Mortgages § 206.27 Mortgage provisions. (a...

  6. 44 CFR 206.225 - Emergency work.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Emergency work. 206.225 Section 206.225 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF... Emergency work. (a) General. (1) Emergency protective measures to save lives, to protect public health and...

  7. 44 CFR 206.221 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... buildings, structures, equipment, or systems used to provide emergency services, such as fire protection... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Definitions. 206.221 Section 206.221 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF...

  8. 30 CFR 206.10 - Information collection.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Information collection. 206.10 Section 206.10 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT... requirements contained in this part have been approved by the Office of Management and Budget (OMB) under 44 U...

  9. 44 CFR 206.227 - Snow assistance.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Snow assistance. 206.227 Section 206.227 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF... Snow assistance. Emergency or major disaster declarations based on snow or blizzard conditions will be...

  10. 44 CFR 206.204 - Project performance.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Project performance. 206.204... § 206.204 Project performance. (a) General. This section describes the policies and procedures applicable during the performance of eligible work. (b) Advances of funds. Advances of funds will be made in...

  11. 24 CFR 235.206 - Substitute mortgagors.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Substitute mortgagors. 235.206... and Obligations-Homes for Lower Income Families § 235.206 Substitute mortgagors. (a) Selling mortgagor... if it obtains the Commissioner's approval of a substitute mortgagor, as provided under this section...

  12. 44 CFR 206.402 - Compliance.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Compliance. 206.402 Section... HOMELAND SECURITY DISASTER ASSISTANCE FEDERAL DISASTER ASSISTANCE Minimum Standards § 206.402 Compliance. A... compliance with this subpart following the completion of any repair or construction activities. ...

  13. 48 CFR 17.206 - Evaluation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Evaluation. 17.206 Section... CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 17.206 Evaluation. (a) In awarding the basic contract... officer need not evaluate offers for any option quantities when it is determined that evaluation would not...

  14. 31 CFR 206.8 - Appeals.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Appeals. 206.8 Section 206.8 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT... the Assistant Commissioner, Federal Finance, of the Service. The temporary board member will be a cash...

  15. 31 CFR 206.9 - Charges.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Charges. 206.9 Section 206.9 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT... information to the Service's Assistant Commissioner, Federal Finance. The charge will be calculated following...

  16. 38 CFR 3.206 - Divorce.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Divorce. 3.206 Section 3..., Compensation, and Dependency and Indemnity Compensation Evidence Requirements § 3.206 Divorce. The validity of a divorce decree regular on its face, will be questioned by the Department of Veterans Affairs only...

  17. 44 CFR 206.362 - Responsibilities.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Responsibilities. 206.362 Section 206.362 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF... Responsibilities. (a) The local government shall submit the financial information required by FEMA in the...

  18. 44 CFR 206.372 - Responsibilities.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Responsibilities. 206.372 Section 206.372 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF... Responsibilities. (a) The local government shall submit the financial information required by FEMA in the...

  19. Dicty_cDB: AHB206 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) AHB206 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) - - AHB206Z 201 -...- - - - Show AHB206 Library AH (Link to library) Clone ID AHB206 (Link to dictyBase) Atlas ID - NBRP ID...URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AH/AHB2-A/AHB206Q.Seq.d/ Representative seq. ID - (Link to Original...site) Representative DNA sequence >AHB206 (AHB206Q) /CSM/AH/AHB2-A/AHB206Q.Seq.d/ XXXXXXXXXXANGGTGGTGAA...significant alignments: (bits) Value AHB206 (AHB206Q) /CSM/AH/AHB2-A/AHB206Q.Seq.d/ 172 1e-42 VHP735 (VHP735Q)

  20. z206sc_video_observations

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This part of DS 781 presents video observations from cruise Z206SC for the Santa Barbara Channel region and beyond in southern California. The vector data file is...

  1. 44 CFR 206.67 - Requirement when limitation is exceeded.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Requirement when limitation is exceeded. 206.67 Section 206.67 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT... Assistance § 206.67 Requirement when limitation is exceeded. Whenever the limitation described in § 206.66 is...

  2. An automated flow system incorporating in-line acid dissolution of bismuth metal from a cyclotron irradiated target assembly for use in the isolation of astatine-211

    Energy Technology Data Exchange (ETDEWEB)

    O’Hara, Matthew J.; Krzysko, Anthony J.; Niver, Cynthia M.; Morrison, Samuel S.; Owsley, Stanley L.; Hamlin, Donald K.; Dorman, Eric F.; Scott Wilbur, D.

    2017-04-01

    Astatine-211 (211At) is a promising cyclotron-produced radionuclide being investigated for use in targeted alpha therapy of blood borne and metastatic cancers, as well as treatment of tumor remnants after surgical resections. The isolation of trace quantities of 211At, produced within several grams of a Bi metal cyclotron target, involves a complex, multi-step procedure: (1) Bi metal dissolution in strong HNO3, (2) distillation of the HNO3 to yield Bi salts containing 211At, (3) dissolution of the salts in strong HCl, (4) solvent extraction of 211At from bismuth salts with diisopropyl ether (DIPE), and (5) back-extraction of 211At from DIPE into NaOH, leading to a purified 211At product. Step (1) has been addressed first to begin the process of automating the onerous 211At isolation process. A computer-controlled Bi target dissolution system has been designed. The system performs in-line dissolution of Bi metal from the target assembly using an enclosed target dissolution block, routing the resulting solubilized 211At/Bi mixture to the subsequent process step. The primary parameters involved in Bi metal solubilization (HNO3 concentration and influent flow rate) were optimized prior to evaluation of the system performance on replicate cyclotron irradiated targets. The results indicate that the system performs reproducibly, having nearly quantitative release of 211At from irradiated targets, with cumulative 211At recoveries that follow a sigmoidal function. The predictable nature of the 211At release profile allows the user to tune the system to meet target processing requirements.

  3. Reagents for astatination of biomolecules. 2. Conjugation of anionic boron cage pendant groups to a protein provides a method for direct labeling that is stable to in vivo deastatination.

    Science.gov (United States)

    Wilbur, D Scott; Chyan, Ming-Kuan; Hamlin, Donald K; Vessella, Robert L; Wedge, Timothy J; Hawthorne, M Frederick

    2007-01-01

    Cancer-targeting biomolecules labeled with 211At must be stable to in vivo deastatination, as control of the 211At distribution is critical due to the highly toxic nature of alpha-particle emission. Unfortunately, no astatinated aryl conjugates have shown in vivo stability toward deastatination when (relatively) rapidly metabolized proteins, such as monoclonal antibody Fab' fragments, are labeled. As a means of increasing the in vivo stability of 211At-labeled proteins, we have been investigating antibody conjugates of boron cage moieties. In this investigation, protein-reactive derivatives containing a nido-carborane (2), a bis-nido-carborane derivative (Venus Flytrap Complex, 3), and four 2-nonahydro-closo-decaborate(2-) derivatives (4-7) were prepared and conjugated with an antibody Fab' fragment such that subsequent astatination and in vivo tissue distributions could be obtained. To aid in determination of stability toward in vivo deastatination, the Fab'-borane conjugates were also labeled with 125I, and that material was coinjected with the 211At-labeled Fab'. For comparison, direct labeling of the Fab' with 125I and 211At was conducted. Direct labeling with Na[125I]I and Chloramine-T gave an 89% radiochemical yield. However, direct labeling of the Fab' with Na[211At]At and Chloramine-T resulted in a yield of Studies to optimize the closo-decaborate(2-) conjugates for protein labeling are underway.

  4. 44 CFR 206.373 - Eligibility criteria.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Eligibility criteria. 206.373... Eligibility criteria. (a) Local government. (1) The local government must be located within the area eligible... government from incurring the indebtedness resulting from a Federal loan. (2) Criteria considered by FEMA in...

  5. 44 CFR 206.363 - Eligibility criteria.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Eligibility criteria. 206.363... Eligibility criteria. (a) Local government. (1) The local government must be located within the area... incurring the indebtedness resulting from a Federal loan. (2) Criteria considered by FEMA in determining the...

  6. 44 CFR 206.62 - Available assistance.

    Science.gov (United States)

    2010-10-01

    ... HOMELAND SECURITY DISASTER ASSISTANCE FEDERAL DISASTER ASSISTANCE Emergency Assistance § 206.62 Available... threat of a catastrophe; (b) Coordinate all disaster relief assistance (including voluntary assistance... Stafford Act; and (g) Assist State and local governments in the distribution of medicine, food, and other...

  7. 44 CFR 206.431 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... Definitions. Activity means any mitigation measure, project, or action proposed to reduce risk of future... application means the request to FEMA for HMGP funding, as outlined in § 206.436, by a State or tribal... subgrantee as a condition of receiving a project subgrant under the HMGP as outlined in 44 CFR 201.6...

  8. 44 CFR 206.200 - General.

    Science.gov (United States)

    2010-10-01

    ... SECURITY DISASTER ASSISTANCE FEDERAL DISASTER ASSISTANCE Public Assistance Project Administration § 206.200... grants approved under the provisions of the Stafford Act. (b) What policies apply to FEMA public..., including notifications of our approvals of Project Worksheets and our estimates of when we will make...

  9. 44 CFR 206.342 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... HOMELAND SECURITY DISASTER ASSISTANCE FEDERAL DISASTER ASSISTANCE Coastal Barrier Resources Act § 206.342... application or other disaster assistance after October 18, 1982. For any other unit added to the CBRS by... ground, as well as a mobile home. (j) Substantial improvement means any repair, reconstruction or other...

  10. 14 CFR 13.206 - Intervention.

    Science.gov (United States)

    2010-01-01

    ... Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION PROCEDURAL RULES INVESTIGATIVE AND ENFORCEMENT PROCEDURES Rules of Practice in FAA Civil Penalty Actions § 13.206 Intervention... property, financial, or other legitimate interest that may not be addressed adequately by the parties. The...

  11. 5 CFR 842.206 - Involuntary retirement.

    Science.gov (United States)

    2010-01-01

    ... position must be— (i) In the employee's agency, including an agency to which the employee would be... geographic mobility is a condition of the employee's employment; (iii) Of the same tenure and work schedule... (CONTINUED) FEDERAL EMPLOYEES RETIREMENT SYSTEM-BASIC ANNUITY Eligibility § 842.206 Involuntary retirement...

  12. 5 CFR 2606.206 - Fees.

    Science.gov (United States)

    2010-01-01

    ... Records and Accounting of Disclosures § 2606.206 Fees. (a) Fees for records filed with OGE—(1) Services... satisfactory assurance of full payment where the requester has a history of prompt payment of Privacy Act fees... case of requesters with no history of payment; or (B) The requester has previously failed to pay a...

  13. 5 CFR 430.206 - Planning performance.

    Science.gov (United States)

    2010-01-01

    ... MANAGEMENT Performance Appraisal for General Schedule, Prevailing Rate, and Certain Other Employees § 430.206 Planning performance. (a) Appraisal period. (1) An appraisal program shall designate an official appraisal... performance plans. (2) Performance plans shall be provided to employees at the beginning of each appraisal...

  14. 44 CFR 206.347 - Requirements.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Requirements. 206.347 Section... Requirements. (a) Location determination. For each disaster assistance action which is proposed on the Atlantic... requirements of these regulations needs to be met, and the action may be processed under other applicable...

  15. 44 CFR 206.141 - Disaster unemployment assistance.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Disaster unemployment assistance. 206.141 Section 206.141 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY... § 206.141 Disaster unemployment assistance. The authority to implement the disaster unemployment...

  16. 37 CFR 41.206 - Common interests in the invention.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Common interests in the invention. 41.206 Section 41.206 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK... Interferences § 41.206 Common interests in the invention. An administrative patent judge may decline to declare...

  17. 21 CFR 206.10 - Code imprint required.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Code imprint required. 206.10 Section 206.10 Food...: GENERAL IMPRINTING OF SOLID ORAL DOSAGE FORM DRUG PRODUCTS FOR HUMAN USE § 206.10 Code imprint required... imprint that, in conjunction with the product's size, shape, and color, permits the unique identification...

  18. 24 CFR 115.206 - Performance assessments; Performance standards.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Performance assessments; Performance standards. 115.206 Section 115.206 Housing and Urban Development Regulations Relating to Housing... AGENCIES Certification of Substantially Equivalent Agencies § 115.206 Performance assessments; Performance...

  19. 14 CFR 1274.206 - Metric Conversion Act.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Metric Conversion Act. 1274.206 Section 1274.206 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION COOPERATIVE AGREEMENTS WITH COMMERCIAL FIRMS Pre-Award Requirements § 1274.206 Metric Conversion Act. The Metric Conversion...

  20. 5 CFR 880.206 - Date of death.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Date of death. 880.206 Section 880.206...) RETIREMENT AND INSURANCE BENEFITS DURING PERIODS OF UNEXPLAINED ABSENCE Procedures § 880.206 Date of death... OPM, the date of death of a missing annuitant who has been determined to be dead by an authorized...

  1. 40 CFR 86.206-94 - Equipment required; overview.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Equipment required; overview. 86.206-94 Section 86.206-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... New Medium-Duty Passenger Vehicles; Cold Temperature Test Procedures § 86.206-94 Equipment required...

  2. 40 CFR 86.206-11 - Equipment required; overview.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Equipment required; overview. 86.206-11 Section 86.206-11 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... New Medium-Duty Passenger Vehicles; Cold Temperature Test Procedures § 86.206-11 Equipment required...

  3. 30 CFR 206.260 - Allocation of washed coal.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Allocation of washed coal. 206.260 Section 206... MANAGEMENT PRODUCT VALUATION Federal Coal § 206.260 Allocation of washed coal. (a) When coal is subjected to washing, the washed coal must be allocated to the leases from which it was extracted. (b) When the net...

  4. 30 CFR 206.459 - Allocation of washed coal.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Allocation of washed coal. 206.459 Section 206... MANAGEMENT PRODUCT VALUATION Indian Coal § 206.459 Allocation of washed coal. (a) When coal is subjected to washing, the washed coal must be allocated to the leases from which it was extracted. (b) When the net...

  5. 27 CFR 27.206 - Bottles not constituting approved containers.

    Science.gov (United States)

    2010-04-01

    ... approved containers. 27.206 Section 27.206 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS IMPORTATION OF DISTILLED SPIRITS, WINES, AND BEER Requirements for Liquor Bottles § 27.206 Bottles not constituting approved containers. The appropriate TTB...

  6. 40 CFR 2.206 - Advance confidentiality determinations.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Advance confidentiality determinations. 2.206 Section 2.206 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL PUBLIC INFORMATION Confidentiality of Business Information § 2.206 Advance confidentiality determinations. (a) An...

  7. 9 CFR 113.206 - Wart Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Wart Vaccine, Killed Virus. 113.206... AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.206 Wart Vaccine, Killed Virus. Wart Vaccine, Killed Virus, shall be prepared...

  8. 45 CFR 1703.206 - Providing information to the public.

    Science.gov (United States)

    2010-10-01

    ... LIBRARIES AND INFORMATION SCIENCE GOVERNMENT IN THE SUNSHINE ACT Procedures Governing Decisions About Meetings § 1703.206 Providing information to the public. Individuals or organizations interested in... 45 Public Welfare 4 2010-10-01 2010-10-01 false Providing information to the public. 1703.206...

  9. 44 CFR 206.118 - Disposal of housing units.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Disposal of housing units. 206.118 Section 206.118 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY... will be no implied warranties. In addition, FEMA will inform the purchaser that he/she may have to...

  10. 30 CFR 206.153 - Valuation standards-processed gas.

    Science.gov (United States)

    2010-07-01

    ...) of this section, if the maximum price permitted by Federal law at which any residue gas or gas plant... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Valuation standards-processed gas. 206.153... MANAGEMENT PRODUCT VALUATION Federal Gas § 206.153 Valuation standards—processed gas. (a)(1) This section...

  11. 19 CFR 206.16 - Industry adjustment plan and commitments.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Industry adjustment plan and commitments. 206.16... OF RELIEF ACTIONS Investigations Relating to Global Safeguard Actions § 206.16 Industry adjustment... determination, any firm in the domestic industry, certified or recognized union or group of workers in the...

  12. 30 CFR 206.152 - Valuation standards-unprocessed gas.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Valuation standards-unprocessed gas. 206.152... MANAGEMENT PRODUCT VALUATION Federal Gas § 206.152 Valuation standards—unprocessed gas. (a)(1) This section applies to the valuation of all gas that is not processed and all gas that is processed but is sold or...

  13. 44 CFR 206.36 - Requests for major disaster declarations.

    Science.gov (United States)

    2010-10-01

    ... and losses stating the impact of the disaster on the public and private sector; (3) Information... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Requests for major disaster declarations. 206.36 Section 206.36 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY...

  14. 30 CFR 77.206 - Ladders; construction; installation and maintenance.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Ladders; construction; installation and maintenance. 77.206 Section 77.206 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF... members of ladders shall not be painted. (c) Steep or vertical ladders which are used regularly at fixed...

  15. 44 CFR 206.203 - Federal grant assistance.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Federal grant assistance. 206.203 Section 206.203 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY...) Improved projects. If a subgrantee desires to make improvements, but still restore the predisaster function...

  16. 31 CFR 800.206 - Convertible voting instrument.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Convertible voting instrument. 800.206 Section 800.206 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF INVESTMENT SECURITY, DEPARTMENT OF THE TREASURY REGULATIONS PERTAINING TO MERGERS, ACQUISITIONS...

  17. 30 CFR 75.206 - Conventional roof support.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Conventional roof support. 75.206 Section 75... HEALTH MANDATORY SAFETY STANDARDS-UNDERGROUND COAL MINES Roof Support § 75.206 Conventional roof support. (a) Except in anthracite mines using non-mechanized mining systems, when conventional roof support...

  18. 27 CFR 25.206 - Removal of beer.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Removal of beer. 25.206... OF THE TREASURY LIQUORS BEER Removals Without Payment of Tax Beer for Personal Or Family Use § 25.206 Removal of beer. Beer made under § 25.205 may be removed from the premises where made for personal or...

  19. 42 CFR 457.206 - Administrative appeals under CHIP.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Administrative appeals under CHIP. 457.206 Section... Claims; Reduction of Federal Medical Payments § 457.206 Administrative appeals under CHIP. Three distinct... provisions of 42 CFR part 430, subpart D of this chapter. (b) FFP in State CHIP expenditures. Disallowances...

  20. 37 CFR 2.206 - Trademark fees payable in advance.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Trademark fees payable in advance. 2.206 Section 2.206 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES Fees and Payment of Money in Trademark Cases § 2...

  1. 30 CFR 206.464 - Value enhancement of marketable coal.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Value enhancement of marketable coal. 206.464... MANAGEMENT PRODUCT VALUATION Indian Coal § 206.464 Value enhancement of marketable coal. If, prior to use, sale, or other disposition, the lessee enhances the value of coal after the coal has been placed in...

  2. 30 CFR 206.265 - Value enhancement of marketable coal.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Value enhancement of marketable coal. 206.265... MANAGEMENT PRODUCT VALUATION Federal Coal § 206.265 Value enhancement of marketable coal. If, prior to use, sale, or other disposition, the lessee enhances the value of coal after the coal has been placed in...

  3. 31 CFR 206.4 - Collection and payment mechanisms.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Collection and payment mechanisms. 206.4 Section 206.4 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY...

  4. 31 CFR 206.1 - Scope and application.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Scope and application. 206.1 Section 206.1 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY RECEIPTS, DISBURSEMENTS...

  5. 31 CFR 206.5 - Collection and deposit procedure exceptions.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Collection and deposit procedure exceptions. 206.5 Section 206.5 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL...

  6. 5 CFR 734.206 - Participation in elections.

    Science.gov (United States)

    2010-01-01

    ... REGULATIONS (CONTINUED) POLITICAL ACTIVITIES OF FEDERAL EMPLOYEES Permitted Activities § 734.206 Participation... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Participation in elections. 734.206... position; and (d) Drive voters to polling places for a partisan political candidate, partisan political...

  7. 9 CFR 206.2 - Swine contract library.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Swine contract library. 206.2 Section... STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE SWINE CONTRACT LIBRARY § 206.2 Swine contract library. (a) Do... swine contract library will be made available to the public? GIPSA will summarize the information it has...

  8. 5 CFR 179.206 - Notice requirements before offset.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Notice requirements before offset. 179.206 Section 179.206 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS... administrative costs including a statement that such assessments must be made unless excused in accordance with...

  9. 19 CFR 206.24 - Contents of request.

    Science.gov (United States)

    2010-04-01

    ... RELIEF ACTIONS Investigations Relating to a Surge in Imports From a NAFTA Country § 206.24 Contents of... representativeness of the entity filing the request; (c) Data concerning imports from the NAFTA country or countries...

  10. 19 CFR 206.21 - Applicability of subpart.

    Science.gov (United States)

    2010-04-01

    ... RELIEF ACTIONS Investigations Relating to a Surge in Imports From a NAFTA Country § 206.21 Applicability of subpart. This subpart C applies specifically to investigations under section 312(c) of the NAFTA...

  11. 17 CFR 275.206(4)-8 - Pooled investment vehicles.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Pooled investment vehicles... COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT ADVISERS ACT OF 1940 § 275.206(4)-8 Pooled investment vehicles. (a) Prohibition. It shall constitute a fraudulent, deceptive, or manipulative act...

  12. 31 CFR 206.3 - Billing policy and procedures.

    Science.gov (United States)

    2010-07-01

    ... SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY RECEIPTS, DISBURSEMENTS, AND OPERATION OF THE CASH MANAGEMENT IMPROVEMENTS FUND § 206.3 Billing policy and procedures. The billing process is considered an integral part of an effective cash management collection program. In...

  13. 31 CFR 206.6 - Cash management planning and review.

    Science.gov (United States)

    2010-07-01

    ... RECEIPTS, DISBURSEMENTS, AND OPERATION OF THE CASH MANAGEMENT IMPROVEMENTS FUND § 206.6 Cash management... needing improvement. (b) As part of its cash management review process, an agency is expected to document... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Cash management planning and review...

  14. 24 CFR 206.201 - Mortgage servicing generally; sanctions.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgage servicing generally... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES HOME EQUITY CONVERSION MORTGAGE INSURANCE Servicing Responsibilities § 206.201 Mortgage servicing...

  15. 24 CFR 206.29 - Initial disbursement of mortgage proceeds.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Initial disbursement of mortgage... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES HOME EQUITY CONVERSION MORTGAGE INSURANCE Eligibility; Endorsement Eligible Mortgages § 206.29...

  16. 44 CFR 206.205 - Payment of claims.

    Science.gov (United States)

    2010-10-01

    ... provisions of the FEMA-State Agreement, and that payments for that project have been made in accordance with... HOMELAND SECURITY DISASTER ASSISTANCE FEDERAL DISASTER ASSISTANCE Public Assistance Project Administration § 206.205 Payment of claims. (a) Small Projects. Final payment of the Federal share of these projects...

  17. 50 CFR 216.206 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Construction and Operation of Offshore Oil and Gas Facilities in the U.S. Beaufort Sea § 216.206 Requirements for monitoring and reporting...

  18. 42 CFR 59.206 - Evaluation and grant award.

    Science.gov (United States)

    2010-10-01

    ... their own staffs; (ii) Improvement of the family planning services delivery skills of family planning... PLANNING SERVICES Grants for Family Planning Service Training § 59.206 Evaluation and grant award. (a... family planning services; (2) The extent to which the training program promises to fulfill the family...

  19. 19 CFR 206.23 - Who may file a request.

    Science.gov (United States)

    2010-04-01

    ... RELIEF ACTIONS Investigations Relating to a Surge in Imports From a NAFTA Country § 206.23 Who may file a request. If the President, under section 312(b) of the NAFTA Implementation Act, has excluded imports from a NAFTA country or countries from an action under chapter 1 of title II of the Trade Act of 1974...

  20. 44 CFR 206.43 - Emergency support teams.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Emergency support teams. 206... Emergency support teams. The Federal Coordinating Officer may activate emergency support teams, composed of... emergency. These emergency support teams assist the FCO in carrying out his/her responsibilities under the...

  1. 44 CFR 206.226 - Restoration of damaged facilities.

    Science.gov (United States)

    2010-10-01

    ... § 206.226 Restoration of damaged facilities. Work to restore eligible facilities on the basis of the..., which include power, water (including water provided by an irrigation organization or facility in... care, fire department services, emergency rescue, and nursing homes; or (2) The private nonprofit...

  2. 31 CFR 537.206 - Evasions; attempts; conspiracies.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Evasions; attempts; conspiracies. 537... § 537.206 Evasions; attempts; conspiracies. (a) Any transaction by a U.S. person or within the United... attempts to violate any of the prohibitions set forth in this part is prohibited. (b) Any conspiracy formed...

  3. 31 CFR 593.206 - Evasions; attempts; conspiracies.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Evasions; attempts; conspiracies. 593... SANCTIONS REGULATIONS Prohibitions § 593.206 Evasions; attempts; conspiracies. (a) Except as otherwise... date that evades or avoids, has the purpose of evading or avoiding, or attempts to violate any of the...

  4. 31 CFR 545.206 - Evasions; attempts; conspiracies.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Evasions; attempts; conspiracies. 545... Prohibitions § 545.206 Evasions; attempts; conspiracies. (a) Except as otherwise authorized, and... avoids, has the purpose of evading or avoiding, or attempts to violate any of the prohibitions set forth...

  5. 48 CFR 1809.206-70 - Small businesses.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Small businesses. 1809.206...-70 Small businesses. If a small business otherwise eligible for award has been placed in a special... that the small business does not appear to have the capacity to perform, the certificate of competency...

  6. 48 CFR 16.206 - Fixed-ceiling-price contracts with retroactive price redetermination.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Fixed-ceiling-price contracts with retroactive price redetermination. 16.206 Section 16.206 Federal Acquisition Regulations...-Price Contracts 16.206 Fixed-ceiling-price contracts with retroactive price redetermination. ...

  7. 48 CFR 1316.206 - Fixed-ceiling-price contracts with retroactive price redetermination.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Fixed-ceiling-price contracts with retroactive price redetermination. 1316.206 Section 1316.206 Federal Acquisition Regulations... Contracts 1316.206 Fixed-ceiling-price contracts with retroactive price redetermination. ...

  8. 24 CFR 983.206 - HAP contract amendments (to add or substitute contract units).

    Science.gov (United States)

    2010-04-01

    ... substitute contract units). 983.206 Section 983.206 Housing and Urban Development Regulations Relating to... Contract § 983.206 HAP contract amendments (to add or substitute contract units). (a) Amendment to substitute contract units. At the discretion of the PHA and subject to all PBV requirements, the HAP contract...

  9. 44 CFR 206.252 - Insurance requirements for facilities damaged by flood.

    Science.gov (United States)

    2010-10-01

    ... facilities damaged by flood. 206.252 Section 206.252 Emergency Management and Assistance FEDERAL EMERGENCY... Assistance Insurance Requirements § 206.252 Insurance requirements for facilities damaged by flood. (a) Where an insurable building damaged by flooding is located in a special flood hazard area identified for...

  10. 44 CFR 206.37 - Processing requests for declarations of a major disaster or emergency.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Processing requests for declarations of a major disaster or emergency. 206.37 Section 206.37 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF HOMELAND SECURITY DISASTER ASSISTANCE FEDERAL DISASTER ASSISTANCE The Declaration Process § 206.37...

  11. 24 CFR 206.40 - Disclosure and verification of Social Security and Employer Identification Numbers.

    Science.gov (United States)

    2010-04-01

    ... Social Security and Employer Identification Numbers. 206.40 Section 206.40 Housing and Urban Development... Eligibility; Endorsement Eligible Mortgagors § 206.40 Disclosure and verification of Social Security and... verification of Social Security and Employer Identification Numbers, as provided by part 200, subpart U, of...

  12. 48 CFR 1809.206-1 - General. (NASA supplements paragraph (b) and (c))

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true General. (NASA supplements paragraph (b) and (c)) 1809.206-1 Section 1809.206-1 Federal Acquisition Regulations System NATIONAL... Qualification requirements 1809.206-1 General. (NASA supplements paragraph (b) and (c)) (c) If an offeror seeks...

  13. 30 CFR 206.60 - What are the quantity and quality bases for royalty settlement?

    Science.gov (United States)

    2010-07-01

    ... royalty settlement? 206.60 Section 206.60 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT PRODUCT VALUATION Indian Oil § 206.60 What are the quantity and... royalty value actual or theoretical losses incurred before the royalty settlement point unless BLM...

  14. 30 CFR 206.119 - How are royalty quantity and quality determined?

    Science.gov (United States)

    2010-07-01

    ...? 206.119 Section 206.119 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT PRODUCT VALUATION Federal Oil § 206.119 How are royalty quantity and quality... settlement or for theoretical losses that are claimed to have taken place either before or after the approved...

  15. 19 CFR 206.2 - Identification of type of petition or request.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Identification of type of petition or request. 206.2 Section 206.2 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION NONADJUDICATIVE... DIVERSION, AND REVIEW OF RELIEF ACTIONS General § 206.2 Identification of type of petition or request. An...

  16. 50 CFR 226.206 - Critical habitat for the Southern Resident killer whale (Orcinus orca).

    Science.gov (United States)

    2010-10-01

    ... killer whale (Orcinus orca). 226.206 Section 226.206 Wildlife and Fisheries NATIONAL MARINE FISHERIES... CRITICAL HABITAT § 226.206 Critical habitat for the Southern Resident killer whale (Orcinus orca). Critical habitat is designated for the Southern Resident killer whale as described in this section. The textual...

  17. 48 CFR 206.302-3 - Industrial mobilization; or engineering, development, or research capability.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Industrial mobilization; or engineering, development, or research capability. 206.302-3 Section 206.302-3 Federal Acquisition... COMPETITION REQUIREMENTS Other Than Full and Open Competition 206.302-3 Industrial mobilization; or...

  18. 19 CFR 206.17 - Limited disclosure of certain confidential business information under administrative protective...

    Science.gov (United States)

    2010-04-01

    ... Investigations Relating to Global Safeguard Actions § 206.17 Limited disclosure of certain confidential business... business information under administrative protective order. 206.17 Section 206.17 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION NONADJUDICATIVE INVESTIGATIONS INVESTIGATIONS RELATING TO GLOBAL...

  19. Completion report for Well Cluster ER-20-6

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-02-01

    The Well Cluster ER-20-6 drilling and completion project was conducted during February, March, and April of 1996 in support of the Nevada Environmental Restoration Project at the Nevada Test Site (NTS), Nye County, Nevada. This project is part of the DOE`s Underground Test Area (UGTA) subproject at the NTS. The primary UGTA tasks include collecting geological, geophysical, and hydrological data from new and existing wells to define groundwater quality as well as pathways and rates of groundwater migration at the NTS. A program of drilling wells near the sites of selected underground nuclear tests (near-field drilling) was implemented as part of the UGTA subproject to obtain site-specific data on the nature and extent of migration of radionuclides produced by an underground nuclear explosion. The ER-20-6 near-field drilling project was originally planned to be very similar to that recently conducted at Well Cluster ER-20-5, which was designed to obtain data on the existing hydrologic regime near the site of an underground nuclear explosion (IT, 1995; IT, 1996a). However, after further consideration of the goals of the near-field drilling program and the characteristics of the BULLION site, the TWG recommended that the ER-20-6 project be redesigned to accommodate a forced-gradient experiment. This proposed experiment is expected to yield more realistic estimates of transport parameters than can be deduced from sampling and testing natural groundwater flow systems.

  20. 48 CFR 206.303-70 - Acquisitions in support of operations in Iraq or Afghanistan.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Acquisitions in support of operations in Iraq or Afghanistan. 206.303-70 Section 206.303-70 Federal Acquisition Regulations System... Afghanistan. The justification and approval addressed in FAR 6.303 is not required for acquisitions conducted...

  1. Structural analysis and dimerization profile of the SCAN domain of the pluripotency factor Zfp206

    KAUST Repository

    Liang, Yu

    2012-06-26

    Zfp206 (also named as Zscan10) belongs to the subfamily of C2H2 zinc finger transcription factors, which is characterized by the N-terminal SCAN domain. The SCAN domain mediates self-association and association between the members of SCAN family transcription factors, but the structural basis and selectivity determinants for complex formation is unknown. Zfp206 is important for maintaining the pluripotency of embryonic stem cells presumably by combinatorial assembly of itself or other SCAN family members on enhancer regions. To gain insights into the folding topology and selectivity determinants for SCAN dimerization, we solved the 1.85 crystal structure of the SCAN domain of Zfp206. In vitro binding studies using a panel of 20 SCAN proteins indicate that the SCAN domain Zfp206 can selectively associate with other members of SCAN family transcription factors. Deletion mutations showed that the N-terminal helix 1 is critical for heterodimerization. Double mutations and multiple mutations based on the Zfp206SCAN-Zfp110SCAN model suggested that domain swapped topology is a possible preference for Zfp206SCAN-Zfp110SCAN heterodimer. Together, we demonstrate that the Zfp206SCAN constitutes a protein module that enables C2H2 transcription factor dimerization in a highly selective manner using a domain-swapped interface architecture and identify novel partners for Zfp206 during embryonal development. 2012 The Author(s).

  2. 24 CFR 206.207 - Allowable charges and fees after endorsement.

    Science.gov (United States)

    2010-04-01

    ... endorsement. 206.207 Section 206.207 Housing and Urban Development Regulations Relating to Housing and Urban... and fees after endorsement. (a) Reasonable and customary charges. The mortgagee may collect reasonable and customary charges and fees from the mortgagor after insurance endorsement by adding them to the...

  3. 44 CFR 206.10 - Use of local firms and individuals.

    Science.gov (United States)

    2010-10-01

    ... business primarily in the area affected by such major disaster or emergency. This shall not be considered... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Use of local firms and individuals. 206.10 Section 206.10 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY...

  4. 30 CFR 206.107 - How do I request a value determination?

    Science.gov (United States)

    2010-07-01

    ... Section 206.107 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT PRODUCT VALUATION Federal Oil § 206.107 How do I request a value determination? (a) You may... signed by the Assistant Secretary, Land and Minerals Management; or (2) Issue a value determination by...

  5. 5 CFR 339.206 - Disqualification on the basis of medical history.

    Science.gov (United States)

    2010-01-01

    ... history. 339.206 Section 339.206 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE... Disqualification on the basis of medical history. A candidate may not be disqualified for any position solely on the basis of medical history. For positions with medical standards or physical requirements, or...

  6. 44 CFR 206.253 - Insurance requirements for facilities damaged by disasters other than flood.

    Science.gov (United States)

    2010-10-01

    ... facilities damaged by disasters other than flood. 206.253 Section 206.253 Emergency Management and Assistance... by disasters other than flood. (a) Prior to approval of a Federal grant for the restoration of a facility and its contents which were damaged by a disaster other than flood, the Grantee shall notify the...

  7. 27 CFR 44.206 - To Government vessels and aircraft for consumption as supplies.

    Science.gov (United States)

    2010-04-01

    ... aircraft for consumption as supplies. 44.206 Section 44.206 Alcohol, Tobacco Products and Firearms ALCOHOL... TOBACCO PRODUCTS AND CIGARETTE PAPERS AND TUBES, WITHOUT PAYMENT OF TAX, OR WITH DRAWBACK OF TAX Removal of Shipments of Tobacco Products and Cigarette Papers and Tubes by Manufacturers and Export Warehouse...

  8. 17 CFR 275.206(3)-2 - Agency cross transactions for advisory clients.

    Science.gov (United States)

    2010-04-01

    ... advisory clients. 275.206(3)-2 Section 275.206(3)-2 Commodity and Securities Exchanges SECURITIES AND... Agency cross transactions for advisory clients. (a) An investment adviser, or a person registered as a... advisory client, if: (1) The advisory client has executed a written consent prospectively authorizing the...

  9. 48 CFR 1832.206 - Solicitation provisions and contract clauses. (NASA supplements paragraph (g))

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Solicitation provisions and contract clauses. (NASA supplements paragraph (g)) 1832.206 Section 1832.206 Federal Acquisition... supplements paragraph (g)) (g)(2) The installment payment rate shall be that which is common in the commercial...

  10. 31 CFR 206.10 - Operation of and payments from the Cash Management Improvements Fund.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Operation of and payments from the Cash Management Improvements Fund. 206.10 Section 206.10 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT...

  11. 7 CFR 810.206 - Grades and grade requirements for barley.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Grades and grade requirements for barley. 810.206... OFFICIAL UNITED STATES STANDARDS FOR GRAIN United States Standards for Barley Principles Governing the Application of Standards § 810.206 Grades and grade requirements for barley. Grade Minimum limits of— Test...

  12. 40 CFR 33.206 - Is there a list of certified MBEs and WBEs?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Is there a list of certified MBEs and WBEs? 33.206 Section 33.206 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GRANTS AND OTHER FEDERAL ASSISTANCE PARTICIPATION BY DISADVANTAGED BUSINESS ENTERPRISES IN UNITED STATES ENVIRONMENTAL...

  13. 40 CFR 262.206 - Labeling and management standards for containers of unwanted material in the laboratory.

    Science.gov (United States)

    2010-07-01

    ... Material for Laboratories Owned by Eligible Academic Entities § 262.206 Labeling and management standards... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Labeling and management standards for containers of unwanted material in the laboratory. 262.206 Section 262.206 Protection of Environment...

  14. 30 CFR 206.361 - How will MMS determine whether my royalty or direct use fee payments are correct?

    Science.gov (United States)

    2010-07-01

    ... direct use fee payments are correct? 206.361 Section 206.361 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT PRODUCT VALUATION Geothermal Resources § 206.361 How will MMS determine whether my royalty or direct use fee payments are correct? (a)(1) The...

  15. 17 CFR 275.206(3)-3T - Temporary rule for principal trades with certain advisory clients.

    Science.gov (United States)

    2010-04-01

    ... trades with certain advisory clients. 275.206(3)-3T Section 275.206(3)-3T Commodity and Securities... 1940 § 275.206(3)-3T Temporary rule for principal trades with certain advisory clients. (a) An..., sells to or purchases from an advisory client any security if: (1) The investment adviser exercises no...

  16. 18 CFR 1304.206 - Requirements for community docks, piers, boathouses, or other water-use facilities.

    Science.gov (United States)

    2010-04-01

    ... community docks, piers, boathouses, or other water-use facilities. 1304.206 Section 1304.206 Conservation of Power and Water Resources TENNESSEE VALLEY AUTHORITY APPROVAL OF CONSTRUCTION IN THE TENNESSEE RIVER....206 Requirements for community docks, piers, boathouses, or other water-use facilities. (a) Community...

  17. 9 CFR 203.15 - Trust benefits under sections 206 and 207 of the Act.

    Science.gov (United States)

    2010-01-01

    ... STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE STATEMENTS OF GENERAL POLICY UNDER THE PACKERS AND STOCKYARDS ACT § 203.15 Trust benefits under sections 206 and 207 of the Act...

  18. Transient downregulation of microRNA-206 protects alkali burn injury in mouse cornea by regulating connexin 43.

    Science.gov (United States)

    Li, Xiaoyan; Zhou, Huanfen; Tang, Weiqiang; Guo, Qing; Zhang, Yan

    2015-01-01

    Chemical burn in cornea may cause permanent visual problem or complete blindness. In the present study, we investigated the role of microRNA 206 (miR-206) in relieving chemical burn in mouse cornea. An alkali burn model was established in C57BL/6 mice to induce chemical corneal injury. Within 72 hours, the transient inflammatory responses in alkali-treated corneas were measured by opacity and corneal neovascularization (CNV) levels, and the gene expression profile of miR-206 was measured by quantitative real-time PCR (qPCR). Inhibitory oligonucleotides of miR-206, miR-206-I, were intrastromally injected into alkali-burned corneas. The possible protective effects of down-regulating miR-206 were assessed by both in vivo measurements of inflammatory responses and in vitro histochemical examinations of corneal epithelium sections. The possible binding of miR-206 on its molecular target, connexin43 (Cx43), was assessed by luciferase reporter (LR) and western blot (WB) assays. Cx43 was silenced by siRNA to examine its effect on regulating miR-206 modulation in alkali-burned cornea. Opacity and CNV levels, along with gene expression of miR-206, were all transiently elevated within 72 hours of alkali-burned mouse cornea. Intrastromal injection of miR-206-I into alkali-burned cornea down-regulated miR-206 and ameliorated inflammatory responses both in vivo and in vitro. LR and WB assays confirmed that Cx43 was directly targeted by miR-206 in mouse cornea. Genetic silencing of Cx43 reversed the protective effect of miR-206 down-regulation in alkali-burned cornea. miR-206, associated with Cx43, is a novel molecular modulator in alkali burn in mouse cornea.

  19. MiR-206, a key modulator of skeletal muscle development and disease.

    Science.gov (United States)

    Ma, Guoda; Wang, Yajun; Li, You; Cui, Lili; Zhao, Yujuan; Zhao, Bin; Li, Keshen

    2015-01-01

    MicroRNAs (miRNAs) have recently emerged as fundamental post-transcriptional regulators inhibit gene expression linked to various biological processes. MiR-206 is one of the most studied and best characterized miRNA to date, which specifically expressed in skeletal muscle. In this review, we summarized the results of studies of miR-206 with emphasis on its function in skeletal muscle development. Importantly, dysregulation of miR-206 has been linked to many disorders in skeletal muscle such as Duchenne muscular dystrophy (DMD) and amyotrophic lateral sclerosis (ALS), and circulating miR-206 has highlighted its potential as a diagnose biomarker. In addition, a mutation in the 3' untranslated region (3'-UTR) of the myostatin gene in the Texel sheep creating a target site for the miR-206 and miR-1 leads to inhibition of myostatin expression, which likely to cause the muscular hypertrophy phenotype of this breed of sheep. Therefore, miR-206 may become novel target for ameliorating skeletal muscle-related disorders and optimization of muscle quantity of domestic animals.

  20. Overexpression of miR-206 suppresses glycolysis, proliferation and migration in breast cancer cells via PFKFB3 targeting

    Energy Technology Data Exchange (ETDEWEB)

    Ge, Xin; Lyu, Pengwei; Cao, Zhang; Li, Jingruo; Guo, Guangcheng; Xia, Wanjun; Gu, Yuanting, E-mail: zzyuantinggu@126.com

    2015-08-07

    miRNAs, sorting as non-coding RNAs, are differentially expressed in breast tumor and act as tumor promoters or suppressors. miR-206 could suppress the progression of breast cancer, the mechanism of which remains unclear. The study here was aimed to investigate the effect of miR-206 on human breast cancers. We found that miR-206 was down-regulated while one of its predicted targets, 6-Phosphofructo-2-kinase (PFKFB3) was up-regulated in human breast carcinomas. 17β-estradiol dose-dependently decreased miR-206 expression as well as enhanced PFKFB3 mRNA and protein expression in estrogen receptor α (ERα) positive breast cancer cells. Furthermore, we identified that miR-206 directly interacted with 3′-untranslated region (UTR) of PFKFB3 mRNA. miR-206 modulated PFKFB3 expression in MCF-7, T47D and SUM159 cells, which was influenced by 17β-estradiol depending on ERα expression. In addition, miR-206 overexpression impeded fructose-2,6-bisphosphate (F2,6BP) production, diminished lactate generation and reduced cell proliferation and migration in breast cancer cells. In conclusion, our study demonstrated that miR-206 regulated PFKFB3 expression in breast cancer cells, thereby stunting glycolysis, cell proliferation and migration. - Highlights: • miR-206 was down-regulated and PFKFB3 was up-regulated in human breast carcinomas. • 17β-estradiol regulated miR-206 and PFKFB3 expression in ERα+ cancer cells. • miR-206directly interacted with 3′-UTR of PFKFB3 mRNA. • miR-206 fructose-2,6-bisphosphate (F2,6BP) impeded production and lactate generation. • miR-206 reduced cell proliferation and migration in breast cancer cells.

  1. 30 CFR 206.102 - How do I calculate royalty value for oil that I or my affiliate sell(s) under an arm's-length...

    Science.gov (United States)

    2010-07-01

    ... or my affiliate sell(s) under an arm's-length contract? 206.102 Section 206.102 Mineral Resources... Federal Oil § 206.102 How do I calculate royalty value for oil that I or my affiliate sell(s) under an arm... seller under the arm's-length contract, less applicable allowances determined under §§ 206.110 or 206.111...

  2. First measurement of the β-decay half-life of 206Au

    Science.gov (United States)

    Morales, A. I.; Benzoni, G.; Al-Dahan, N.; Vergani, S.; Podolyák, Zs.; Regan, P. H.; Swan, T. P. D.; Valiente-Dobón, J. J.; Bracco, A.; Boutachkov, P.; Crespi, F. C. L.; Gerl, J.; Górska, M.; Pietri, S.; Walker, P. M.; Wollersheim, H.-J.

    2015-09-01

    The β decay of the N = 127 isotone 206Au has been investigated at the Gesellschaft für Schwerionenforschung laboratory within the rare isotope investigations at GSI Collaboration. From the experimental data, both its half-life and the level structure of the N = 126 daughter nucleus 206Hg have been extracted. On the basis of the new results, the systematics of Au β-decay half-lives beyond the N = 126 shell closure is discussed. In addition, the interplay between allowed Gamow-Teller and first-forbidden transitions in the N > 126, Z < 82 mass region is reviewed.

  3. miR-206 represses hypertrophy of myogenic cells but not muscle fibers via inhibition of HDAC4.

    Directory of Open Access Journals (Sweden)

    Catherine E Winbanks

    Full Text Available microRNAs regulate the development of myogenic progenitors, and the formation of skeletal muscle fibers. However, the role miRNAs play in controlling the growth and adaptation of post-mitotic musculature is less clear. Here, we show that inhibition of the established pro-myogenic regulator miR-206 can promote hypertrophy and increased protein synthesis in post-mitotic cells of the myogenic lineage. We have previously demonstrated that histone deacetylase 4 (HDAC4 is a target of miR-206 in the regulation of myogenic differentiation. We confirmed that inhibition of miR-206 de-repressed HDAC4 accumulation in cultured myotubes. Importantly, inhibition of HDAC4 activity by valproic acid or sodium butyrate prevented hypertrophy of myogenic cells otherwise induced by inhibition of miR-206. To test the significance of miRNA-206 as a regulator of skeletal muscle mass in vivo, we designed recombinant adeno-associated viral vectors (rAAV6 vectors expressing miR-206, or a miR-206 "sponge," featuring repeats of a validated miR-206 target sequence. We observed that over-expression or inhibition of miR-206 in the muscles of mice decreased or increased endogenous HDAC4 levels respectively, but did not alter muscle mass or myofiber size. We subsequently manipulated miR-206 levels in muscles undergoing follistatin-induced hypertrophy or denervation-induced atrophy (models of muscle adaptation where endogenous miR-206 expression is altered. Vector-mediated manipulation of miR-206 activity in these models of cell growth and wasting did not alter gain or loss of muscle mass respectively. Our data demonstrate that although the miR-206/HDAC4 axis operates in skeletal muscle, the post-natal expression of miR-206 is not a key regulator of basal skeletal muscle mass or specific modes of muscle growth and wasting. These studies support a context-dependent role of miR-206 in regulating hypertrophy that may be dispensable for maintaining or modifying the adult skeletal

  4. 19 CFR 206.44 - Contents of a petition under section 421(b) or (o) of the Trade Act.

    Science.gov (United States)

    2010-04-01

    ...) of the Trade Act. 206.44 Section 206.44 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION... requests the Commission to seek pricing information in its questionnaires, and an explanation of why the petitioner believes the Commission should collect pricing information for each such product; (3) For each...

  5. 19 CFR 206.43 - Contents of a petition under section 406(a) of the Trade Act.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Contents of a petition under section 406(a) of the Trade Act. 206.43 Section 206.43 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION... States for like or directly competitive articles; evidence of disruptive pricing practices, or other...

  6. 27 CFR 19.206 - Curtailment and extension of plant premises for the manufacture of eligible flavors.

    Science.gov (United States)

    2010-04-01

    ... of plant premises for the manufacture of eligible flavors. 19.206 Section 19.206 Alcohol, Tobacco... and extension of plant premises for the manufacture of eligible flavors. (a) General. The premises of... permit the use of the facilities for the manufacture of eligible flavors. (b) Qualifying documents. When...

  7. 30 CFR 206.103 - How do I value oil that is not sold under an arm's-length contract?

    Science.gov (United States)

    2010-07-01

    ... arm's-length contract? 206.103 Section 206.103 Mineral Resources MINERALS MANAGEMENT SERVICE... oil that is not sold under an arm's-length contract? This section explains how to value oil that you... average of the gross proceeds accruing to the seller under your or your affiliates' arm's-length contracts...

  8. 45 CFR 46.206 - Research involving, after delivery, the placenta, the dead fetus or fetal material.

    Science.gov (United States)

    2010-10-01

    ..., the dead fetus or fetal material. 46.206 Section 46.206 Public Welfare DEPARTMENT OF HEALTH AND HUMAN... placenta, the dead fetus or fetal material. (a) Research involving, after delivery, the placenta; the dead fetus; macerated fetal material; or cells, tissue, or organs excised from a dead fetus, shall be...

  9. 17 CFR 275.206(4)-4 - Financial and disciplinary information that investment advisers must disclose to clients.

    Science.gov (United States)

    2010-04-01

    ... information that investment advisers must disclose to clients. 275.206(4)-4 Section 275.206(4)-4 Commodity and... disclose to clients. (a) It shall constitute a fraudulent, deceptive, or manipulative act, practice, or... fail to disclose to any client or prospective client all material facts with respect to: (1) A...

  10. 34 CFR 206.1 - What are the special educational programs for students whose families are engaged in migrant and...

    Science.gov (United States)

    2010-07-01

    ... whose families are engaged in migrant and other seasonal farmwork? 206.1 Section 206.1 Education..., DEPARTMENT OF EDUCATION SPECIAL EDUCATIONAL PROGRAMS FOR STUDENTS WHOSE FAMILIES ARE ENGAGED IN MIGRANT AND OTHER SEASONAL FARMWORK-HIGH SCHOOL EQUIVALENCY PROGRAM AND COLLEGE ASSISTANCE MIGRANT PROGRAM General...

  11. Overexpression of miR-206 suppresses glycolysis, proliferation and migration in breast cancer cells via PFKFB3 targeting.

    Science.gov (United States)

    Ge, Xin; Lyu, Pengwei; Cao, Zhang; Li, Jingruo; Guo, Guangcheng; Xia, Wanjun; Gu, Yuanting

    2015-08-07

    miRNAs, sorting as non-coding RNAs, are differentially expressed in breast tumor and act as tumor promoters or suppressors. miR-206 could suppress the progression of breast cancer, the mechanism of which remains unclear. The study here was aimed to investigate the effect of miR-206 on human breast cancers. We found that miR-206 was down-regulated while one of its predicted targets, 6-Phosphofructo-2-kinase (PFKFB3) was up-regulated in human breast carcinomas. 17β-estradiol dose-dependently decreased miR-206 expression as well as enhanced PFKFB3 mRNA and protein expression in estrogen receptor α (ERα) positive breast cancer cells. Furthermore, we identified that miR-206 directly interacted with 3'-untranslated region (UTR) of PFKFB3 mRNA. miR-206 modulated PFKFB3 expression in MCF-7, T47D and SUM159 cells, which was influenced by 17β-estradiol depending on ERα expression. In addition, miR-206 overexpression impeded fructose-2,6-bisphosphate (F2,6BP) production, diminished lactate generation and reduced cell proliferation and migration in breast cancer cells. In conclusion, our study demonstrated that miR-206 regulated PFKFB3 expression in breast cancer cells, thereby stunting glycolysis, cell proliferation and migration. Copyright © 2015 Elsevier Inc. All rights reserved.

  12. 42 CFR 415.206 - Services of residents in nonprovider settings.

    Science.gov (United States)

    2010-10-01

    ... PHYSICIANS IN TEACHING SETTINGS, AND RESIDENTS IN CERTAIN SETTINGS Services of Residents § 415.206 Services... payments. If the conditions in § 413.78 regarding patient care activities and training of residents are met... equivalency residents in the calculation of a teaching hospital's resident count. The teaching physician rules...

  13. 17 CFR 275.206(4)-1 - Advertisements by investment advisers.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Advertisements by investment... COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT ADVISERS ACT OF 1940 § 275.206(4)-1 Advertisements by investment advisers. (a) It shall constitute a fraudulent, deceptive, or manipulative act...

  14. 30 CFR 206.350 - What is the purpose of this subpart?

    Science.gov (United States)

    2010-07-01

    ... MANAGEMENT PRODUCT VALUATION Geothermal Resources § 206.350 What is the purpose of this subpart? (a) This subpart applies to all geothermal resources produced from Federal geothermal leases issued pursuant to the... definitions apply: (1) “Settlement agreement” means a settlement agreement between the United States and a...

  15. 28 CFR 2.206 - Travel approval and transfers of supervision.

    Science.gov (United States)

    2010-07-01

    ... Supervised Releasees § 2.206 Travel approval and transfers of supervision. (a) A releasee's supervision... request for such permission shall be in writing and must demonstrate a substantial need for such travel... include the D.C. metropolitan area as defined in the certificate of supervised release. (e) A supervised...

  16. 30 CFR 206.100 - What is the purpose of this subpart?

    Science.gov (United States)

    2010-07-01

    ... MANAGEMENT PRODUCT VALUATION Federal Oil § 206.100 What is the purpose of this subpart? (a) This subpart applies to all oil produced from Federal oil and gas leases onshore and on the Outer Continental Shelf..., you as a designee must determine and report royalty value for the lessee's oil by applying the rules...

  17. 46 CFR 180.206 - Survival craft-vessels operating on Great Lakes routes.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Survival craft-vessels operating on Great Lakes routes... Craft § 180.206 Survival craft—vessels operating on Great Lakes routes. (a) Except as allowed by paragraph (b) of this section, each vessel certificated to operate on a Great Lakes route must be provided...

  18. 49 CFR 236.206 - Battery or power supply with respect to relay; location.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Battery or power supply with respect to relay..., AND APPLIANCES Automatic Block Signal Systems Standards § 236.206 Battery or power supply with respect to relay; location. The battery or power supply for each signal control relay circuit, where an open...

  19. 5 CFR 531.206 - Order of processing simultaneous pay actions.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Order of processing simultaneous pay... REGULATIONS PAY UNDER THE GENERAL SCHEDULE Determining Rate of Basic Pay General Provisions § 531.206 Order of processing simultaneous pay actions. When multiple pay actions with the same effective date affect an...

  20. 42 CFR 3.206 - Confidentiality of patient safety work product.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Confidentiality of patient safety work product. 3... PROVISIONS PATIENT SAFETY ORGANIZATIONS AND PATIENT SAFETY WORK PRODUCT Confidentiality and Privilege Protections of Patient Safety Work Product § 3.206 Confidentiality of patient safety work product. (a...

  1. 45 CFR 400.206 - Federal funding for social services and targeted assistance services.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Federal funding for social services and targeted... and Providing Assistance and Services § 400.206 Federal funding for social services and targeted assistance services. (a) Federal funding is available for refugee social services as set forth in Subpart I...

  2. 42 CFR 50.206 - Sterilization of a mentally incompetent individual or of an institutionalized individual.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Sterilization of a mentally incompetent individual..., DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS POLICIES OF GENERAL APPLICABILITY Sterilization of Persons in Federally Assisted Family Planning Projects § 50.206 Sterilization of a mentally incompetent individual or...

  3. 19 CFR 206.7 - Confidential business information; furnishing of nonconfidential summaries thereof.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Confidential business information; furnishing of... NONADJUDICATIVE INVESTIGATIONS INVESTIGATIONS RELATING TO GLOBAL AND BILATERAL SAFEGUARD ACTIONS, MARKET DISRUPTION, TRADE DIVERSION, AND REVIEW OF RELIEF ACTIONS General § 206.7 Confidential business information...

  4. 7 CFR 205.206 - Crop pest, weed, and disease management practice standard.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Crop pest, weed, and disease management practice... Requirements § 205.206 Crop pest, weed, and disease management practice standard. (a) The producer must use management practices to prevent crop pests, weeds, and diseases including but not limited to: (1) Crop...

  5. 30 CFR 206.104 - What publications are acceptable to MMS?

    Science.gov (United States)

    2010-07-01

    ... daily surveys of buyers and sellers of crude oil, and, for ANS spot prices, buyers and sellers of ANS... REVENUE MANAGEMENT PRODUCT VALUATION Federal Oil § 206.104 What publications are acceptable to MMS? (a... price and ANS spot price based on certain criteria, including, but not limited to: (1) Publications...

  6. Hmgb3 is regulated by microRNA-206 during muscle regeneration.

    Directory of Open Access Journals (Sweden)

    Simona Maciotta

    Full Text Available MicroRNAs (miRNAs have been recently involved in most of human diseases as targets for potential strategies to rescue the pathological phenotype. Since the skeletal muscle is a spread-wide highly differentiated and organized tissue, rescue of severely compromised muscle still remains distant from nowadays. For this reason, we aimed to identify a subset of miRNAs major involved in muscle remodelling and regeneration by analysing the miRNA-profile of single fibres isolated from dystrophic muscle, which was here considered as a model of chronic damage.The miRNA-signature associated to regenerating (newly formed and remodelling (resting fibres was investigated in animal models of muscular dystrophies and acute damage, in order to distinguish which miRNAs are primary related to muscle regeneration. In this study we identify fourteen miRNAs associated to dystrophic fibres responsible for muscle regeneration and remodelling, and confirm over-expression of the previously identified regeneration-associated myomiR-206. In particular, a functional binding site for myomiR-206 was identified and validated in the 3'untranslated region (3'UTR of an X-linked member of a family of sequence independent chromatin-binding proteins (Hmgb3 that is preferentially expressed in hematopoietic stem cells. During regeneration of single muscle fibres, Hmgb3 messenger RNA (mRNA and protein expression was gradually reduced, concurrent with the up-regulation of miR-206.Our results elucidate a negative feedback circuit in which myomiR-206 represses Hmgb3 expression to modulate the regeneration of single muscle fibres after acute and chronic muscle damage. These findings suggest that myomiR-206 may be a potential therapeutic target in muscle diseases.

  7. Pygmy and core polarization dipole modes in 206Pb: Connecting nuclear structure to stellar nucleosynthesis

    Science.gov (United States)

    Tonchev, A. P.; Tsoneva, N.; Bhatia, C.; Arnold, C. W.; Goriely, S.; Hammond, S. L.; Kelley, J. H.; Kwan, E.; Lenske, H.; Piekarewicz, J.; Raut, R.; Rusev, G.; Shizuma, T.; Tornow, W.

    2017-10-01

    A high-resolution study of the electromagnetic response of 206Pb below the neutron separation energy is performed using a (γ → ,γ‧) experiment at the HI γ → S facility. Nuclear resonance fluorescence with 100% linearly polarized photon beams is used to measure spins, parities, branching ratios, and decay widths of excited states in 206Pb from 4.9 to 8.1 MeV. The extracted ΣB (E 1) ↑ and ΣB (M 1) ↑ values for the total electric and magnetic dipole strength below the neutron separation energy are 0.9 ± 0.2 e2fm2 and 8.3 ± 2.0 μN2, respectively. These measurements are found to be in very good agreement with the predictions from an energy-density functional (EDF) plus quasiparticle phonon model (QPM). Such a detailed theoretical analysis allows to separate the pygmy dipole resonance from both the tail of the giant dipole resonance and multi-phonon excitations. Combined with earlier photonuclear experiments above the neutron separation energy, one extracts a value for the electric dipole polarizability of 206Pb of αD = 122 ± 10 mb /MeV. When compared to predictions from both the EDF+QPM and accurately calibrated relativistic EDFs, one deduces a range for the neutron-skin thickness of Rskin206 = 0.12- 0.19 fm and a corresponding range for the slope of the symmetry energy of L = 48- 60 MeV. This newly obtained information is also used to estimate the Maxwellian-averaged radiative cross section 205Pb (n , γ)206Pb at 30 keV to be σ = 130 ± 25 mb. The astrophysical impact of this measurement-on both the s-process in stellar nucleosynthesis and on the equation of state of neutron-rich matter-is discussed.

  8. 30 CFR 206.356 - How do I calculate royalty or fees due on geothermal resources I use for direct use purposes?

    Science.gov (United States)

    2010-07-01

    ... geothermal resources I use for direct use purposes? 206.356 Section 206.356 Mineral Resources MINERALS... Resources § 206.356 How do I calculate royalty or fees due on geothermal resources I use for direct use purposes? If you use the geothermal resource for direct use: (a) For Class I leases, you must determine the...

  9. MicroRNA-206: a potential circulating biomarker candidate for amyotrophic lateral sclerosis.

    Directory of Open Access Journals (Sweden)

    Janne M Toivonen

    Full Text Available Amyotrophic lateral sclerosis (ALS is a lethal motor neuron disease that progressively debilitates neuronal cells that control voluntary muscle activity. Biomarkers are urgently needed to facilitate ALS diagnosis and prognosis, and as indicators of therapeutic response in clinical trials. microRNAs (miRNAs, small posttranscriptional modifiers of gene expression, are frequently altered in disease conditions. Besides their important regulatory role in variety of biological processes, miRNAs can also be released into the circulation by pathologically affected tissues and display remarkable stability in body fluids. In a mouse model of ALS that expresses mutated human superoxide dismutase 1 (SOD1-G93A skeletal muscle is one of the tissues affected early by mutant SOD1 toxicity. To find biomarkers for ALS, we studied miRNA alterations from skeletal muscle and plasma of SOD1-G93A mice, and subsequently tested the levels of the affected miRNAs in the serum from human ALS patients. Fast-twitch and slow-twitch muscles from symptomatic SOD1-G93A mice (age 90 days and their control littermates were first studied using miRNA microarrays and then evaluated with quantitative PCR from five age groups from neonatal to the terminal disease stage (10-120 days. Among those miRNA changed in various age/gender/muscle groups (miR-206, -1, -133a, -133b, -145, -21, -24, miR-206 was the only one consistently altered during the course of the disease pathology. In both sexes, mature miR-206 was increased in fast-twitch muscles preferably affected in the SOD1-G93A model, with highest expression towards the most severely affected animals. Importantly, miR-206 was also increased in the circulation of symptomatic animals and in a group of 12 definite ALS patients tested. We conclude that miR-206 is elevated in the circulation of symptomatic SOD1-G93A mice and possibly in human ALS patients. Although larger scale studies on ALS patients are warranted, miR-206 is a promising

  10. Coulomb excitation of the two proton-hole nucleus $^{206}$Hg

    CERN Multimedia

    We propose to use Coulomb excitation of the single magic two-proton-hole nucleus $^{206}$Hg. In a single-step excitation both the first 2$^{+}$ and the highly collective octupole 3$^{-}$ states will be populated. Thus, information on both quadrupole and octupole collectivity will be gained in this neutron-rich nucleus. Due to the high beam intensity, we will be able to observe multi-step Coulomb excitation as well, providing further test on theoretical calculations. The results will be used to improve the predictive power of the shell model for more exotic nuclei as we move to lighter N=126 nuclei. The experiment will use the new HIE-ISOLDE facility and the MINIBALL array, and will take advantage of the recently developed $^{206}$Hg beam from the molten lead target.

  11. Comprehensive gene and microRNA expression profiling reveals miR-206 inhibits MET in lung cancer metastasis.

    Science.gov (United States)

    Chen, Qing-yong; Jiao, De-min; Yan, Li; Wu, Yu-quan; Hu, Hui-zhen; Song, Jia; Yan, Jie; Wu, Li-jun; Xu, Li-qun; Shi, Jian-guo

    2015-08-01

    MiRNAs associated with the metastasis of lung cancer remain largely unexplored. In this study, gene and miRNA expression profiling were performed to analyze the global expression of mRNAs and miRNAs in human high- and low-metastatic lung cancer cell strains. By developing an integrated bioinformatics analysis, six miRNAs (miR-424-3p, miR-450b-5p, miR-335-5p, miR-34a-5p, miR-302b-3p and miR-206) showed higher target gene degrees in the miRNA-gene network and might be potential metastasis-related miRNAs. Using the qRT-PCR method, the six miRNAs were further confirmed to show a significant expression difference between human lung cancer and normal tissue samples. Since miR-206 showed lower expression both in lung cancer tissues and cell lines, it was used as an example for further functional verification. The wound healing assay and transwell invasion assay showed that miR-206 mimics significantly inhibited the cell migration and invasion of the high-metastatic lung cancer 95D cell strain. One of its predicted targets in our miRNA-gene network, MET, was also obviously decreased at the protein level when miR-206 was overexpressed. Instead, miR-206 inhibitors increased MET protein expression, cell migration and invasion of the low-metastatic lung cancer 95C cell strain. Meanwhile, the luciferase assay showed that MET was a direct target of miR-206. Furthermore, MET gene silence showed a similar anti-migration and anti-invasion effect with miR-206 mimics in 95D cells and could partially attenuate the migration- and invasion-promoting effect of miR-206 inhibitors in 95C cells, suggesting that miR-206 targets MET in lung cancer metastasis. Finally, we also demonstrated that miR-206 can significantly inhibit lung cancer proliferation and metastasis in mouse models. In conclusion, our study provided a miRNA-gene regulatory network in lung cancer metastasis and further demonstrated the roles of miR-206 and MET in this process, which enhances the understanding of the

  12. Maternal and foetal outcome of 206 high risk pregnancy cases in border guard hospital, dhaka.

    Science.gov (United States)

    Shapla, N R; Islam, M A; Shahida, S M; Parveen, Z; Lipe, Y S

    2015-04-01

    This observational study was carried out to identify the various types of high risk pregnancy and to determine the maternal and foetal outcome. The study was carried out on 206 pregnant high risk women in the Gynecology and Obstetrics department of Border Guard Hospital, Dhaka from January 2012 to December 2012. During mentioned period among 598 pregnant women 206 high risk pregnancy cases were randomly selected. Pregnant women (gestational age from 34 weeks upto 40 weeks) having medical condition and pregnancy related high risk factors were included and uncomplicated pregnancy, pregnancy before 37 weeks, post dated pregnancy were excluded from this study. Data was collected from semi structured history sheet and data analysis done by percentage. High risk pregnant women were grouped into three. Group A and Group B includes pregnant women having medical condition before and during pregnancy respectively. Group C consists of pregnant women had pregnancy related high risk issues. Among 206 high risk pregnancy cases majority 47.57% women had medical condition during pregnancy, 31.55% patient had medical condition before pregnancy. Among them majority 30.58% of the patient suffered from pregnancy induced hypertension, 15.04% patients suffered from gestational Diabetes Mellitus and premature rupture of membranes were 12.13%. In this study majority 43.68% of high risk pregnant patients were in age group of 30-35 years, 19.90% pregnant women were in age group of >35 years and 19.40% were in age group of upto 20 years. Among study groups maximum 65.04% of the patients were multiparous. Among 206 study population 60.19% high risk pregnant women were at term at the time of delivery and 39.8% women delivered their babies preterm. Caesarean section was done in 69.41% of high risk pregnant women. After delivery majority 77.66% women had no complication, only 10.19%, 8.25%, 2.91% and 0.97% high risk pregnant women suffered from fever, UTI, abdominal wound infection and post

  13. 17 CFR 275.206(4)-2 - Custody of funds or securities of clients by investment advisers.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Custody of funds or securities... 1940 § 275.206(4)-2 Custody of funds or securities of clients by investment advisers. (a) Safekeeping... business within the meaning of section 206(4) of the Act (15 U.S.C. 80b-6(4)) for you to have custody of...

  14. MicroRNA-206 colocalizes with ribosome-rich regions in both the nucleolus and cytoplasm of rat myogenic cells.

    Science.gov (United States)

    Politz, Joan C Ritland; Zhang, Fan; Pederson, Thoru

    2006-12-12

    MicroRNAs are small, approximately 21- to 24-nt RNAs that have been found to regulate gene expression. miR-206 is a microRNA that is expressed at high levels in Drosophila, zebrafish, and mouse skeletal muscle and is thought to be involved in the attainment and/or maintenance of the differentiated state. We used locked nucleic acid probes for in situ hybridization analysis of the intracellular localization of miR-206 during differentiation of rat myogenic cells. Like most microRNAs, which are presumed to suppress translation of target mRNAs, we found that miR-206 occupies a cytoplasmic location in cultured myoblasts and differentiated myotubes and that its level increases in myotubes over the course of differentiation, consistent with previous findings in muscle tissue in vivo. However, to our surprise, we also observed miR-206 to be concentrated in nucleoli. A probe designed to be complementary to the precursor forms of miR-206 gave no nucleolar signal. We characterized the intracellular localization of miR-206 at higher spatial resolution and found that a substantial fraction colocalizes with 28S rRNA in both the cytoplasm and the nucleolus. miR-206 is not concentrated in either the fibrillar centers of the nucleolus or the dense fibrillar component, where ribosomal RNA transcription and early processing occur, but rather is localized in the granular component, the region of the nucleolus where final ribosome assembly takes place. These results suggest that miR-206 may associate both with nascent ribosomes in the nucleolus and with exported, functional ribosomes in the cytoplasm.

  15. WSA206, a paralog of duplicated MPF2-like MADS-box family is recruited in fertility function in Withania.

    Science.gov (United States)

    Khan, Muhammad Ramzan; Ihsan, Humera; Ali, Ghulam Muhammad

    2016-12-01

    Best known for their implication in calyx inflation, MPF2-like genes pertinent to the STMADS11 clade of the MADS-box family exert their functions in leaf development, flowering time, inflorescence architecture and floral reversion to just name but a few. However, our knowledge about their involvement in fertility function remained obscure. Therefore the major thrust of this study was to probe the recruitment of WSA206 (MPF2-like) protein in fertility function. The WSA206 functions were revealed by knocking down and overexpressing this protein in Withania somnifera. The WSA206 promoter functions were defined by stable integration in Arabidopsis using GUS tag. The interactions of WSA206 were investigated by screening Arabidopsis Oligo-dT yeast library and YFP-split analysis. WSA206 knockdown plants revealed fewer flowers, abortion in seed set, reduction in pollen number and deformed non-viable pollen in comparison with wild type counterparts. Overexpression of WSA206 in Withania generated more berries/seeds and healthier viable pollen grains. Remarkably, along with fertility control, the impairment in calyx inflation in knockdown Withania plants and extraordinary growth of sepals in overexpression lines is observed. Thus, fertility and calyx inflation are tightly coupled traits under the control of WSA206. Coding sequence revealed SNP mutations from arginine to lysine as well as a leucine-rich motif duplication at the C-terminus, a characteristic feature of pollen specific and fertility function proteins. The protein-protein interaction spectrum of WSA206 comprises 40% of those MADS and non-MADS-box proteins implicated in floral/anther expression and embryogenesis. Predominant WSA206 promoter:GUS expression accrued in the anthers/pollen may be attributed to of the presence of GAAATTGTTA pollen specific proximal motifs along with several other anther specific homotypic cis-clusters. MPF2-like protein WSA206 through interactions with MADS-box and non

  16. Effect of excess oxygen for CuFeO2.06 delafossite on thermoelectric and optical properties

    Science.gov (United States)

    Rudradawong, Chalermpol; Ruttanapun, Chesta

    2017-12-01

    This work presents the role of excess oxygen in CuFeO2.06 compounds on thermoelectric and optical properties. The CuFeO2.06 specimens were synthesized by solid state reaction method. X-ray diffraction technique has confirmed the CuFeO2 structure for the specimens. In particularly, CuFeO2.06 specimen revealed the structural extension of lattice parameter: a and c. Also, the specimen found increasing excess oxygen of approximately 3% as a resulted enhancement of mixed valence state of Cu+ and Cu2+ ions. XPS showed mixed valence state of the Cu+/Cu2+ ions, and Fe3+ and Fe2+ ions was also found in the CuFeO2.06 specimen. Mixed valence states contributed the co-existence of hole and electron carriers for conduction. Consequently, electrical conductivity of the CuFeO2.06 specimen increased up to 23 S/cm at 873 K. Also, increasing Seebeck coefficient was shown to be approximately 302 μV/K at 873 K. The CuFeO2.06 specimen was found power factor to be approximately 2.1 × 10-4 W/m•K2 at 873 K. The indirect optical gap of CuFeO2.06 (2.40 eV) was lower than that of the CuFeO2 (2.60 eV). Thus, thermoelectric and optical properties were governed by an existence of excess oxygen.

  17. Higgs Candidates in $e^+ e^-$ Interactions at $\\sqrt{s}$= 206.6 GeV

    CERN Document Server

    Acciarri, M; Adriani, O; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, L; Balandras, A; Baldew, S V; Todorova-Nová, S; Banerjee, Sw; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brochu, F; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Cucciarelli, S; Dai, T S; van Dalen, J A; D'Alessandro, R; De Asmundis, R; Déglon, P L; Degré, A; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Van Dierendonck, D N; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Dufournaud, D; Duinker, P; Durán, I; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ewers, A; Extermann, Pierre; Fabre, M; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Guida, M; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Hofer, H; Holzner, G; Hoorani, H; Hou, S R; Hu, Y; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Khan, R A; Käfer, D; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, J K; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopal, M; Kopp, A; Koutsenko, V F; Kräber, M H; Krämer, R W; Krenz, W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Levchenko, P M; Li Chuan; Likhoded, S A; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Lugnier, L; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mans, J; Marian, G; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Moulik, T; Muanza, G S; Muijs, A J M; Musicar, B; Musy, M; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nisati, A; Nowak, H; Ofierzynski, R A; Organtini, G; Oulianov, A; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Paramatti, R; Park, H K; Park, I H; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Pedace, M; Pensotti, S; Perret-Gallix, D; Petersen, B; Piccolo, D; Pierella, F; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Prokofiev, D O; Prokofev, D; Quartieri, J; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A V; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Rodin, J; Roe, B P; Romero, L; Rosca, A; Rosier-Lees, S; Roth, S; Rosenbleck, C; Rubio, Juan Antonio; Ruggiero, G; Rykaczewski, H; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Sanders, M P; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schopper, Herwig Franz; Schotanus, D J; Schwering, G; Sciacca, C; Seganti, A; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Sushkov, S V; Suter, H; Swain, J D; Szillási, Z; Sztaricskai, T; Tang, X W; Tauscher, Ludwig; Taylor, L; Tellili, B; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Vicinanza, D; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, M; Wang, X L; Wang, Z M; Weber, A; Weber, M; Wienemann, P; Wilkens, H; Wu, S X; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhu, G Y; Zhu, R Y; Zichichi, A; Zilizi, G; Zimmermann, B; Zöller, M

    2000-01-01

    In a search for the Standard Model Higgs boson, carried out on 212.5~$\\mathrm{pb^{-1}}$ of data collected by the L3 detector at the highest LEP centre-of-mass energies, including 116.5~$\\mathrm{pb^{-1}}$ above $\\sqrt{s} = 206$~GeV, an excess of candidates for the process $e^+ e^- \\rightarrow Z^{*}\\rightarrow HZ$ is found for Higgs masses near 114.5~GeV. We present an analysis of our data and the characteristics of our strongest candidates.

  18. Use of cement in concrete according to European standard EN 206-1

    Directory of Open Access Journals (Sweden)

    Christoph Müller

    2012-04-01

    Full Text Available The manufacture of cements with several main constituents (blended cements is of particular importance with regard to reducing climatically relevant CO2 emissions in the cement industry. A wide variety of common cement products exists in the different EU Member States. They match local manufacturing conditions, throughout meeting particular climatic or other local conditions, including building practices. In general, all cements conforming to European Cement Standard EN 197-1 are suitable for the manufacture of concrete according to European Concrete Standard EN 206-1. Depending on the area of application, however, differences related to the cement type may possibly have to be taken into account to ensure the durability of the concretes manufactured with these cements. These regulations were laid down in National Application Documents (NADs to EN 206-1 dependent upon the exposure classes that a structural element is assigned to. This paper deals with the overall concept of EN 206-1 with regard to concrete durability. It gives an overview of the cement types used in Europe and the areas of application of cements conforming to EN 197-1 in concrete conforming to EN 206-1 and various national annexes. The option of combining several main constituents makes blended cements particularly well suited for combining the advantages of individual main constituents, and thus for developing these cements into even more robust systems. This process requires an integrated assessment of all requirements to be met by cements during manufacture and application. From a technical perspective these include the strength formation potential as well as good workability of the concrete and, in particular, the durability of the concrete made from these cements. The effects that the main constituents have with regard to properties relevant to durability can be utilized in particular in cements made from a combination of limestone/blastfurnace slag or limestone/fly ash as

  19. Fatores que influenciaram a evolução de 206 pacientes com traumatismo craniencefálico grave Relevant factors in 206 patients with severe head injury

    Directory of Open Access Journals (Sweden)

    Venâncio Pereira Dantas Filho

    2004-06-01

    Full Text Available A busca de fatores prognósticos para o traumatismo craniencefálico (TCE tem sido alvo de muitos estudos nas últimas décadas. A identificação de indicadores consistentes da evolução destes pacientes tem representado um grande desafio e sua utilidade considerada evidente tanto para orientar o tratamento, quanto para a estimativa do resultado final. Baseados numa casuística de 206 pacientes com TCE grave (8 pontos ou menos pela Escala de Coma de Glasgow - ECG, estudamos a influência de vários fatores sobre a evolução dos pacientes. A gravidade inicial medida pela ECG, a presença de hipertensão intracraniana (níveis acima de 20 mmHg, o tipo de lesão intracraniana e a presença de hipoxia, hipotensão arterial e a associação de hipóxia e hipotensão arterial tiveram influência significativa sobre a evolução dos pacientes. A presença de politraumatismo (pelo menos dois sítios de lesão além do TCE e a idade (acima e abaixo de 40 anos não influenciaram significativamente a evolução dos pacientes desta casuística.The search for head injury prognostic factors has been intense in the last decades. The importance of identification of these factors has been also recognised to treatment orientation and results estimatives. Based on 206 severe head injuried patients series, we analized the influence of factors over the outcome. The initial severity by Glasgow coma scale, the presence of intracranial hypertension (over 20 mmHg, the type of intracranial lesion and the presence of hypoxia, systemic hypotension or both, significantly influenced the results. The presence of multiple traumas (at least two sites of lesion over head injury, as age, did not influence the final results in this series.

  20. MR-Guided vacuum biopsy of 206 contrast-enhancing breast lesions; MRT-gefuehrte Vakuumbiopsie bei 206 Kontrastmittel anreichernden Laesionen der Mamma

    Energy Technology Data Exchange (ETDEWEB)

    Perlet, C.; Schneider, P.; Sittek, H.; Reiser, M.F. [Klinikum der Universitaet Grosshadern, Muenchen (Germany). Inst. fuer Klinische Radiologie; Amaya, B.; Grosse, A.; Heywang-Koebrunner, S.H. [Martin-Luther-Universitaet, Halle (Germany). Klinik fuer Diagnostische Radiologie

    2002-01-01

    Purpose: To determine the accuracy and clinical use of MR-guided vacuum biopsy (VB) of enhancing breast lesions. Material and Methods: 254 lesions were referred to MR-guided vacuum-assisted breast biopsy. In 43 (16%) patients the indication was dropped because the lesions could not be identified at the time VB was scheduled. This was due to hormonal influences (n=37), to too strong compression (n=3) or to misinterpretation of the initial diagnostic MRI. In 5 cases (2%) VB was not performed due to obesity (n=2); problems of access (n=2) or a defect of the MR-unit (n=1). VB was performed on altogether 206 lesions. In 4 cases (2%) VB was unsuccessful. This was immediately realized on the post-interventional images. Thus a false negative diagnosis was avoided. Verification included excision of the cavity in cases with proven malignancy or atypical ductal hyperplasia (ADH) and (for benign lesions) retrospective correlation of VB-histology with pre- and postinterventional MRI and subsequent follow-up. Results: 51/202 successful biopsies proved malignancy. In 7 cases ADH and in 144 cases a benign lesion was diagnosed. One DCIS was underestimated as ADH. All other benign or malignant diagnoses proved to be correct. Conclusion: MR-guided VB allows reliable histological work-up of contrast-enhancing small lesions which are not visible by any other modality. (orig.) [German] Zielsetzung: Evaluation der Wertigkeit und klinischen Anwendbarkeit der MRT-gefuehrten Vakuumbiopsie (VB) bei anreichernden Mammalaesionen. Material und Methoden: Insgesamt wurden 254 Laesionen der MRT-gefuehrten VB zugewiesen. Hiervon entfiel bei 43 Patientinnen (16%) die Biopsieindikation beim Planungs-MRT, da die urspruengliche Anreicherung hormonell (n=37), durch zu starke Kompression (n=3) oder durch eine Fehlinterpretation des vorausgegangenen diagnostischen MRT (n=3) nicht mehr abgrenzbar war. Bei 5 weiteren Laesionen (2%) war die Biopsie nicht moeglich (Adipositas n=2; Zugangsprobleme n=2; MRT

  1. Processing and geologic analysis of conventional cores from well ER-20-6 No. 1, Nevada Test Site

    Energy Technology Data Exchange (ETDEWEB)

    Prothro, L.B., Townsend, M.J.; Drellack, S.L. Jr. [and others

    1997-09-01

    In 1996, Well Cluster ER-20-6 was drilled on Pahute Mesa in Area 20, in the northwestern corner of the Nevada Test Site (NTS). The three wells of the cluster are located from 166 to 296 meters (m) (544 to 971 feet [ft]) southwest of the site of the underground nuclear test code-named BULLION, conducted in 1990 in Emplacement Hole U-20bd. The well cluster was planned to be the site of a forced-gradient experiment designed to investigate radionuclide transport in groundwater. To obtain additional information on the occurrence of radionuclides, nature of fractures, and lithology, a portion of Well ER-20-6 No. 1, the hole closest to the explosion cavity, was cored for later analysis. Bechtel Nevada (BN) geologists originally prepared the geologic interpretation of the Well Cluster ER-20-6 site and documented the geology of each well in the cluster. However, the cores from Well ER-20-6 No. 1 were not accessible at the time of that work. As the forced-gradient experiment and other radio nuclide migration studies associated with the well cluster progressed, it was deemed appropriate to open the cores, describe the geology, and re-package the core for long-term air-tight storage. This report documents and describes the processing, geologic analysis, and preservation of the conventional cores from Well ER20-6 No. 1.

  2. Characterization of three new varieties of Vigna unguiculata ('IPA 206' and 'IPA 207' Y 'guariba' in Cuba

    Directory of Open Access Journals (Sweden)

    Yadelys Figueroa Aguila

    2014-04-01

    Full Text Available The research was conducted on a fairly soft Brown soil washing vignas varieties (‘IPA 206’, ‘IPA 207’ and ‘Guariba’ recently introduced in our country. Its main objective is to characterize varieties under our climatic conditions. Having as main results achieved include in the record as the characterization of varieties developed by our institute using two seasons, the indeterminate growth habit with pods distributed throughout the plant stands in the varieties ‘IPA 206’ and ‘IPA 207’, while the ‘Guariba’ is determined by finding these distributed over the plant, as regards the yield, the variety ‘IPA 207 ‘is higher than that obtained by ‘PA 206’ and ‘Guariba’, the weight of 1000 seed varieties ‘Guariba’ and ‘IPA 206’ are greater than the weight of the ‘IPA 207’, the variety ‘Guariba’ is economically more profitable than the ‘IPA 206’ and ‘IPA 207’ by employing a number crop much lower than those above. It can be sown during all seasons, but it is best in cold weather to obtain seed and summer to produce where it is more productive and can replace the common bean. Tolerate water stress and high rainfall regime, except at harvest and does not allow puddling.

  3. Fabrication of self-supporting targets of lead (206,208Pb) using evaporation technique

    Science.gov (United States)

    Goyal, Savi; Abhilash, S. R.; Kabiraj, D.; Kalkal, Sunil; Mandal, S.

    2015-03-01

    The self-supporting 206,208Pb enriched isotopic targets of thicknesses varying from 500 μg/cm2 to 800 μg/cm2 have been prepared in the high vacuum environment at the target laboratory of Inter University Accelerator Centre (IUAC), by using the resistive heating method. The limited amount of the target material, selection of the parting agent, highly oxidizing tendency of the Pb in the atmosphere and the separation of the lead film from the glass slides were the few major challenges faced in the fabrication of the targets. A limited amount of isotopic material (100 mg) was utilized for the preparation of more than 20 thick self-supporting targets of 206Pb and 208Pb isotopes. Several attempts were made to overcome the difficulty of finding a suitable parting agent to avoid direct contact of water with the target material are discussed, along with the methods adopted for the fabrication of the targets. Further Energy Dispersive X-ray (EDX) analysis was performed to check the elemental purity of the foils. These targets have been successfully used for several nuclear physics experiments using the neutron detector setup known as National Array of Neutron Detectors (NAND) at IUAC, New Delhi.

  4. Fabrication of self-supporting targets of lead ({sup 206,208}Pb) using evaporation technique

    Energy Technology Data Exchange (ETDEWEB)

    Goyal, Savi, E-mail: savi.november@gmail.com [Department of Physics & Astrophysics, University of Delhi, Delhi 110007 (India); Abhilash, S.R.; Kabiraj, D. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, New Delhi 110067 (India); Kalkal, Sunil; Mandal, S. [Department of Physics & Astrophysics, University of Delhi, Delhi 110007 (India)

    2015-03-21

    The self-supporting {sup 206,208}Pb enriched isotopic targets of thicknesses varying from 500 μg/cm{sup 2} to 800 μg/cm{sup 2} have been prepared in the high vacuum environment at the target laboratory of Inter University Accelerator Centre (IUAC), by using the resistive heating method. The limited amount of the target material, selection of the parting agent, highly oxidizing tendency of the Pb in the atmosphere and the separation of the lead film from the glass slides were the few major challenges faced in the fabrication of the targets. A limited amount of isotopic material (100 mg) was utilized for the preparation of more than 20 thick self-supporting targets of {sup 206}Pb and {sup 208}Pb isotopes. Several attempts were made to overcome the difficulty of finding a suitable parting agent to avoid direct contact of water with the target material are discussed, along with the methods adopted for the fabrication of the targets. Further Energy Dispersive X-ray (EDX) analysis was performed to check the elemental purity of the foils. These targets have been successfully used for several nuclear physics experiments using the neutron detector setup known as National Array of Neutron Detectors (NAND) at IUAC, New Delhi.

  5. $^{206}$ Po sources for production and release studies relevant for high power spallation targets

    CERN Multimedia

    The knowledge of the evaporation behaviour of Po is of essential importance for several scientific and technological applications, like accelerator driven systems (ADS) or the LIEBE project at CERN-ISOLDE. Fundamental investigations on the experimental conditions for the formation of volatile Po species as well as on the chemical composition of the volatile compounds are necessary for a safe operation of such facilities. $^{206}$Po, a mainly $\\gamma$- ray-emitting Po isotope with a half-life of 8.8 d, is best suited for model studies, due to the lower radiation hazard compared to the longer-lived $\\alpha$-emitting isotopes $^{208-210}$Po as well as the easy-to-measure $\\gamma$-ray emission. We propose the production of $^{206}$Po samples in several matrices via the implantation of its precursor $^{210}$Fr into selected metal foils at CERN-ISOLDE. Using these samples, experiments will be carried out at PSI studying the volatilization of Po from different matrices under varying chemical conditions.

  6. COL Application Content Guide for HTGRs: Revision to RG 1.206, Part 1 - Status Report

    Energy Technology Data Exchange (ETDEWEB)

    Wayne Moe

    2012-08-01

    A combined license (COL) application is required by the Nuclear Regulatory Commission (NRC) for all proposed nuclear plants. The information requirements for a COL application are set forth in 10 CFR 52.79, “Contents of Applications; Technical Information in Final Safety Analysis Report.” An applicant for a modular high temperature gas-cooled reactor (HTGR) must develop and submit for NRC review and approval a COL application which conforms to these requirements. The technical information necessary to allow NRC staff to evaluate a COL application and resolve all safety issues related to a proposed nuclear plant is detailed and comprehensive. To this, Regulatory Guide (RG) 1.206, “Combined License Applications for Nuclear Power Plants” (LWR Edition), was developed to assist light water reactor (LWR) applicants in incorporating and effectively formatting required information for COL application review (Ref. 1). However, the guidance prescribed in RG 1.206 presumes a LWR design proposal consistent with the systems and functions associated with large LWR power plants currently operating under NRC license.

  7. Measurement of the radiative neutron capture cross section of 206Pb and its astrophysical implications

    CERN Document Server

    Domingo-Pardo, C.; Aerts, G.; Alvarez, H.; Alvarez-Velarde, F.; Andriamonje, S.; Andrzejewski, J.; Assimakopoulos, P.; Audouin, L.; Badurek, G.; Baumann, P.; Becvar, F.; Berthoumieux, E.; Bisterzo, S.; Calvino, F.; Calviani, M.; Cano-Ott, D.; Capote, R.; Carrapico, C.; Cennini, P.; Chepel, V.; Chiaveri, E.; Colonna, N.; Cortes, G.; Couture, A.; Cox, J.; Dahlfors, M.; David, S.; Dillman, I.; Dolfini, R.; Dridi, W.; Duran, I.; Eleftheriadis, C.; Embid-Segura, M.; Ferrant, L.; Ferrari, A.; Ferreira-Marques, R.; Fitzpatrick, L.; Frais-Koelbl, H.; Fujii, K.; Furman, W.; Gallino, R.; Goncalves, I.; Gonzalez-Romero, E.; Goverdovski, A.; Gramegna, F.; Griesmayer, E.; Guerrero, C.; Gunsing, F.; Haas, B.; Haight, R.; Heil, M.; Herrera-Martinez, A.; Igashira, M.; Isaev, M.; Jericha, E.; Kappeler, F.; Kadi, Y.; Karadimos, D.; Karamanis, D.; Kerveno, M.; Ketlerov, V.; Koehler, P.; Konovalov, V.; Kossionides, E.; Krticka, M.; Lamboudis, C.; Leeb, H.; Lindote, A.; Lopes, I.; Lozano, M.; Lukic, S.; Marganiec, J.; Marrone, S.; Massimi, C.; Mastinu, P.; Mengoni, A.; Milazzo, P.M.; Moreau, C.; Mosconi, M.; Neves, F.; Oberhummer, H.; Oshima, M.; O'Brien, S.; Pancin, J.; Papachristodoulou, C.; Papadopoulos, C.; Paradela, C.; Patronis, N.; Pavlik, A.; Pavlopoulos, P.; Perrot, L.; Plag, R.; Plompen, A.; Plukis, A.; Poch, A.; Pretel, C.; Quesada, J.; Rauscher, T.; Reifarth, R.; Rosetti, M.; Rubbia, C.; Rudolf, G.; Rullhusen, P.; Salgado, J.; Sarchiapone, L.; Savvidis, I.; Stephan, C.; Tagliente, G.; Tain, J.L.; Tassan-Got, L.; Tavora, L.; Terlizzi, R.; Vannini, G.; Vaz, P.; Ventura, A.; Villamarin, D.; Vincente, M.C.; Vlachoudis, V.; Vlastou, R.; Voss, F.; Walter, S.; Wendler, H.; Wiescher, M.; Wisshak, K.

    2007-01-01

    The (n, gamma) cross section of 206Pb has been measured at the CERN n_TOF facility with high resolution in the energy range from 1 eV to 600 keV by using two optimized C6D6 detectors. In the investigated energy interval about 130 resonances could be observed, from which 61 had enough statistics to be reliably analyzed via the R-matrix analysis code SAMMY. Experimental uncertainties were minimized, in particular with respect to (i) angular distribution effects of the prompt capture gamma-rays, and to (ii) the TOF-dependent background due to sample-scattered neutrons. Other background components were addressed by background measurements with an enriched 208Pb sample. The effect of the lower energy cutoff in the pulse height spectra of the C6D6 detectors was carefully corrected via Monte Carlo simulations. Compared to previous 206Pb values, the Maxwellian averaged capture cross sections derived from these data are about 20% and 9% lower at thermal energies of 5 keV and 30 keV, respectively. These new results hav...

  8. Expression of Muscle-Specific MiRNA 206 in the Progression of Disease in a Murine SMA Model.

    Directory of Open Access Journals (Sweden)

    Valeria Valsecchi

    Full Text Available Spinal muscular atrophy (SMA is a severe neuromuscular disease, the most common in infancy, and the third one among young people under 18 years. The major pathological landmark of SMA is a selective degeneration of lower motor neurons, resulting in progressive skeletal muscle denervation, atrophy, and paralysis. Recently, it has been shown that specific or general changes in the activity of ribonucleoprotein containing micro RNAs (miRNAs play a role in the development of SMA. Additionally miRNA-206 has been shown to be required for efficient regeneration of neuromuscular synapses after acute nerve injury in an ALS mouse model. Therefore, we correlated the morphology and the architecture of the neuromuscular junctions (NMJs of quadriceps, a muscle affected in the early stage of the disease, with the expression levels of miRNA-206 in a mouse model of intermediate SMA (SMAII, one of the most frequently used experimental model. Our results showed a decrease in the percentage of type II fibers, an increase in atrophic muscle fibers and a remarkable accumulation of neurofilament (NF in the pre-synaptic terminal of the NMJs in the quadriceps of SMAII mice. Furthermore, molecular investigation showed a direct link between miRNA-206-HDAC4-FGFBP1, and in particular, a strong up-regulation of this pathway in the late phase of the disease. We propose that miRNA-206 is activated as survival endogenous mechanism, although not sufficient to rescue the integrity of motor neurons. We speculate that early modulation of miRNA-206 expression might delay SMA neurodegenerative pathway and that miRNA-206 could be an innovative, still relatively unexplored, therapeutic target for SMA.

  9. Overexpression of microRNA-206 in the skeletal muscle from myotonic dystrophy type 1 patients

    Directory of Open Access Journals (Sweden)

    Angelini Corrado

    2010-05-01

    Full Text Available Abstract Background MicroRNAs are highly conserved, noncoding RNAs involved in post-transcriptional gene silencing. They have been shown to participate in a wide range of biological processes, including myogenesis and muscle regeneration. The goal of this study is to test the hypothesis that myo-miRs (myo = muscle + miR = miRNA expression is altered in muscle from patients affected by myotonic dystrophy type 1 (DM1, the most frequently inherited neuromuscular disease in adults. In order to gain better insights about the role of miRNAs in the DM1 pathogenesis, we have also analyzed the muscular expression of miR-103 and miR-107, which have been identified in silico as attractive candidates for binding to the DMPK mRNA. Methods To this aim, we have profiled the expression of miR-133 (miR-133a, miR-133b, miR-1, miR-181 (miR-181a, miR-181b, miR-181c and miR-206, that are specifically induced during myogenesis in cardiac and skeletal muscle tissues. miR-103 and miR-107, highly expressed in brain, heart and muscle have also been included in this study. QRT-PCR experiments have been performed on RNA from vastus lateralis biopsies of DM1 patients (n = 7 and control subjects (n = 4. Results of miRNAs expression have been confirmed by Northern blot, whereas in situ hybridization technique have been performed to localize misexpressed miRNAs on muscle sections from DM1 and control individuals. Results Only miR-206 showed an over-expression in 5 of 7 DM1 patients (threshold = 2, fold change between 1.20 and 13.22, average = 5.37 compared to the control group. This result has been further confirmed by Northern blot analysis (3.37-fold overexpression, R2 = 0.89. In situ hybridization localized miR-206 to nuclear site both in normal and DM1 tissues. Cellular distribution in DM1 tissues includes also the nuclear regions of centralized nuclei, with a strong signal corresponding to nuclear clumps. Conclusions This work provides, for the first time, evidences about

  10. Collective 2{sup +}{sub 1} excitations in {sup 206}Po and {sup 208,210}Rn

    Energy Technology Data Exchange (ETDEWEB)

    Grahn, T.; Auranen, K.; Herzan, A.; Jakobsson, U.; Julin, R.; Konki, J.; Peura, P.; Rahkila, P.; Stolze, S. [Department of Physics, University of Jyvaskyla (Finland); Helsinki Institute of Physics, Helsinki (Finland); Pakarinen, J. [Department of Physics, University of Jyvaskyla (Finland); Helsinki Institute of Physics, Helsinki (Finland); CERN-ISOLDE, PH Department, CERN, Geneva (Switzerland); Jokiniemi, L.; Suhonen, J. [Department of Physics, University of Jyvaskyla (Finland); Albers, M.; Blazhev, A.; Lewandowski, L.; Moschner, K.; Pfeiffer, M.; Radeck, D.; Reiter, P.; Rudiger, M.; Seidlitz, M.; Siebeck, B.; Steinbach, T.; Thoele, P.; Warr, N.; Vogt, A. [Universitaet zu Koeln, Institut fuer Kernphysik, Koeln (Germany); Bauer, C.; Boenig, S.; Kroell, T.; Thuerauf, M. [TU Darmstadt, Institut fuer Kernphysik, Darmstadt (Germany); Bernards, C. [Yale University, Wright Nuclear Structure Laboratory, New Haven, CT (United States); Butler, P.A. [University of Liverpool, Department of Physics, Oliver Lodge Laboratory, Liverpool (United Kingdom); Damyanova, A. [Universite de Geneve (Switzerland); Coster, T. de; Witte, H. de; Elseviers, J.; Huyse, M.; Kesteloot, N.; Reynders, K.; Sambi, S.; Wrzosek-Lipska, K. [Department of Physics, Instituut voor Kern- en Stralingsfysica, Leuven (Belgium); Gaffney, L.P. [University of Liverpool, Department of Physics, Oliver Lodge Laboratory, Liverpool (United Kingdom); Department of Physics, Instituut voor Kern- en Stralingsfysica, Leuven (Belgium); University of the West of Scotland, School of Engineering, Paisley (United Kingdom); Rapisarda, E.; Duppen, P. van [Department of Physics, Instituut voor Kern- en Stralingsfysica, Leuven (Belgium); CERN-ISOLDE, PH Department, CERN, Geneva (Switzerland); Salsac, M.D.; Zielinska, M. [CEA-Saclay, Gif-sur-Yvette (France); Scheck, M. [TU Darmstadt, Institut fuer Kernphysik, Darmstadt (Germany); University of the West of Scotland, School of Engineering, Paisley (United Kingdom); Venhart, M.; Veselsky, M. [Slovak Academy of Sciences, Institute of Physics, Bratislava 45 (Slovakia); Vermeulen, M.J. [University of York, Department of Physics, York (United Kingdom); Werner, V. [TU Darmstadt, Institut fuer Kernphysik, Darmstadt (Germany); Yale University, Wright Nuclear Structure Laboratory, New Haven, CT (United States)

    2016-11-15

    In the present study, B(E2; 2{sup +}{sub 1} → 0{sup +}{sub 1}) values have been measured in the {sup 208,210}Rn and {sup 206}Po nuclei through Coulomb excitation of re-accelerated radioactive beams in inverse kinematics at CERN-ISOLDE. These nuclei have been proposed to lie in, or at the boundary of the region where the seniority scheme should persist. However, contributions from collective excitations are likely to be present when moving away from the N = 126 closed shell. Such an effect is confirmed by the observed increased collectivity of the 2{sup +}{sub 1} → 0{sup +}{sub 1} transitions. Experimental results have been interpreted with the aid of theoretical studies carried out within the BCS-based QRPA framework. (orig.)

  11. Coulomb excitation of re-accelerated 208Rn and 206Po beams

    Directory of Open Access Journals (Sweden)

    Grahn T.

    2013-12-01

    Full Text Available In the present study, B(E2; 2+ → 0+ values have been measured in the 208Rn and 206Po nuclei through Coulomb excitation of re-accelerated radioactive beams in inverse kinematics at CERN-ISOLDE. The resulting B(E2; 2+ → 0+ in 208Rn is ∼ 0.08 e2b2. These nuclei lie in, or at the boundary of the region where seniority scheme should persist. However, contributions from collective excitations may be present when moving away from the N = 126 shell closure. To date, surprisingly little is known of the transition probabilities between the low-spin states in this region.

  12. SHELS: A complete galaxy redshift survey with R ≤ 20.6

    Energy Technology Data Exchange (ETDEWEB)

    Geller, Margaret J.; Hwang, Ho Seong; Fabricant, Daniel G.; Kurtz, Michael J. [Smithsonian Astrophysical Observatory, 60 Garden Street, Cambridge, MA 02138 (United States); Dell' Antonio, Ian P. [Department of Physics, Brown University, Box 1843, Providence, RI 02912 (United States); Zahid, Harus Jabran, E-mail: mgeller@cfa.harvard.edu, E-mail: hhwang@cfa.harvard.edu, E-mail: dfabricant@cfa.harvard.edu, E-mail: mkurtz@cfa.harvard.edu, E-mail: ian@het.brown.edu, E-mail: jabran@ifa.hawaii.edu [Institute for Astronomy, University of Hawaii at Manoa, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States)

    2014-08-01

    The SHELS (Smithsonian Hectospec Lensing Survey) is a complete redshift survey covering two well-separated fields (F1 and F2) of the Deep Lens Survey to a limiting R = 20.6. Here we describe the redshift survey of the F2 field (R.A.{sub 2000} = 09{sup h}19{sup m}32.4 and decl.{sub 2000} = +30°00'00''). The survey includes 16,294 new redshifts measured with the Hectospec on the MMT. The resulting survey of the 4 deg{sup 2} F2 field is 95% complete to R = 20.6, currently the densest survey to this magnitude limit. The median survey redshift is z = 0.3; the survey provides a view of structure in the range 0.1 ≲ z ≲ 0.6. An animation displays the large-scale structure in the survey region. We provide a redshift, spectral index D {sub n}4000, and stellar mass for each galaxy in the survey. We also provide a metallicity for each galaxy in the range 0.2

  13. 40 CFR 600.206-86 - Calculation and use of fuel economy values for gasoline-fueled, diesel, and electric vehicle...

    Science.gov (United States)

    2010-07-01

    ... values for gasoline-fueled, diesel, and electric vehicle configurations. 600.206-86 Section 600.206-86... values for gasoline-fueled, diesel, and electric vehicle configurations. (a) Fuel economy values... exists for an electric vehicle configuration, all values for that vehicle configuration are harmonically...

  14. 30 CFR 206.54 - How do I fulfill the lease provision regarding valuing production on the basis of the major...

    Science.gov (United States)

    2010-07-01

    ... values. (b) For purposes of this paragraph, major portion means the highest price paid or offered at the... valuing production on the basis of the major portion of like-quality oil? 206.54 Section 206.54 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT PRODUCT...

  15. 48 CFR 206.302-1 - Only one responsible source and no other supplies or services will satisfy agency requirements.

    Science.gov (United States)

    2010-10-01

    ... ACQUISITION PLANNING COMPETITION REQUIREMENTS Other Than Full and Open Competition 206.302-1 Only one... subpart 37.2) on the basis of an unsolicited proposal without providing for full and open competition... office, determines that— (i) Following thorough technical evaluation, only one source is fully qualified...

  16. Non-host disease resistance response in pea (Pisum sativum) pods: Biochemical function of DRR206 and phytoalexin pathway localization.

    Science.gov (United States)

    Seneviratne, Herana Kamal; Dalisay, Doralyn S; Kim, Kye-Won; Moinuddin, Syed G A; Yang, Hong; Hartshorn, Christopher M; Davin, Laurence B; Lewis, Norman G

    2015-05-01

    Continually exposed to potential pathogens, vascular plants have evolved intricate defense mechanisms to recognize encroaching threats and defend themselves. They do so by inducing a set of defense responses that can help defeat and/or limit effects of invading pathogens, of which the non-host disease resistance response is the most common. In this regard, pea (Pisum sativum) pod tissue, when exposed to Fusarium solani f. sp. phaseoli spores, undergoes an inducible transcriptional activation of pathogenesis-related genes, and also produces (+)-pisatin, its major phytoalexin. One of the inducible pathogenesis-related genes is Disease Resistance Response-206 (DRR206), whose role in vivo was unknown. DRR206 is, however, related to the dirigent protein (DP) family. In this study, its biochemical function was investigated in planta, with the metabolite associated with its gene induction being pinoresinol monoglucoside. Interestingly, both pinoresinol monoglucoside and (+)-pisatin were co-localized in pea pod endocarp epidermal cells, as demonstrated using matrix-assisted laser desorption/ionization (MALDI) mass spectrometry imaging. In addition, endocarp epidermal cells are also the site for both chalcone synthase and DRR206 gene expression. Taken together, these data indicate that both (+)-pisatin and pinoresinol monoglucoside function in the overall phytoalexin responses. Copyright © 2014 Elsevier Ltd. All rights reserved.

  17. 30 CFR 206.112 - What adjustments and transportation allowances apply when I value oil production from my lease...

    Science.gov (United States)

    2010-07-01

    ... apply when I value oil production from my lease using NYMEX prices or ANS spot prices? 206.112 Section... I value oil production from my lease using NYMEX prices or ANS spot prices? This section applies.... Assume the lessee refines the oil received in exchange at Midland. Assume that the NYMEX price is $30.00...

  18. 19 CFR 206.44a - Special rules for conducting investigations under section 421(b) of the Trade Act.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Special rules for conducting investigations under... Disruption § 206.44a Special rules for conducting investigations under section 421(b) of the Trade Act. (a... COMMISSION NONADJUDICATIVE INVESTIGATIONS INVESTIGATIONS RELATING TO GLOBAL AND BILATERAL SAFEGUARD ACTIONS...

  19. Role of miR206 in genistein-induced rescue of pulmonary hypertension in monocrotaline model.

    Science.gov (United States)

    Sharma, Salil; Umar, Soban; Centala, Alexander; Eghbali, Mansoureh

    2015-12-15

    Pulmonary hypertension (PH) is a progressive lung disease associated with proliferation of smooth muscle cells and constriction of lung microvasculature, leading to increased pulmonary arterial pressure, right ventricular failure, and death. We have previously shown that genistein rescues preexisting established PH by significantly improving lung and heart function. (Matori H, Umar S, Nadadur RD, Sharma S, Partow-Navid R, Afkhami M, Amjedi M, Eghbali M. Hypertension 60: 425-430, 2012). Here, we have examined the role of microRNAs (miRs) in the rescue action of genistein in monocrotaline (MCT)-induced PH in rats. Our miR microarray analysis on the lung samples from control, PH, and genistein-rescue group revealed that miR206, which was robustly upregulated to ∼11-fold by PH, was completely normalized to control levels by genistein treatment. Next, we examined whether knockdown of miR206 could reverse preexisting established PH. PH was induced in male rats by 60 mg/kg of MCT, and rats received three intratracheal doses of either miR206 antagomir (10 mg/kg body wt) or scrambled miR control at days 17, 21, and 26. Knockdown of miR206 resulted in significant improvement in the cardiopulmonary function, as right ventricular pressure was significantly reduced to 38.6 ± 3.61 mmHg from 61.2 ± 5.4 mmHg in PH, and right ventricular hypertrophy index was decreased to 0.35 ± 0.04 from 0.59 ± 0.037 in PH. Knockdown of miR206 reversed PH-induced pulmonary vascular remodeling in vivo and was associated with restoration of PH-induced loss of capillaries in the lungs and induction of vascular endothelial growth factor A expression. In conclusion, miR206 antagomir therapy improves cardiopulmonary function and structure and rescues preexisting severe PH in MCT rat model possibly by stimulating angiogenesis in the lung. Copyright © 2015 the American Physiological Society.

  20. MiR-206, a Cerebellum Enriched miRNA Is Downregulated in All Medulloblastoma Subgroups and Its Overexpression Is Necessary for Growth Inhibition of Medulloblastoma Cells.

    Science.gov (United States)

    Panwalkar, Pooja; Moiyadi, Aliasgar; Goel, Atul; Shetty, Prakash; Goel, Naina; Sridhar, Epari; Shirsat, Neelam

    2015-07-01

    Medulloblastoma is the most common and a highly malignant pediatric brain tumor located in the cerebellar region of the brain. Medulloblastomas have recently been shown to consist of four distinct molecular subgroups, viz., WNT, SHH, group 3, and group 4. MiR-206, a miRNA first identified as a myomiR due to its enriched expression in skeletal muscle was found to be expressed specifically in the cerebellum, the site of medulloblastoma occurrence. MiR-206 expression was found to be downregulated in medulloblastomas belonging to all the four molecular subgroups as well as in established medulloblastoma cell lines. Further, the expression of murine homolog of miR-206 was also found to be downregulated in SHH subgroup medulloblastomas from the Smo (+/+) transgenic mice and the Ptch1 (+/-) knockout mice. MiR-206 downregulation in all the four medulloblastoma subgroups suggests tumor-suppressive role for miR-206 in medulloblastoma pathogenesis. The effect of miR-206 expression was analyzed in three established medulloblastoma cell lines, viz., Daoy, D425, and D283 belonging to distinct molecular subgroups. Restoration of miR-206 expression to the levels comparable to those in the normal cerebellum, however, was found to be insufficient to inhibit the growth of established medulloblastoma cell lines. OTX2, an oncogenic miR-206 target, overexpressed in all non-SHH medulloblastomas, is known to inhibit myogenic differentiation of medulloblastoma cells. Overexpression of miR-206 was necessary to downregulate OTX2 expression and inhibit growth of medulloblastoma cell lines.

  1. Kinematics of SNRs CTB 109 and G206.9+2.3

    Science.gov (United States)

    Rosado, Margarita; Sánchez-Cruces, Mónica; Ambrocio-Cruz, Patricia

    2017-11-01

    We present results of optical observations in the lines of Hα and [SII] (λ 6717 and 6731 Å) obtained with the UNAM Scanning Fabry-Perot Interferometer PUMA (Rosado et al. 1995,RMxAASC, 3, 263 ) aimed at obtaining the kinematical distance, shock velocity and other important parameters of two supernova remnants (SNRs) with optical counterparts. We discuss on how kinematical distances thus obtained fit with other distance determinations. The studied SNRs are CTB 109 (SNR G109.1 - 1.0) hosting a magnetar (Sánchez-Cruces et al. 2017, in preparation) and the SNR G206.9 + 2.3 (Ambrocio-Cruz et al. 2014,RMxAA, 50, 323), a typical supernova remnant, to have a comparison. In Fig. 1 is depicted the [SII] line emission of two filaments of the optical counterpart of SNR CTB 109. We find complex radial velocity profiles obtained with the Fabry-Perot interferometer, revealing the presence of different velocity components. From these velocity profiles we obtain the kinematical distance, an expansion velocity of 188 km/s and an initial energy of 8.1 x 1050 ergs. These values are rather typical of other SNRs regardless that SNR CTB 109 hosts a magnetar. Thus, the mechanical energy delivered in the supernova explosion forming the magnetar does not seem to impact more than other SNe explosions the interstellar medium. This work has been funded by grants IN103116 and 253085 from DGAPA-UNAM and CONACYT, respectively.

  2. Role of the Mannose Receptor (CD206 in Innate Immunity to Ricin Toxin

    Directory of Open Access Journals (Sweden)

    Emily Gage

    2011-09-01

    Full Text Available The entry of ricin toxin into macrophages and certain other cell types in the spleen and liver results in toxin-induced inflammation, tissue damage and organ failure. It has been proposed that uptake of ricin into macrophages is facilitated by the mannose receptor (MR; CD206, a C-type lectin known to recognize the oligosaccharide side chains on ricin’s A (RTA and B (RTB subunits. In this study, we confirmed that the MR does indeed promote ricin binding, uptake and killing of monocytes in vitro. To assess the role of MR in the pathogenesis of ricin in vivo, MR knockout (MR−/− mice were challenged with the equivalent of 2.5× or 5× LD50 of ricin by intraperitoneal injection. We found that MR−/− mice were significantly more susceptible to toxin-induced death than their age-matched, wild-type control counterparts. These data are consistent with a role for the MR in scavenging and degradation of ricin, not facilitating its uptake and toxicity in vivo.

  3. Proteome Analysis of Disease Resistance against Ralstonia solanacearum in Potato Cultivar CT206-10

    Directory of Open Access Journals (Sweden)

    Sangryeol Park

    2016-02-01

    Full Text Available Potato is one of the most important crops worldwide. Its commercial cultivars are highly susceptible to many fungal and bacterial diseases. Among these, bacterial wilt caused by Ralstonia solanacearum causes significant yield loss. In the present study, integrated proteomics and genomics approaches were used in order to identify bacterial wilt resistant genes from Rs resistance potato cultivar CT-206-10. 2-DE and MALDI-TOF/TOF-MS analysis identified eight differentially abundant proteins including glycine-rich RNA binding protein (GRP, tomato stress induced-1 (TSI-1 protein, pathogenesis-related (STH-2 protein and pentatricopeptide repeat containing (PPR protein in response to Rs infection. Further, semi-quantitative RT-PCR identified up-regulation in transcript levels of all these genes upon Rs infection. Taken together, our results showed the involvement of the identified proteins in the Rs stress tolerance in potato. In the future, it would be interesting to raise the transgenic plants to further validate their involvement in resistance against Rs in potato.

  4. 7P1/2 hyperfine splitting in 206 , 207 , 209 , 213Fr and the hyperfine anomaly

    Science.gov (United States)

    Zhang, J.; Orozco, L. A.; Collister, R.; Gwinner, G.; Tandecki, M.; Behr, J. A.; Pearson, M. R.; Gomez, E.; Aubin, S.

    2013-05-01

    We perform precision measurements on francium, the heaviest alkali with no stable isotopes, at the recently commissioned Francium Trapping Facility at TRIUMF. A combination of RF and optical spectroscopy allows better than 10 ppm (statistical) measurements of the 7P1 / 2 state hyperfine splitting for the isotopes 206 , 207 , 209 , 213Fr, in preparation for weak interaction studies. Together with previous measurements of the ground state hyperfine structure, it is possible to extract the hyperfine anomaly. This is a correction to the point interaction of the nuclear magnetic moment and the electron wavefunction, known as the Bohr Weisskopf effect. Our measurements extend previous measurements to the neutron closed shell isotope (213) as well as further in the neutron deficient isotopes (206, 207). Work supported by NSERC and NRC from Canada, NSF and DOE from USA, CONYACT from Mexico.

  5. Flight service evaluation of composite components on the Bell Helicopter model 206L: Design, fabrication and testing

    Science.gov (United States)

    Zinberg, H.

    1982-01-01

    The design, fabrication, and testing phases of a program to obtain long term flight service experience on representative helicopter airframe structural components operating in typical commercial environments are described. The aircraft chosen is the Bell Helicopter Model 206L. The structural components are the forward fairing, litter door, baggage door, and vertical fin. The advanced composite components were designed to replace the production parts in the field and were certified by the FAA to be operable through the full flight envelope of the 206L. A description of the fabrication process that was used for each of the components is given. Static failing load tests on all components were done. In addition fatigue tests were run on four specimens that simulated the attachment of the vertical fin to the helicopter's tail boom.

  6. Radiometric observations of atmospheric attenuation at 20.6 and 31.65 GHz: The Wave Propagation Laboratory data base

    Science.gov (United States)

    Jacobson, Mark D.; Snider, J. B.; Westwater, E. R.

    1993-01-01

    The National Oceanic and Atmospheric Administration (NOAA) Wave Propagation Laboratory (WPL) presently operates five dual-channel microwave radiometers, one triple-channel microwave radiometer, and one six-channel microwave radiometer. The dual-channel radiometers operate at frequencies of 20.6 or 23.87 GHz and 31.4 or 31.65 GHz. The triple-channel radiometer operates at 20.6, 31.65, and 90.0 GHz. The six-channel radiometer operates at frequencies of 20.6, 31.65, 52.85, 53.85, 55.45, and 58.8 GHz. Recent brightness temperature measurements and attenuation values from some of the above radiometers are presented. These radiometric measurements, taken in different locations throughout the world, have given WPL a diverse set of measurements under a variety of atmospheric conditions. We propose to do a more complete attenuation analysis on these measurements in the future. In addition, a new spinning reflector was installed recently for the dual-channel radiometer at the Platteville, Colorado site. This reflector will extend our measurement capabilities during precipating conditions. Locating the three-channel and portable dual-channel radiometers at or near Greeley, Colorado to support the Advanced Communications Technology Satellite (ACTS) program is discussed.

  7. Serum Levels of MicroRNA-206 and Novel Mini-STR Assays for Carrier Detection in Duchenne Muscular Dystrophy

    Science.gov (United States)

    Anaya-Segura, Mónica Alejandra; Rangel-Villalobos, Héctor; Martínez-Cortés, Gabriela; Gómez-Díaz, Benjamín; Coral-Vázquez, Ramón Mauricio; Zamora-González, Edgar Oswaldo; García, Silvia; López-Hernández, Luz Berenice

    2016-01-01

    Duchenne Muscular Dystrophy (DMD) is an X-linked neuromuscular disorder in which the detection of female carriers is of the utmost importance for genetic counseling. Haplotyping with polymorphic markers and quantitation of creatine kinase levels (CK) allow tracking of the at-risk haplotype and evidence muscle damage, respectively. Such approaches are useful for carrier detection in cases of unknown mutations. The lack of informative markers and the inaccuracy of CK affect carrier detection. Therefore, herein we designed novel mini-STR (Short Tandem Repeats) assays to amplify 10 loci within the DMD gene and estimated allele frequencies and the polymorphism information content among other parameters in 337 unrelated individuals from three Mexican populations. In addition, we tested the utility of the assays for carrier detection in three families. Moreover, given that serum levels of miR-206 discern between DMD patients and controls with a high area under the curve (AUC), the potential applicability for carrier detection was assessed. The serum levels of miR-206 of non-carriers (n = 24) and carriers (n = 23) were compared by relative quantitation using real-time PCR (p < 0.05), which resulted in an AUC = 0.80 in the Receiver Operating Characteristic curve analysis. In conclusion, miR-206 has potential as a “liquid biopsy” for carrier detection and genetic counseling in DMD. PMID:27529242

  8. The Correlation of CD206, CD209, and Disease Severity in Behçet’s Disease with Arthritis

    Directory of Open Access Journals (Sweden)

    Bunsoon Choi

    2017-01-01

    Full Text Available The purpose of this study was to clarify the role of pattern recognition receptors in Behçet’s disease (BD. The frequencies of several pattern recognition receptors (CD11b, CD11c, CD32, CD206, CD209, and dectin-1 were analyzed in patients with BD by flow cytometry, and cytokine levels, interleukin- (IL- 18, IL-23, and IL-17A, were compared in plasma. The analysis was performed in active (n=13 and inactive (n=13 stages of BD patients. Rheumatoid arthritis patients (n=19, as a disease control, and healthy control (HC (n=19 were enrolled. The frequencies of CD11b+ and CD32+ cells were significantly increased in active BD patients compared to HC. Disease severity score was correlated to CD11c+, CD206+, and CD209+ in whole leukocytes and CD11b+, CD11c+, CD206+, CD209+, and Dectin-1+ in granulocytes. The plasma levels of IL-17A were significantly different between HC and active BD. IL-18 showed significant difference between active and inactive BD patients. From this study, we concluded the expressions of several pattern recognition receptors were correlated to the joint symptoms of BD.

  9. Molecular and Structural Characterization of the Tegumental 20.6-kDa Protein in Clonorchis sinensis as a Potential Druggable Target

    Directory of Open Access Journals (Sweden)

    Yu-Jung Kim

    2017-03-01

    Full Text Available The tegument, representing the membrane-bound outer surface of platyhelminth parasites, plays an important role for the regulation of the host immune response and parasite survival. A comprehensive understanding of tegumental proteins can provide drug candidates for use against helminth-associated diseases, such as clonorchiasis caused by the liver fluke Clonorchis sinensis. However, little is known regarding the physicochemical properties of C. sinensis teguments. In this study, a novel 20.6-kDa tegumental protein of the C. sinensis adult worm (CsTegu20.6 was identified and characterized by molecular and in silico methods. The complete coding sequence of 525 bp was derived from cDNA clones and encodes a protein of 175 amino acids. Homology search using BLASTX showed CsTegu20.6 identity ranging from 29% to 39% with previously-known tegumental proteins in C. sinensis. Domain analysis indicated the presence of a calcium-binding EF-hand domain containing a basic helix-loop-helix structure and a dynein light chain domain exhibiting a ferredoxin fold. We used a modified method to obtain the accurate tertiary structure of the CsTegu20.6 protein because of the unavailability of appropriate templates. The CsTegu20.6 protein sequence was split into two domains based on the disordered region, and then, the structure of each domain was modeled using I-TASSER. A final full-length structure was obtained by combining two structures and refining the whole structure. A refined CsTegu20.6 structure was used to identify a potential CsTegu20.6 inhibitor based on protein structure-compound interaction analysis. The recombinant proteins were expressed in Escherichia coli and purified by nickel-nitrilotriacetic acid affinity chromatography. In C. sinensis, CsTegu20.6 mRNAs were abundant in adult and metacercariae, but not in the egg. Immunohistochemistry revealed that CsTegu20.6 localized to the surface of the tegument in the adult fluke. Collectively, our results

  10. European isotopic signatures for lead in atmospheric aerosols. A source apportionment based upon 206Pb/207Pb ratios

    Energy Technology Data Exchange (ETDEWEB)

    Flament, Pascal; Deboudt, Karine [Laboratoire de Biogeochimie et Environnement du Littoral (LABEL), Universite du Littoral-Cote d' Opale, CNRS/INSU 8013 ' ELICO' , 32 Avenue Foch, F-62930 Wimereux (France); Bertho, Marie-Laure; Puskaric, Emile [Laboratoire Interdisciplinaire en Sciences de l' Environnement (LISE), Universite du Littoral-Cote d' Opale, CNRS/INSU 8013 ' ELICO' , 32 Avenue Foch, F-62930 Wimereux (France); Veron, Alain [Universite d' Aix-Marseille III, Geosciences de l' Environnement (UMR CNRS 6536) CEREGE, BP 80, F-13545 Cedex 4 Aix en Provence (France)

    2002-09-16

    To investigate the capability of the lead isotope signature technique to support a source apportionment study at a Continental scale, atmospheric particulate matter was collected at Cap Gris-Nez (Eastern Channel, northern France), over one year (1995-1996). Four days retrospective trajectories of air masses were available during each sampling experiment. Twenty-eight samples, for which the origin of aerosols was unambiguously determined, were selected for isotopic measurements. Considering the Enrichment Factors, EF{sub Crust} of lead and its size distribution, we show that lead is mostly from anthropogenic origin and mainly associated with [0.4206}Pb/207Pb<1.172) than air masses coming from the United Kingdom (1.106<{sup 206}Pb/207Pb<1.124). Generally, lead isotopic compositions in aerosols are clearly distinct from the gasoline signatures in European countries, strongly suggesting that automotive lead is no longer the major component of this metal in the air. Gasoline and industrial isotopic signatures could explain the origin of lead in our aerosol samples. A source apportionment based upon 206Pb/207Pb ratios, suggests that the difference between British (206Pb/207Pb=1.122{+-}0.038) and Continental (206Pb/207Pb=1.155{+-}0.022) signatures may be largely explained by

  11. 18 CFR Appendix I to Subpart F of... - Procedures for Compliance With the Endangered Species Act of 1973 Under § 157.206(b)(3)(i)

    Science.gov (United States)

    2010-04-01

    ... Compliance With the Endangered Species Act of 1973 Under § 157.206(b)(3)(i) I Appendix I to Subpart F of... Transactions and Abandonment Pt. 157, Subpt. F, App. I Appendix I to Subpart F of Part 157—Procedures for Compliance With the Endangered Species Act of 1973 Under § 157.206(b)(3)(i) The following procedures apply to...

  12. Higgs Candidates in $e^{+}e^{-}$ Interactions at $\\sqrt{s}$ = 206.6 GeV

    CERN Document Server

    Acciarri, M.; Adriani, O.; Aguilar-Benitez, M.; Alcaraz, J.; Alemanni, G.; Allaby, J.; Aloisio, A.; Alviggi, M.G.; Ambrosi, G.; Anderhub, H.; Andreev, Valery P.; Angelescu, T.; Anselmo, F.; Arefev, A.; Azemoon, T.; Aziz, T.; Bagnaia, P.; Bajo, A.; Baksay, L.; Balandras, A.; Baldew, S.V.; Banerjee, S.; Banerjee, Sw.; Barczyk, A.; Barillere, R.; Bartalini, P.; Basile, M.; Batalova, N.; Battiston, R.; Bay, A.; Becattini, F.; Becker, U.; Behner, F.; Bellucci, L.; Berbeco, R.; Berdugo, J.; Berges, P.; Bertucci, B.; Betev, B.L.; Bhattacharya, S.; Biasini, M.; Biland, A.; Blaising, J.J.; Blyth, S.C.; Bobbink, G.J.; Bohm, A.; Boldizsar, L.; Borgia, B.; Bourilkov, D.; Bourquin, M.; Braccini, S.; Branson, J.G.; Brochu, F.; Buffini, A.; Buijs, A.; Burger, J.D.; Burger, W.J.; Cai, X.D.; Capell, M.; Cara Romeo, G.; Carlino, G.; Cartacci, A.M.; Casaus, J.; Castellini, G.; Cavallari, F.; Cavallo, N.; Cecchi, C.; Cerrada, M.; Cesaroni, F.; Chamizo, M.; Chang, Y.H.; Chaturvedi, U.K.; Chemarin, M.; Chen, A.; Chen, G.; Chen, G.M.; Chen, H.F.; Chen, H.S.; Chiefari, G.; Cifarelli, L.; Cindolo, F.; Civinini, C.; Clare, I.; Clare, R.; Coignet, G.; Colino, N.; Costantini, S.; Cotorobai, F.; de la Cruz, B.; Csilling, A.; Cucciarelli, S.; Dai, T.S.; van Dalen, J.A.; D'Alessandro, R.; de Asmundis, R.; Deglon, P.; Degre, A.; Deiters, K.; della Volpe, D.; Delmeire, E.; Denes, P.; DeNotaristefani, F.; De Salvo, A.; Diemoz, M.; Dierckxsens, M.; van Dierendonck, D.; Dionisi, C.; Dittmar, M.; Dominguez, A.; Doria, A.; Dova, M.T.; Duchesneau, D.; Dufournaud, D.; Duinker, P.; Duran, I.; El Mamouni, H.; Engler, A.; Eppling, F.J.; Erne, F.C.; Ewers, A.; Extermann, P.; Fabre, M.; Falagan, M.A.; Falciano, S.; Favara, A.; Fay, J.; Fedin, O.; Felcini, M.; Ferguson, T.; Fesefeldt, H.; Fiandrini, E.; Field, J.H.; Filthaut, F.; Fisher, P.H.; Fisk, I.; Forconi, G.; Freudenreich, K.; Furetta, C.; Galaktionov, Iouri; Ganguli, S.N.; Garcia-Abia, Pablo; Gataullin, M.; Gau, S.S.; Gentile, S.; Gheordanescu, N.; Giagu, S.; Gong, Z.F.; Grenier, Gerald Jean; Grimm, O.; Gruenewald, M.W.; Guida, M.; van Gulik, R.; Gupta, V.K.; Gurtu, A.; Gutay, L.J.; Haas, D.; Hasan, A.; Hatzifotiadou, D.; Hebbeker, T.; Herve, Alain; Hidas, P.; Hirschfelder, J.; Hofer, H.; Holzner, G.; Hoorani, H.; Hou, S.R.; Hu, Y.; Iashvili, I.; Jin, B.N.; Jones, Lawrence W.; de Jong, P.; Josa-Mutuberria, I.; Khan, R.A.; Kafer, D.; Kaur, M.; Kienzle-Focacci, M.N.; Kim, D.; Kim, J.K.; Kirkby, Jasper; Kiss, D.; Kittel, W.; Klimentov, A.; Konig, A.C.; Kopal, M.; Kopp, A.; Koutsenko, V.; Kraber, M.; Kraemer, R.W.; Krenz, W.; Kruger, A.; Kunin, A.; Ladron de Guevara, P.; Laktineh, I.; Landi, G.; Lebeau, M.; Lebedev, A.; Lebrun, P.; Lecomte, P.; Lecoq, P.; Le Coultre, P.; Lee, H.J.; Le Goff, J.M.; Leiste, R.; Levtchenko, P.; Li, C.; Likhoded, S.; Lin, C.H.; Lin, W.T.; Linde, F.L.; Lista, L.; Liu, Z.A.; Lohmann, W.; Longo, E.; Lu, Y.S.; Lubelsmeyer, K.; Luci, C.; Luckey, David; Lugnier, L.; Luminari, L.; Lustermann, W.; Ma, W.G.; Maity, M.; Malgeri, L.; Malinin, A.; Mana, C.; Mangeol, D.; Mans, J.; Marian, G.; Martin, J.P.; Marzano, F.; Mazumdar, K.; McNeil, R.R.; Mele, S.; Merola, L.; Meschini, M.; Metzger, W.J.; von der Mey, M.; Mihul, A.; Milcent, H.; Mirabelli, G.; Mnich, J.; Mohanty, G.B.; Moulik, T.; Muanza, G.S.; Muijs, A.J.M.; Musicar, B.; Musy, M.; Napolitano, M.; Nessi-Tedaldi, F.; Newman, H.; Niessen, T.; Nisati, A.; Kluge, Hannelies; Ofierzynski, R.; Organtini, G.; Oulianov, A.; Palomares, C.; Pandoulas, D.; Paoletti, S.; Paolucci, P.; Paramatti, R.; Park, H.K.; Park, I.H.; Passaleva, G.; Patricelli, S.; Paul, Thomas Cantzon; Pauluzzi, M.; Paus, C.; Pauss, F.; Pedace, M.; Pensotti, S.; Perret-Gallix, D.; Petersen, B.; Piccolo, D.; Pierella, F.; Pieri, M.; Piroue, P.A.; Pistolesi, E.; Plyaskin, V.; Pohl, M.; Pojidaev, V.; Postema, H.; Pothier, J.; Prokofev, D.O.; Prokofev, D.; Quartieri, J.; Rahal-Callot, G.; Rahaman, M.A.; Raics, P.; Raja, N.; Ramelli, R.; Rancoita, P.G.; Ranieri, R.; Raspereza, A.; Raven, G.; Razis, P.; Ren, D.; Rescigno, M.; Reucroft, S.; Riemann, S.; Riles, Keith; Rodin, J.; Roe, B.P.; Romero, L.; Rosca, A.; Rosier-Lees, S.; Roth, Stefan; Rosenbleck, C.; Rubio, J.A.; Ruggiero, G.; Rykaczewski, H.; Saremi, S.; Sarkar, S.; Salicio, J.; Sanchez, E.; Sanders, M.P.; Schafer, C.; Schegelsky, V.; Schmidt-Kaerst, S.; Schmitz, D.; Schopper, H.; Schotanus, D.J.; Schwering, G.; Sciacca, C.; Seganti, A.; Servoli, L.; Shevchenko, S.; Shivarov, N.; Shoutko, V.; Shumilov, E.; Shvorob, A.; Siedenburg, T.; Son, D.; Smith, B.; Spillantini, P.; Steuer, M.; Stickland, D.P.; Stone, A.; Stoyanov, B.; Straessner, A.; Sudhakar, K.; Sultanov, G.; Sun, L.Z.; Sushkov, S.; Suter, H.; Swain, J.D.; Szillasi, Z.; Sztaricskai, T.; Tang, X.W.; Tauscher, L.; Taylor, L.; Tellili, B.; Timmermans, Charles; Ting, Samuel C.C.; Ting, S.M.; Tonwar, S.C.; Toth, J.; Tully, C.; Tung, K.L.; Uchida, Y.; Ulbricht, J.; Valente, E.; Vesztergombi, G.; Vetlitsky, I.; Vicinanza, D.; Viertel, G.; Villa, S.; Vivargent, M.; Vlachos, S.; Vodopianov, I.; Vogel, H.; Vogt, H.; Vorobev, I.; Vorobov, A.A.; Vorvolakos, A.; Wadhwa, M.; Wallraff, W.; Wang, M.; Wang, X.L.; Wang, Z.M.; Weber, A.; Weber, M.; Wienemann, P.; Wilkens, H.; Wu, S.X.; Wynhoff, S.; Xia, L.; Xu, Z.Z.; Yamamoto, J.; Yang, B.Z.; Yang, C.G.; Yang, H.J.; Yang, M.; Ye, J.B.; Yeh, S.C.; Zalite, A.; Zalite, Yu.; Zhang, Z.P.; Zhu, G.Y.; Zhu, R.Y.; Zichichi, A.; Zilizi, G.; Zimmermann, B.; Zoller, M.

    2000-01-01

    In a search for the Standard Model Higgs boson, carried out on 212.5 pb-1 of data collected by the L3 detector at the highest LEP centre-of-mass energies, including 116.5 pb-1 above root(s) = 206GeV, an excess of candidates for the process e+e- -> Z* -> HZ is found for Higgs masses near 114.5GeV. We present an analysis of our data and the characteristics of our strongest candidates.

  13. Stellar population of the superbubble N 206 in the LMC. I. Analysis of the Of-type stars

    Science.gov (United States)

    Ramachandran, Varsha; Hainich, R.; Hamann, W.-R.; Oskinova, L. M.; Shenar, T.; Sander, A. A. C.; Todt, H.; Gallagher, J. S.

    2018-01-01

    Context. Massive stars severely influence their environment by their strong ionizing radiation and by the momentum and kinetic energy input provided by their stellar winds and supernovae. Quantitative analyses of massive stars are required to understand how their feedback creates and shapes large scale structures of the interstellar medium. The giant H II region N 206 in the Large Magellanic Cloud contains an OB association that powers a superbubble filled with hot X-ray emitting gas, serving as an ideal laboratory in this context. Aims: We aim to estimate stellar and wind parameters of all OB stars in N 206 by means of quantitative spectroscopic analyses. In this first paper, we focus on the nine Of-type stars located in this region. We determine their ionizing flux and wind mechanical energy. The analysis of nitrogen abundances in our sample probes rotational mixing. Methods: We obtained optical spectra with the multi-object spectrograph FLAMES at the ESO-VLT. When possible, the optical spectroscopy was complemented by UV spectra from the HST, IUE, and FUSE archives. Detailed spectral classifications are presented for our sample Of-type stars. For the quantitative spectroscopic analysis we used the Potsdam Wolf-Rayet model atmosphere code. We determined the physical parameters and nitrogen abundances of our sample stars by fitting synthetic spectra to the observations. Results: The stellar and wind parameters of nine Of-type stars, which are largely derived from spectral analysis are used to construct wind momentum - luminosity relationship. We find that our sample follows a relation close to the theoretical prediction, assuming clumped winds. The most massive star in the N 206 association is an Of supergiant that has a very high mass-loss rate. Two objects in our sample reveal composite spectra, showing that the Of primaries have companions of late O subtype. All stars in our sample have an evolutionary age of less than 4 million yr, with the O2-type star being

  14. Study of the 2 n-evaporation channel in the 4,6He + 206,208Pb reactions

    Science.gov (United States)

    Lukyanov, S. M.; Penionzhkevich, Yu. E.; Astabatian, R. A.; Demekhina, N. A.; Dlouhy, Z.; Ivanov, M. P.; Kalpakchieva, R.; Kulko, A. A.; Markarian, E. R.; Maslov, V. A.; Revenko, R. V.; Skobelev, N. K.; Smirnov, V. I.; Sobolev, Yu. G.; Trazska, W.; Khlebnikov, S. V.

    2009-01-01

    Excitation functions of the reaction products were measured for the reactions induced by 4,6He projectiles on 208,206Pb targets, leading to the same compound nucleus. This was accomplished by using the stacked-foil activation technique. The identification of the reaction products (accumulated in the Pb targets) was done by their radioactive α-decays. The excitation functions for the various products were obtained at energies including the sub-Coulomb barrier region. A large value of the fusion cross section was observed in the case of the reaction induced by the weakly bound 6He projectile.

  15. The Correlation of CD206, CD209, and Disease Severity in Behçet’s Disease with Arthritis

    OpenAIRE

    Bunsoon Choi; Chang-Hee Suh; Hyoun-Ah Kim; Sayeed, Hasan M.; Seonghyang Sohn

    2017-01-01

    The purpose of this study was to clarify the role of pattern recognition receptors in Beh?et's disease (BD). The frequencies of several pattern recognition receptors (CD11b, CD11c, CD32, CD206, CD209, and dectin-1) were analyzed in patients with BD by flow cytometry, and cytokine levels, interleukin- (IL-) 18, IL-23, and IL-17A, were compared in plasma. The analysis was performed in active (n = 13) and inactive (n = 13) stages of BD patients. Rheumatoid arthritis patients (n = 19), as a disea...

  16. Caracterización de tres nuevas variedades de vignas (‘IPA 206’ e ‘IPA 207’ y ‘Guariba’ en Cuba.

    Directory of Open Access Journals (Sweden)

    Yadelys Figueroa Aguila

    2012-07-01

    Full Text Available RESUMEN La investigación se desarrolló sobre un suelo Pardo mullido medianamente lavado con las variedades de vignas (‘IPA 206’, ‘IPA 207’ y ‘Guariba’ de reciente introducción en nuestro país. Tiene como principal objetivo caracterizar las variedades (‘IPA 206, ‘IPA 207’ y ‘Guariba’ bajo nuestras condiciones climáticas. Teniendo como principales resultados que se logró incluir en el registro de variedades según la caracterización desarrollada por nuestro instituto utilizando dos épocas de siembra, el hábitos de crecimiento indeterminado con vainas distribuidas por toda la planta se destaca en las variedades ‘IPA 206’ e ‘IPA 207’, mientras que en la ‘Guariba’ es determinado encontrándose estas distribuidas por encima de la planta, en cuanto al rendimiento, la variedad ‘IPA 207’ es superiores que la obtenida por la ‘'PA 206’ y ‘Guariba’, el peso de 1000 semillas en las variedades ‘Guariba’ y ‘IPA 206’ son superiores al peso de la ‘IPA 207’, la variedad ‘Guariba’ es económicamente más rentable que las ‘IPA 206’ y ‘IPA 207’ por emplear un número de cosechas muy inferior a las antes mencionadas. Puede sembrarse durante todas las épocas del año, pero lo más aconsejable es en época de frío para la obtención de semilla y el verano para la producción donde es más productiva y puede sustituir al fríjol común. Tolera estrés hídrico y régimen de abundantes lluvias, excepto en el momento de la cosecha y no admite el encharcamiento. Characterization of three new varieties vignas (' IPA 206' and ' IPA 207' y 'Guariba' in Cuba. ABSTRACT The research was conducted on a fairly soft Brown soil washing vignas varieties ('IPA 206', 'IPA 207' and 'Guariba' recently introduced in our country. Its main objective is to characterize varieties ('IPA 206,' IPA 207 'and' Guariba ' under our climatic conditions. Having as main results achieved include in the record as the

  17. Cross section measurements for neutron inelastic scattering and the (n , 2 n γ ) reaction on 206Pb

    Science.gov (United States)

    Negret, A.; Mihailescu, L. C.; Borcea, C.; Dessagne, Ph.; Guber, K. H.; Kerveno, M.; Koning, A. J.; Olacel, A.; Plompen, A. J. M.; Rouki, C.; Rudolf, G.

    2015-06-01

    Excitation functions for γ production associated with the neutron inelastic scattering and the (n , 2 n ) reactions on 206Pb were measured from threshold up to 18 MeV for about 40 transitions. Two independent measurements were performed using different samples and acquisition systems to check consistency of the results. The neutron flux was determined with a 235U fission chamber and a procedure that were validated against a fluence standard. For incident energy higher than the threshold for the first excited level and up to 3.5 MeV, estimates are provided for the total inelastic and level cross sections by combining the present γ production cross sections with the level and decay data of 206Pb reported in the literature. The uncertainty common to all incident energies is 3.0% allowing overall uncertainties from 3.3% to 30% depending on transition and neutron energy. The present data agree well with earlier work, but significantly expand the experimental database while comparisons with model calculations using the talys reaction code show good agreement over the full energy range.

  18. WBP2 modulates G1/S transition in ER+ breast cancer cells and is a direct target of miR-206.

    Science.gov (United States)

    Ren, Yong-Qiang; Wang, Hui-Jun; Zhang, Yong-Qing; Liu, Yan-Bing

    2017-05-01

    The mechanisms underlying the oncogenic properties of WW domain binding protein 2 (WBP2) in breast cancer have not been fully understood. In this study, we explored the role of WBP2 in cell cycle regulation in ER+ breast cancer cells and how it is regulated in the cancer cells. The association between WBP2 expression and prognosis in ER+ breast cancer was assessed by data mining in Breast Cancer Gene-Expression Miner v4.0. Cell cycle was assessed by PI staining and flow cytometry. EdU staining was applied to visualize cells in S phase. The binding between miR-206 and WBP2 were verified by dual luciferase assay. CCK-8 assay and flow cytometric analysis were applied to assess the functional role of WBP2 and miR-206 in the cancer cells. High WBP2 expression correlates with higher risk of any events (AE) and metastatic relapse (MR) and also indicates shorter AE-free survival and MR-free survival in ER+ breast cancer patients. In both MCF-7 and BT474 cells, WBP can influence the expression of G1/S-related cell cycle proteins, including p21, CDK4, and cyclin D1. In addition, WBP2 overexpression resulted in facilitated G1/S transition, while WBP2 knockdown impaired the transition. The 3'UTR of WBP2 has a conserved miR-206 binding site. Functionally, miR-206 knockdown decreased tamoxifen sensitivity in tamoxifen-sensitive (TamS) MCF-7 cells, while miR-206 overexpression and WBP2 knockdown enhanced the sensitivity in tamoxifen-resistant (TamR) MCF-7 cells. Based on these findings, we infer that the miR-206/WBP2 axis can modulate tamoxifen sensitivity via regulating G1/S progression in ER+ breast cancer.

  19. Object characteristics of the facility amount to a crime under the article #206-2 of the Criminal code of Ukraine

    OpenAIRE

    Федулова, Инна Николаевна

    2017-01-01

    The scientific approaches towards the definition of the object offense as a mandatory element, which defines a socially dangerous act is studied; characterization of the object of an offense in the scope of the Article 206-2 of the Criminal Code of Ukraine is carried out, including the classification of «vertical» and «horizontal»; the article analyzes the classification of crimes in the sphere of economic activity in accordance with their direct objects, defined place in the Article 206-2 of...

  20. Caracterización de tres nuevas variedades de vignas (‘IPA 206’ e ‘IPA 207’ y ‘Guariba’) en Cuba.

    OpenAIRE

    Yadelys Figueroa Aguila; José Ventura Martín; Sergio Rodríguez Morales

    2012-01-01

    RESUMEN La investigación se desarrolló sobre un suelo Pardo mullido medianamente lavado con las variedades de vignas (‘IPA 206’, ‘IPA 207’ y ‘Guariba’) de reciente introducción en nuestro país. Tiene como principal objetivo caracterizar las variedades (‘IPA 206, ‘IPA 207’ y ‘Guariba’) bajo nuestras condiciones climáticas. Teniendo como principales resultados que se logró incluir en el registro de variedades según la caracterización desarrollada por nuestro instituto utilizando dos época...

  1. Pro-Inflammatory CD11c+CD206+ Adipose Tissue Macrophages Are Associated With Insulin Resistance in Human Obesity

    Science.gov (United States)

    Wentworth, John M.; Naselli, Gaetano; Brown, Wendy A.; Doyle, Lisa; Phipson, Belinda; Smyth, Gordon K.; Wabitsch, Martin; O'Brien, Paul E.; Harrison, Leonard C.

    2010-01-01

    OBJECTIVE Insulin resistance and other features of the metabolic syndrome have been causally linked to adipose tissue macrophages (ATMs) in mice with diet-induced obesity. We aimed to characterize macrophage phenotype and function in human subcutaneous and omental adipose tissue in relation to insulin resistance in obesity. RESEARCH DESIGN AND METHODS Adipose tissue was obtained from lean and obese women undergoing bariatric surgery. Metabolic markers were measured in fasting serum and ATMs characterized by immunohistology, flow cytometry, and tissue culture studies. RESULTS ATMs comprised CD11c+CD206+ cells in “crown” aggregates and solitary CD11c−CD206+ cells at adipocyte junctions. In obese women, CD11c+ ATM density was greater in subcutaneous than omental adipose tissue and correlated with markers of insulin resistance. CD11c+ ATMs were distinguished by high expression of integrins and antigen presentation molecules; interleukin (IL)-1β, -6, -8, and -10; tumor necrosis factor-α; and CC chemokine ligand-3, indicative of an activated, proinflammatory state. In addition, CD11c+ ATMs were enriched for mitochondria and for RNA transcripts encoding mitochondrial, proteasomal, and lysosomal proteins, fatty acid metabolism enzymes, and T-cell chemoattractants, whereas CD11c− ATMs were enriched for transcripts involved in tissue maintenance and repair. Tissue culture medium conditioned by CD11c+ ATMs, but not CD11c− ATMs or other stromovascular cells, impaired insulin-stimulated glucose uptake by human adipocytes. CONCLUSIONS These findings identify proinflammatory CD11c+ ATMs as markers of insulin resistance in human obesity. In addition, the machinery of CD11c+ ATMs indicates they metabolize lipid and may initiate adaptive immune responses. PMID:20357360

  2. Excitation functions of fusion reactions and neutron transfer in the interaction of 6He with 197Au and 206Pb

    Science.gov (United States)

    Penionzhkevich, Yu. E.; Astabatyan, R. A.; Demekhina, N. A.; Gulbekian, G. G.; Kalpakchieva, R.; Kulko, A. A.; Lukyanov, S. M.; Markaryan, E. R.; Maslov, V. A.; Muzychka, Yu. A.; Oganessian, Yu. Ts.; Revenko, R. V.; Skobelev, N. K.; Sobolev, Yu. G.; Testov, D. A.; Zholdybaev, T.

    2007-02-01

    Excitation functions for evaporation residues in the reactions 197Au(6He, xn)203-xnTl, x = 2-7, and 206Pb(6He, 2n)210Po, as well as for neutron transfer reactions for the production of 196Au and 198Au in the interaction of 6He with 197Au were measured. The 6He beam was obtained from the accelerator complex for radioactive beams DRIBs (JINR). The maximum energy of the beam was about 10AMeV and the intensity reached 2×107pps. The stacked-foil activation technique was used directly in the beam extracted from the cyclotron or in the focal plane of the magnetic spectrometer MSP-144. The identification of the reaction products was done by their radioactive γ- or α-decay. The fusion reaction with the evaporation of two neutrons was characterized by an increase in the cross-section compared to statistical model calculations. The analysis of the data in the framework of the statistical model for the decay of excited nuclei, which took into account the sequential fusion of 6He has shown good agreement between the experimental and the calculated values of the cross-sections in the case of sub-Coulomb-barrier fusion in the 206Pb + 6He reaction. An unusually large cross-section was observed below the Coulomb barrier for the production of 198Au in the interaction of 6He with 197Au. Possible mechanisms of formation and decay of transfer reaction products are discussed.

  3. 30 CFR 206.181 - How do I establish processing costs for dual accounting purposes when I do not process the gas?

    Science.gov (United States)

    2010-07-01

    ... Processing Allowances § 206.181 How do I establish processing costs for dual accounting purposes when I do... methods to establish processing costs for dual accounting purposes: (a) The average of the costs... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How do I establish processing costs for dual...

  4. 30 CFR 206.111 - How do I determine a transportation allowance if I do not have an arm's-length transportation...

    Science.gov (United States)

    2010-07-01

    ....111 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT PRODUCT VALUATION Federal Oil § 206.111 How do I determine a transportation allowance if I do not... high-gravity petroleum (generally in excess of 51 degrees API) is mixed with lower-gravity crude oil...

  5. 30 CFR 206.53 - How do I determine value for oil that I or my affiliate do(es) not sell under an arm's-length...

    Science.gov (United States)

    2010-07-01

    ... MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT PRODUCT VALUATION Indian Oil § 206... with an API gravity of 23.5°. Assume that the refinery purchases at arm's length oil (all of which must be Wyoming general sour) in the following volumes of the API gravities stated at the prices and...

  6. Anterior Submandibular Approach for Transmylohyoid Endotracheal Intubation: A Reappraisal with Prospective Study in 206 Cases of Craniomaxillofacial Fractures.

    Science.gov (United States)

    Bhola, Nitin; Jadhav, Anendd; Kala, Atul; Deshmukh, Rahul; Bhutekar, Umesh; Prasad, G S V

    2017-12-01

    Despite a paradigm shift in anesthesia and trauma airway management, the craniomaxillofacial fracture (CMF) patients continue to pose a challenge. A prospective study was planned between April 2007 and March 2015 to investigate the safety, efficacy, utility, and complications of anterior submandibular approach for transmylohyoid intubation (TMI) in CMFs using an armored endotracheal tube (ETT). Out of 1,207 maxillofacial trauma cases reported, this study recruited 206 patients (152 males and 54 females) aged between 21 and 60 years. No episode of oxygen desaturation was noted intraoperatively. Mean time to perform TMI was 6 ± 2 minutes. The mean transmylohyoid ETT withdrawal time/disconnection time from ventilator was approximately 1.5 minutes. Accidental partial extubation of ETT was noted in two patients (0.97%), and three patients (1.45%) developed abscess formations at anterior submandibular site which were managed by incision and drainage. The anterior submandibular approach for TMI was successfully used and provided stable airway in all elective CMF surgery cases, where oral or nasal intubations were not indicated/feasible and long-term ventilation support was not required. It permitted simultaneous dental occlusion-guided reduction and fixation of all the facial fractures without interference from the tube during the surgery with unhindered maintenance of the anesthesia and airway. The advantages include easy, swift, efficient, and reliable approach with a small learning curve.

  7. An Activin Receptor IA/Activin-Like Kinase-2 (R206H Mutation in Fibrodysplasia Ossificans Progressiva

    Directory of Open Access Journals (Sweden)

    Rafael Herrera-Esparza

    2013-01-01

    Full Text Available Fibrodysplasia ossificans progressiva (FOP is an exceptionally rare genetic disease that is characterised by congenital malformations of the great toes and progressive heterotopic ossification (HO in specific anatomical areas. This disease is caused by a mutation in activin receptor IA/activin-like kinase-2 (ACVR1/ALK2. A Mexican family with one member affected by FOP was studied. The patient is a 19-year-old female who first presented with symptoms of FOP at 8 years old; she developed spontaneous and painful swelling of the right scapular area accompanied by functional limitation of movement. Mutation analysis was performed in which genomic DNA as PCR amplified using primers flanking exons 4 and 6, and PCR products were digested with Cac8I and HphI restriction enzymes. The most informative results were obtained with the exon 4 flanking primers and the Cac8I restriction enzyme, which generated a 253 bp product that carries the ACVR1 617G>A mutation, which causes an amino acid substitution of histidine for arginine at position 206 of the glycine-serine (GS domain, and its mutation results in the dysregulation of bone morphogenetic protein (BMP signalling that causes FOP.

  8. Equilibrium constant for the reaction ClO + ClO ↔ ClOOCl between 250 and 206 K.

    Science.gov (United States)

    Hume, Kelly L; Bayes, Kyle D; Sander, Stanley P

    2015-05-14

    The chlorine peroxide molecule, ClOOCl, is an important participant in the chlorine-catalyzed destruction of ozone in the stratosphere. Very few laboratory measurements have been made for the partitioning between monomer ClO and dimer ClOOCl at temperatures lower than 250 K. This paper reports absorption spectra for both ClO and ClOOCl when they are in equilibrium at 1 atm and temperatures down to 206 K. The very low ClO concentrations involved requires measuring and calibrating a differential cross section, ΔσClO, for the 10-0 band of ClO. A third law fit of the new results gives Keq = [(2.01 ± 0.17) 10–27 cm3 molecule–1] e(8554∓21)K/T, where the error limits reflect the uncertainty in the entropy change. The resulting equilibrium constants are slightly lower than currently recommended. The slope of the van’t Hoff plot yields a value for the enthalpy of formation of ClOOCl at 298 K, ΔHfo, of 129.8 ± 0.6 kJ mol–1. Uncertainties in the absolute ultraviolet cross sections of ClOOCl and ClO appear to be the limiting factors in these measurements. The new Keq parameters are consistent with the measurements of Santee et al.42 in the stratosphere.

  9. Highway concrete pavement technology development and testing : volume IV, field evaluation of Strategic Highway Research Program (SHRP) C-206 test sites (early opening of full-depth pavement repairs).

    Science.gov (United States)

    2006-08-01

    The objective of this study was to monitor and evaluate the performance of experimental full-depth repairs made with high-early-strength (HES) materials placed under Strategic Highway Research Program (SHRP) project C-206, Optimization of Highway Con...

  10. Impact of body mass index on graft loss in normal and overweight patients: retrospective analysis of 206 renal transplants.

    Science.gov (United States)

    Papalia, Teresa; Greco, Rosita; Lofaro, Danilo; Maestripieri, Simona; Mancuso, Domenico; Bonofiglio, Renzo

    2010-01-01

    Excess body mass is increasingly prevalent in transplant recipients. Currently, most investigators consider body mass index (BMI) a categorical variable, which assumes that all risk factors and transplant outcomes will be similar in all patients within the same category. We investigated the effect of categorical and continuous BMI increments on renal transplant outcome in normal weight (NW: BMI 18.5-24.9) and overweight (OW: BMI 25-30) patients. We retrospectively studied 206 patients. The mean BMI of our population was 24.3 ± 2.83 kg/m(2) . Patients of each group were similar regarding age, gender, time on dialysis, donor type, cold ischemia time, and number of HLA mismatches. The independent association of BMI with survival was determined using Cox multivariate regression. OW patients showed a higher prevalence of co-morbidities. In patients with graft loss, there was a higher incidence of delayed graft function, chronic allograft nephropathy, acute rejection, and hypertension. Graft survival was significantly lower in OW patients compared to NW patients upon Kaplan-Meier analysis (p = 0.008). In a multivariate Cox regression analysis, the initial BMI, evaluated as a continuous variable, remained an independent predictor of graft loss (hazard ratio 1.21, 95% CI 1.04-1.47). However, with patient stratification into World Health Organization BMI category and, further, into quartiles of initial BMI, no significant correlation between BMI category and graft loss was found. We suggest that increasing BMI value, although without categorical variation, may represent an independent risk factor for graft loss. Our retrospective analysis of a small sample population will require further studies to confirm these data. © 2010 John Wiley & Sons A/S.

  11. Effects of silicon, copper and iron on static and dynamic properties of alloy 206 (aluminum-copper) in semi-solids produced by the SEED process

    Science.gov (United States)

    Lemieux, Alain

    The advantages of producing metal parts by rheocasting are generally recognised for common foundry alloys of Al-Si. However, other more performing alloys in terms of mechanical properties could have a great interest in specialized applications in the automotive industry, while remaining competitive in the forming. Indeed, the growing demand for more competitive products requires the development of new alloys better suited to semi-solid processes. Among others, Al-Cu alloys of the 2XX series are known for their superior mechanical strength. However, in the past, 2XX alloys were never candidates for pressure die casting. The main reason is their propensity to hot tearing. Semi-solid processes provide better conditions for molding with the rheological behavior of dough and molding temperatures lower reducing this type of defect. In the initial phase, this research has studied factors that reduce hot tearing susceptibility of castings produced by semi-solid SEED of alloy 206. Subsequently, a comparative study on the tensile properties and fatigue was performed on four variants of the alloy 206. The results of tensile strength and fatigue were compared with the specifications for applications in the automotive industry and also to other competing processes and alloys. During this study, several metallurgical aspects were analyzed. The following main points have been validated: i) the main effects of compositional variations of silicon, iron and copper alloy Al-Cu (206) on the mechanical properties, and ii) certain relationships between the mechanism of hot cracking and the solidification rate in semi-solid. Parts produced from the semi-solid paste coming from the SEED process combined with modified 206 alloys have been successfully molded and achieved superior mechanical properties than the requirements of the automotive industry. The fatigue properties of the two best modified 206 alloys were higher than those of A357 alloy castings and are close to those of the

  12. CD206+ Cell Number Differentiates Influenza A (H1N1pdm09 from Seasonal Influenza A Virus in Fatal Cases

    Directory of Open Access Journals (Sweden)

    Heidi G. Rodriguez-Ramirez

    2014-01-01

    Full Text Available In 2009, a new influenza A (H1N1 virus affected many persons around the world. There is an urgent need for finding biomarkers to distinguish between influenza A (H1N1pdm09 and seasonal influenza virus. We investigated these possible biomarkers in the lung of fatal cases of confirmed influenza A (H1N1pdm09. Cytokines (inflammatory and anti-inflammatory and cellular markers (macrophages and lymphocytes subpopulation markers were analyzed in lung tissue from both influenza A (H1N1pdm09 and seasonal influenza virus. High levels of IL-17, IFN-γ, and TNF-α positive cells were identical in lung tissue from the influenza A (H1N1pdm09 and seasonal cases when compared with healthy lung tissue (P<0.05. Increased IL-4+ cells, and CD4+ and CD14+ cells were also found in high levels in both influenza A (H1N1pdm09 and seasonal influenza virus (P<0.05. Low levels of CD206+ cells (marker of alternatively activated macrophages marker in lung were found in influenza A (H1N1pdm09 when compared with seasonal influenza virus (P<0.05, and the ratio of CD206/CD14+ cells was 2.5-fold higher in seasonal and noninfluenza group compared with influenza A (H1N1pdm09 (P<0.05. In conclusion, CD206+ cells differentiate between influenza A (H1N1pdm09 and seasonal influenza virus in lung tissue of fatal cases.

  13. The cross sections and energy spectra of the particle emission in proton induced reaction on 204,206,207,208Pb and 209Bi

    Directory of Open Access Journals (Sweden)

    Zhang Zhengjun

    2017-01-01

    Full Text Available All cross sections of proton induced reactions, angular distributions, energy spectra and double differential cross sections of neutron, proton, deuteron, triton, helium and alpha-particle emissions for p+ 204,206,207,208Pb, 209Bi reactions are consistently calculated and analyzed at incident proton energies below 200 MeV. The optical model, the distorted wave Born approximation theory, the unified Hauser-Feshbach and exciton model which includes the improved Iwamoto-Harada model are used. Theoretically calculated results are compared with the existing experimental data.

  14. Excitation functions of product nuclei from 40 to 2600 MeV proton-irradiated {sup 206,207,208,nat}Pb and {sup 209}Bi

    Energy Technology Data Exchange (ETDEWEB)

    Titarenko, Yury E. [Institute for Theoretical and Experimental Physcis, 117218 Moscow (Russian Federation)]. E-mail: yury.titarenko@itep.ru; Batyaev, Viacheslav F. [Institute for Theoretical and Experimental Physcis, 117218 Moscow (Russian Federation); Mulambetov, Ruslan D. [Institute for Theoretical and Experimental Physcis, 117218 Moscow (Russian Federation); Zhivun, Valery M. [Institute for Theoretical and Experimental Physcis, 117218 Moscow (Russian Federation); Barashenkov, Vladilen S. [Joint Institute for Nuclear Research, 141980 Dubna (Russian Federation); Mashnik, Stepan G. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Shubin, Yury N. [Institute for Physics and Power Engineering, 249020 Obninsk (Russian Federation); Ignatyuk, Anatoly V. [Institute for Physics and Power Engineering, 249020 Obninsk (Russian Federation)

    2006-06-23

    5972 nuclide yields from proton-irradiated {sup 206,207,208,nat}Pb and {sup 209}Bi thin targets have been measured for 11 proton energies within the range 0.04-2.6 GeV. The measured data have been compared with data obtained at other laboratories as well as with theoretical simulations by seven codes. We found that the predictive power of the tested codes is different but is satisfactory for most of the nuclides in the spallation region, though none of the codes agree well with the data in the whole mass region of product nuclides and all should be improved further.

  15. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  16. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  17. Mixing of isoscalar and isovector magnetic dipole excitation modes in /sup 206/Pb and /sup 208/Pb: Case of electron scattering form factors

    Energy Technology Data Exchange (ETDEWEB)

    Schanz, M.; Richter, A.; Lipparini, E.

    1987-08-01

    Inelastic electron scattering form factors of the J/sup ..pi../ = 1/sup +/ states at excitation energies E/sub x/ = 5.800 and 5.846 MeV in /sup 206/Pb and /sup 208/Pb, respectively, are discussed in terms of a simple model of isoscalar-isovector mixing. It is known that for these states, which are often called loosely ''isoscalar'' 1/sup +/ states, about half of the transition strength is accounted for by this mixing. It is demonstrated here that the isoscalar-isovector mixing is also crucial for explaining the momentum dependence and the absolute magnitude of the form factor. The relative importance of the convection current contribution to the form factor with respect to the spin one is also studied. Finally, the isovector M1 strength distribution in /sup 206/Pb between E/sub x/ = 6.7--8.2 MeV derived from high resolution inelastic electron scattering is shown to agree in shape and magnitude with the one measured recently in an experiment with tagged polarized photons.

  18. Understanding the two neutron transfer reaction mechanism in {sup 206}Pb({sup 18}O,{sup 16}O){sup 208}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Parmar, A.; Sonika [Nuclear Physics Division, Bhabha Atomic Research Centre, Mumbai - 400 085 (India); Roy, B.J., E-mail: bjroy@barc.gov.in [Nuclear Physics Division, Bhabha Atomic Research Centre, Mumbai - 400 085 (India); Jha, V.; Pal, U.K. [Nuclear Physics Division, Bhabha Atomic Research Centre, Mumbai - 400 085 (India); Sinha, T. [High Energy Nuclear and Particle Physics Division, Saha Institute of Nuclear Physics, Kolkata - 700 064 (India); Pandit, S.K.; Parkar, V.V.; Ramachandran, K.; Mahata, K.; Santra, S.; Mohanty, A.K. [Nuclear Physics Division, Bhabha Atomic Research Centre, Mumbai - 400 085 (India)

    2015-08-15

    The absolute cross sections for elastic scattering and two-neutron transfer reaction for {sup 18}O + {sup 206}Pb system have been measured at an incident energy near the Coulomb barrier. Detailed coupled reaction channel calculations have been carried out for description of the measured angular distributions for the elastic scattering and transfer reactions simultaneously. The two-neutron transfer reaction {sup 206}Pb({sup 18}O, {sup 16}O){sup 208}Pb in the g.s. → g.s. transition is analyzed in (i) extreme cluster model assuming a di-neutron transfer, (ii) two-step successive transfer, and (iii) microscopic approach (independent coordinate scheme) of simultaneous transfer of two neutrons. The relative importance of one step simultaneous transfer versus two-step successive transfer has been studied. Present analysis suggests dominance of cluster transfer of a di-neutron. The contribution from the two-step sequential processes is less significant, however, the combined “two-step plus simultaneous (microscopic)” calculations give a reasonably good agreement with the measurement. The possibility of multi-step route via projectile and target excitations and contribution from such indirect transfer paths to the present two-neutron transfer cross section has been investigated.

  19. Amphiregulin enhances VEGF-A production in human chondrosarcoma cells and promotes angiogenesis by inhibiting miR-206 via FAK/c-Src/PKCδ pathway.

    Science.gov (United States)

    Wang, Chao-Qun; Huang, Yu-Wen; Wang, Shih-Wei; Huang, Yuan-Li; Tsai, Chun-Hao; Zhao, Yong-Ming; Huang, Bi-Fei; Xu, Guo-Hong; Fong, Yi-Chin; Tang, Chih-Hsin

    2017-01-28

    Chondrosarcoma is the second most common primary malignancy of bone after myeloma and osteosarcoma. Chondrosarcoma development may be linked to angiogenesis, which is principally elicited by vascular endothelial growth factor-A (VEGF-A). The expression of VEGF-A has been recognized as a prognostic marker in angiogenesis. Amphiregulin (AR), an epidermal growth factor receptor ligand, promotes tumor proliferation, metastasis and angiogenesis. However, the role of AR in VEGF-A expression and angiogenesis in human chondrosarcoma remains largely unknown. This current study shows that AR promoted VEGF-A production and induced angiogenesis of human endothelial progenitor cells. Moreover, AR-enhanced VEGF-A expression and angiogenesis involved the FAK, c-Src and PKCδ signaling pathways, while miR-206 expression was negatively mediated by AR via the FAK, c-Src and PKCδ pathways. Our results illustrate the clinical significance between AR, VEGF-A and miR-206, as well as tumor stage, in human chondrosarcoma. AR may represent a novel therapeutic target in the metastasis and angiogenesis of chondrosarcoma. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  20. Palovarotene Inhibits Heterotopic Ossification and Maintains Limb Mobility and Growth in Mice With the Human ACVR1(R206H) Fibrodysplasia Ossificans Progressiva (FOP) Mutation.

    Science.gov (United States)

    Chakkalakal, Salin A; Uchibe, Kenta; Convente, Michael R; Zhang, Deyu; Economides, Aris N; Kaplan, Frederick S; Pacifici, Maurizio; Iwamoto, Masahiro; Shore, Eileen M

    2016-09-01

    Fibrodysplasia ossificans progressiva (FOP), a rare and as yet untreatable genetic disorder of progressive extraskeletal ossification, is the most disabling form of heterotopic ossification (HO) in humans and causes skeletal deformities, movement impairment, and premature death. Most FOP patients carry an activating mutation in a bone morphogenetic protein (BMP) type I receptor gene, ACVR1(R206H) , that promotes ectopic chondrogenesis and osteogenesis and, in turn, HO. We showed previously that the retinoic acid receptor γ (RARγ) agonist palovarotene effectively inhibited HO in injury-induced and genetic mouse models of the disease. Here we report that the drug additionally prevents spontaneous HO, using a novel conditional-on knock-in mouse line carrying the human ACVR1(R206H) mutation for classic FOP. In addition, palovarotene restored long bone growth, maintained growth plate function, and protected growing mutant neonates when given to lactating mothers. Importantly, palovarotene maintained joint, limb, and body motion, providing clear evidence for its encompassing therapeutic potential as a treatment for FOP. © 2016 American Society for Bone and Mineral Research. © 2016 American Society for Bone and Mineral Research.

  1. Comparative study on the immunopotentiator effect of ISA 201, ISA 61, ISA 50, ISA 206 used in trivalent foot and mouth disease vaccine

    Directory of Open Access Journals (Sweden)

    Ehab El-Sayed Ibrahim

    2015-10-01

    Full Text Available Aim: A comparison study was conducted to explore the best internationally available adjuvant that could be used in production of a highly potent foot and mouth disease (FMD vaccine, that could stimulate a strong immune response and possibly give greater protection against FMD. Materials and Methods: Four experimental batches of trivalent FMD vaccine were prepared with different available oil adjuvants which included Montanide ISA 201, 206, 61 and 50. Results: The results indicated that vaccines emulsified using Montanide ISA 201 and Montanide ISA 206 adjuvants elicited a protective humoral immune response from the 2nd week postvaccination (WPV as for ISA 201 with serum neutralization test (SNT and enzyme-linked immune sorbent assay (ELISA antibody titers of 1.62±0.047a and 1.8±0.049a, 1.59±0.076a and 1.836±0.077a, and 1.71±0.06b and 1.96±0.074b for serotypes O, A, SAT2, respectively, and for ISA 206 at SNT and ELISA antibody titers of 1.5±0.082a and 1.84±0.084a, 1.56±0.037a and 1.818±0.052a, and 1.5±0.106a,b and 1.81±0.104a,b for FMD virus serotypes O, A and SAT2, respectively. For ISA 61 and ISA 50, the protective antibody titer appeared in the 3rd WPV. In the ISA 61 FMD vaccine, SNT and ELISA titer were 1.59±0.076a and 1.9±0.094a, 1.53±0.056a and 1.83±0.070a, and 1.5±0.082a and 1.84±0.094a for serotypes O, A and SAT2, respectively, and in the case of ISA 50 FMD vaccine, the SNT, and ELISA titer were recorded for serotypes O, A and SAT2 respectively, 1.59±0.037a and 1.8±0.030a, 1.68±0.056a,b and 1.916±0.065a,b, and 1.65±0.082a and 1.9±0.09a. On estimating the cellular immune response, the highest delta optical density levels for ISA 201 (0.395-0.460 and ISA 206 (0.375-0.428 were observed on 14 and 21 days post vaccination (DPV respectively, while the highest levels of lymphoproliferation for ISA 61 (0.375-0.455 and ISA 50 (0.411-0.430 were on 21 and 28 DPV, respectively. Conclusion: The duration of immunity from

  2. MiR-206 functions as a tumor suppressor and directly targets K-Ras in human oral squamous cell carcinoma [Retraction

    Directory of Open Access Journals (Sweden)

    Lin FO

    2016-10-01

    Full Text Available The Editor-in-Chief and Publisher of OncoTargets and Therapy have been alerted to unacceptable levels of duplication with another published paper: Zhang D, Ni Z, Xu X, and Xiao J. MiR-32 Functions as a Tumor Suppressor and Directly Targets EZH2 in Human Oral Squamous Cell Carcinoma. Medical Science Monitor. 20:2527–2535, 2014.Accordingly, we retract Lin FO, Yao LJ, Xiao J, Liu DF, and Ni ZY. MiR-206 functions as a tumor suppressor and directly targets K-Ras in human oral squamous cell carcinoma. OncoTargets and Therapy. 2014;7:1583–1591.This Retraction relates to 

  3. Advances in Interlaboratory Testing and Evaluation of Bituminous Materials State-of-the-Art Report of the RILEM Technical Committee 206-ATB

    CERN Document Server

    Bahia, Hussain; Canestrari, Francesco; Roche, Chantal; Benedetto, Hervé; Piber, Herald; Sybilski, Dariusz

    2013-01-01

    This STAR on asphalt materials presents the achievements of RILEM TC 206 ATB, acquired over many years of interlaboratory tests and international knowledge exchange. It covers experimental aspects of bituminous binder fatigue testing; the background on compaction methods and imaging techniques for characterizing asphalt mixtures including validation of a new imaging software; it focuses on experimental questions and analysis tools regarding mechanical wheel tracking tests, comparing results from different labs and using finite element techniques. Furthermore, long-term rutting prediction and evaluation for an Austrian road are discussed, followed by an extensive analysis and test program on interlayer bond testing of three different test sections which were specifically constructed for this purpose. Finally, the key issue of manufacturing reclaimed hot mix asphalt in the laboratory is studied and recommendations for laboratory ageing of bituminous mixtures are given.

  4. Mapping the boundaries of the seniority regime and collective motion: Coulomb excitation studies of N = 122 isotones $^{206}$Po and $^{208}$Rn

    CERN Multimedia

    Butler, P; Voulot, D; Rahkila, P J; Darby, I G; Grahn, T; Bree, N C F; Julin, R J; Diriken, J V J; Jenkins, D G; Kroell, T; Huyse, M L

    In regions near magic nuclei, seniority can be regarded as a good quantum number. In the N = 122 isotones above the Z = 82 shell closure relative high-$\\textit{j}\\,$ single-particle proton orbitals dominate the structure and thus levels up to $\\textit{I}$ = 2$\\textit{j}$ - 1 could, in principle, be understood within the seniority scheme. While B(E2) values usually increase within the band with increasing $\\textit{I}$, the seniority scheme can lead to a contrasting result. The present proposal addresses this phenomenon through the measurements of previously unknown B(E2; 0$^{+}\\rightarrow$ 2$^{+}$) values in $^{206}$Po and $^{208}$Rn. The proposed Coulomb excitation measurements of radioactive beams will be carried out at the REX-ISOLDE facility using the MINIBALL $\\gamma$-ray spectrometer.

  5. Moraxella catarrhalis adhesin UspA1-derived recombinant fragment rD-7 induces monocyte differentiation to CD14+CD206+ phenotype.

    Science.gov (United States)

    Xie, Qi; Brackenbury, Louise S; Hill, Darryl J; Williams, Neil A; Qu, Xun; Virji, Mumtaz

    2014-01-01

    Circulating monocytes in the bloodstream typically migrate to other tissues and differentiate into tissue resident macrophages, the process being determined by the constituents of the microenvironments encountered. These may include microbes and their products. In this study, we investigated whether Moraxella catarrhalis Ubiquitous Surface Protein A1 (UspA1), known to bind to a widely expressed human cell surface receptor CEACAM1, influences monocyte differentiation as receptor engagement has been shown to have profound effects on monocytes. We used the recombinant molecules corresponding to the regions of UspA1 which either bind (rD-7; UspA1527-665) or do not bind (r6-8; UspA1659-863) to CEACAM1 and investigated their effects on CD206, CD80 and CD86 expression on freshly isolated human CD14+ monocytes from peripheral blood mononuclear cells (PBMC). Exposure to rD-7, but not r6-8, biased monocyte differentiation towards a CD14+CD206+ phenotype, with reduced CD80 expression. Monocytes treated with rD-7 also secreted high levels of IL-1ra and chemokine IL-8 but not IL-10 or IL-12p70. The effects of rD-7 were independent of any residual endotoxin. Unexpectedly, these effects of rD-7 were also independent of its ability to bind to CEACAM1, as monocyte pre-treatment with the anti-CEACAM antibody A0115 known to inhibit rD-7 binding to the receptor, did not affect rD-7-driven differentiation. Further, another control protein rD-7/D (a mutant form of rD-7, known not to bind to CEACAMs), also behaved as the parent molecule. Our data suggest that specific regions of M. catarrhalis adhesin UspA1 may modulate inflammation during infection through a yet unknown receptor on monocytes.

  6. Serum miRNAs miR-206, 143-3p and 374b-5p as potential biomarkers for amyotrophic lateral sclerosis (ALS).

    Science.gov (United States)

    Waller, Rachel; Goodall, Emily F; Milo, Marta; Cooper-Knock, Jonathan; Da Costa, Marc; Hobson, Esther; Kazoka, Mbombe; Wollff, Helen; Heath, Paul R; Shaw, Pamela J; Kirby, Janine

    2017-07-01

    Amyotrophic lateral sclerosis (ALS) is a fatal, neurodegenerative condition characterized by loss of motor neurones and progressive muscle wasting. There is no diagnostic test for ALS therefore robust biomarkers would not only be valuable for diagnosis, but also for the classification of disease subtypes, monitoring responses to drugs and tracking disease progression. As regulators of gene expression, microRNAs (miRNAs) are increasingly used for diagnostic and prognostic purposes in various disease states with increasing exploration in neurodegenerative disorders. We hypothesize that circulating blood-based miRNAs will serve as biomarkers and use miRNA profiling to determine miRNA signatures from the serum of sporadic ALS patients compared to healthy controls and patients with diseases that mimic ALS. A number of differentially expressed miRNAs were identified in each set of patient comparisons. Validation in an additional patient cohort showed that miR-206 and miR-143-3p were increased and miR-374b-5p was decreased compared to controls. A continued change in miRNA expression persisted during disease progression indicating the potential use of these particular miRNAs as longitudinal biomarkers in ALS. Copyright © 2017 The Authors. Published by Elsevier Inc. All rights reserved.

  7. J-UNIO protocol used for NMR structure determination of the 206-residue protein NP-346487.1 from Streptococcus pneumoniae TIGR4

    Energy Technology Data Exchange (ETDEWEB)

    Jaudzems, Kristaps [Latvian Institute of Organic Synthesis (Latvia); Pedrini, Bill [Paul Scherrer Institute (PSI), SwissFEL Project (Switzerland); Geralt, Michael; Serrano, Pedro; Wüthrich, Kurt, E-mail: wuthrich@scripps.edu [The Scripps Research Institute, Department of Integrative Structural and Computational Biology (United States)

    2015-01-15

    The NMR structure of the 206-residue protein NP-346487.1 was determined with the J-UNIO protocol, which includes extensive automation of the structure determination. With input from three APSY-NMR experiments, UNIO-MATCH automatically yielded 77 % of the backbone assignments, which were interactively validated and extended to 97 %. With an input of the near-complete backbone assignments and three 3D heteronuclear-resolved [{sup 1}H,{sup 1}H]-NOESY spectra, automated side chain assignment with UNIO-ATNOS/ASCAN resulted in 77 % of the expected assignments, which was extended interactively to about 90 %. Automated NOE assignment and structure calculation with UNIO-ATNOS/CANDID in combination with CYANA was used for the structure determination of this two-domain protein. The individual domains in the NMR structure coincide closely with the crystal structure, and the NMR studies further imply that the two domains undergo restricted hinge motions relative to each other in solution. NP-346487.1 is so far the largest polypeptide chain to which the J-UNIO structure determination protocol has successfully been applied.

  8. Depth profile of production yields of {sup nat}Pb(p, xn) {sup 206,205,204,203,202,201}Bi nuclear reactions

    Energy Technology Data Exchange (ETDEWEB)

    Mokhtari Oranj, Leila [Division of Advanced Nuclear Engineering, POSTECH, Pohang 37673 (Korea, Republic of); Jung, Nam-Suk; Kim, Dong-Hyun; Lee, Arim; Bae, Oryun [Pohang Accelerator Laboratory, POSTECH, Pohang 37673 (Korea, Republic of); Lee, Hee-Seock, E-mail: lee@postech.ac.kr [Pohang Accelerator Laboratory, POSTECH, Pohang 37673 (Korea, Republic of)

    2016-11-01

    Experimental and simulation studies on the depth profiles of production yields of {sup nat}Pb(p, xn) {sup 206,205,204,203,202,201}Bi nuclear reactions were carried out. Irradiation experiments were performed at the high-intensity proton linac facility (KOMAC) in Korea. The targets, irradiated by 100-MeV protons, were arranged in a stack consisting of natural Pb, Al, Au foils and Pb plates. The proton beam intensity was determined by activation analysis method using {sup 27}Al(p, 3p1n){sup 24}Na, {sup 197}Au(p, p1n){sup 196}Au, and {sup 197}Au(p, p3n){sup 194}Au monitor reactions and also by Gafchromic film dosimetry method. The yields of produced radio-nuclei in the {sup nat}Pb activation foils and monitor foils were measured by HPGe spectroscopy system. Monte Carlo simulations were performed by FLUKA, PHITS/DCHAIN-SP, and MCNPX/FISPACT codes and the calculated data were compared with the experimental results. A satisfactory agreement was observed between the present experimental data and the simulations.

  9. Depth profiles of production yields of natPb(p, xn206,205,204,203,202 Bi reactions using 100-MeV proton beam

    Directory of Open Access Journals (Sweden)

    Oranj Leila Mokhtari

    2017-01-01

    Full Text Available In this study, results of the experimental study on the depth profiles of production yields of 206,205,204,203,202Bi radio-nuclei in the natural Pb target irradiated by a 100-MeV proton beam are presented. Irradiation was performed at proton linac facility (KOMAC in Korea. The target, irradiated by 100-MeV protons, was arranged in a stack consisting of natural Pb, Al, Au foils and Pb plates. The proton beam intensity was determined by activation analysis method using 27Al(p, 3p1n24Na, 197Au(p, p1n196Au, and 197Au(p, p3n194Au monitor reactions and also using dosimetry method by a Gafchromic film. The production yields of produced Bi radio-nuclei in the natural Pb foils and monitor reactions were measured by gamma-ray spectroscopy. Monte Carlo simulations were performed by FLUKA, PHITS, and MCNPX codes and compared with the measurements in order to verify validity of physical models and nuclear data libraries in the Monte Carlo codes. A fairly good agreement was observed between the present experimental data and the simulations by FLUKA, PHITS, and MCNPX. However, physical models and the nuclear data relevant to the end of range of protons in the codes need to be improved.

  10. Tolerogenic responses of CD206+, CD83+, FOXP3+, and CTLA-4 to sericin/polyvinyl alcohol/glycerin scaffolds relevant to IL-33 and HSP60 activity.

    Science.gov (United States)

    Ampawong, Sumate; Aramwit, Pornanong

    2016-09-01

    Silk sericin-releasing (sericin/polyvinyl alcohol (PVA)/glycerin) scaffolds have been designed for wound dressing applications using different fabrication techniques that influence scaffold antigenicity. The immunological tolerance of scaffolds depends on the balance of immunogenic and tolerogenic responses modulated by dendritic cells (DCs). An in vivo skin implantation model was used to compare the tolerogenic effect of sericin/PVA/glycerin scaffolds prepared by freeze-drying versus salt-leaching techniques, using an Allevyn® scaffold as a control. Immunohistochemical and histopathological studies were performed to evaluate tolerogenic DCs (CD206+), immunogenic DCs (CD83+), regulatory T-cells (FOXP3+ and CTLA-4), a proinflammatory cytokine (interleukin 33: IL-33), a stress marker (heat shock protein 60; HSP60), histopathological changes and related inflammatory cells. It was found that both sericin/PVA/glycerin scaffolds were tolerogenic and induced early activated Treg functions, while the Allevyn® scaffold was immunogenic. However, the tolerance of the freeze-dried sericin/PVA/glycerin scaffolds was not as consistent as the salt-leached sericin/PVA/glycerin scaffolds, indicated by the low level of CTLA-4 expression. This was probably due to molecular cross-linking and the morphological and mechanical properties of the freeze-drying technique, which would enhance the immune response. Severe inflammatory responses (including mast cell degranulation and foreign body giant cell accumulation) and histopathological changes (including fat infiltration and fibrosis formation) were mainly found with the Allevyn® scaffold, presumably from its architecture and chemical composition, especially polyurethane. The up-regulation of IL-33 and HSP60 with the Allevyn® scaffold was correlated with the inflammatory and pathological levels. Our findings suggested that salt-leached sericin/PVA/glycerin scaffolds were tolerogenic, induced a low inflammatory response and were

  11. Neighborhood socioeconomic circumstances and the co-occurrence of unhealthy lifestyles: evidence from 206,457 Australians in the 45 and up study.

    Science.gov (United States)

    Feng, Xiaoqi; Astell-Burt, Thomas

    2013-01-01

    Research on the co-occurrence of unhealthy lifestyles has tended to focus mainly upon the demographic and socioeconomic characteristics of individuals. This study investigated the relevance of neighborhood socioeconomic circumstance for multiple unhealthy lifestyles. An unhealthy lifestyle index was constructed for 206,457 participants in the 45 and Up Study (2006-2009) by summing binary responses on smoking, alcohol, physical activity and five diet-related variables. Higher scores indicated the co-occurrence of unhealthy lifestyles. Association with self-rated health, quality of life; and risk of psychological distress was investigated using multilevel logistic regression. Association between the unhealthy lifestyle index with neighborhood characteristics (local affluence and geographic remoteness) were assessed using multilevel linear regression, adjusting for individual-level characteristics. Nearly 50% of the sample reported 3 or 4 unhealthy lifestyles. Only 1.5% reported zero unhealthy lifestyles and 0.2% had all eight. Compared to people who scored zero, those who scored 8 (the 'unhealthiest' group) were 7 times more likely to rate their health as poor (95%CI 3.6, 13.7), 5 times more likely to report poor quality of life (95%CI 2.6, 10.1), and had a 2.6 times greater risk of psychological distress (95%CI 1.8, 3.7). Higher scores among men decreased with age, whereas a parabolic distribution was observed among women. Neighborhood affluence was independently associated with lower scores on the unhealthy lifestyle index. People on high incomes scored higher on the unhealthy lifestyle index if they were in poorer neighborhoods, while those on low incomes had fewer unhealthy lifestyles if living in more affluent areas. Residents of deprived neighborhoods tend to report more unhealthy lifestyles than their peers in affluent areas, regardless of their individual demographic and socioeconomic characteristics. Future research should investigate the trade-offs of

  12. 75 FR 52914 - Airworthiness Directives; Bell Helicopter Textron Canada Limited Models 206A, 206B, 206L, 206L-1...

    Science.gov (United States)

    2010-08-30

    ... Part Number (P/N) 101584-1 or -2, sold through Bell Helicopter Spares beginning March 2009, as an... maintenance records to determine if a disc assembly, part number (P/N) 101584-1 or -2, is installed. Do this... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Bell Helicopter...

  13. Effect of national wealth on BMI: An analysis of 206,266 individuals in 70 low-, middle- and high-income countries.

    Science.gov (United States)

    Masood, Mohd; Reidpath, Daniel D

    2017-01-01

    This study explores the relationship between BMI and national-wealth and the cross-level interaction effect of national-wealth and individual household-wealth using multilevel analysis. Data from the World Health Survey conducted in 2002-2004, across 70 low-, middle- and high-income countries was used. Participants aged 18 years and over were selected using multistage, stratified cluster sampling. BMI was used as outcome variable. The potential determinants of individual-level BMI were participants' sex, age, marital-status, education, occupation, household-wealth and location(rural/urban) at the individual-level. The country-level factors used were average national income (GNI-PPP) and income inequality (Gini-index). A two-level random-intercepts and fixed-slopes model structure with individuals nested within countries was fitted, treating BMI as a continuous outcome. The weighted mean BMI and standard-error of the 206,266 people from 70-countries was 23.90 (4.84). All the low-income countries were below the 25.0 mean BMI level and most of the high-income countries were above. All wealthier quintiles of household-wealth had higher scores in BMI than lowest quintile. Each USD10000 increase in GNI-PPP was associated with a 0.4 unit increase in BMI. The Gini-index was not associated with BMI. All these variables explained 28.1% of country-level, 4.9% of individual-level and 7.7% of total variance in BMI. The cross-level interaction effect between GNI-PPP and household-wealth was significant. BMI increased as the GNI-PPP increased in first four quintiles of household-wealth. However, the BMI of the wealthiest people decreased as the GNI-PPP increased. Both individual-level and country-level factors made an independent contribution to the BMI of the people. Household-wealth and national-income had significant interaction effects.

  14. Improved 206Pb/238U microprobe geochronology by the monitoring of a trace-element-related matrix effect; SHRIMP, ID-TIMS, ELA-ICP-MS and oxygen isotope documentation for a series of zircon standards

    Science.gov (United States)

    Black, L.P.; Kamo, S.L.; Allen, C.M.; Davis, D.W.; Aleinikoff, J.N.; Valley, J.W.; Mundil, R.; Campbell, I.H.; Korsch, R.J.; Williams, I.S.; Foudoulis, C.

    2004-01-01

    Precise isotope dilution-thermal ionisation mass spectrometry (ID-TIMS) documentation is given for two new Palaeozoic zircon standards (TEMORA 2 and R33). These data, in combination with results for previously documented standards (AS3, SL13, QGNG and TEMORA 1), provide the basis for a detailed investigation of inconsistencies in 206Pb/238U ages measured by microprobe. Although these ages are normally consistent between any two standards, their relative age offsets are often different from those established by ID-TIMS. This is true for both sensitive high-resolution ion-microprobe (SHRIMP) and excimer laser ablation-inductively coupled plasma-mass spectrometry (ELA-ICP-MS) dating, although the age offsets are in the opposite sense for the two techniques. Various factors have been investigated for possible correlations with age bias, in an attempt to resolve why the accuracy of the method is worse than the indicated precision. Crystallographic orientation, position on the grain-mount and oxygen isotopic composition are unrelated to the bias. There are, however, striking correlations between the 206Pb/238U age offsets and P, Sm and, most particularly, Nd abundances in the zircons. Although these are not believed to be the primary cause of this apparent matrix effect, they indicate that ionisation of 206Pb/238U is influenced, at least in part, by a combination of trace elements. Nd is sufficiently representative of the controlling trace elements that it provides a quantitative means of correcting for the microprobe age bias. This approach has the potential to reduce age biases associated with different techniques, different instrumentation and different standards within and between laboratories. Crown Copyright ?? 2004 Published by Elsevier B.V. All rights reserved.

  15. Excitation functions of $^{nat}$Pb(d,x)$^{206,205,204,203,202}$Bi, $^{203cum,202m,201cum}$Pb and $^{202cum,201cum}$Tl reactions up to 50 MeV

    OpenAIRE

    Ditrói, F.; Tárkányi, F.; Takács, S.; Hermanne, A.; Ignatyuk, A. V.

    2014-01-01

    Cross-sections of deuteron induced nuclear reactions on lead were measured up to 50 MeV using the standard stacked foil irradiation technique and high resolution $\\gamma$-ray spectrometry. Experimental cross-sections and derived integral yields are presented for the $^{nat}$Pb(d,x)$^{206,205,204,203,202}$Bi, $^{203cum,202m,201cum}$Pb and $^{202cum,201cum}$Tl reactions. The experimental data were compared with the results from literature and with the data in the TENDL-2013 library (obtained wi...

  16. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  17. High resolution neutron (n,xn) cross-section measurements for {sup 206,207,208}Pb and {sup 209}Bi from threshold up to 20 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Mihailescu, L.C.; Borcea, C.; Plompen, A.J.M. [European Commission, Joint Research Center, Institute for Reference Materials and Measurements, Geel (Belgium); Baumann, P.; Dessagne, P.; Kerveno, M.; Lukic, S.; Rudolf, G. [IReS, IN2P3, 67 - Strasbourg (France); Jericha, E.; Pavlik, A. [Wien Technische Univ. (Austria); Koning, A.J. [Nuclear Research Group Petten (Netherlands)

    2008-07-01

    Gamma production cross sections for neutron inelastic scattering reactions (n,xn) (x = 1, 2, 3) were measured for three different highly enriched targets of {sup 206}Pb, {sup 207}Pb and {sup 208}Pb and for {sup 209}Bi. Using the known decay schemes of these isotopes, the total inelastic cross sections and level inelastic cross sections were determined. The measurements are continuous in neutron energy and cover a wide interval (from threshold energy up to about 20 MeV). The experiments were performed at the GELINA white neutron source, at the 200 m flight path station with a time resolution of 8 ns, resulting in an unprecedented neutron energy resolution of 1.1 keV at 1 MeV (36 keV at 10 MeV). (authors)

  18. Rare hemoglobin variants: Hb G-Szuhu (HBB: c.243C>G), Hb G-Coushatta (HBB: c.68A>C) and Hb Mizuho (HBB: c.206T>C) in Sri Lankan families.

    Science.gov (United States)

    Perera, P Shiromi; Silva, Ishari; Hapugoda, Menaka; Wickramarathne, Merita N; Wijesiriwardena, Indira; Efremov, Dimitar G; Fisher, Christopher A; Weatherall, David J; Premawardhena, Anuja

    2015-01-01

    In this short communication, we describe the clinical presentation of unusual hemoglobin (Hb), variants in three Sri Lankan cases under study for β-thalassemia intermedia (β-TI). We believe this is the first report on their occurrence in Sri Lanka as well as from the Indian subcontinent. During a molecular study performed on β-TI patients, we identified three unusual Hb variants as Hb G-Szuhu (HBB: c.243C>G), Hb G-Coushatta (HBB: c.68A>C) and Hb Mizuho (HBB: c.206T>C) in three unrelated families. Hb G-Szuhu and Hb G-Coushatta were found in combination with the common β-thalassemia (β-thal) mutation, IVS-I-5 (G>C). Both probands had mild anemia with greatly reduced red cell indices and had non palpable livers and spleens, however, by ultrasound, both were observed to be enlarged. The final Hb variant, Hb Mizuho, was identified as a heterozygous mutation found in both proband and his mother. Both family members had severe anemia and were regularly transfused and had increased red cell parameters.

  19. Rb-Sr and single - zircon grain 207Pb / 206Pb chronology of the Monesterio granodiorite and related migmatites. Evidence of a Late Cambrian melting event in the Ossa-Morena Zone, Iberian Massif

    Directory of Open Access Journals (Sweden)

    Bea, F.

    1999-04-01

    Full Text Available The Monesterio granodiorite, a small granodioritic body placed in a migmatitic complex in the SW of the Olivenza-Monesterio antiform, is a key plutonic body to understanding the relationships among the magmatism, metamorphism, and deformation in the Ossa-Morena Zone, SW Iberian Massif. We dated the granodiorite with the single zircon stepwise-evaporation 207Pb/206Pb method, and the related migmatization event with the Rb-Sr method on leucosomes. Our results indicate that the Monesterio granodiorite crystallised at 510 ± 7 Ma and its protolith had a component with Upper Proterozoic zircons with a minimum age of 1696 Ma. Leucosomes give a Rb-Sr age of 511 ± 40 Ma (MSWD =1,7 with initial 87Sr/86Sr =0.70914 ± 0.00048. The lower initial 87Sr/86Sr of the granodiorite and its calc-alkaline chemistry precludes it from having derived from the same protolith as the migmatites. The existence of different magmatic bodies in the Ossa-Morena Zone with ages clustering around 500-510 Ma reveals the existence of a significant melting event during the Late Cambrian that involved protoliths with very different geochemical and isotopic signatures.La granodiorita de Monesterio es un pequeño cuerpo emplazado en un complejo migmatítico en el SO del antiforme Olivenza-Monesterio, importante para entender las relaciones entre magmatismo, metamorfismo y deformación en la Zona de Ossa-Morena. Se ha datado la granodiorita por el método de evaporación secuencial de 207Pb/206Pb en cristal único de circón y los leucosomes de las migmatitas circundantes por el método Rb-Sr. Los datos indican una edad de cristalización de la granodiorita de 510 ± 4 Ma y un posible protolito Proterozoico Superior con una edad mínima de ∼1.700 Ma, obtenida a partir de núcleos heredados de los circones analizados. Los leucosomes dan una edad Rb-Sr de 511 ± 40 Ma, con una relación 87Sr/86Sr=0,70914 ± 0,00048. La relación inicial de 87Sr/86Sr en la granodiorita (

  20. Evaluation of health status of horses immunized with snake venom and montanide adjuvants, IMS 3012 (nanoparticle), ISA 206 and ISA 35 (emulsion based) during polyvalent snake antivenom production: hematological and biochemical assessment.

    Science.gov (United States)

    Waghmare, A B; Salvi, N C; Deopurkar, R L; Shenoy, P A; Sonpetkar, J M

    2014-05-01

    Several biochemical and hematological changes in horses are observed during production of snake antivenom. Although conventional adjuvants like Freund's (Complete and Incomplete) are good immunopotentiators, they produce considerable local reactions in animals. Variety of commercial adjuvants, like montanide adjuvants, having high immunopotentiation and showing lesser side effects are available. The prime objective during antivenom production is to strike a balance between safety of immunized horses and efficacy of the product. In our earlier work, efficacy of montanide group of adjuvants in antivenom production has already been established. The aim of the present work was to assess the safety parameters in horses, viz.: biochemical and hematological, during production of snake antivenom. In the present study, 33 new horses were randomly divided into four groups and hyperimmunized using mixture of snake venoms, viz.: Cobra venom, Russell's viper venom, Krait venom and Echis venom along with montanide adjuvants, IMS 3012, ISA 206, ISA 35 and Incomplete Freund's adjuvant as a control adjuvant; through subcutaneous route at intervals of two weeks. During the immunization period, biochemical and hematological parameters were monitored at 0th, 14th, 21st, 30th and 42nd weeks. The mean hemoglobin values dropped slightly during initial immunization but subsequently regained to normal levels. The mean serum total protein values and globulin levels showed an increment in all the four groups, compared to day zero, vice-versa a slight drop was observed in albumin levels. No significant changes were observed in serum creatinine, bilirubin, alkaline phosphatase and blood urea nitrogen values. Finally, we conclude that montanide adjuvants could be a safer alternative to the conventional adjuvants for primary phase of immunization in antivenom production. Copyright © 2014 Elsevier Ltd. All rights reserved.

  1. Characterization and Functional Analysis of Extracellular Vesicles and Muscle-Abundant miRNAs (miR-1, miR-133a, and miR-206 in C2C12 Myocytes and mdx Mice.

    Directory of Open Access Journals (Sweden)

    Yasunari Matsuzaka

    Full Text Available Duchenne muscular dystrophy (DMD is a progressive neuromuscular disorder. Here, we show that the CD63 antigen, which is located on the surface of extracellular vesicles (EVs, is associated with increased levels of muscle-abundant miRNAs, namely myomiRs miR-1, miR-133a, and miR-206, in the sera of DMD patients and mdx mice. Furthermore, the release of EVs from the murine myoblast C2C12 cell line was found to be modulated by intracellular ceramide levels in a Ca2+-dependent manner. Next, to investigate the effects of EVs on cell survival, C2C12 myoblasts and myotubes were cultured with EVs from the sera of mdx mice or C2C12 cells overexpressing myomiRs in presence of cellular stresses. Both the exposure of C2C12 myoblasts and myotubes to EVs from the serum of mdx mice, and the overexpression of miR-133a in C2C12 cells in presence of cellular stress resulted in a significant decrease in cell death. Finally, to assess whether miRNAs regulate skeletal muscle regeneration in vivo, we intraperitoneally injected GW4869 (an inhibitor of exosome secretion into mdx mice for 5 and 10 days. Levels of miRNAs and creatine kinase in the serum of GW4869-treated mdx mice were significantly downregulated compared with those of controls. The tibialis anterior muscles of the GW4869-treated mdx mice showed a robust decrease in Evans blue dye uptake. Collectively, these results indicate that EVs and myomiRs might protect the skeletal muscle of mdx mice from degeneration.

  2. 9 CFR 206.3 - Monthly report.

    Science.gov (United States)

    2010-01-01

    ... capacity specified in the definition of packer. (b) When is the monthly report due? Each packer must send a separate monthly report for each plant that has the slaughtering capacity specified in the definition of... will be available on the Internet on the GIPSA Web site (http://www.usda.gov/gipsa/) and at USDA GIPSA...

  3. 24 CFR 206.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ..., except where the term business day is used. Estate planning service firm means an individual or entity... attorney or accountant, in the bona fide business of generally providing tax or other legal or financial...

  4. 44 CFR 206.364 - Loan application.

    Science.gov (United States)

    2010-10-01

    ... exercises administrative authority over the local government's application. The State's review should... eligible applicant is not subject to State administration authority and the State cannot legally... not exercise the right to collect, are not a legitimate revenue loss for purposes of evaluating the...

  5. 28 CFR 42.206 - Compliance reviews.

    Science.gov (United States)

    2010-07-01

    ... benefits; (3) The number and nature of discrimination complaints filed against a recipient with OJARS or... possibility of discrimination in the services to be performed under the grant, or in the employment practices... percentage of minorities, or women, in the relevant labor market, and the percentage of minorities, or women...

  6. 31 CFR 206.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... techniques designed to accelerate and control collections, ensure prompt deposit of receipts, improve control... Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY RECEIPTS, DISBURSEMENTS...

  7. 44 CFR 206.111 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... formal title to the residence and pays no rent, but is responsible for the payment of taxes or maintenance of the residence; or (3) A person who has lifetime occupancy rights with formal title vested in... voluntary or charitable organizations, insurance, other governmental programs, or from any sources other...

  8. 44 CFR 206.202 - Application procedures.

    Science.gov (United States)

    2010-10-01

    ... applicant, assisted by the State as appropriate, will prepare a Project Worksheet (FEMA Form 90-91) for each..., DEPARTMENT OF HOMELAND SECURITY DISASTER ASSISTANCE FEDERAL DISASTER ASSISTANCE Public Assistance Project...) Providing technical advice and assistance to eligible subgrantees; (2) Providing State support for project...

  9. 44 CFR 206.376 - Loan cancellation.

    Science.gov (United States)

    2010-10-01

    ... money borrowed to pay amounts FEMA does not advance toward completion of approved Project Applications... cancellation. (a) FEMA shall cancel repayment of all or part of a Special Community Disaster Loan to the extent...-month period beginning September 1, 2005, FEMA will prorate the revenues and expenses for the partial...

  10. 44 CFR 206.439 - Allowable costs.

    Science.gov (United States)

    2010-10-01

    ... CFR part 207. (c) Pre-award costs. FEMA may fund eligible pre-award planning or project costs at its... costs for activities directly related to the development of the project or planning proposal. These...

  11. 31 CFR 515.206 - Exempt transactions.

    Science.gov (United States)

    2010-07-01

    ... Cuban film in any medium, including home video distribution, for five years, with the Cuban party... musician. The music written in Cuba is to be recorded in a studio that the recording company owns in the..., and from providing the Cuban with production services through the use of its studio in the Bahamas. No...

  12. Publications | Page 206 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Decision making and role playing : young married women's sexual and reproductive health in Ahmedabad, India (restricted access). Young women and men are deeply situated in patriarchal systems where core structures of dominations remained unmoved. This thesis aims to better understand the sexual and reproductive ...

  13. 21 CFR 131.206 - Nonfat yogurt.

    Science.gov (United States)

    2010-04-01

    ...) Nutritive carbohydrate sweeteners. Sugar (sucrose), beet or cane; invert sugar (in paste or sirup form); brown sugar; refiner's sirup; molasses (other than blackstrap); high fructose corn sirup; fructose..., dried malt sirup; honey; maple sugar; or any of the sweeteners listed in part 168 of this chapter...

  14. 47 CFR 76.206 - Candidate rates.

    Science.gov (United States)

    2010-10-01

    ... Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES MULTICHANNEL VIDEO AND... most favored commercial advertisers for the same classes and amounts of time for the same periods. Any... as distinct classes of time. (iii) Systems may establish and define their own reasonable classes of...

  15. 9 CFR 205.206 - Farm products.

    Science.gov (United States)

    2010-01-01

    ... specify by name) Cotton Tobacco Flaxseed, peanuts, soybeans, sunflower seeds, other oil crops (system must... must specify by name) Apples, apricots, avocados, bananas, cherries, coffee, dates, figs, grapes... crops (system must specify by name) Grass seeds, legume seeds, other seed crops (system must specify by...

  16. 44 CFR 206.434 - Eligibility.

    Science.gov (United States)

    2010-10-01

    ... outdoor recreational activities, nature reserves, cultivation, grazing, camping (except where adequate...; (2) Have a beneficial impact upon the designated disaster area, whether or not located in the... subsequent negative impacts to the area if future disasters were to occur, (iii) Has been determined to be...

  17. Publications | Page 206 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    restricted access). Despite decades long treatment and control programs, all countries of the Lower Mekong Basin are still highly endemic with liver flukes, O. viverrini and/or C. sinensis as well as alarmingly high levels of CCA (type 1 carcinogens) ...

  18. 44 CFR 206.440 - Appeals.

    Science.gov (United States)

    2010-10-01

    ... the monetary figure in dispute and the provisions in Federal law, regulation, or policy with which the... Directorate will notify the grantee in writing of the disposition of the appeal. (e) Transition. (1) This rule...

  19. 44 CFR 206.345 - Exceptions.

    Science.gov (United States)

    2010-10-01

    ... expansion, of publicly owned or publicly operated roads, structures, or facilities that are essential links... actions essential to the saving of lives and the protection of property and the public health and safety..., reconstruction, or repair, but not the expansion, of publicly owned or publicly operated roads, structures, or...

  20. 44 CFR 206.2 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... rural community, unincorporated town or village, or other public entity, for which an application for..., flood, or explosion, in any part of the United States, which in the determination of the President...

  1. 44 CFR 206.117 - Housing assistance.

    Science.gov (United States)

    2010-10-01

    ... notice when initiating the termination of direct assistance that we provide under our lease agreements... components, including foundation, exterior walls, and roof; (ii) Repair or replacement of the structure's windows and doors; (iii) Repair or replacement of the structure's Heating, Ventilation and Air...

  2. Reference: 206 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available ized. Extracts from the knockout ugt72B1 plants showed radically reduced conjugating activity towards DCA an...d TCP and the absence of immunodetectable UGT72B1 protein. In contrast, activities towards

  3. 18 CFR 157.206 - Standard conditions.

    Science.gov (United States)

    2010-04-01

    ... finds that there is no effect on any property protected by 16 U.S.C. 470f; (iii) Paragraph (b)(2)(v) of... with the noise level limits. (iii) Any horizontal directional drilling or drilling of wells which will...

  4. 44 CFR 206.436 - Application procedures.

    Science.gov (United States)

    2010-10-01

    ... Programs, if appropriate, and a narrative statement. The narrative statement will contain any pertinent... narrative statement will also serve to identify the specific mitigation measures for which funding is... of the measure; (5) Cost estimate for the measure; (6) Analysis of the measure's cost-effectiveness...

  5. 44 CFR 206.394 - Cost eligibility.

    Science.gov (United States)

    2010-10-01

    ... costs. (2) Costs for use of publicly owned equipment used on eligible fire suppression work based on... presuppression, salvaging timber, restoring facilities, seeding and planting operations. (2) Any costs not...

  6. 12 CFR 206.3 - Prudential standards.

    Science.gov (United States)

    2010-01-01

    ... level of the correspondent, level of nonaccrual and past due loans and leases, level of earnings, and... limits; (ii) The volatility of the exposure; and (iii) The financial condition of the correspondent. (3...

  7. 206 Aerobasics–An Introduction to Aeronautics

    Indian Academy of Sciences (India)

    IAS Admin

    1. C r. L. R3+ rL. H. A. C. D. B. E. 244. 223. Transverse section of the ring porous wood (Ash). Credit: Brian Matthews. (www.matthewswoodworks.com) ... Anil Kakodkar talks to. SujataVaradarajan 277. Classroom. Optimization of the Anderson Bridge Experiment. P Arun, Kuldeep Kumar and Mamta. Chaos from Jerk Circuit.

  8. 44 CFR 206.374 - Loan application.

    Science.gov (United States)

    2010-10-01

    ... fiscal year of the disaster and the applicant's most recent financial statement must, unless... annual (or interim) consolidated and/or individual official annual financial presentations for the... the local government as published in the official financial statements of the local government. (3...

  9. 44 CFR 206.375 - Loan administration.

    Science.gov (United States)

    2010-10-01

    ... justified. The local government shall also provide the latest available data on anticipated and actual tax... management system, to account for loan funds received and disbursed and to provide an audit trail. (2) FEMA... the United States or their duly authorized representatives shall, for the purpose of audits and...

  10. 44 CFR 206.365 - Loan administration.

    Science.gov (United States)

    2010-10-01

    ... justified. The local government shall also provide the latest available data on anticipated and actual tax... disbursed and to provide an audit trail. (2) FEMA auditors, State auditors, the GAR, the Regional... of the United States or their duly authorized representatives shall, for the purpose of audits and...

  11. 30 CFR 206.151 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... of power to exercise control over or common control with another person. (3) Regardless of any.... Allowance means a deduction in determining value for royalty purposes. Processing allowance means an allowance for the reasonable, actual costs of processing gas determined under this subpart. Transportation...

  12. 31 CFR 587.206 - Exempt transactions.

    Science.gov (United States)

    2010-07-01

    ... prohibitions contained in this part do not apply to donations by U.S. persons of articles, such as food...-circulated magazines and other periodical publications); provision of services to market, produce or co...

  13. 31 CFR 586.206 - Exempt transactions.

    Science.gov (United States)

    2010-07-01

    ... magazines and other periodical publications), provision of services to market, produce or co-produce, create.... The prohibitions of this part do not apply to donations by U.S. persons of articles, such as food...

  14. 13 CFR 400.206 - Environmental requirements.

    Science.gov (United States)

    2010-01-01

    ... approach that will ensure the integrated use of the natural and social sciences and the environmental... Chapter V. (2) Definitions. For purposes of this section, the following definitions apply: Categorical...

  15. 13 CFR 500.206 - Environmental requirements.

    Science.gov (United States)

    2010-01-01

    ... integrated use of the natural and social sciences and the environmental design arts.” 42 U.S.C. 4332(A). If... supplements regulations at 40 CFR Chapter V. (2) Definitions. For purposes of this section, the following definitions apply: Categorical exclusion means a category of actions which do not individually or cumulatively...

  16. Reseña de: Aguiar Andrade, Amélia y Millán da Costa, Adelaide (Eds. La ville Médiévale en Débat. Instituto de Estudos Medievais, Lisboa, 2013, 206 páginas (Estudos, 8, (Idiomas Francés, Español e Inglés. ISBN: 978-989-97066-9-9.

    Directory of Open Access Journals (Sweden)

    Ana María Rivera Medina

    2017-05-01

    Full Text Available Aguiar Andrade, Amélia y Millán da Costa, Adelaide (Eds. La ville Médiévale en Débat. Instituto de Estudos Medievais, Lisboa, 2013, 206 páginas (Estudos, 8, (Idiomas Francés, Español e Inglés. isbn: 978-989-97066-9-9.

  17. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  18. Corrigendum to "Observation of Neon at mid and high latitudes in the sunlit Lunar Exosphere: Results from CHACE aboard MIP/Chandrayaan-1", Vol. 272 (2016), pp 206-211, doi 10.1016/j.icarus.2016.02.030

    Science.gov (United States)

    Pratim Das, Tirtha; Thampi, Smitha V.; Bhardwaj, Anil; Ahmed, S. M.; Sridharan, R.

    2017-03-01

    Our paper titled "Observation of Neon at mid and high latitudes in the sunlit Lunar Exosphere: Results from CHACE aboard MIP/Chandrayaan-1" (Icarus 272 (2016) 206-211) presents the results of the observations on the distribution of neutral Neon in the mid and high lunar latitudes by the CHACE instrument aboard Moon Impact Probe (MIP) in Chandrayaan-1. The authors recently noticed two errors in the representation of the results in two figures, although there is no change in the reported number densities and the other interpretations of the results.

  19. 49 CFR 571.206 - Standard No. 206; Door locks and door retention components.

    Science.gov (United States)

    2010-10-01

    ... striker cut-out configuration similar to the environment in which the door latch will be mounted on normal... of 30 g for a period of at least 30 ms, while keeping the recorded acceleration within the pulse...) Determine the forward and aft edge of the sliding door, or its adjoining vehicle structure, that contains a...

  20. U/Pb (SHRIMP), {sup 207}Pb/{sup 206}Pb, Rb/Sr, Sm/Nd e K/Ar geochronology of granite-greenstone terrains of Gaviao Block: implications for the Proterozoic and Archean evolution of Sao Francisco Craton, Brazil; Geocronologia U/Pb (SHRIMP), {sup 207}Pb/{sup 206}Pb, Rb/Sr, Sm/Nd e K/Ar dos terrenos granito-greenstone do Bloco do Gaviao: implicacoes para a evolucao arqueana e proterozoica do craton do Sao Francisco, Brasil

    Energy Technology Data Exchange (ETDEWEB)

    Leal, Luiz Rogerio Bastos

    1998-07-01

    The Gaviao Block (GB) in the northern portion of the Sao Francisco Craton-Northeast of Brazil, constitutes one of the oldest Archean fragments of the South American Platform Archean crust. GB underwent several events of juvenile accretion and reworking of continental crust along its evolutionary history, notably between the Archean and the Paleoproterozoic. {sup 207}Pb/{sup 206}Pb isotopic analyses were carried out in two zircons populations from strongly migmatized TTG terranes found in the proximity of Brumado: the first population (7 crystals) is taken as representative of the crystallization period of the TTG terranes at 3300 {+-} 45 Ma; the second (2 crystals) represents the age of the first even of metamorphism/migmatization at 2910 {+-} 10 Ma. {sup 207} Pb/{sup 206} Pb analyses in zircons from an outcrop of non-migmatized TTG in the area yielded a 3202 {+-} 15 Ma age (4 crystals), interpreted to be the crystallization period of the gneiss protolith. Sm/Nd analyses on the TTG rocks of the Brumado region yielded T{sub DM} model ages varying between 3.26 and 3.36 Ga and {epsilon}{sub Nd}{sup (t)} between -3.5 and +0.7. These data suggest the occurrence of juvenile accretions to the continental crust during the Archean, with differential involvement of crustal materials. The geochemical data of rare earth elements corresponding to the TTG terranes revealed moderate LRRE contents (La{sub N}=83,5), low HREE contents (La{sub N}=2,5) and a fairly fractionated pattern (La/Yb){sub N}=34, besides lack of negative Eu anomaly, showing that these rocks have similar compositions to those TTG terranes of cratonic continents, as well as some Archean rocks from CSF (e.g. Sete Voltas, Boa Vista). Finally, the youngest ages present in GB rocks (ca. 1.2-0.45 Ga) represent the role played by tectono thermal events, which produced partial or total rejuvenation of the Rb/Sr and K/Ar isotopic systems during the Espinhaco and Brasiliano cycles. In particular, K/Ar ages illustrate the

  1. 44 CFR 206.346 - Applicability to disaster assistance.

    Science.gov (United States)

    2010-10-01

    ... facilities; (6) Relocation of individuals or property out of danger, such as moving a mobile home to an area...) Housing eligible families in existing resources in the CBRS; and (9) Mortgage and rental payment...

  2. 12 CFR 708b.206 - Share insurance communications to members.

    Science.gov (United States)

    2010-01-01

    ... conversion is discussed and, if the communication is on an internet website posting, the credit union must... page of the communication where termination is discussed and, if the communication is on an internet... that the credit union will make during the voting period. The Regional Director must receive the copy...

  3. 41 CFR 101-6.206 - Illustrative applications.

    Science.gov (United States)

    2010-07-01

    ... organizations and institutions for the collecting, describing, preserving, and compiling and publishing of... special recruitment policies to make its program better known and more readily available to such group...

  4. 19 CFR 206.63 - Contents of petition.

    Science.gov (United States)

    2010-04-01

    ... market of the United States; (d) Trade diversion data. (1) The actual or imminent increase in United States market share held by such imports from the People's Republic of China; (2) The actual or imminent... proposed by the WTO member concerned; (4) The extent of exports from the People's Republic of China to that...

  5. Dicty_cDB: VFM206 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nfkmmvf hticyglmlnnvmdvgvi*vttqhlfkkplklpkilvlmlvftvqlvngvkl*vi*vv*v ltygmltmiiih...hsliqafmnlvvglhql*nntlvmemsvvlali*islvlehvqhqlvq vqahhqvhhqvhhqvhhqvqvhhqvqvhhrvhhqvqdqahhhqdq Frame B: flil

  6. 44 CFR 206.33 - Preliminary damage assessment.

    Science.gov (United States)

    2010-10-01

    ... basis for the Governor's request, and by FEMA to document the recommendation made to the President in... responsible for disaster operations determines may be beyond the State and local government capabilities to... assistance; therefore, the State will be expected to verify their initial information, in some manner, before...

  7. 48 CFR 5.206 - Notices of subcontracting opportunities.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Notices of subcontracting... subcontracting opportunities. (a) The following entities may transmit a notice to the GPE to seek competition for... concerns, and to meet established subcontracting plan goals: (1) A contractor awarded a contract exceeding...

  8. and SAT2 Antigens and Montanide ISA 206

    African Journals Online (AJOL)

    BSN

    Scrum Neutralisation Test. Micro serum neutralisation method \\\\as used (Golding et al. 1976). The tests. \\\\Crc carried out in microtitrc (96 ''ell flat bottom) plates. One hundred 'fCIDsn virus suspension ''as inoculated into BHK-21 monolayer cells and incubated at 37 "' for 36 hours. The neutralisation tiJres were expressed as ...

  9. 48 CFR 15.206 - Amending the solicitation.

    Science.gov (United States)

    2010-10-01

    ... the contract file and formalize the notice with an amendment (see subpart 4.5, Electronic Commerce in... (and electronic or facsimile address, if appropriate). (7) Revision to solicitation closing date, if...

  10. 32 CFR 206.5 - Final proposal process.

    Science.gov (United States)

    2010-07-01

    ... Washington D.C. to discuss and review the independent and competing merits of proposals. (b) Proposals will be evaluated in two basic categories: (1) Proposals that address study abroad infrastructure and (2... foreign cultural competency? In the case of study abroad programs, how will the success and impact of...

  11. 44 CFR 206.201 - Definitions used in this subpart.

    Science.gov (United States)

    2010-10-01

    .... The scope of work and cost estimate for a project are documented on a Project Worksheet (FEMA Form 90..., DEPARTMENT OF HOMELAND SECURITY DISASTER ASSISTANCE FEDERAL DISASTER ASSISTANCE Public Assistance Project... projects. (e) Grantee. Grantee means the government to which a grant is awarded, and which is accountable...

  12. 44 CFR 206.208 - Direct Federal assistance.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF HOMELAND SECURITY DISASTER ASSISTANCE FEDERAL DISASTER ASSISTANCE Public Assistance Project... contained in Subpart H of these regulations. FEMA will reimburse other Federal agencies in accordance with... from such work; (iii) Provide reimbursement to FEMA for the nonFederal share of the cost of such work...

  13. 44 CFR 206.207 - Administrative and audit requirements.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF HOMELAND SECURITY DISASTER ASSISTANCE FEDERAL DISASTER ASSISTANCE Public Assistance Project... procedures, program eligibility guidance and program deadlines; (C) Assisting FEMA in determining applicant eligibility; (D) Participating with FEMA in conducting damage surveys to serve as a basis for obligations of...

  14. 44 CFR 206.171 - Crisis counseling assistance and training.

    Science.gov (United States)

    2010-10-01

    ... cause, any fire, flood, or explosion, in any part of the United States, which in the determination of the President causes damage of sufficient severity and magnitude to warrant major disaster assistance... declaration. The purpose of the assessment is to provide an estimate of the size and cost of the program...

  15. All projects related to | Page 206 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: MALNUTRITION, CHILDREN, WOMEN, LOW INCOME GROUPS, FOOD SUPPLY, WATER QUALITY, AGRICULTURAL LEGISLATION, GENDER ANALYSIS, INTERDISCIPLINARY RESEARCH, POLICY MAKING. Region: India, Central Asia, Far East Asia, South Asia, United Kingdom. Program: Agriculture and Food ...

  16. 32 CFR 206.4 - Proposal development and review.

    Science.gov (United States)

    2010-07-01

    ... Education and the Academy for Educational Development function in administering NSEP scholarship and... opportunity to present their ideas without creating a paperwork burden on both the proposal authors and the... salaries, funds for students, travel, materials and supplies, consultants, etc., and how or why these costs...

  17. 19 CFR 206.14 - Contents of petition.

    Science.gov (United States)

    2010-04-01

    ...) Changes in the level of prices, production, and productivity. (f) Cause of injury. An enumeration and... facilitating the orderly transfer of resources to more productive pursuits, enhancing competitiveness, or other...

  18. 19 CFR 206.34 - Contents of petition.

    Science.gov (United States)

    2010-04-01

    ...) Changes in the level of prices, production, and productivity. (f) Cause of injury. An enumeration and... resources to more productive pursuits, enhancing competitiveness, or other means of adjustment to new...

  19. Philosophy for Children: An Approach to Critical Thinking. Fastback 206.

    Science.gov (United States)

    Johnson, Tony W.

    This document describes curriculum and resources designed to foster and expand the philosophical thinking of elementary and middle school students. The booklet begins with excerpts from and a discussion of Matthew Lipman's novel "Harry Stottlemeier's Discovery," written to help elementary and middle school students discover both formal…

  20. 18 CFR 375.206 - Procedures to close meetings.

    Science.gov (United States)

    2010-04-01

    ... such minutes. (2) The Secretary shall maintain a complete verbatim copy of the transcript, a complete... transcript, or minutes, or a transcription of such recording shall be furnished to any person at the actual cost of duplication or transcription. (2) The determination of the Director of the Division of Public...

  1. 24 CFR 206.47 - Property standards; repair work.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Property standards; repair work... Property standards; repair work. (a) Need for repairs. Properties must meet the applicable property... insured mortgage. (b) Assurance that repairs are made. The mortgage may be closed before the repair work...

  2. Dicty_cDB: VFH206 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ---IGVDYIDESEVLTIADNENHIDKSEFKVPFVCGCRNLGEALRRISEGAAMIRTKGEA GTGDVVEAVRHARAVNKEIKKIQNMDPHELYTYAKEI*aplelvkevkrlgrlpvvnfaa...---IGVDYIDESEVLTIADNENHIDKSEFKVPFVCGCRNLGEALRRISEGAAMIRTKGEA GTGDVVEAVRHARAVNKEIKKIQNMDPHELYTYAKEI*aplelvkevkrlgrlpvvnfaa

  3. 44 CFR 206.11 - Nondiscrimination in disaster assistance.

    Science.gov (United States)

    2010-10-01

    ... Programs. (b) All personnel carrying out Federal major disaster or emergency assistance functions... activities, shall perform their work in an equitable and impartial manner, without discrimination on the...

  4. 7 CFR 20.6 - Submission of reports.

    Science.gov (United States)

    2010-01-01

    ... specified in paragraph (k) of this section, a report by marketing year on the applicable forms contained in... quantity of outstanding export sales from the previous report by country of destination. (ii) Quantity of... cancelled and quantity of buyback contracts made during the week. (v) Changes in destination during the week...

  5. 15 CFR 971.206 - Statement of ownership.

    Science.gov (United States)

    2010-01-01

    ... business entity is registered; (iii) The name and place of business of the registered agent or equivalent... provisions in articles of incorporation, charter or articles of association; and (v) The name of each member...

  6. 15 CFR 970.206 - Statement of ownership.

    Science.gov (United States)

    2010-01-01

    ... association; (2) The state of incorporation or state in which the partnership or other business entity is registered; (3) The name of registered agent or equivalent representative and places of business; (4) Certification of essential and nonproprietary provisions in articles of incorporation, charter or articles of...

  7. 29 CFR 1603.206 - Consolidation and severance of hearings.

    Science.gov (United States)

    2010-07-01

    ... PROCEDURES FOR PREVIOUSLY EXEMPT STATE AND LOCAL GOVERNMENT EMPLOYEE COMPLAINTS OF EMPLOYMENT DISCRIMINATION... severance of hearings. (a) The administrative law judge may, upon motion by a party or upon his or her own motion, after providing reasonable notice and opportunity to object to all parties affected, consolidate...

  8. 32 CFR 206.3 - Overall program emphasis.

    Science.gov (United States)

    2010-07-01

    ...-represented by U.S. students, and (ii) Development of meaningful competencies in foreign languages and... opportunities for study of foreign languages and cultures and the integration of these studies into overall... the study of foreign cultures and languages typically neglected or under-represented in higher...

  9. 19 CFR 206.1 - Applicability of part.

    Science.gov (United States)

    2010-04-01

    ... North American Free Trade Agreement Implementation Act (19 U.S.C. 3351 et seq.) (hereinafter NAFTA... investigations under section 312(c) of the NAFTA Implementation Act; subpart D sets forth rules specifically applicable to petitions and investigations under section 302 of the NAFTA Implementation Act; and subpart E...

  10. 48 CFR 49.206-1 - Submission of settlement proposals.

    Science.gov (United States)

    2010-10-01

    ... accounting data. Actual, standard (appropriately adjusted), or average costs may be used in preparing settlement proposals if they are determined under generally recognized accounting principles consistently... not be required to maintain unduly elaborate cost accounting systems merely because their contracts...

  11. 30 CFR 206.170 - What does this subpart contain?

    Science.gov (United States)

    2010-07-01

    ... Federal leases. (b) If the specific provisions of any Federal statute, treaty, negotiated agreement... are inconsistent with any regulation in this subpart, then the Federal statute, treaty, negotiated... calculate the value of production for royalty purposes under methods other than those the regulations in...

  12. 19 CFR 10.206 - Value content requirement.

    Science.gov (United States)

    2010-04-01

    ... section, the words materials produced in a beneficiary country or countries refer to those materials...) combining or packaging operations, or mere dilution with water or mere dilution with another substance that... included. For purposes of paragraph (a) of this section, the words direct costs of processing operations...

  13. 47 CFR 20.6 - CMRS spectrum aggregation limit.

    Science.gov (United States)

    2010-10-01

    ... link in the vertical ownership chain and application of the relevant attribution benchmark to the resulting product, except that if the ownership percentage for an interest in any link in the chain exceeds...

  14. Dicty_cDB: VFG206 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |AC098048.6 Rattus norvegicus clone CH230-115I10, WORKING DRAFT SEQUENCE, 3 unordered pieces. 44 0.67 1 AC121005...|AC121005.4 Rattus norvegicus clone CH230-322A11, WORKING DRAFT SEQUENCE, 1 ordered piece. 36 2.6 2 AC040900...sapiens chromosome 1 clone RP11-162H11 map 1, WORKING DRAFT SEQUENCE, 19 unordered pieces. 42 2.7 1 BX469923...sapiens chromosome 15 clone RP11-438C24 map 15, WORKING DRAFT SEQUENCE, 16 unordered pieces. 42 2.7 1 BF369934...|AC142424.2 Rattus norvegicus clone CH230-408K24, WORKING DRAFT SEQUENCE, 39 unordered pieces. 42 2.7 1 AC068052

  15. Dicty_cDB: AFI206 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Translated Amino Acid sequence ---DNTYKVLVDXKEIQAGNLADDWELLPSKQIKDPKQSKPVDWVDVKEIDDPEDVKPAG HDDIPASIVDPEAVK...nqks*s*rtlxk*innkkk Frame C: ---DNTYKVLVDXKEIQAGNLADDWELLPSKQIKDPKQSKPVDWVDVKEIDDPEDVKPAG HDDIPASIVDPEAVK

  16. 30 CFR 206.157 - Determination of transportation allowances.

    Science.gov (United States)

    2010-07-01

    ... operating expenses include: Operations supervision and engineering; operations labor; fuel; utilities... reforming or terminating supply contracts with producers to implement the restructuring requirements of FERC... pay to hub operators for administrative services (e.g., title transfer tracking) necessary to account...

  17. 41 CFR 101-39.206 - Seasonal or unusual requirements.

    Science.gov (United States)

    2010-07-01

    ... VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.2-GSA Interagency Fleet Management System Services... requirements for vehicles or related services shall inform the GSA IFMS fleet management center as far in... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Seasonal or unusual...

  18. Dicty_cDB: CFJ206 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FDIPFIGYTYRNFDAMRDAFGSVNSR DAFGSINSREXFW*yk**rfftrckyvnr Translated Amino Acid sequence (All Frames)...FDIPFIGYTYRNFDAMRDAFGSVNSR DAFGSINSREXFW*yk**rfftrckyvnr Frame B: i*eknknq*reenwikkkqsilnqeesdslvtll

  19. Southern Forests: a Journal of Forest Science - Vol 206 (2006)

    African Journals Online (AJOL)

    Strategies for the selection of uncontaminated Eucalyptus explants for shoot multiplication in a temporary immersion system (RITA) in a commercial laboratory · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. MP Watt, M Banasiak, T Nicholson, B McAlister, 13-21 ...

  20. 24 CFR 570.206 - Program administrative costs.

    Science.gov (United States)

    2010-04-01

    ... services performed under third party contracts or agreements, including such services as general legal..., religion, sex, national origin, familial status or handicap, aware of the range of housing opportunities...

  1. Dicty_cDB: VFA206 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TANEKNTXYRSAALYNAI MKIKAVXNHXECLL Frame B: qaeidneprflecfktffdkaagltnlkpgvlnnmkecnvalrvefpiknehgdvdiiag yraq...hshhrlpckggirfseevdlqevmalaslmtykcacrrcsiwwc*rwcpyrpkeih crpt*kdhsclhsplmskefhrtrcrctssrygyr*tr--- ---lslisq

  2. 24 CFR 1003.206 - Program administration costs.

    Science.gov (United States)

    2010-04-01

    ... Development (Continued) OFFICE OF ASSISTANT SECRETARY FOR PUBLIC AND INDIAN HOUSING, DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT COMMUNITY DEVELOPMENT BLOCK GRANTS FOR INDIAN TRIBES AND ALASKA NATIVE VILLAGES... achieve its community development objectives. ...

  3. MO-AB-206-01: PET Physics

    Energy Technology Data Exchange (ETDEWEB)

    Turkington, T. [Duke University Medical Center (United States)

    2016-06-15

    This education session will cover the physics and operation principles of gamma cameras and PET scanners. The first talk will focus on PET imaging. An overview of the principles of PET imaging will be provided, including positron decay physics, and the transition from 2D to 3D imaging. More recent advances in hardware and software will be discussed, such as time-of-flight imaging, and improvements in reconstruction algorithms that provide for options such as depth-of-interaction corrections. Quantitative applications of PET will be discussed, as well as the requirements for doing accurate quantitation. Relevant performance tests will also be described. Learning Objectives: Be able to describe basic physics principles of PET and operation of PET scanners. Learn about recent advances in PET scanner hardware technology. Be able to describe advances in reconstruction techniques and improvements Be able to list relevant performance tests. The second talk will focus on gamma cameras. The Nuclear Medicine subcommittee has charged a task group (TG177) to develop a report on the current state of physics testing of gamma cameras, SPECT, and SPECT/CT systems. The report makes recommendations for performance tests to be done for routine quality assurance, annual physics testing, and acceptance tests, and identifies those needed satisfy the ACR accreditation program and The Joint Commission imaging standards. The report is also intended to be used as a manual with detailed instructions on how to perform tests under widely varying conditions. Learning Objectives: At the end of the presentation members of the audience will: Be familiar with the tests recommended for routine quality assurance, annual physics testing, and acceptance tests of gamma cameras for planar imaging. Be familiar with the tests recommended for routine quality assurance, annual physics testing, and acceptance tests of SPECT systems. Be familiar with the tests of a SPECT/CT system that include the CT images for SPECT reconstructions. Become knowledgeable of items to be included in annual acceptance testing reports including CT dosimetry and PACS monitor measurements. T. Turkington, GE Healthcare.

  4. 17 CFR 275.206(4)-6 - Proxy voting.

    Science.gov (United States)

    2010-04-01

    ... client securities, unless you: (a) Adopt and implement written policies and procedures that are reasonably designed to ensure that you vote client securities in the best interest of clients, which... your clients; (b) Disclose to clients how they may obtain information from you about how you voted with...

  5. Publications | Page 206 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, de la mise en commun des connaissances et de la formation. Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons à ...

  6. Dicty_cDB: VSC206 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 72 4e-14 2 AL111854...Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 72 4e-14 2 AL111255...Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 72 5e-14 2 AL116832...Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 72 5e-14 2 AL116249...Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 72 5e-14 2 AL116178

  7. 24 CFR 92.206 - Eligible project costs.

    Science.gov (United States)

    2010-04-01

    ... ensure that this requirement is met by establishing a minimum level of rehabilitation per unit or a... affirmative marketing and fair housing information to prospective homeowners and tenants as required by § 92... HOME-assisted project. For multi-unit projects, such costs must be allocated among HOME-assisted units...

  8. Dicty_cDB: SFI206 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KLKNGESITSI GSSSSSSSSSLASSPLTFSAGGGGGGSYSPMFNFSAISISAPMGIDDMVSKQKGH--- Translated Amino Acid sequence...KLKNGESITSI GSSSSSSSSSLASSPLTFSAGGGGGGSYSPMFNFSAISISAPMGIDDMVSKQKGH--- Frame B: klkimvgqnhalgrklvksl

  9. Dicty_cDB: VSA206 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Acid sequence giqlnmmf*LITWVKIKINGFLVVYHENNNNNNNNNYINYIKVSLLVF*swyk*nsknkk *kti*kl Translated Amino Acid...Frames) Frame A: giqlnmmf*LITWVKIKINGFLVVYHENNNNNNNNNYINYIKVSLLVF*swyk*nsknkk *kti*kl Frame B: gss*i*cfn*

  10. Dicty_cDB: SHD206 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Number of HSP's gapped (non-prelim): 0 length of query: 123 length of database: 80,480,566 effective HSP length: 17 effective... length of query: 106 effective length of database: 78,821,179 effective search space: 8355044974 effective...ve HSP length: 22 effective length of query: 101 effective length of database: 55,795,563,357 effective... search space: 5635351899057 effective search space used: 5635351899057 T: 0 A: 0 X1: 11...r of successful extensions: 0 Number of sequences better than 10.0: 0 length of query: 123 length of database: 56,950,275,839 effecti

  11. 5 CFR 551.206 - Administrative exemption criteria.

    Science.gov (United States)

    2010-01-01

    ... conducting the audit, the lead auditor makes on-site decisions and/or proposes major changes to managers on... assist and support line managers and assume facets of the overall management function. Neither the... be considered as performing a line rather than a staff function. (i) An employee who leads a team of...

  12. : tous les projets | Page 206 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: Capacity building, Science and Technology, MEDIA, FRENCH SPEAKING AFRICA, JOURNALISM, COMPUTER NETWORKS, BUSINESS ORGANIZATION. Région: Middle East, North of Sahara, South of Sahara, Central Asia, Far East Asia, South Asia. Programme: Économies en réseaux. Financement total : CA$ ...

  13. 7 CFR 760.206 - Notice of loss and application process.

    Science.gov (United States)

    2010-01-01

    ... colony or honeybee hive was due to colony collapse disorder from an appropriate third party, as...) Chattel inspections. (d) For the loss of honeybee colonies and honeybee hives due to colony collapse... Application; (ii) For honeybee feed, honeybee colony, honeybee hive, or farm-raised fish feed or death losses...

  14. 42 CFR 422.206 - Interference with health care professionals' advice to enrollees prohibited.

    Science.gov (United States)

    2010-10-01

    ... throughout the health system in making decisions regarding treatment options. (b) Conscience protection. The... construed to affect disclosure requirements under State law or under the Employee Retirement Income Security... future treatment decisions. (2) Health care professionals must provide information regarding treatment...

  15. 78 FR 51808 - 34th Meeting: RTCA Special Committee 206, Aeronautical Information and Meteorological Data Link...

    Science.gov (United States)

    2013-08-21

    ... 23, Monday--Opening Plenary Introduction and opening remarks Approval of previous meeting minutes and... SESAR Update Wake Vortex Safety System: Today and Tomorrow Flight Simulation Evaluation of AIS/MET Data...

  16. 44 CFR 206.181 - Use of gifts and bequests for disaster assistance purposes.

    Science.gov (United States)

    2010-10-01

    ... victims of natural disasters and other disasters not caused by or attributable to war. FEMA intends to use... grounds of race, color, religion, national origin, sex, age, or economic status. (8) Funds awarded to a...

  17. SU-G-TeP2-06: Development of Novel Radiochromic Films for Radiotherapy Dosimetry

    Energy Technology Data Exchange (ETDEWEB)

    Alqathami, M; Lee, H; Ibbott, G [UT MD Anderson Cancer Center, Houston, TX (United States); Won Choi, G [UT MD Anderson Cancer Center, Houston, TX-Texas (United States); Blencowe, A [The University of South Australia, South Australia, SA (Australia); Wen, Z [MD Anderson Cancer Center, Houston, TX (United States); Adamovics, J [Department of Chemistry and Biology, Rider University, Skillman, NJ (United States)

    2016-06-15

    Purpose: To develop and evaluate novel radiochromic films for quality assurance in radiotherapy dosimetry. Materials and Methods: Novel radiochromic film compositions were formulated using leuco crystal violet (LCV) as a reporting system and tetrabromoethane as a free radical source. The film matrix used consisted of polyurethane polymer mixed with dibutyl phthalate plasticizer (20 wt%). The concentration of the radical initiator was kept constant at 10 wt% and the concentration of the LCV dye varied (1 and 2 wt%). To ensure uniform thickness of the film, its precursors were sandwiched between two pieces of glass separated by a 1 mm gap between during the curing process. The films were cut into pieces and were irradiated with a 6 MV X-ray beam to selected doses. The change in optical density was measured using a flatbed scanner and a spectrophotometer. Results: The results showed that all film formulations exhibited a linear response with dose and an absorption maximum at ∼ 590 nm. The formulation with 2 wt% LCV was ∼ 30% more sensitive to dose than the formulation with 1 wt% LCV. Both films were very deformable. In addition, the radiochromic response of the film was found to bleach over a short period of time (few weeks) allowing the film to be reused for dose verification measurements. Conclusion: Both film formulations displayed excellent sensitivity and linearity to radiation dose and thus can be used for the 2D dosimetry of clinical megavoltage and kilovoltage X-ray beams. In addition, the thickness of the film could easily be increased allowing for their potential use as a deformable bolus material. However, thicker films would need more optimization of the manufacturing procedure to ensure consistent material uniformity and sensitivity are recommended.

  18. 44 CFR 206.12 - Use and coordination of relief organizations.

    Science.gov (United States)

    2010-10-01

    ... MANAGEMENT AGENCY, DEPARTMENT OF HOMELAND SECURITY DISASTER ASSISTANCE FEDERAL DISASTER ASSISTANCE General... facilities of the American National Red Cross, the Salvation Army, the Mennonite Disaster Service, and other voluntary organizations in the distribution of medicine, food, supplies, or other items, and in the...

  19. 45 CFR 206.10 - Application, determination of eligibility and furnishing of assistance.

    Science.gov (United States)

    2010-10-01

    ... respect the rights of individuals under the United States Constitution, the Social Security Act, title VI of the Civil Rights Act of 1964, and all other relevant provisions of Federal and State laws. (11... of States with laws of general applicability); and (B) Any blood-related or adoptive brother or...

  20. 50 CFR 223.206 - Exceptions to prohibitions relating to sea turtles.

    Science.gov (United States)

    2010-10-01

    ... to prohibitions relating to sea turtles. (a) Permits—(1) Scientific research, education, zoological... zoological exhibition, or to enhance the propagation or survival of threatened species of sea turtles, in... of sea turtle is found injured, dead, or stranded, any agent or employee of the National Marine...

  1. 42 CFR 447.206 - Cost limit for providers operated by units of government.

    Science.gov (United States)

    2010-10-01

    ... cost report (or Medicaid cost report for intermediate nursing facility care and ICFs/MR consistent with Medicare cost reporting principles, and audited financial statements that will be used in conjunction with...

  2. 30 CFR 206.351 - What definitions apply to this subpart?

    Science.gov (United States)

    2010-07-01

    ... compliance activities of lessees or other interest holders who pay royalties, fees, rents, or bonuses on...; (2) Sheriffs' offices; (3) The courts; (4) Penal and correctional institutions (including juvenile...

  3. 44 CFR 206.34 - Request for utilization of Department of Defense (DOD) resources.

    Science.gov (United States)

    2010-10-01

    ... reimburse FEMA for the non-Federal share of the cost of such work; and (5) An agreement: (i) To provide all... this section shall be not less than 75 percent of the cost of eligible work. (g) Project management... State advised of work progress and other project developments. It is the responsibility of DOD to ensure...

  4. 31 CFR 500.206 - Exemption of information and informational materials.

    Science.gov (United States)

    2010-07-01

    ... exploit in the United States the Vietnamese film in any medium, including home video distribution, for... a studio that the recording company owns in the Bahamas. These are all prohibited transactions. The... production services through the use of its studio in the Bahamas. No informational materials are in being at...

  5. 32 CFR 206.1 - Major characteristics of the NSEP institutional grants program.

    Science.gov (United States)

    2010-07-01

    ... interdisciplinary opportunities involving international education. (6) NSEP views student funding as portable and hopes that universities will develop ways to move students to programs and to provide credit with these... build a critical base of future leaders in the marketplace and in government service who have cultivated...

  6. 29 CFR 779.206 - What are “related activities.”

    Science.gov (United States)

    2010-07-01

    ... retail or service stores in a chain, or departments of an establishment operated through leasing... operation or common control, they will be a part of a single enterprise. Thus, a retail store enterprise may... separate and unrelated business purpose. For example, where a company operates retail or service...

  7. SU-G-206-15: Effects of Dose Reduction On Emphysema Score

    Energy Technology Data Exchange (ETDEWEB)

    Lo, P; Wahi-Anwar, M; Kim, H [University of California, Los Angeles, Los Angeles, CA (United States); Young, S; Hoffman, J [UCLA, Los Angeles, CA (United States); McNitt-Gray, M [UCLA School of Medicine, Los Angeles, CA (United States)

    2016-06-15

    Purpose: The purpose of this study was to investigate the effects of reducing radiation dose levels on emphysema scores from lung cancer screening CT exams. Methods: 52 cases were selected from the National Lung Screening Trial (NLST) patients for which we had both the image series and the raw CT data. All scans were acquired with fixed effective mAs (25 for standard-sized patients, 40 for large patients) on a 64-slice scanner (Sensation 64, Siemens Healthcare) using 120kV, 64×0.6mm collimation and pitch 1.0. All images were reconstructed with 1mm slice thickness, B50 kernel. Based on a previously-published technique, we added noise to the raw data to simulate reduced-dose versions at 50% and 25% of the original dose (approximately 1.0- and 0.5-mGy CTDIvol). Lung segmentations were obtained via region growing from manual seed point at a threshold of 600HU followed by manual removal of trachea and major airways. Lung segmentations were only performed on original dose scans, and mapped to simulated reduced-dose scans. Emphysema scores based on relative area of lung with attenuation values lower than −950HU (RA950) were computed for all cases. Results: Average RA950 of all 50 cases were 31.6 (±5.5), 32.5 (±4.9) and 32.8 (±4.6) for 100%, 50% and 25% dose level respectively. The average absolute difference in RA950 between simulated and original dose scans were 1.0 (±0.7) and 1.4 (±1.1) for 50% and 25% dose level respectively. Conclusion: RA950 is relatively robust to dose level, with a difference of no more than 5 from the original dose scans. The average RA950 of this population was high for a two reasons: This was a high risk population of patients with substantial smoking history; The use of B50 kernel, which may be biased towards high emphysema scores. Further exploration with smoother kernels will be conducted in the future. Institutional research agreement, Siemens Healthcare; Past recipient, research grant support, Siemens Healthcare; Consultant, Toshiba America Medical Systems; Consultant, Samsung Electronics; NIH grant support from U01 CA181156.

  8. RCT: Module 2.06, Air Sampling Program and Methods, Course 8772

    Energy Technology Data Exchange (ETDEWEB)

    Hillmer, Kurt T. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-07-19

    The inhalation of radioactive particles is the largest cause of an internal radiation dose. Airborne radioactivity measurements are necessary to ensure that the control measures are and continue to be effective. Regulations govern the allowable effective dose equivalent to an individual. The effective dose equivalent is determined by combining the external and internal dose equivalent values. Typically, airborne radioactivity levels are maintained well below allowable levels to keep the total effective dose equivalent small. This course will prepare the student with the skills necessary for RCT qualification by passing quizzes, tests, and the RCT Comprehensive Phase 1, Unit 2 Examination (TEST 27566) and will provide in-the-field skills.

  9. 46 CFR 117.206 - Survival craft-vessels operating on Great Lakes routes.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft-vessels operating on Great Lakes routes...—vessels operating on Great Lakes routes. (a) Except as allowed by paragraph (b) of this section, each vessel certificated to operate on a Great Lakes route must be provided with the survival craft required...

  10. 24 CFR 960.206 - Waiting list: Local preferences in admission to public housing program.

    Science.gov (United States)

    2010-04-01

    ... otherwise denying admission to the program based on the race, color, ethnic origin, gender, religion... or who have been notified that they are hired to work in a residency preference area must be treated... in, education and training programs in a residency preference area as residents of the residency...

  11. 30 CFR 206.171 - What definitions apply to this subpart?

    Science.gov (United States)

    2010-07-01

    ... least one index-pricing point in the index zone. Allowance means a deduction in determining value for... production month as well as when the contract was executed. Audit means a review, conducted under generally..., including amendments or revisions thereto, between two or more persons and enforceable by law that with due...

  12. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (206-0613-332211)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  13. 27 CFR 46.206 - Articles in a foreign trade zone.

    Science.gov (United States)

    2010-04-01

    ... trade zone. If articles subject to floor stocks tax are stored in a foreign trade zone established under the Foreign Trade Zone Act (the Act of June 18, 1934, 48 Stat. 998, 19 U.S.C. 81a et seq.), the dealer..., with respect to the articles pursuant to the first proviso of section 3(a) of the Foreign Trade Zone...

  14. 34 CFR 206.10 - What types of services may be provided?

    Science.gov (United States)

    2010-07-01

    ... SECONDARY EDUCATION, DEPARTMENT OF EDUCATION SPECIAL EDUCATIONAL PROGRAMS FOR STUDENTS WHOSE FAMILIES ARE... in a university, college, or junior college program, or in military services or career positions; and..., including: (A) Personal, academic, and career counseling as an ongoing part of the program; (B) Tutoring and...

  15. Navy's land and water use assessment : Section 206©- Public Law 101-618

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This note is about an Environmental Assessment in which the Naval Air Station in Fallon, NV proposes an agricultural leasing program for Navy lands to reduce soil...

  16. 76 FR 34123 - 25th Meeting: RTCA Special Committee 206: Aeronautical Information and Meteorological Data Link

    Science.gov (United States)

    2011-06-10

    ... with AEEC Systems Architecture & Interface SC 10 a.m. WG1, WG2, and WG3 Meetings 29 June--Wednesday 9 a....m. WG1, WG2, and WG3 Meetings 12 p.m. Adjourn Attendance is open to the interested public but limited to space availability. With the approval of the chairmen, members of the public may present oral...

  17. 78 FR 20167 - 33rd Meeting: RTCA Special Committee 206, Aeronautical Information and Meteorological Data Link...

    Science.gov (United States)

    2013-04-03

    ... Other business ] Adjourn Attendance is open to the interested public but limited to space availability... necessary daily EDR Turbulence Standards Project Briefing from FAA SE2020 Team SG6 WG1 Architecture and MASPS presentations SG3 AIS and MET Services Delivery Architecture Recommendations Document Review (FRAC...

  18. 34 CFR 206.2 - Who is eligible to participate as a grantee?

    Science.gov (United States)

    2010-07-01

    ... SECONDARY EDUCATION, DEPARTMENT OF EDUCATION SPECIAL EDUCATIONAL PROGRAMS FOR STUDENTS WHOSE FAMILIES ARE ENGAGED IN MIGRANT AND OTHER SEASONAL FARMWORK-HIGH SCHOOL EQUIVALENCY PROGRAM AND COLLEGE ASSISTANCE... planning. If a private nonprofit organization other than an IHE applies for a HEP or a CAMP grant, that...

  19. SU-D-206-07: CBCT Scatter Correction Based On Rotating Collimator

    Energy Technology Data Exchange (ETDEWEB)

    Yu, G; Feng, Z [Shandong Normal University, Jinan, Shandong (China); Yin, Y [Shandong Cancer Hospital and Institute, China, Jinan, Shandong (China); Qiang, L [Zhang Jiagang STFK Medical Device Co, Zhangjiangkang, Suzhou (China); Li, B [Shandong Academy of Medical Sciences, Jinan, Shandong provice (China); Huang, P [Shandong Province Key Laboratory of Medical Physics and Image Processing Te, Ji’nan, Shandong province (China); Li, D [School of Physics and Electronics, Shandong Normal University, Jinan, Shandong (China)

    2016-06-15

    Purpose: Scatter correction in cone-beam computed tomography (CBCT) has obvious effect on the removal of image noise, the cup artifact and the increase of image contrast. Several methods using a beam blocker for the estimation and subtraction of scatter have been proposed. However, the inconvenience of mechanics and propensity to residual artifacts limited the further evolution of basic and clinical research. Here, we propose a rotating collimator-based approach, in conjunction with reconstruction based on a discrete Radon transform and Tchebichef moments algorithm, to correct scatter-induced artifacts. Methods: A rotating-collimator, comprising round tungsten alloy strips, was mounted on a linear actuator. The rotating-collimator is divided into 6 portions equally. The round strips space is evenly spaced on each portion but staggered between different portions. A step motor connected to the rotating collimator drove the blocker to around x-ray source during the CBCT acquisition. The CBCT reconstruction based on a discrete Radon transform and Tchebichef moments algorithm is performed. Experimental studies using water phantom and Catphan504 were carried out to evaluate the performance of the proposed scheme. Results: The proposed algorithm was tested on both the Monte Carlo simulation and actual experiments with the Catphan504 phantom. From the simulation result, the mean square error of the reconstruction error decreases from 16% to 1.18%, the cupping (τcup) from 14.005% to 0.66%, and the peak signal-to-noise ratio increase from 16.9594 to 31.45. From the actual experiments, the induced visual artifacts are significantly reduced. Conclusion: We conducted an experiment on CBCT imaging system with a rotating collimator to develop and optimize x-ray scatter control and reduction technique. The proposed method is attractive in applications where a high CBCT image quality is critical, for example, dose calculation in adaptive radiation therapy. We want to thank Dr. Lei Xing and Dr. Yong Yang in the Stanford University School of Medicine for this work. This work was jointly supported by NSFC (61471226), Natural Science Foundation for Distinguished Young Scholars of Shandong Province (JQ201516), and China Postdoctoral Science Foundation (2015T80739, 2014M551949).

  20. 48 CFR 206.302-5 - Authorized or required by statute.

    Science.gov (United States)

    2010-10-01

    ... authority to— (i) Acquire supplies and services from military exchange stores outside the United States for... operation, or other community services from local governments at military installations to be closed under... universities for the performance of research and development, or for the construction of any research or other...

  1. 23 CFR 450.206 - Scope of the statewide transportation planning process.

    Science.gov (United States)

    2010-04-01

    ...: (1) Support the economic vitality of the United States, the States, metropolitan areas, and non... security of the transportation system for motorized and non-motorized users; (4) Increase accessibility and...

  2. 76 FR 54526 - 26th Meeting: RTCA Special Committee 206: Aeronautical Information and Meteorological Data Link

    Science.gov (United States)

    2011-09-01

    ...'s comments. Introductions. Approval of previous meeting minutes. Review and approve meeting agenda. Schedule for this week. Action Item Review. Sub Group 1, Work Plan--SG1 Chairmen. Sub Group 2 Work Plan... of MET information on the flight deck (all SG's). OGC Sensor Modeling Language Presentation (SG2 and...

  3. 17 CFR 275.206(4)-3 - Cash payments for client solicitations.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Cash payments for client... for client solicitations. (a) It shall be unlawful for any investment adviser required to be... client at the time of the solicitation or referral; or (iii) Other than a solicitor specified in...

  4. 30 CFR 206.178 - How do I determine a transportation allowance?

    Science.gov (United States)

    2010-07-01

    ... operations supervision and engineering, operations labor, fuel, utilities, materials, ad valorem property... restructuring requirements of FERC orders in 18 CFR part 284. (3) Commodity charges. The commodity charge allows... transfer fees. These are fees you pay to hub operators for administrative services (e.g., title transfer...

  5. 25 CFR 170.206 - How is an emergency/disaster defined?

    Science.gov (United States)

    2010-04-01

    ... disaster over a widespread area or catastrophic failure from an external cause. (b) Some examples of natural disasters are: floods, droughts, earthquakes, tornadoes, landslides, avalanches, and severe storms...

  6. MO-AB-206-02: Testing Gamma Cameras Based On TG177 WG Report

    Energy Technology Data Exchange (ETDEWEB)

    Halama, J. [Loyola Univ. Medical Center (United States)

    2016-06-15

    This education session will cover the physics and operation principles of gamma cameras and PET scanners. The first talk will focus on PET imaging. An overview of the principles of PET imaging will be provided, including positron decay physics, and the transition from 2D to 3D imaging. More recent advances in hardware and software will be discussed, such as time-of-flight imaging, and improvements in reconstruction algorithms that provide for options such as depth-of-interaction corrections. Quantitative applications of PET will be discussed, as well as the requirements for doing accurate quantitation. Relevant performance tests will also be described. Learning Objectives: Be able to describe basic physics principles of PET and operation of PET scanners. Learn about recent advances in PET scanner hardware technology. Be able to describe advances in reconstruction techniques and improvements Be able to list relevant performance tests. The second talk will focus on gamma cameras. The Nuclear Medicine subcommittee has charged a task group (TG177) to develop a report on the current state of physics testing of gamma cameras, SPECT, and SPECT/CT systems. The report makes recommendations for performance tests to be done for routine quality assurance, annual physics testing, and acceptance tests, and identifies those needed satisfy the ACR accreditation program and The Joint Commission imaging standards. The report is also intended to be used as a manual with detailed instructions on how to perform tests under widely varying conditions. Learning Objectives: At the end of the presentation members of the audience will: Be familiar with the tests recommended for routine quality assurance, annual physics testing, and acceptance tests of gamma cameras for planar imaging. Be familiar with the tests recommended for routine quality assurance, annual physics testing, and acceptance tests of SPECT systems. Be familiar with the tests of a SPECT/CT system that include the CT images for SPECT reconstructions. Become knowledgeable of items to be included in annual acceptance testing reports including CT dosimetry and PACS monitor measurements. T. Turkington, GE Healthcare.

  7. MO-AB-206-00: Nuclear Medicine Physics and Testing

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2016-06-15

    This education session will cover the physics and operation principles of gamma cameras and PET scanners. The first talk will focus on PET imaging. An overview of the principles of PET imaging will be provided, including positron decay physics, and the transition from 2D to 3D imaging. More recent advances in hardware and software will be discussed, such as time-of-flight imaging, and improvements in reconstruction algorithms that provide for options such as depth-of-interaction corrections. Quantitative applications of PET will be discussed, as well as the requirements for doing accurate quantitation. Relevant performance tests will also be described. Learning Objectives: Be able to describe basic physics principles of PET and operation of PET scanners. Learn about recent advances in PET scanner hardware technology. Be able to describe advances in reconstruction techniques and improvements Be able to list relevant performance tests. The second talk will focus on gamma cameras. The Nuclear Medicine subcommittee has charged a task group (TG177) to develop a report on the current state of physics testing of gamma cameras, SPECT, and SPECT/CT systems. The report makes recommendations for performance tests to be done for routine quality assurance, annual physics testing, and acceptance tests, and identifies those needed satisfy the ACR accreditation program and The Joint Commission imaging standards. The report is also intended to be used as a manual with detailed instructions on how to perform tests under widely varying conditions. Learning Objectives: At the end of the presentation members of the audience will: Be familiar with the tests recommended for routine quality assurance, annual physics testing, and acceptance tests of gamma cameras for planar imaging. Be familiar with the tests recommended for routine quality assurance, annual physics testing, and acceptance tests of SPECT systems. Be familiar with the tests of a SPECT/CT system that include the CT images for SPECT reconstructions. Become knowledgeable of items to be included in annual acceptance testing reports including CT dosimetry and PACS monitor measurements. T. Turkington, GE Healthcare.

  8. 30 CFR 206.353 - How do I determine transmission deductions?

    Science.gov (United States)

    2010-07-01

    ... installation of capital equipment) that are an integral part of the transmission line. (2)(i) You may include a return on capital you invested in the purchase of real estate for transmission facilities if: (A) Such...: (1) Maintenance of the transmission line; (2) Maintenance of equipment; (3) Maintenance labor; and (4...

  9. 30 CFR 206.359 - How do I determine byproduct transportation allowances?

    Science.gov (United States)

    2010-07-01

    ... depreciable fixed assets (including costs of delivery and installation of capital equipment) that are an integral part of the transportation system. (2)(i) You may include a return on capital you invested in the...; (2) Maintenance of equipment; (3) Maintenance labor; and (4) Other directly allocable and...

  10. 30 CFR 206.354 - How do I determine generating deductions?

    Science.gov (United States)

    2010-07-01

    ... capital equipment) that are an integral part of the power plant or are required by the design specifications of the power conversion cycle. (2)(i) You may include a return on capital you invested in the...: (1) Maintenance of the power plant; (2) Maintenance of equipment; (3) Maintenance labor; and (4...

  11. Hot tearing of aluminum-copper B206 alloys with iron and silicon additions

    National Research Council Canada - National Science Library

    Kamguo Kamga, H; Larouche, D; Bournane, M; Rahem, A

    2010-01-01

    ...) to investigate the combined effect of these additions on hot tear resistance. Susceptibility to hot tearing was found to increase gradually with iron content when the conditions were favorable to the formation of the β(FeCu) phase...

  12. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (206-0613-272217)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  13. 77 FR 58210 - 31st Meeting: RTCA Special Committee 206, Aeronautical Information and Meteorological Data Link...

    Science.gov (United States)

    2012-09-19

    ... Presentations: Category 1 End-to-End Performance Metrics paper Human Factors Product Evaluation paper Data Link... open to the interested public but limited to space availability. With the approval of the chairman...

  14. 21 CFR 10.206 - Procedures for electronic media coverage of agency public administrative proceedings.

    Science.gov (United States)

    2010-04-01

    ..., whenever possible, provide advance notice to the Press Relations Staff (HFI-20), Office of Public Affairs... (telephone 301-443-4177), at least 48 hours in advance of the proceeding. The Press Relations Staff will... required by the presiding officer. If so, the Press Relations Staff will function as a liaison between the...

  15. Evaluation of Composite Components on the Bell 206L and Sikorsky S-76 Helicopters

    Science.gov (United States)

    1990-08-01

    Continent (fig. 6). The se- with the following ASTM standards : (1) Tension- lected locations are in the general areas where the D3039 , (2) SBS-D2344, and...figure 3. The S-glass1 I/epoxy tube with a short length of steel tub- door consists of Kevlar-49 fabric/LRF-277V epoxy ing and standard abrasion pad

  16. 34 CFR 206.5 - What definitions apply to these programs?

    Science.gov (United States)

    2010-07-01

    ... activity directly related to the production of crops, dairy products, poultry, or livestock; (ii) Any...—whose employment required travel that precluded the farmworker from returning to his or her domicile...

  17. 30 CFR 206.51 - What definitions apply to this subpart?

    Science.gov (United States)

    2010-07-01

    ... agreements: (1) May or may not specify prices for the oil involved; (2) Frequently specify dollar amounts... or buy down the purchase price of oil to be produced in later periods, by allocating those payments... price received for oil delivered and the price paid for oil received under a buy/sell exchange agreement...

  18. 30 CFR 206.101 - What definitions apply to this subpart?

    Science.gov (United States)

    2010-07-01

    ... may not specify prices for the oil involved. They frequently specify dollar amounts reflecting... interest may be exempt from taxation; (5) Payments made to reduce or buy down the purchase price of oil to... differential may represent all or part of the difference between the price received for oil delivered and the...

  19. 42 CFR 420.206 - Disclosure of persons having ownership, financial, or control interest.

    Science.gov (United States)

    2010-10-01

    ... direct or indirect ownership interest totaling 5 percent or more. In the case of a part B supplier that... ownership or control interest or position as managing employee, and the nature of the relationship with the... or reissued a billing number as a part B supplier. (3) A disclosing entity must furnish updated...

  20. Measurement of the Bi209(n,4n)Bi206 and Tm169(n,3n)Tm167 cross sections between 23.5 and 30.5 MeV relevant to reaction-in-flight neutron studies at the National Ignition Facility

    Energy Technology Data Exchange (ETDEWEB)

    Gooden, M. E.; Bredeweg, T. A.; Champine, B.; Combs, D. C.; Finch, S.; Hayes-Sterbenz, A.; Henry, E.; Krishichayan,; Rundberg, R.; Tornow, W.; Wilhelmy, J.; Yeamans, C.

    2017-08-01

    At the National Ignition Facility, experiments are being performed to measure charged-particle stopping powers in the previously unexplored warm dense plasma regime. These measurements are done using reaction-in-flight (RIF) neutrons from an inertial confinement fusion system. RIF neutrons are produced with a continuum of energies up to 30 MeV. By making activation measurements utilizing threshold reactions for neutrons in the energy range of 15 < E n < 30 MeV , the number of RIF neutrons can be determined and from this the stopping power of the deuterium and tritium ions that produced the RIF neutrons can be inferred. Currently, the 169 Tm ( n , 3 n ) 167 Tm reaction has been used. However, in an effort to provide a secondary complimentary measurement, efforts are underway to make use of the 209 Bi ( n , 4 n ) 206 Bi reaction, with a threshold of 22.5 MeV. The cross sections were measured at the 10 MV tandem Van De Graaff accelerator at the Triangle Universities Nuclear Laboratory with quasimonoenergetic neutrons between 23.5 and 30.5 MeV, where few previous measurements have been made. Cross-section data are compared to calculations and other available measurements.

  1. Derivation of Soil Screening Guidelines for Gross Alpha/Beta Radioactivity for United States Air Force Deployment Sites

    Science.gov (United States)

    2007-04-19

    the emission of 7 alpha particles and 4 beta particles. Three radionuclides ( francium -223, astatine-215, and polonium-211) are not listed below...no no Uranium-233 159,200 y alpha yes no Thorium-229 7,300 y alpha yes no Radium-225 14.9 d beta no no Actinium-225 10.0 d alpha no no Francium

  2. δ37Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine.

  3. δ³⁷Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine. This thesis presents the first chlorine

  4. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  5. Racial and Ethnic Disparities in Men's Use of Mental Health Treatments. NCHS Data Brief. Number 206

    Science.gov (United States)

    Blumberg, Stephen J.; Clarke, Tainya C.; Blackwell, Debra L.

    2016-01-01

    Compared with white Americans, persons of other races in the United States are less likely to have access to and receive needed mental health care (1-4). Few studies, however, have explored such disparities specifically among men. Mental health and treatment have traditionally received less attention for men than women, perhaps because men are…

  6. 44 CFR 206.131 - Individual and Family Grant Program for major disasters declared on or before October 14, 2002.

    Science.gov (United States)

    2010-10-01

    ... State shares. The $10,000 limit will be adjusted annually, at the beginning of each fiscal year, to... address only disaster-related needs. (c) Definitions used in this section. (1) Necessary expense means the... not hold formal title to the residence but is responsible for payment of taxes, maintenance of the...

  7. 44 CFR 206.101 - Temporary housing assistance for emergencies and major disasters declared on or before October 14...

    Science.gov (United States)

    2010-10-01

    ... impediments to access, or restrictions placed on movement by a responsible official due to continued health... documentation according to the requirements of 44 CFR part 13, Uniform Administrative Requirements for Grants... authorized if in compliance with 44 CFR 13.22, Allowable Costs, and the associated OMB Circular A-87, Cost...

  8. SU-E-T-206: Improving Radiotherapy Toxicity Based On Artificial Neural Network (ANN) for Head and Neck Cancer Patients

    Energy Technology Data Exchange (ETDEWEB)

    Cho, Daniel D; Wernicke, A Gabriella; Nori, Dattatreyudu; Chao, KSC; Parashar, Bhupesh; Chang, Jenghwa [Weill Cornell Medical College, NY, NY (United States)

    2014-06-01

    Purpose/Objective(s): The aim of this study is to build the estimator of toxicity using artificial neural network (ANN) for head and neck cancer patients Materials/Methods: An ANN can combine variables into a predictive model during training and considered all possible correlations of variables. We constructed an ANN based on the data from 73 patients with advanced H and N cancer treated with external beam radiotherapy and/or chemotherapy at our institution. For the toxicity estimator we defined input data including age, sex, site, stage, pathology, status of chemo, technique of external beam radiation therapy (EBRT), length of treatment, dose of EBRT, status of post operation, length of follow-up, the status of local recurrences and distant metastasis. These data were digitized based on the significance and fed to the ANN as input nodes. We used 20 hidden nodes (for the 13 input nodes) to take care of the correlations of input nodes. For training ANN, we divided data into three subsets such as training set, validation set and test set. Finally, we built the estimator for the toxicity from ANN output. Results: We used 13 input variables including the status of local recurrences and distant metastasis and 20 hidden nodes for correlations. 59 patients for training set, 7 patients for validation set and 7 patients for test set and fed the inputs to Matlab neural network fitting tool. We trained the data within 15% of errors of outcome. In the end we have the toxicity estimation with 74% of accuracy. Conclusion: We proved in principle that ANN can be a very useful tool for predicting the RT outcomes for high risk H and N patients. Currently we are improving the results using cross validation.

  9. Oahu Hyperspectral Imagery 2000 (206-0613-272217) - Visual Interpretation from Remote Sensing Imagery Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...

  10. 44 CFR 206.48 - Factors considered when evaluating a Governor's request for a major disaster declaration.

    Science.gov (United States)

    2010-10-01

    ... Governor's request for a major disaster declaration. When we review a Governor's request for major disaster... might warrant Federal assistance, and adjust this figure annually based on the Consumer Price Index for... amount of insurance coverage that is in force or should have been in force as required by law and...

  11. 75 FR 71183 - 23rd Meeting: RTCA Special Committee 206: EUROCAE WG 76 Plenary: AIS and MET Data Link Services

    Science.gov (United States)

    2010-11-22

    ... revision to the Minimum Interoperability Standards (MIS) for ] Automated Meteorological Transmission... Applications, WG1 Chairmen Working Group 2, AIS Uplink and MET Uplink, Downlink, and Crosslink, Concept of Use...

  12. SU-F-J-206: Systematic Evaluation of the Minimum Detectable Shift Using a Range- Finding Camera

    Energy Technology Data Exchange (ETDEWEB)

    Platt, M; Platt, M [College of Medicine University of Cincinnati, Cincinnati, OH (United States); Lamba, M [University of Cincinnati, Cincinnati, OH (United States); Mascia, A [University of Cincinnati Medical Center, Cincinnati, OH (United States); Huang, K [UC Health Barret Cancer Center, Cincinnati, OH (United States)

    2016-06-15

    Purpose: The robotic table used for patient alignment in proton therapy is calibrated only at commissioning under well-defined conditions and table shifts may vary over time and with differing conditions. The purpose of this study is to systematically investigate minimum detectable shifts using a time-of-flight (TOF) range-finding camera for table position feedback. Methods: A TOF camera was used to acquire one hundred 424 × 512 range images from a flat surface before and after known shifts. Range was assigned by averaging central regions of the image across multiple images. Depth resolution was determined by evaluating the difference between the actual shift of the surface and the measured shift. Depth resolution was evaluated for number of images averaged, area of sensor over which depth was averaged, distance from camera to surface, central versus peripheral image regions, and angle of surface relative to camera. Results: For one to one thousand images with a shift of one millimeter the range in error was 0.852 ± 0.27 mm to 0.004 ± 0.01 mm (95% C.I.). For varying regions of the camera sensor the range in error was 0.02 ± 0.05 mm to 0.47 ± 0.04 mm. The following results are for 10 image averages. For areas ranging from one pixel to 9 × 9 pixels the range in error was 0.15 ± 0.09 to 0.29 ± 0.15 mm (1σ). For distances ranging from two to four meters the range in error was 0.15 ± 0.09 to 0.28 ± 0.15 mm. For an angle of incidence between thirty degrees and ninety degrees the average range in error was 0.11 ± 0.08 to 0.17 ± 0.09 mm. Conclusion: It is feasible to use a TOF camera for measuring shifts in flat surfaces under clinically relevant conditions with submillimeter precision.

  13. The novel biomarker of alternative macrophage activation, soluble mannose receptor (sMR/sCD206): Implications in multiple myeloma

    DEFF Research Database (Denmark)

    Andersen, Morten N; Andersen, Niels F; Rødgaard-Hansen, Sidsel

    2015-01-01

    Tumor-associated macrophages (TAMs) play an important role in the pathophysiology of human malignancies. They support growth of cancer cells by promoting angiogenesis, and by inhibiting tumour cell apoptosis and anti-tumor immune reactions. Several membrane proteins are well-described markers...

  14. 30 CFR 206.110 - How do I determine a transportation allowance under an arm's-length transportation contract?

    Science.gov (United States)

    2010-07-01

    ... MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT PRODUCT VALUATION Federal Oil... when high-gravity petroleum (generally in excess of 51 degrees API) is mixed with lower-gravity crude...

  15. 20 CFR 655.206 - Determinations of U.S. worker availability and adverse effect on U.S. workers.

    Science.gov (United States)

    2010-04-01

    ... TRAINING ADMINISTRATION, DEPARTMENT OF LABOR TEMPORARY EMPLOYMENT OF FOREIGN WORKERS IN THE UNITED STATES... shall continue its efforts to actively recruit U.S. workers until the foreign workers have departed for... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Determinations of U.S. worker availability...

  16. 44 CFR 206.209 - Arbitration for Public Assistance determinations related to Hurricanes Katrina and Rita (Major...

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Arbitration for Public Assistance determinations related to Hurricanes Katrina and Rita (Major disaster declarations DR-1603, DR... determinations related to Hurricanes Katrina and Rita (Major disaster declarations DR-1603, DR-1604, DR-1605, DR...

  17. Characteristics and Education Outcomes of Utah High School Dropouts Who Re-Enrolled. REL 2017-206

    Science.gov (United States)

    Barrat, Vanessa X.; Berliner, BethAnn

    2016-01-01

    Numerous studies over the past two decades have examined the prevalence, causes, predictors, and prevention of high school dropout, but comparatively little is known about students who drop out and later re-enroll. This study contributes to an emerging body of research on re-enrollees that challenges the perception that when students drop out,…

  18. Variation Found in Rates of Restraint and Seclusion among Students with a Disability. Paper 206. National Issue Brief No. 67

    Science.gov (United States)

    Gagnon, Douglas J.; Mattingly, Marybeth; Connelly, Vincent J.

    2013-01-01

    The restraint and seclusion of individuals--practices usually associated with highly restrictive environments--are extreme responses to student behavior used in some public schools. In this brief, authors Douglas Gagnon, Marybeth Mattingly, and Vincent Connelly report that restraint and seclusion are used much more frequently on students with a…

  19. 25 CFR 900.206 - What employees are covered by FTCA for non-medical-related claims?

    Science.gov (United States)

    2010-04-01

    ... INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES CONTRACTS UNDER THE INDIAN SELF... employees; (b) Temporary employees; (c) Persons providing services without compensation in carrying out a... 25 Indians 2 2010-04-01 2010-04-01 false What employees are covered by FTCA for non-medical...

  20. 7 CFR 718.206 - Determining farms, tracts, allotments, quotas, and bases when reconstitution is made by division.

    Science.gov (United States)

    2010-01-01

    ... Department of Agriculture (Continued) FARM SERVICE AGENCY, DEPARTMENT OF AGRICULTURE FARM MARKETING QUOTAS... available land, cultural operations, and changes in type of farming. (e) The cropland method is the pro-rata... the method used did not provide an equitable distribution considering available land, cultural...

  1. 206. Reparación mitral como tratamiento de la insuficiencia mitral crónica. Estudio de 119 casos

    Directory of Open Access Journals (Sweden)

    S. Ramis

    2010-01-01

    Conclusiones: La cirugía de reparación mitral es una técnica segura y eficaz que permite corregir adecuadamente el vicio valvular. Su morbimortalidad hospitalaria es baja, presentando excelentes resultados a corto y medio plazo, además de evitar todas las complicaciones propias de las prótesis.

  2. 7 CFR 1710.206 - Approval requirements for load forecasts prepared pursuant to approved load forecast work plans.

    Science.gov (United States)

    2010-01-01

    ... dictionary thoroughly defining the database shall be included. The borrower shall make all or parts of the... competition; or (vii) new environmental requirements. (7) A summary of the forecast's results on an annual...

  3. 30 CFR 206.172 - How do I value gas produced from leases in an index zone?

    Science.gov (United States)

    2010-07-01

    ... for each month the safety net differential (SND). You must perform this calculation separately for...). (i) Include in your calculation only sales under those contracts that establish a delivery point... calculation those volumes that are allocable to your Indian leases in that index zone. (ii) Do not reduce the...

  4. SU-C-206-03: Metal Artifact Reduction in X-Ray Computed Tomography Based On Local Anatomical Similarity

    Energy Technology Data Exchange (ETDEWEB)

    Dong, X; Yang, X; Rosenfield, J; Elder, E; Dhabaan, A [Emory University, Winship Cancer Institute, Atlanta, GA (United States)

    2016-06-15

    Purpose: Metal implants such as orthopedic hardware and dental fillings cause severe bright and dark streaking in reconstructed CT images. These artifacts decrease image contrast and degrade HU accuracy, leading to inaccuracies in target delineation and dose calculation. Additionally, such artifacts negatively impact patient set-up in image guided radiation therapy (IGRT). In this work, we propose a novel method for metal artifact reduction which utilizes the anatomical similarity between neighboring CT slices. Methods: Neighboring CT slices show similar anatomy. Based on this anatomical similarity, the proposed method replaces corrupted CT pixels with pixels from adjacent, artifact-free slices. A gamma map, which is the weighted summation of relative HU error and distance error, is calculated for each pixel in the artifact-corrupted CT image. The minimum value in each pixel’s gamma map is used to identify a pixel from the adjacent CT slice to replace the corresponding artifact-corrupted pixel. This replacement only occurs if the minimum value in a particular pixel’s gamma map is larger than a threshold. The proposed method was evaluated with clinical images. Results: Highly attenuating dental fillings and hip implants cause severe streaking artifacts on CT images. The proposed method eliminates the dark and bright streaking and improves the implant delineation and visibility. In particular, the image non-uniformity in the central region of interest was reduced from 1.88 and 1.01 to 0.28 and 0.35, respectively. Further, the mean CT HU error was reduced from 328 HU and 460 HU to 60 HU and 36 HU, respectively. Conclusions: The proposed metal artifact reduction method replaces corrupted image pixels with pixels from neighboring slices that are free of metal artifacts. This method proved capable of suppressing streaking artifacts, improving HU accuracy and image detectability.

  5. Five Year Ground Exposure of Composite Materials Used on the Bell Model 206L Flight Service Evaluation

    Science.gov (United States)

    1989-07-01

    were performed in accordance with the following ASTM standards ; 1.) Tension- D3039 , 2.) SBS-D2344, 3.) Compression-D3410 using the IITRI test fixture...and standard deviation ar, a’"o given for each material. The results of tests on compression specimens that have been exposed up to 5 years are...compression strength and standard deviation for each set of replicate specimens (same exposure site and exposure time) are also given in Tables III-VI. A

  6. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  7. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita

    2011-01-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  8. Production cross section of At radionuclides from 7Li+natPb and 9Be+natTl reactions

    Science.gov (United States)

    Maiti, Moumita; Lahiri, Susanta

    2011-12-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from 6,7Li- and 9Be-induced reactions on natural lead and thallium targets, respectively. The production of astatine radionuclides were investigated experimentally with two heavy-ion-induced reactions: 9Be + natTl and 7Li + natPb. Formation cross sections of the evaporation residues, 207,208,209,210At, produced in the (HI,xn) channel, were measured by the stacked-foil technique followed by off-line γ spectrometry at low incident energies (<50 MeV). Measured excitation functions were interpreted in terms of a compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach models. Measured cross-section values are lower than the respective theoretical predictions.

  9. Index to Nuclear Safety: a technical progress review by chrology, permuted title, and author, Volume 11(1) through Volume 20(6)

    Energy Technology Data Exchange (ETDEWEB)

    Cottrell, W B; Passiakos, M

    1980-06-01

    This index to Nuclear Safety, a bimonthly technical progress review, covers articles published in Nuclear Safety, Volume II, No. 1 (January-February 1970), through Volume 20, No. 6 (November-December 1979). It is divided into three sections: a chronological list of articles (including abstracts) followed by a permuted-title (KWIC) index and an author index. Nuclear Safety, a bimonthly technical progress review prepared by the Nuclear Safety Information Center (NSIC), covers all safety aspects of nuclear power reactors and associated facilities. Over 600 technical articles published in Nuclear Safety in the last ten years are listed in this index.

  10. Brooks, T., y Nussbaum, M. C. (eds.. (2015. Rawls's Political Liberalism. Nueva York, Estados Unidos de América: Columbia University. 206 pp.

    Directory of Open Access Journals (Sweden)

    Mario Josue Cunningham-Matamoros

    2017-06-01

    Full Text Available Poco más de dos décadas después de la publicación de Political Liberalism (1993 del filósofo estadounidense John Rawls, Thom Brooks y Martha Nussbaum se dieron la tarea de editar una compilación de seis ensayos que muestran la actualidad de este libro. Los escritos que participan en esta recopilación se aproximan al texto rawlsiano de manera variopinta, tanto a nivel disciplinar como en lo referido a la finalidad con la cual lo abordan. A grandes rasgos, estos se dividen en tres grupos: el primer grupo, cuya pretensión es realizar una revisión crítica de la obra o de conceptos medulares de esta (Frank I. Michelman, Martha Nussbaum y Onora O'Neill; el segundo conjunto, donde se realiza una labor exegética capaz de responder a múltiples críticas que ha enfrentado el texto desde su publicación (Jeremy Waldron y Paul Weithman y, finalmente, un artículo ―el tercer grupo― que muestra la consistencia práctica en el modo en que Rawls concibió el derecho constitucional estadounidense.

  11. International Civil Aviation Organization Helicopter Noise Measurement Repeatability Program: U.S. Test Report, Bell 206L-1, Noise Measurement Flight Test,

    Science.gov (United States)

    1985-09-01

    unclassified unclassified 421 Form DOT F 1700.7 (8-72) Reproduction of completed page authorized ,0-.% ACKNOWLEDGEDENTS The authors would like to thank...118 0 990 0.3 9.22 87 118 0 98) M3 19:22 83 118 0 19751 TABLE J.44 TABLE J.42 : 8-274- WE : 8-27-84 MATU: UFO 0.9 Th 117 I1. MOM : LR 0.9 Vh 117 1S

  12. Optimisation of the solution heat treatment of Rheo-processed Al-Cu-Mg-(Ag) Alloys A206 and A201

    CSIR Research Space (South Africa)

    Masuku, EP

    2009-06-01

    Full Text Available The traditional solution treatment cycles that are currently applied to rheo-processed A201 are mostly those that are used for conventional castings. These solution treatments are not necessarily the optimum solution treatments for rheo...

  13. Fusion-fission studies on 19F+206,208Pb and 11B,19F+238U reactions around barrier energies at IUAC facility

    Science.gov (United States)

    Pullanhiotan, Sugathan; Dubey, Rakesh; Yadav, Chandrabhan; Jhingan, Akhil; Komalan Satheedas, Golda; Nedumbally, Saneesh; Kumar, Mohit

    2017-11-01

    Fission process is strongly influenced by entrance channel dynamical variables. Among these, the nuclear charge product, mass asymmetry and deformation play important role in fission dynamics. Reaction characteristics are distinguished by investigating the properties of fission mass and angular distributions. Experiments using actinide targets are challenging due to many conflicting results making unambiguous identification of quasi-fission difficult. At IUAC accelerator facility many experiments have been performed to make a systematic study of fission mechanism and role of entrance channel parameters and deformation. Fragment mass distribution, angular distribution and neutron multiplicity measurements are performed to study reactions using spherical and deformed targets.

  14. FCJ-206 From Braitenberg’s Vehicles to Jansen’s Beach Animals: Towards an Ecological Approach to the Design of Non-Organic Intelligence

    Directory of Open Access Journals (Sweden)

    Maaike Bleeker

    2016-12-01

    Full Text Available This article presents a comparison of two proposals for how to conceive of the evolution of non-organic intelligence. One is Valentino Braitenberg’s 1984 essay ‘Vehicles: Experiments in Synthetic Psychology’. The other is the Strandbeesten (beach animals of Dutch engineer-artist Theo Jansen. Jansen’s beach animals are not robots. Yet, as semi-autonomous non-organic agents created by humans, they are interesting in the context of the development of robots for how they present an ecological approach to the design of non-organic intelligence. Placing Braitenberg’s and Jansen’s approaches side by side illuminates how Jansen’s approach implies a radically different take than Braitenberg’s on non-organic intelligence, on intelligence as environmental, and on what the relationship between agency and behaviour might comprise.

  15. SU-D-206-05: A Critical Look at CBCT-Based Dose Calculation Accuracy as It Is Applied to Adaptive Radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Bejarano Buele, A; Sperling, N; Parsai, E [University of Toledo Medical Center, Toledo, OH (United States)

    2016-06-15

    Purpose: Cone-beam CTs (CBCT) obtained from On-Board Imaging Devices (OBI) are increasingly being used for dose calculation purposes in adaptive radiotherapy. Patient and target morphology are monitored and the treatment plan is updated using CBCT. Due to the difference in image acquisition parameters, dose calculated in a CBCT can differ from planned dose. We evaluate the difference between dose calculation in kV CBCT and simulation CT, and the effect of HU-density tables in dose discrepancies Methods: HU values for various materials were obtained using a Catphan 504 phantom for a simulator CT (CTSIM) and two different OBI systems using three imaging protocols: Head, Thorax and Pelvis. HU-density tables were created in the TPS for each OBI image protocol. Treatment plans were made on each Catphan 504 dataset and on the head, thorax and pelvis sections of an anthropomorphic phantom, with and without the respective HU-density table. DVH information was compared among OBI systems and planning CT. Results: Dose calculations carried on the Catphan 504 CBCTs, with and without the respective CT-density table, had a maximum difference of −0.65% from the values on the planning CT. The use of the respective HU-density table decreased the percent differences from planned values by half in most of the protocols. For the anthropomorphic phantom datasets, the use of the correct HU-density table reduced differences by 0.89% on OBI1 and 0.59% on OBI2 for the head, 0.49% on OBI1 for the thorax, and 0.25% on OBI2 for the pelvis. Differences from planned values without HU-density correction ranged from 3.13% (OBI1, thorax) to 0.30% (OBI2, thorax). Conclusion: CT-density tables in the TPS yield acceptable differences when used in partly homogeneous medium. Further corrections are needed when the medium contains pronounced density differences for accurate CBCT calculation. Current difference range (1–3%) can be clinically acceptable.

  16. [A study using the computer-controlled perimeter Perimat 206 on the effect of Circo-Maren on visual field defects].

    Science.gov (United States)

    Schubert, E; Weber, S

    1988-11-01

    In 1987 an open study was conducted in an ophthalmological practice to test Circo-Maren tablets. Examinations using a computerized perimeter revealed that therapy with Circo-Maren can lead to a reduction in visual field defects in patients with senile macular edema and retinal angiosclerosis. In cases with severe defects, favorable results were achieved which were statistically significant (duration of treatment: 4-12 weeks). Considerable fluctuations in the number and intensity of the defects were seen in the various intermediate examinations.

  17. 30 CFR 206.360 - What records must I keep to support my calculations of royalty or fees under this subpart?

    Science.gov (United States)

    2010-07-01

    ... subpart? If you determine royalties or direct use fees for your geothermal resource under this subpart... MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT PRODUCT VALUATION Geothermal...

  18. 30 CFR 206.355 - How do I calculate royalty due on geothermal resources I sell at arm's length to a purchaser for...

    Science.gov (United States)

    2010-07-01

    ... to a purchaser for direct use? If you sell geothermal resources produced from Class I, II, or III leases at arm's length to a purchaser for direct use, then the royalty on the geothermal resource is the... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How do I calculate royalty due on geothermal...

  19. SU-G-206-06: Analytic Dose Function for CT Scans in Infinite Cylinders as a Function of Scan Length and Cylinder Radius

    Energy Technology Data Exchange (ETDEWEB)

    Bakalyar, D [Henry Ford Health System, Detroit, MI (United States); Feng, W [New York Presbyterian Hospital, Tenafly, NJ (United States); McKenney, S [Children’s National Medical Center, Washington, DC (United States)

    2016-06-15

    Purpose: The radiation dose absorbed at a particular radius ρ within the central plane of a long cylinder following a CT scan is a function of the length of the scan L and the cylinder radius R along with kVp and cylinder composition. An analytic function was created that that not only expresses these dependencies but is integrable in closed form over the area of the central plane. This feature facilitates explicit calculation of the planar average dose. The “approach to equilibrium” h(L) discussed in the TG111 report is seamlessly included in this function. Methods: For a cylindrically symmetric radiation field, Monte Carlo calculations were performed to compute the dose distribution to long polyethylene cylinders for scans of varying L for cylinders ranging in radius from 5 to 20 cm. The function was developed from the resultant Monte Carlo data. In addition, the function was successfully fit to data taken from measurements on the 30 cm diameter ICRU/TG200 phantom using a real-time dosimeter. Results: Symmetry and continuity dictate a local extremum at the center which is a minimum for the larger sizes. There are competing effects as the beam penetrates the cylinder from the outside: attenuation, resulting in a decrease; scatter, abruptly increasing at the circumference. This competition may result in an absolute maximum between the center and outer edge leading to a “gull wing” shape for the radial dependence. For the smallest cylinders, scatter may dominate to the extent that there is an absolute maximum at the center. Conclusion: An integrable, analytic function has been developed that provides the radial dependency of dose for the central plane of a scan of length L for cylinders of varying diameter. Equivalently, we have developed h(L,R,ρ).

  20. SU-C-206-01: Impact of Charge Sharing Effect On Sub-Pitch Resolution for CZT-Based Photon Counting CT Systems

    Energy Technology Data Exchange (ETDEWEB)

    Zheng, X; Cheng, Z; Deen, J; Peng, H [McMaster University, Hamilton, Ontario (Canada); Xing, L [Stanford University School of Medicine, Stanford, CA (United States)

    2016-06-15

    Purposes: Photon counting CT is a new imaging technology that can provide tissue composition information such as calcium/iodine content quantification. Cadmium zinc telluride CZT is considered a good candidate the photon counting CT due to its relatively high atomic number and band gap. One potential challenge is the degradation of both spatial and energy resolution as the fine electrode pitch is deployed (<50 µm). We investigated the extent of charge sharing effect as functions of gap width, bias voltage and depth-of-interaction (DOI). Methods: The initial electron cloud size and diffusion process were modeled analytically. The valid range of charge sharing effect refers to the range over which both signals of adjacent electrodes are above the triggering threshold (10% of the amplitude of 60keV X-ray photons). The intensity ratios of output in three regions (I1/I2/I3: left pixel, gap area and right pixel) were calculated. With Gaussian white noises modeled (a SNR of 5 based upon the preliminary experiments), the sub-pitch resolution as a function of the spatial position in-between two pixels was studied. Results: The valid range of charge sharing increases linearly with depth-of-interaction (DOI) but decreases with gap width and bias voltage. For a 1.5mm thickness CZT detector (pitch: 50µm, bias: 400 V), the range increase from ∼90µm up to ∼110µm. Such an increase can be attributed to a longer travel distance and the associated electron cloud broadening. The achievable sub-pitch resolution is in the range of ∼10–30µm. Conclusion: The preliminary results demonstrate that sub-pixel spatial resolution can be achieved using the ratio of amplitudes of two neighboring pixels. Such ratio may also be used to correct charge loss and help improve energy resolution of a CZT detector. The impact of characteristic X-rays hitting adjacent pixels (i.e., multiple interaction) on charge sharing is currently being investigated.

  1. SU-G-JeP2-06: Dosimetric and Workflow Evaluation of First Commercial Synthetic CT Software for Clinical Use in Pelvis

    Energy Technology Data Exchange (ETDEWEB)

    Tyagi, N; Zhang, J; Happersett, L; Kadbi, M; Mechalakos, J; Deasy, J; Hunt, M [Memorial Sloan Kettering Cancer Center, New York, NY (United States)

    2016-06-15

    Purpose: evaluate a commercial synthetic CT (syn-CT) software for use in prostate radiotherapy Methods: Twenty prostate patients underwent CT and MR simulation scans in treatment position on a 3T Philips scanner. The MR protocol consisted of a T2w turbo spin-echo for soft tissue contrast, a 2D balanced-fast field echo (b-FFE) for fiducial identification, a dual-echo 3D FFE B0 map for distortion analysis and a 3D mDIXON FFE sequence to generate syn-CT. Two echoes are acquired during mDIXON scan, allowing water, fat, and in-phase images to be derived using the frequency shift of the fat and water protons. Tissues were classified as: air, adipose, water, trabecular/spongy bone and compact/cortical bone and assigned specific bulk HU values. Bone structures are segmented based on a pelvis bone atlas. Accuracy of syn-CT for patient treatment planning was analyzed by transferring the original plan and structures from the CT to syn-CT via rigid registration and recalculating dose. In addition, new IMRT plans were generated on the syn-CT using structures contoured on MR and transferred to the syn-CT. Accuracy of fiducial-based localization at the treatment machine performed using syn-CT or DRRs generated from syn-CT was assessed by comparing to orthogonal kV radiographs or CBCT. Results: Dosimetric comparison between CT and syn-CT was within 0.5% for all structures. The de-novo optimized plans generated on the syn-CT met our institutional clinical objectives for target and normal structures. Patient-induced susceptibility distortion based on B0 maps was within 1mm and 0.4 mm in the body and prostate. The rectal and bladder outlines on the syn-CT were deemed sufficient for assessing rectal and bladder filling on the CBCT at the time of treatment. CBCT localization showed a median error of < ±1 mm in LR, AP and SI direction. Conclusion: MRI derived syn-CT can be used clinically in MR-alone planning and treatment process for prostate. Drs. Deasy, Hunt and Tyagi have Master research agreement with Philips healthcare.

  2. SU-E-J-206: A Comparison of Different Hardware Design Approaches for Feature-Supported Optical Head-Tracking with Respect to Angular Dependencies

    Energy Technology Data Exchange (ETDEWEB)

    Stueber, P; Wissel, T; Wagner, B [Institute for Robotics and Cognitive Systems, University of Luebeck, Luebeck (Germany); Graduate School for Computing in Life Science, University of Luebeck, Luebeck (Germany); Bruder, R; Schweikard, A; Ernst, F [Institute for Robotics and Cognitive Systems, University of Luebeck, Luebeck (Germany)

    2014-06-01

    Purpose: Recent research has shown that optical features significantly improve marker-less optical head-tracking for cranial radiotherapy. Simulations, however, showed that these optical features, which are used to derive tissue thickness, depend on the incident angle of the IR scanning laser beam and the perspective of the camera analyzing the reflective patterns. We present an experimental analysis determining which is the most robust optical setup concerning angular influences. Methods: In three consecutive experiments, the incident angle of the laser (1), the perspective of the camera (2) or both simultaneously (3, ‘inBeam’-perspective) were changed with respect to the target. We analyzed how this affects feature intensity. These intensities were determined from seven concentric regions of interest (ROIs) around the laser spot. Two targets were used: a tissue-like silicone phantom and a human's forehead. Results: For each experiment, the feature intensity generally decreases with increasing angle. We found that the optical properties of the silicone phantom do not fit the properties of human skin. Furthermore, the angular influence of the laser on the features is significantly higher than the perspective of the camera. With the ‘inBeam’- perspective, the smoothest decays of feature intensity were found. We suppose that this is because of a fixed relationship between both devices. This smoothness, suggesting a predictable functional relationship, may simplify angle compensation for machine learning algorithms. This is particularly prominent for the medial ROIs. The inner ROIs highly depend on the angle and power of the laser. The outer ROIs show less angular dependency but the signal strength is critically low and prone to artifacts. Therefore and because of the smooth decays, medial ROIs are a suitable tradeoff between susceptibility, signal-noise-ratio and distance to the center of the laser spot. Conclusion: For tissue thickness correlated feature acquisition, the medial ROIs with the ‘inBeam’-setup provide most valuable features This work was supported by Varian Medical Systems Inc. (Palo Alto, CA, USA). In addition, this work was supported by the Graduate School for Computing in Medicine and Life Sciences funded by Germany's Excellence Initiative [DFG GSC 235/1].

  3. Central pathology laboratory review of HER2 and ER in early breast cancer: an ALTTO trial [BIG 2-06/NCCTG N063D (Alliance)] ring study.

    Science.gov (United States)

    McCullough, Ann E; Dell'orto, Patrizia; Reinholz, Monica M; Gelber, Richard D; Dueck, Amylou C; Russo, Leila; Jenkins, Robert B; Andrighetto, Stefania; Chen, Beiyun; Jackisch, Christian; Untch, Michael; Perez, Edith A; Piccart-Gebhart, Martine J; Viale, Giuseppe

    2014-02-01

    Choice of therapy for breast cancer relies on human epidermal growth factor receptor-2 (HER2) and estrogen receptor α (ER) status. Before randomization in the phase III Adjuvant Lapatinib and/or Trastuzumab Treatment Optimisation (ALTTO) trial for HER2-positive disease, HER2 and ER were centrally reviewed by Mayo Clinic (Rochester, MN, and Scottsdale, AZ) for North America and by the European Institute of Oncology (IEO; Milan, Italy) for the rest of world (except China). Discordance rates (local vs. central review) differed between Mayo and IEO. Among locally HER2-positive cases, 5.8 % (Mayo) and 14.5 % (IEO) were centrally HER2 negative. Among locally ER-positive cases, 16.2 % (Mayo) and 4.2 % (IEO) were centrally ER-negative. Among locally ER-negative cases, 3.4 % (Mayo) and 21.4 % (IEO) were centrally ER-positive. We, therefore, performed a ring study to identify features contributing to these differing discordance rates. Mayo and IEO exchanged slides for 25 HER2 and 35 ER locally/centrally discordant cases. Both laboratories performed IHC and FISH for HER2 using the HercepTest(®) and PathVysion HER2 DNA probe kit/HER2/centromere 17 probe mixture. IHC for ER was tested centrally using the monoclonal ER 1D5 antibody (Mayo) or the DAKO cocktail of ER 1D5 and 2.123 antibodies (IEO). Mayo and IEO confirmed the central HER2-negative result in 100 % of 25 cases. Mayo and IEO confirmed the central ER result in 29 (85 %) of 34 evaluable cases. The five Mayo-negative/IEO-positive cases were ER-positive when retested at Mayo using the DAKO ER cocktail. In this ring study, ALTTO ineligibility did not change when HER2 testing was performed by either IEO or Mayo central laboratories. However, a dual antibody ER assay had fewer false-negative test results than an assay with a single antibody, and there was more discordance between the two ER reagents than has been previously reported. Using even slightly different assay methods yielded different results, even between experienced central laboratories.

  4. WE-FG-206-06: Dual-Input Tracer Kinetic Modeling and Its Analog Implementation for Dynamic Contrast-Enhanced (DCE-) MRI of Malignant Mesothelioma (MPM)

    Energy Technology Data Exchange (ETDEWEB)

    Lee, S; Rimner, A; Hayes, S; Hunt, M; Deasy, J; Zauderer, M; Rusch, V; Tyagi, N [Memorial Sloan Kettering Cancer Center, New York, NY (United States)

    2016-06-15

    Purpose: To use dual-input tracer kinetic modeling of the lung for mapping spatial heterogeneity of various kinetic parameters in malignant MPM Methods: Six MPM patients received DCE-MRI as part of their radiation therapy simulation scan. 5 patients had the epitheloid subtype of MPM, while one was biphasic. A 3D fast-field echo sequence with TR/TE/Flip angle of 3.62ms/1.69ms/15° was used for DCE-MRI acquisition. The scan was collected for 5 minutes with a temporal resolution of 5-9 seconds depending on the spatial extent of the tumor. A principal component analysis-based groupwise deformable registration was used to co-register all the DCE-MRI series for motion compensation. All the images were analyzed using five different dual-input tracer kinetic models implemented in analog continuous-time formalism: the Tofts-Kety (TK), extended TK (ETK), two compartment exchange (2CX), adiabatic approximation to the tissue homogeneity (AATH), and distributed parameter (DP) models. The following parameters were computed for each model: total blood flow (BF), pulmonary flow fraction (γ), pulmonary blood flow (BF-pa), systemic blood flow (BF-a), blood volume (BV), mean transit time (MTT), permeability-surface area product (PS), fractional interstitial volume (vi), extraction fraction (E), volume transfer constant (Ktrans) and efflux rate constant (kep). Results: Although the majority of patients had epitheloid histologies, kinetic parameter values varied across different models. One patient showed a higher total BF value in all models among the epitheloid histologies, although the γ value was varying among these different models. In one tumor with a large area of necrosis, the TK and ETK models showed higher E, Ktrans, and kep values and lower interstitial volume as compared to AATH and DP and 2CX models. Kinetic parameters such as BF-pa, BF-a, PS, Ktrans values were higher in surviving group compared to non-surviving group across most models. Conclusion: Dual-input tracer kinetic modeling is feasible in determining micro-vascular characteristics of MPM. This project was supported from Cycle for Survival and MSK Imaging and radiation science (IMRAS) grants.

  5. 30 CFR 206.52 - How do I calculate royalty value for oil that I or my affiliate sell(s) or exchange(s) under an...

    Science.gov (United States)

    2010-07-01

    ...) In some cases the seller may apply timely for a price increase or benefit allowed under the oil sales... value the oil using the NYMEX price, adjusted for applicable location and quality differentials under... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How do I calculate royalty value for oil that I...

  6. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    Energy Technology Data Exchange (ETDEWEB)

    Koziorowski, J

    1998-10-01

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on {sup 211}At and {sup 124}I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[{sup 211}At]astato-2`-deoxyuridine (AUdR) and N-succinimidyl-4-[{sup 211}At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [{sup 124}I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[{sup 124}I]iodo-2`-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for

  7. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...

  8. INFLUENCE OF SINTERING TEMPERATURE ON THE POLARIZATION RESISTANCE OF LaO20.6SrO20.4CoO20.2FeO20.8O3-δ - SDC CARBONATE COMPOSITE CATHODE

    Directory of Open Access Journals (Sweden)

    Nurul Akidah Baharuddin

    2016-05-01

    Full Text Available The effects of sintering temperature of an LSCF-samarium-doped ceria carbonate (SDCC cathode composite film on its polarization resistance (Rp were evaluated in this study. An LSCF-SDCC composite cathode was prepared for cathode film development by electrophoretic deposition (EPD. The LSCF-SDCC composite cathode was prepared at 50:50 weight percentage ratio. An EPD suspension which is based on an organic aqueous solution was used, and a mixture of ethanol and deionized water was used as medium with poly diallyl dimethyl ammonium chloride (PDADMAC as a dispersing agent. SDCC substrate was used, and EPD was performed on both sides. A symmetrical cell with cathode composite LSCF-SDCC films on both sides of the substrate was subjected to sintering at five different temperatures (from 550°C to 750°C. A symmetrical cell was painted using silver paste before undergoing electrochemical performance test (air condition, in which the impedance, Z data, was measured. The effects of sintering temperature change on element content and film porosity were first investigated by energy-dispersive X-ray spectroscopy, field emission scanning electron microscopy, and J-image analysis. Ceramic-based cathode LSCF-SDCC that was sintered at 600°C exhibited the lowest Rp at a value of 0.68 Ω when operated at 650°C. This study proved that EPD has potential in developing IT-LT solid oxide fuel cell cathode components with high electrochemical performance in terms of Rp values.

  9. On the structure and optical band gap in some (PbO)x(BaO)0.3-x(ZnO)0.1(TeO2)0.6 glasses

    Czech Academy of Sciences Publication Activity Database

    Tichá, H.; Tichý, Ladislav

    2015-01-01

    Roč. 9, 7-8 (2015), s. 951-955 ISSN 1842-6573 Institutional support: RVO:61389013 Keywords : optical properties * oxide glasses * Raman spectroscopy Subject RIV: CA - Inorganic Chemistry Impact factor: 0.412, year: 2015 http://oam-rc.inoe.ro/index.php?option=magazine&op=view&idu=2643&catid=91

  10. Review Plan Using the NWD Model Review Plan for Continuing Authorities Program Section 14, 107, 111, 204, 206, 208, 1135 and Projects Directed by Guidance to Use CAP Procedures: Sheridan, Wyoming, Section 1135 Project

    Science.gov (United States)

    2014-12-19

    Approval Status HEC - RAS 4.1 HEC - RAS is designed to perform one-dimensional hydraulic calculations for a full network of natural and constructed...channels. The HEC - RAS system contains four one-dimensional river analysis components for: (1) steady flow water surface profile computations; (2

  11. Thermosalinograph data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 Miles North of Oahu, Hawaii for Cruises HOT199-206 during 2008 (NCEI Accession 0059943)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  12. MENDONÇA, F.; DANNI-OLIVEIRA, I. M. Climatologia: noções básicas e climas do Brasil. São Paulo: Oficina de Texto, 2007. 206 p.

    Directory of Open Access Journals (Sweden)

    ELIS DENER LIMA ALVES

    2010-12-01

    Full Text Available Com o intuito de encerrar a carência de uma obra escrita por pesquisadores brasileiros, que tivesse maior enfoque nas características da atmosfera do país, foi que Mendonça e Danni-Oliveira elaboraram o livro: Climatologia: Noções básicas e climas do Brasil.

  13. Niskin bottle data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 Miles North of Oahu, Hawaii for Cruises HOT199-206 during 2008 (NODC Accession 0059936)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  14. Dollar Summary of Federal Supply Classification and Service Category by Company. Section 3: Other Services and Construction. Fiscal Year 1993. (S206 Guard Services, Acid Protection Associates-Z300 Restoration Activities). Part 5

    Science.gov (United States)

    1994-03-01

    a Ww)I LAC.W44CD 011 0 0 F-1LaUx -j A u wInx j (7) 0 DUC cam Z.- x 0 u9-ml~ww>1(01>0))( -9- X- F- C ( uZ U- I-- tu 0 a ’-. 0 -0 <kWW...1 -t (D 1- -- 001 P- -; a GO X <LLWNZ - u)LLɘ ’-.- CL - (.D D Liicn - *-Li- I 00 -J WInx LiJw.J 01- .- .C 0 0) ox0oE )d~ x Wo0E c0In <mmE ý-0Inzcw

  15. Eficacia de los criterios de identificación del hormigón en la normativa europea (EN 206 y la reglamentación española (EHE-08

    Directory of Open Access Journals (Sweden)

    Revuelta, D.

    2015-12-01

    Full Text Available European and Spanish regulations establish a series of conformity and acceptance criteria for concrete, as well as identity testing. The effectiveness of the first ones has been sufficiently studied by means of Operative Control Curves that provide the probability of acceptance or rejection of conforming concrete. However, it is not possible to find similar studies in the literature about the effectiveness of the identity criteria, despite their relevance in the decision making process for the manufacturer, the authorities and the consumer. In this paper the authors, using Monte Carlo simulation, have investigated the effectiveness of the European and Spanish identity criteria by obtaining curves with the probability of identifying unsolicited concrete and the probability of rejecting a conforming concrete when applying the criteria.La normativa europea y la reglamentación española establecen una serie de criterios de conformidad y aceptación para el hormigón, así como para la identificación del producto servido. La eficacia de los primeros ha sido suficientemente estudiada mediante el análisis de las Curvas Operativas de Control, que proporcionan la probabilidad de aceptación o rechazo de hormigones conformes. Sin embargo no es posible encontrar en la bibliografía trabajos similares sobre la eficacia de los criterios de identificación, a pesar de la importancia que tienen en la toma de decisiones para el fabricante, el legislador y el consumidor. En este trabajo los autores, empleando la simulación de Monte Carlo, han investigado la eficacia de los criterios de identificación europeos y españoles trazando las curvas de probabilidad de identificación de un hormigón no conforme con lo solicitado, y de la probabilidad de rechazo de un hormigón conforme al aplicar estos criterios.

  16. CTD data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 Miles North of Oahu, Hawaii for Cruises HOT199-206 during 2008 (NODC Accession 0059842)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  17. AVALIAÇÃO DA RESISTÊNCIA EM POPULAÇÃO F3 ORIUNDA DO CRUZAMENTO CNC-0434 X IPA-206 DE FEIJÃO-CAUPI AO MOSAICO SEVERO

    Directory of Open Access Journals (Sweden)

    ERLEN KEILA CANDIDO E SILVA

    2012-01-01

    Full Text Available In the Northeastern part of Brazil, the mosaics caused by viruses, emerge as the most important diseases for the cowpea, thus becoming a limiting factor of production. Genetic resistance has been considered as the best alternative of controlling Cowpea severe mosaic virus. Thus, the aim was to evaluate the F3 population behavior developed for the resistance against different isolated CPSMV collected from different areas of cultivation. Leaf samples presenting cowpea mosaic symptoms were collected from plantations from the states of Pernambuco and Paraiba. There was inoculation on susceptible cultivars of cowpea kept in house vegetation. The isolates were also diagnosed by reactions RT-PCR using specific primers. Of the 185 F3 plants inoculated 183 plants were resistant to different isolates of CPSMV.

  18. ORF Alignment: NC_005071 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available h = 206 ... Query: 82 ... FDEISDALAAIRNGECXXXXXXXXXXNEGDLICAAQFATPEQINFMATEARGLICLAMQG 141 ... FDEISDALAAI...RNGEC ... NEGDLICAAQFATPEQINFMATEARGLICLAMQG Sbjct: 1 ... FDEISDALAAIRNGECVVVVDDERRENEGDLICAAQFATPEQINFMATEA

  19. Gene : CBRC-MDOM-06-0145 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available dm.206 /len=927 0.005 20% MYIYIHIYTNTYIHLFFSLSLTFPLPLSLSLSLYIYIYIYIFPSLSLPPFLFPLPFYLSISLSCFLLPFFHPVFFTF...LCLSLSLCLSVSLPLPLSLSLSLSLSLSLYIYIYIYIYIFPLSFPFSFLSLSISFCLVFSFRFFHSVFFTFLSVSVCLSVSPTSLS...LSLSLSLSIYIYIYIYIFLSFSLSLSLLSLFLPLSISLSCFLIPFFLLFFTFLSVCLSASPSLSLSLSLSLSIYIYIYIYIYISLSLSLSLFSLSLSISLHLSQSYFLLPFFPLLSSLHFYLSVCLSASLPSYLAPFDIPLVNYVACSYFIF ...

  20. ORF Alignment: NC_005125 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GRVIAEHRGSYGVATEMGEVAAAVSGRLRHAARGPADFPAVGDWVVLERRELPGHGLIQA 60 ... Query: 147 VLNKADVCSELEKRVQXXXXXXXXXXXXXXXX...XXXXXXXXXXWLTPGRTVALLGSSGVGK 206 ... VLNKADVCSELEKRVQ ... WLTPGRTVALLGSSGVGK Sbjct: 121 VLNKADVCSEL

  1. ORF Alignment: NC_006177 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 4863] ... Length = 206 ... Query: 142 GDHPAMQRLKEQALRAAATDSPVLVYGETGTGKELLVHA...IHAASPRRHRPLVAQNCAALP 201 ... GDHPAMQRLKEQALRAAATDSPVLVYGETGTGKELLVHAIHAASPRRHRPLVAQNCAALP Sbjct: 1 ... GDHPAM

  2. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    Directory of Open Access Journals (Sweden)

    Ali BAYRAM

    1998-03-01

    Full Text Available In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 10, 50 and 259 mm/min. Strength properties of dual-phase steels were investigated depending on annealing temperature, ratio of martensite and loading rate.

  3. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  4. Nuclear and in-source laser spectroscopy with the ISAC yield station

    Energy Technology Data Exchange (ETDEWEB)

    Kunz, Peter, E-mail: pkunz@triumf.ca; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning [TRIUMF, 4004 Wesbrook Mall, Vancouver, British Columbia V6T 2A3 (Canada); Andreoiu, Corina; Wong, Fiona [Department of Chemistry, Simon Fraser University, Burnaby, British Columbia V5A 1S6 (Canada)

    2014-05-15

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10{sup 11} ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of {sup 46}K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  5. Nuclear and in-source laser spectroscopy with the ISAC yield station.

    Science.gov (United States)

    Kunz, Peter; Andreoiu, Corina; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning; Wong, Fiona

    2014-05-01

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10(11) ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of (46)K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  6. Radiopharmaceutical chemistry of targeted radiotherapeutics, part 4: Strategies for211At labeling at high activities and radiation doses of211At α-particles.

    Science.gov (United States)

    Pozzi, Oscar R; Zalutsky, Michael R

    2017-03-01

    Alpha particles are radiation of high energy and short range, properties that can lead to radiolysis-mediated complications in labeling chemistry at the high radioactivity levels required for clinical application. In previous papers in this series, we have shown that radiation dose has a profound effect on the astatine species that are present in the labeling reaction and their suitability for the synthesis of N-succinimidyl 3-[ 211 At]astatobenzoate. The purpose of this study was to evaluate the effects of adding N-chlorosuccinimide (NCS) to the methanol solution used for initial isolation of 211 At after distillation, a process referred to as 211 At stabilization, on 211 At chemistry after exposure to high radiation doses. High performance liquid chromatography was used to evaluate the distribution of 211 At species present in methanol in the 500-65,000Gy radiation dose range and the synthesis of SAB from N-succinimidyl 3-(tri-n-butylstannyl)benzoate in the 500-120,000Gy radiation dose range using different 211 At timeactivity combinations under conditions with/without 211 At stabilization. In the absence of NCS stabilization, a reduced form of astatine, At(2), increased with increasing radiation dose, accounting for about half the total activity by about 15,000Gy, while with stabilization, At(2) accounted for 60,000Gy. SAB yields without stabilization rapidly declined with increasing dose, falling to ~20% at about 5000Gy while with stabilization, yields >80% were obtained with 211 At solutions stored for more than 23h and receiving radiation doses >100,000Gy. Adding NCS to the methanol solution used for initial isolation of 211 At is a promising strategy for countering the deleterious effects of radiolysis on 211 At chemistry. This strategy could facilitate the ability to perform 211 At labeling at sites remote from its production and at the high activity levels required for clinical applications. Copyright © 2016 Elsevier Inc. All rights reserved.

  7. Gclust Server: 164757 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Bsu_BSU24380=spoIIIAF Cluster Sequences - 206 mutants block sporulation after engulfment (stage III sporulation)...Sequence length 206 Representative annotation mutants block sporulation after engulfment (stage III sporulation)

  8. Gclust Server: 95938 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available m00182 Cluster Sequences Related Sequences(206) 454 Josephin family protein chr_0_8254459_67; no annotation...Sequences(206) Sequence length 454 Representative annotation Josephin family protein chr_0_8254459_67; no annotation

  9. Gclust Server: 197605 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 197605 DME_CG13695_17977702 Cluster Sequences - 206 gk: geko CG13695-PB 1 1.00e-99 ...ences Cluster Sequences Link to related sequences - Sequence length 206 Representative annotation gk: geko C

  10. Gene : CBRC-MDOM-11-0075 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 39859 /gi=89886377 /ug=Mdm.206 /len=927 3e-05 22% MISSELIFGVAFFFQCAIGIVGNSLLLVLYVCIAFKKPQEKKPMDLILAHLTVANM...ATLFTRGIPEIMFCIGMRNVLNDLGCKVVMYIYRISRGFSVCTTSLLSMFQAIIISPNNSVWAMIKVKAHKYILHCFLFFCVT

  11. Using stable lead isotopes to trace heavy metal contamination sources in sediments of Xiangjiang and Lishui Rivers in China.

    Science.gov (United States)

    Sun, Guo-Xin; Wang, Xin-Jun; Hu, Qin-Hong

    2011-12-01

    Lead isotopes and heavy metal concentrations were measured in two sediment cores sampled in estuaries of Xiangjiang and Lishui Rivers in Hunan province, China. The presence of anthropogenic contribution was observed in both sediments, especially in Xiangjiang sediment. In the Xiangjiang sediment, the lower (206)Pb/(207)Pb and higher (208)Pb/(206)Pb ratio, than natural Pb isotope signature (1.198 and 2.075 for (206)Pb/(207)Pb and (208)Pb/(206)Pb, respectively), indicated a significant input of non-indigenous Pb with low (206)Pb/(207)Pb and high (208)Pb/(206)Pb. The corresponding concentrations of heavy metals (As, Cd, Zn, Mn and Pb) were much higher than natural values, suggesting the contaminations of heavy metals from extensive ore-mining activities in the region. Copyright © 2011 Elsevier Ltd. All rights reserved.

  12. Variation in plant performance in a grassland: species-specific and neighbouring root mass effects

    Czech Academy of Sciences Publication Activity Database

    Herben, Tomáš; Březina, Stanislav; Skálová, Hana; Hadincová, Věroslava; Krahulec, František

    2007-01-01

    Roč. 18, - (2007), s. 55-62 ISSN 1100-9233 R&D Projects: GA ČR GA206/02/0578; GA ČR GA206/02/0953; GA ČR GA206/06/0098 Institutional research plan: CEZ:AV0Z60050516 Keywords : Competion * Above-ground * Belowground Subject RIV: EF - Botanics Impact factor: 2.251, year: 2007

  13. Dicty_cDB: Contig-U14936-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gene fo... 227 9e-58 B71196( B71196 ) probable transitional endoplasmic reticulum ATPas... 226 1e-57 EU188624_3(...Patent WO2008... 206 1e-51 (Q7KN62) RecName: Full=Transitional endoplasmic reticulum ATPase... 206 2e-51 CP000968_194(...AF047037_1( AF047037 |pid:none) Drosophila melanogaster transition... 206 2e-51 BA000023_415( BA000023 |pid:none)

  14. ORF Alignment: NC_002771 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002771 gi|15828599 >1jsxA 2 206 1 206 8e-25 ... ref|NP_325959.1| GLUCOSE INHIBITED DIVISIO...N PROTEIN B [Mycoplasma pulmonis UAB CTIP] ... emb|CAC13301.1| GLUCOSE INHIBITED DIVISION PRO...TEIN B ... [Mycoplasma pulmonis] pir||H90527 glucose inhibited ... division protein b [importe...transferase ... gidB (Glucose inhibited division protein B) ... Length = 206 ... Query: 1 ... MNCLE

  15. ORF Alignment: NC_005042 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available us str. CCMP1375] ... Length = 206 ... Query: 11 ... FDQIADALAAIRNGECVVVVDDESRENEGDLICAAQFATPQQINFMATEA...RGLICLAMDG 70 ... FDQIADALAAIRNGECVVVVDDESRENEGDLICAAQFATPQQINFMATEARGLICLAMDG... Sbjct: 1 ... FDQIADALAAIRNGECVVVVDDESRENEGDLICAAQFATPQQINFMATEARGLICLAMDG 60 ... Query: 131 LRRPGHVFPLRANKGGVLKR

  16. C2-rational cubic spline involving tension parameters

    Indian Academy of Sciences (India)

    iИ1 ИfЕ122Y 128Ж; Е122Y 156Ж; Е150Y 184Ж; Е178Y 184Ж;. Е206Y 156Ж; Е206Y 128Ж; Е178Y 100Ж; Е150Y 100Ж;. Е122Y 72Ж; Е122Y 44Ж; Е150Y 16Ж; Е178Y 16Ж;. Е206Y 44Ж; Е206Y 72ЖgY we obtain the C2-rational cubic spline interpolant. Thus for different values of the tension parameters r and t, ...

  17. ORF Alignment: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available PPDLGPSTFKLVRFNEVEVDG Sbjct: 1 ... KTFFIDQTRCTACRGCQAACKQWKKFGSIETRNTGSYQNPPDLGPSTFKLVRFNEVEVDG 60 ... Query: 147 DIPRQDPATGLLTKCNMCID...RVQNGMLPACVKTCPTGTMHFGDRADMLELAQKRLGEVKK 206 ... DIPRQDPATGLLTKCNMCID...RVQNGMLPACVKTCPTGTMHFGDRADMLELAQKRLGEVKK Sbjct: 121 DIPRQDPATGLLTKCNMCIDRVQNGMLPACVKTCPTGTMHFGDRADMLELAQKRLGEVKK 180 ...

  18. ORF Alignment: NC_000911 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available CC 6803) ... Length = 206 ... Query: 91 ... GTLRLGCSVLFGEMQIVPRLSLFIARYPQVKIDLMMAD...YFVDMVQEGLDLAIRIGNHQDK 150 ... GTLRLGCSVLFGEMQIVPRLSLFIARYPQVKIDLMMADYFVDMVQEGLDLAIRIGNHQDK Sbjct: ...1 ... GTLRLGCSVLFGEMQIVPRLSLFIARYPQVKIDLMMADYFVDMVQEGLDLAIRIGNHQDK 60 ... Query: 211 INVKGSFQTNSSVAVRAAVLSDLGIAIA

  19. Gene : CBRC-MDOM-01-0560 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available gb=NM_001039859 /gi=89886377 /ug=Mdm.206 /len=927 7e-04 23% MYIYLSVCLSIYLSVCLSVCLCLYLSIYLSISIICLSI...SICLSLPVHLSLCLSVCLSLSIYISICLSVYLSVCLSIYLSVCLSVYLSVCLCLYLSIYLSISIICLSISICLSLPVYLSVCLSVSLSIYI...SICLFVYLSVCLSLSIYISICLSVYLSICLSICLSLSVYLSIYLSISIICLSISICLSLSIYLSVCLSVYLSVCLSVYISICLSLSIYPSIYPSLLSVSLYLSVCLCLSICLSVCLSTYLSVCLSI...YLSVCLCLSIHLSIHLYYLSLSLSVSICLSICLSVCLSICLSVSVSVYLSIYISISIICLYLS...VCLYLSIYLPVSLSLSIYMSVCLSVCLSVCLSIYLSVCLSVYLTYASEPKFGFWGVCFNLEGEGAPYFIVFVLIAPFRISSRHFRIWLVSKSL ...

  20. 42 CFR Appendix A to Part 81 - Glossary of ICD-9 Codes and Their Cancer Descriptions 1

    Science.gov (United States)

    2010-10-01

    ... leukemia 205 Myeloid leukemia. 206 Monocytic leukemia. 207 Other specified leukemia. 208 Leukemia of unspecified cell type. 1 The International Classification of Diseases Clinical Modification (9th Revision...