WorldWideScience

Sample records for astatine 206

  1. Radiochemistry of astatine

    International Nuclear Information System (INIS)

    Ruth, T.J.; Dombsky, M.; D'Auria, J.M.; Ward, T.E.

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs

  2. Formation and decomposition of astatine molecules

    International Nuclear Information System (INIS)

    Takahashi, Naruto; Ishikuro, Mituhiro; Baba Hiroshi

    1989-01-01

    A method determining the boiling points of elementary astatine and astatine iodide has been developed (K. Otozai and N. Takahashi, Radio. Chim. Acta 31, (1982) 201). Further, it was concluded from the simple rule among the boiling point of elementary halogens and interhalogen compounds that elementary astatine might exist in diatomic molecules as the other halogens. In the present work the reaction mechanisms of elementary astatine with radioactive iodine and organic solvents were studied by means of radiogaschromatography in order to obtain further experimental evidences for diatomic astaine molecules. The following conclusions were obtained by the analysis of reaction kinetics. Two astatine atoms are lost from the elementary astatine fraction per each radioactive decay of astatine. The astatine radical or hot atom liberated by the decay of the complementary astatine atom immediately reacts with iodine or organic solvents. Thus formed astatine compounds decompose in turn due to the decay of astatine

  3. Organic astatine compounds, their preparation and properties

    Energy Technology Data Exchange (ETDEWEB)

    Vasaros, L; Berei, K

    1985-01-01

    Aromatic astatine compounds of possible medical application were prepared by high energy substitutions, by astatine-halogen, and by electrophil astatine-hydrogen substitutions at the Joint Institute of Nuclear Researches, Dubna. Physico-chemical properties of organic astatine compounds such as boiling point and evaporation heat, and the refraction and dissociation energy of carbon-astatine bonds were determined experimentally by gas chromatography. The results are compared with extrapolated data. (V.N.). 41 refs.; 7 figs.; 5 tables.

  4. Bibliography of astatine chemistry and biomedical applications

    International Nuclear Information System (INIS)

    Berei, K.; Vasaros, L.

    1992-02-01

    An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211 At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)

  5. Recent advances in the organic chemistry of astatine

    International Nuclear Information System (INIS)

    Berei, K.; Vasaros, L.

    1994-03-01

    Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211 At species, 211 At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs

  6. Experimental and computational evidence of halogen bonds involving astatine

    Science.gov (United States)

    Guo, Ning; Maurice, Rémi; Teze, David; Graton, Jérôme; Champion, Julie; Montavon, Gilles; Galland, Nicolas

    2018-03-01

    The importance of halogen bonds—highly directional interactions between an electron-deficient σ-hole moiety in a halogenated compound and an acceptor such as a Lewis base—is being increasingly recognized in a wide variety of fields from biomedicinal chemistry to materials science. The heaviest halogens are known to form stronger halogen bonds, implying that if this trend continues down the periodic table, astatine should exhibit the highest halogen-bond donating ability. This may be mitigated, however, by the relativistic effects undergone by heavy elements, as illustrated by the metallic character of astatine. Here, the occurrence of halogen-bonding interactions involving astatine is experimentally evidenced. The complexation constants of astatine monoiodide with a series of organic ligands in cyclohexane solution were derived from distribution coefficient measurements and supported by relativistic quantum mechanical calculations. Taken together, the results show that astatine indeed behaves as a halogen-bond donor—a stronger one than iodine—owing to its much more electrophilic σ-hole.

  7. The reaction of astatine with aromatic diazonium compounds

    International Nuclear Information System (INIS)

    Visser, G.W.M.; Diemer, E.L.

    1982-01-01

    Astatine reacts prefrentially with that type of aromatic diazonium salt that decomposes via a radical reaction channel (homolytic breakage of the C-N bond). The dediazonation with p-aminobenzoic acid and p-toluidine as model compounds was investigated through estatin produced in the 209 Bi(α,2n) 211 At reaction. (author)

  8. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    Science.gov (United States)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Köster, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjödin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine. PMID:23673620

  9. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...... vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....

  10. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single...... to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3......-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison...

  11. Some aspects of the organic, biological and inorganic chemistry of astatine

    International Nuclear Information System (INIS)

    Visser, G.W.M.

    1982-01-01

    Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments ( 209 At, 210 At, 211 At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)

  12. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    International Nuclear Information System (INIS)

    Sjoestroem, A.; Carlsson, J.; Lundqvist, H.; Koziorowski, J.

    2003-01-01

    A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)

  13. Estimation of the chemical form and the boiling point of elementary astatine by radiogas-chromatography

    International Nuclear Information System (INIS)

    Otozai, K.; Takahashi, N.

    1982-01-01

    After astatine (0) was mixed with 131 I 2 containing carrier I 2 , the sample was analyzed by means of radiogaschromatography and the peaks due to I 2 , AtI and At 2 were observed. Further, the boiling points were estimated from the retention volume in terms of the semi-empirical theory on gas chromatography. The boiling points of I 2 , AtI and At 2 were 457 +- 2,486 +- 2 and 503 +- 3K, respectively. The boiling point of At 2 obtained in the present work is far smaller than that expected by the extrapolation of lighter halogens. (orig.)

  14. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    Czech Academy of Sciences Publication Activity Database

    Sjostrom, A.; Tolmachev, V.; Lebeda, Ondřej; Koziorowski, J.; Carlsson, J.; Lundqvist, H.

    2003-01-01

    Roč. 256, č. 7 (2003), s. 191-197 ISSN 0236-5731 R&D Projects: GA AV ČR KSK4055109 Keywords : neutron-capture therapy * astatine-211 Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.472, year: 2003

  15. 211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    Pruszynski, M.; Bilewicz, A.

    2006-01-01

    211 At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211 At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At - to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh 3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At - anions, but first of all because of the kinetic inertness of low spin rhodium(III) d 6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh 3+ . The experiments related to optimization of the reaction conditions were performed with the 131 I, basing on a chemical similarity of I - to At - . The experiments with 211 At were then carried out under the conditions found optimal for I - . The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211 At-Rh(16-S4-diol) complex

  16. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  17. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  18. Thermogravimetric determination of the enthalpy of astatine and radon adsorption on palladium surfaces

    International Nuclear Information System (INIS)

    Eichler, B.; Son Chun, K.

    1985-01-01

    In order to investigate the adsorption of astatine and radon on a palladium surface some on- and off-line thermochromatographic experiments were carried out with 210 At and 220 Rn tracers. The partial molar adsorption enthalpy for zero covering was found to be ΔH/sub a//sup 0, loc./(At) = -(15S +- 10) kJ mole -1 and ΔH/sub a//sup 0, mob./(Rn) = -(37 +- 4) kJ mole -1 . The results are compared with theoretical and experimental values for other elements of the sixth period. The adsorption behaviour of At is in conformity with that of the p-metals on a palladium surface. (author)

  19. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  20. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    International Nuclear Information System (INIS)

    Lahiri, Susanta; Roy, Kamalika; Sen, Souvik

    2008-01-01

    No-carrier-added astatine radionuclides produced in the 7 Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about ∼12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h

  1. Astatine-211 Radiochemistry: The Development Of Methodologies For High Activity Level Radiosynthesis

    International Nuclear Information System (INIS)

    Zalutsky, Michael R.

    2012-01-01

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for α-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the α-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At-labeled targeted

  2. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  3. Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

    CERN Document Server

    Andreyev, Andrei

    2013-01-01

    Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

  4. In vitro evaluation of the astatinated chimeric monoclonal antibody U36, a potential candidate for treatment of head and neck squamous cell carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Nestor, M.; Anniko, M. [Uppsala University, Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala (Sweden); Persson, M. [Uppsala University, Unit of Urology, Department of Surgical Sciences, Uppsala (Sweden); Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden); Dongen, G.A.M.S. van [Vrije Universiteit Medical Center, Department of Otolaryngology/Head and Neck Surgery, Amsterdam (Netherlands); Jensen, H.J. [Righshospitalet, PET and Cyclotron Unit, Department of Clinical Physiology and Nuclear Medicine, Copenhagen (Denmark); Lundqvist, H.; Tolmachev, V. [Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden)

    2005-11-01

    The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with {sup 211}At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with {sup 125}I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with {sup 131}I-labelled cMAb U36 (directly labelled). Comparisons between {sup 211}At-cMAb U36 and {sup 125}I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31{+-}2% vs 42.6{+-}1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for {sup 211}At-cMAb U36, with about 10% cell survival at 50 decays per cell. The {sup 131}I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)

  5. In vitro evaluation of the astatinated chimeric monoclonal antibody U36, a potential candidate for treatment of head and neck squamous cell carcinoma

    International Nuclear Information System (INIS)

    Nestor, M.; Anniko, M.; Persson, M.; Dongen, G.A.M.S. van; Jensen, H.J.; Lundqvist, H.; Tolmachev, V.

    2005-01-01

    The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with 211 At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with 125 I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with 131 I-labelled cMAb U36 (directly labelled). Comparisons between 211 At-cMAb U36 and 125 I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31±2% vs 42.6±1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for 211 At-cMAb U36, with about 10% cell survival at 50 decays per cell. The 131 I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)

  6. High-efficiency astatination of antibodies using N-iodosuccinimide as the oxidising agent in labelling of N-succinimidyl 3-(trimethylstannyl)benzoate

    International Nuclear Information System (INIS)

    Lindegren, S.; Andersson, H.; Baeck, T.; Jacobsson, L.; Karlsson, B.; Skarnemark, G.

    2001-01-01

    Monoclonal antibodies C215, reactive with colorectal carcinomas, and MOv18, reactive with most of the ovarian carcinomas, were radiohalogenated with [ 211 At]astatine. The radiohalogen was conjugate coupled to antibodies via the intermediate labelling reagent N-succinimidyl-3-(trimethylstannyl)benzoate (m-MeATE) in a two-step, single-pot reaction. Optimisation of the labelling of the reagent was achieved using N-iodosuccinimide, NIS, as the oxidising agent. The yields ranged from 69-95% in the labelling of 0.1-1.0 nmole of the m-MeATE precursor. Subsequent conjugation to antibodies resulted in yields of 58±7%. In vitro binding to tumour cells showed that the immunoreactivity of both antibodies was retained after astatine labelling

  7. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  8. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    International Nuclear Information System (INIS)

    Rothe, Sebastian

    2012-01-01

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  9. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  10. Radiobiological Effects of Alpha-Particles from Astatine-211: From DNA Damage to Cell Death

    Energy Technology Data Exchange (ETDEWEB)

    Claesson, Kristina

    2011-05-15

    In recent years, the use of high linear energy transfer (LET) radiation for radiotherapeutic applications has gained increased interest. Astatine-211 (211At) is an alpha-particle emitting radionuclide, promising for targeted radioimmunotherapy of isolated tumor cells and microscopic clusters. To improve development of safe radiotherapy using 211At it is important to increase our knowledge of the radiobiological effects in cells. During radiotherapy, both tumors and adjacent normal tissue will be irradiated and therefore, it is of importance to understand differences in the radio response between proliferating and resting cells. The aim of this thesis was to investigate effects in fibroblasts with different proliferation status after irradiation with alpha-particles from 211At or X-rays, from inflicted DNA damage, to cellular responses and biological consequences. Throughout this work, irradiation was performed with alpha-particles from 211A or X-rays. The induction and repair of double-strand breaks (DSBs) in human normal fibroblasts were investigated using pulsed-field gel electrophoresis and fragment analysis. The relative biological effectiveness (RBE) of 211At for DSB induction varied between 1.4 and 3.1. A small increase of DSBs was observed in cycling cells compared to stationary cells. The repair kinetics was slower after 211At and more residual damage was found after 24 h. Comparison between cells with different proliferation status showed that the repair was inefficient in cycling cells with more residual damage, regardless of radiation quality. Activation of cell cycle arrests was investigated using immunofluorescent labeling of the checkpoint kinase Chk2 and by measuring cell cycle distributions with flow cytometry analysis. After alpha-particle irradiation, the average number of Chk2-foci was larger and the cells had a more affected cell cycle progression for several weeks compared with X-irradiated cells, indicating a more powerful arrest after 211At

  11. 24 CFR 206.17 - General.

    Science.gov (United States)

    2010-04-01

    ... CONVERSION MORTGAGE INSURANCE Eligibility; Endorsement Eligible Mortgages § 206.17 General. (a) Payment... option (§ 206.19(b)), or the line of credit payment option (§ 206.19(c)), or a combination as provided in...

  12. 48 CFR 1417.206 - Evaluation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Evaluation. 1417.206 Section 1417.206 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 1417.206 Evaluation. The determination in FAR 17.206(b...

  13. 24 CFR 206.19 - Payment options.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Payment options. 206.19 Section 206... CONVERSION MORTGAGE INSURANCE Eligibility; Endorsement Eligible Mortgages § 206.19 Payment options. (a) Term payment option. Under the term payment option, equal monthly payments are made by the mortgagee to the...

  14. 14 CFR 206.1 - Emergency transportation.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Emergency transportation. 206.1 Section 206.1 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS... EXEMPTIONS § 206.1 Emergency transportation. Notwithstanding the provisions of section 41101 of the Statute...

  15. 19 CFR 206.52 - Monitoring.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Monitoring. 206.52 Section 206.52 Customs Duties... Monitoring; Advice As to Effect of Extension, Reduction, Modification, or Termination of Relief Action § 206.52 Monitoring. (a) In general. As long as any import relief imposed by the President pursuant to...

  16. 24 CFR 206.41 - Counseling.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Counseling. 206.41 Section 206.41... CONVERSION MORTGAGE INSURANCE Eligibility; Endorsement Eligible Mortgagors § 206.41 Counseling. (a) List... receive counseling. (b) Information to be provided. A counselor must discuss with the mortgagor: (1) The...

  17. 10 CFR 611.206 - Existing facilities.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Existing facilities. 611.206 Section 611.206 Energy... PROGRAM Facility/Funding Awards § 611.206 Existing facilities. The Secretary shall, in making awards to those manufacturers that have existing facilities, give priority to those facilities that are oldest or...

  18. 40 CFR 89.206 - Trading.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Trading. 89.206 Section 89.206... EMISSIONS FROM NEW AND IN-USE NONROAD COMPRESSION-IGNITION ENGINES Averaging, Banking, and Trading Provisions § 89.206 Trading. (a) Requirements for Tier 1 engines rated at or above 37 kW. (1) A nonroad...

  19. 40 CFR 91.206 - Trading.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Trading. 91.206 Section 91.206... EMISSIONS FROM MARINE SPARK-IGNITION ENGINES Averaging, Banking, and Trading Provisions § 91.206 Trading. (a... manufacturers in trading. These credits must be used in the same averaging set as generated. (b) Credits for...

  20. 40 CFR 90.206 - Trading.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Trading. 90.206 Section 90.206... Trading Provisions § 90.206 Trading. (a) An engine manufacturer may exchange emission credits with other engine manufacturers in trading, subject to the trading restriction specified in § 90.207(c)(2). (b...

  1. 21 CFR 131.206 - Nonfat yogurt.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Nonfat yogurt. 131.206 Section 131.206 Food and... CONSUMPTION MILK AND CREAM Requirements for Specific Standardized Milk and Cream § 131.206 Nonfat yogurt. (a) Description. Nonfat yogurt is the food produced by culturing one or more of the optional dairy ingredients...

  2. 24 CFR 206.21 - Interest rate.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Interest rate. 206.21 Section 206... CONVERSION MORTGAGE INSURANCE Eligibility; Endorsement Eligible Mortgages § 206.21 Interest rate. (a) Fixed interest rate. A fixed interest rate is agreed upon by the mortgagor and mortgagee. (b) Adjustable interest...

  3. 24 CFR 206.37 - Credit standing.

    Science.gov (United States)

    2010-04-01

    ... CONVERSION MORTGAGE INSURANCE Eligibility; Endorsement Eligible Mortgagors § 206.37 Credit standing. Each mortgagor must have a general credit standing satisfactory to the Secretary. ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Credit standing. 206.37 Section 206...

  4. 5 CFR 430.206 - Planning performance.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Planning performance. 430.206 Section 430.206 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PERFORMANCE MANAGEMENT Performance Appraisal for General Schedule, Prevailing Rate, and Certain Other Employees § 430.206...

  5. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  6. 38 CFR 3.206 - Divorce.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Divorce. 3.206 Section 3..., Compensation, and Dependency and Indemnity Compensation Evidence Requirements § 3.206 Divorce. The validity of a divorce decree regular on its face, will be questioned by the Department of Veterans Affairs only...

  7. 5 CFR 330.206 - Job consideration.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Job consideration. 330.206 Section 330..., SELECTION, AND PLACEMENT (GENERAL) Reemployment Priority List (RPL) § 330.206 Job consideration. (a)(1) An eligible employee under § 330.203 is entitled to consideration for positions in the commuting area for...

  8. 49 CFR 229.206 - Design requirements.

    Science.gov (United States)

    2010-10-01

    ...-climber, emergency egress, emergency interior lighting, and interior configuration design requirements set... 49 Transportation 4 2010-10-01 2010-10-01 false Design requirements. 229.206 Section 229.206..., DEPARTMENT OF TRANSPORTATION RAILROAD LOCOMOTIVE SAFETY STANDARDS Locomotive Crashworthiness Design...

  9. 30 CFR 206.251 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Definitions. 206.251 Section 206.251 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT PRODUCT... impurities from coal. Coal washing may include, but is not limited to, operations such as flotation, air...

  10. 44 CFR 206.438 - Project management.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Project management. 206.438 Section 206.438 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF... Project management. (a) General. The State serving as grantee has primary responsibility for project...

  11. 5 CFR 1216.206 - Final determination.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Final determination. 1216.206 Section... PROCEEDINGS Demands or Requests for Testimony and Production of Documents § 1216.206 Final determination. The General Counsel makes the final determination on demands to requests to employees for production of...

  12. 44 CFR 206.38 - Presidential determination.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Presidential determination. 206.38 Section 206.38 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY....38 Presidential determination. (a) The Governor's request for a major disaster declaration may result...

  13. 9 CFR 206.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Definitions. 206.1 Section 206.1 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND... account. Further, the contract specifies how the balance in the account affects producer and packer rights...

  14. 44 CFR 206.343 - Scope.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Scope. 206.343 Section 206.343 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF HOMELAND...; (2) Crisis counseling; (3) Disaster Legal services; and (4) Disaster unemployment assistance. ...

  15. 47 CFR 25.206 - Station identification.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Station identification. 25.206 Section 25.206 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS... identification is waived for all radio stations licensed under this part with the exception of satellite uplinks...

  16. 48 CFR 17.206 - Evaluation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Evaluation. 17.206 Section... CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 17.206 Evaluation. (a) In awarding the basic contract... officer need not evaluate offers for any option quantities when it is determined that evaluation would not...

  17. 44 CFR 206.31 - Purpose.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Purpose. 206.31 Section 206.31 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF HOMELAND... purpose of this subpart is to describe the process leading to a Presidential declaration of a major...

  18. 31 CFR 588.206 - Exempt transactions.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Exempt transactions. 588.206 Section 588.206 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... assist in the creation of information or informational materials; and, with respect to information or...

  19. 31 CFR 542.206 - Exempt transactions.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Exempt transactions. 542.206 Section 542.206 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... assist in the creation of information or informational materials; and, with respect to information or...

  20. 31 CFR 587.206 - Exempt transactions.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Exempt transactions. 587.206 Section 587.206 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF...-produce, create, or assist in the creation of information or informational materials; and, with respect to...

  1. 31 CFR 586.206 - Exempt transactions.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Exempt transactions. 586.206 Section 586.206 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... or assist in the creation of information and informational materials, and payment of royalties to...

  2. 31 CFR 548.206 - Exempt transactions.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Exempt transactions. 548.206 Section 548.206 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... assist in the creation of information or informational materials; and, with respect to information or...

  3. 31 CFR 544.206 - Exempt transactions.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Exempt transactions. 544.206 Section 544.206 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF...-produce, create, or assist in the creation of information or informational materials; and, with respect to...

  4. 31 CFR 541.206 - Exempt transactions.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Exempt transactions. 541.206 Section 541.206 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... assist in the creation of information or informational materials; and, with respect to information or...

  5. 24 CFR 206.23 - Shared appreciation.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Shared appreciation. 206.23 Section 206.23 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued) OFFICE OF ASSISTANT SECRETARY FOR HOUSING-FEDERAL HOUSING COMMISSIONER, DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE...

  6. 44 CFR 206.371 - Loan program.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Loan program. 206.371 Section... HOMELAND SECURITY DISASTER ASSISTANCE FEDERAL DISASTER ASSISTANCE Community Disaster Loans § 206.371 Loan... Special Community Disaster Loan to any local government which has suffered a substantial loss of tax and...

  7. 44 CFR 206.361 - Loan program.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Loan program. 206.361 Section... HOMELAND SECURITY DISASTER ASSISTANCE FEDERAL DISASTER ASSISTANCE Community Disaster Loans § 206.361 Loan... Community Disaster Loan to any local government which has suffered a substantial loss of tax and other...

  8. 31 CFR 206.9 - Charges.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Charges. 206.9 Section 206.9 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT... effective date of the charge or the appeals decision, an agency must submit appropriate accounting...

  9. 31 CFR 206.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Definitions. 206.2 Section 206.2 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY RECEIPTS, DISBURSEMENTS...

  10. 31 CFR 206.8 - Appeals.

    Science.gov (United States)

    2010-07-01

    ... Treasury, the Assistant Commissioner, Federal Finance, and the designated agency cash management official... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Appeals. 206.8 Section 206.8 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT...

  11. 31 CFR 206.7 - Compliance.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Compliance. 206.7 Section 206.7 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY RECEIPTS, DISBURSEMENTS...

  12. 44 CFR 206.367 - Loan repayment.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Loan repayment. 206.367 Section 206.367 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF... interest, P=the principal amount disbursed; R=the interest rate of the loan; and, T=the outstanding term in...

  13. 44 CFR 206.204 - Project performance.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Project performance. 206.204... § 206.204 Project performance. (a) General. This section describes the policies and procedures applicable during the performance of eligible work. (b) Advances of funds. Advances of funds will be made in...

  14. 12 CFR 206.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... LIABILITIES (REGULATION F) § 206.2 Definitions. As used in this part, unless the context requires otherwise... credit and liquidity risks, including operational risks, related to intraday and interday transactions...

  15. 24 CFR 206.116 - Refunds.

    Science.gov (United States)

    2010-04-01

    ... MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES HOME EQUITY CONVERSION MORTGAGE INSURANCE Contract Rights and Obligations Mortgage Insurance Premiums § 206.116 Refunds...

  16. 24 CFR 206.115 - [Reserved

    Science.gov (United States)

    2010-04-01

    ... MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES HOME EQUITY CONVERSION MORTGAGE INSURANCE Contract Rights and Obligations Mortgage Insurance Premiums § 206.115 [Reserved] ...

  17. 206Pb level structure from 206Pb(n,n'γ) measurements

    International Nuclear Information System (INIS)

    Dickens, J.K.

    1982-03-01

    A study of gamma-ray data produced by neutron inelastic scattering from a lead sample enriched in the isotope 206 Pb has resulted in placements, or tentative placements, of 146 gamma rays as transitions among 112 known or postulated levels of the 206 Pb level structure

  18. 31 CFR 595.206 - Exempt transactions.

    Science.gov (United States)

    2010-07-01

    ... FOREIGN ASSETS CONTROL, DEPARTMENT OF THE TREASURY TERRORISM SANCTIONS REGULATIONS Prohibitions § 595.206 Exempt transactions. (a) Personal communications. The prohibitions contained in this part do not apply to any postal, telegraphic, telephonic, or other personal communication, which does not involve the...

  19. 44 CFR 206.363 - Eligibility criteria.

    Science.gov (United States)

    2010-10-01

    ... HOMELAND SECURITY DISASTER ASSISTANCE FEDERAL DISASTER ASSISTANCE Community Disaster Loans § 206.363... disaster caused a large enough reduction in cash receipts from normal revenue sources, excluding borrowing... other Federal agencies for direct program expenditures; (vii) Displacement of revenue-producing business...

  20. 44 CFR 206.373 - Eligibility criteria.

    Science.gov (United States)

    2010-10-01

    ... HOMELAND SECURITY DISASTER ASSISTANCE FEDERAL DISASTER ASSISTANCE Community Disaster Loans § 206.373... following disaster-related factors: (i) Whether the disaster caused a large enough reduction in cash... service); (vi) Displacement of revenue-producing business due to property destruction; (vii) Necessity to...

  1. 9 CFR 206.3 - Monthly report.

    Science.gov (United States)

    2010-01-01

    ... the close of business on the 15th of each month, beginning at least 45 days after the initial... the close of the next business day following the 15th. (c) What information do I need to provide in... in § 206.1. (4) Expansion clauses. Any conditions or circumstances specified by clauses in any...

  2. 5 CFR 720.206 - Selection guidelines.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Selection guidelines. 720.206 Section 720... guidelines. This subpart sets forth requirements for a recruitment program, not a selection program... procedures and criteria must be consistent with the Uniform Guidelines on Employee Selection Procedures (43...

  3. 44 CFR 206.225 - Emergency work.

    Science.gov (United States)

    2010-10-01

    ... communications. Emergency communications necessary for the purpose of carrying out disaster relief functions may... HOMELAND SECURITY DISASTER ASSISTANCE FEDERAL DISASTER ASSISTANCE Public Assistance Eligibility § 206.225... economically eliminates the need for temporary housing. The work will be limited to that necessary for the...

  4. 41 CFR 101-27.206-3 - Packaging.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Packaging. 101-27.206-3 Section 101-27.206-3 Public Contracts and Property Management Federal Property Management Regulations...-Management of Shelf-Life Materials § 101-27.206-3 Packaging. To the extent feasible and economical, shelf...

  5. 21 CFR 206.10 - Code imprint required.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Code imprint required. 206.10 Section 206.10 Food...: GENERAL IMPRINTING OF SOLID ORAL DOSAGE FORM DRUG PRODUCTS FOR HUMAN USE § 206.10 Code imprint required... imprint that, in conjunction with the product's size, shape, and color, permits the unique identification...

  6. 44 CFR 206.141 - Disaster unemployment assistance.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Disaster unemployment assistance. 206.141 Section 206.141 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY... § 206.141 Disaster unemployment assistance. The authority to implement the disaster unemployment...

  7. 29 CFR 825.206 - Interaction with the FLSA.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Interaction with the FLSA. 825.206 Section 825.206 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR OTHER LAWS THE FAMILY....206 Interaction with the FLSA. (a) Leave taken under FMLA may be unpaid. If an employee is otherwise...

  8. 5 CFR 297.206 - Fees charged by the Office.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Fees charged by the Office. 297.206 Section 297.206 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PRIVACY PROCEDURES FOR PERSONNEL RECORDS Request for Access § 297.206 Fees charged by the Office. (a) No fees will be charged for search and review time...

  9. 30 CFR 206.156 - Transportation allowances-general.

    Science.gov (United States)

    2010-07-01

    ... any sales type code be reduced to zero. (d) If, after a review or audit, MMS determines that a lessee... MANAGEMENT PRODUCT VALUATION Federal Gas § 206.156 Transportation allowances—general. (a) Where the value of gas has been determined pursuant to § 206.152 or § 206.153 of this subpart at a point (e.g., sales...

  10. 5 CFR 362.206 - Movement between departments or agencies.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Movement between departments or agencies. 362.206 Section 362.206 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PRESIDENTIAL MANAGEMENT FELLOWS PROGRAM Program Administration § 362.206 Movement between...

  11. 30 CFR 206.155 - Accounting for comparison.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Accounting for comparison. 206.155 Section 206... MANAGEMENT PRODUCT VALUATION Federal Gas § 206.155 Accounting for comparison. (a) Except as provided in... the gas the residue gas is not sold pursuant to an arm's-length contract, the value, for royalty...

  12. 5 CFR 880.206 - Date of death.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Date of death. 880.206 Section 880.206...) RETIREMENT AND INSURANCE BENEFITS DURING PERIODS OF UNEXPLAINED ABSENCE Procedures § 880.206 Date of death... OPM, the date of death of a missing annuitant who has been determined to be dead by an authorized...

  13. 40 CFR 86.206-11 - Equipment required; overview.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Equipment required; overview. 86.206-11 Section 86.206-11 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... New Medium-Duty Passenger Vehicles; Cold Temperature Test Procedures § 86.206-11 Equipment required...

  14. 40 CFR 86.206-94 - Equipment required; overview.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Equipment required; overview. 86.206-94 Section 86.206-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... New Medium-Duty Passenger Vehicles; Cold Temperature Test Procedures § 86.206-94 Equipment required...

  15. 24 CFR 115.206 - Performance assessments; Performance standards.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Performance assessments; Performance standards. 115.206 Section 115.206 Housing and Urban Development Regulations Relating to Housing... AGENCIES Certification of Substantially Equivalent Agencies § 115.206 Performance assessments; Performance...

  16. 30 CFR 206.459 - Allocation of washed coal.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Allocation of washed coal. 206.459 Section 206... MANAGEMENT PRODUCT VALUATION Indian Coal § 206.459 Allocation of washed coal. (a) When coal is subjected to washing, the washed coal must be allocated to the leases from which it was extracted. (b) When the net...

  17. 30 CFR 206.260 - Allocation of washed coal.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Allocation of washed coal. 206.260 Section 206... MANAGEMENT PRODUCT VALUATION Federal Coal § 206.260 Allocation of washed coal. (a) When coal is subjected to washing, the washed coal must be allocated to the leases from which it was extracted. (b) When the net...

  18. 49 CFR 173.206 - Packaging requirements for chlorosilanes.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Packaging requirements for chlorosilanes. 173.206...-GENERAL REQUIREMENTS FOR SHIPMENTS AND PACKAGINGS Non-bulk Packaging for Hazardous Materials Other Than Class 1 and Class 7 § 173.206 Packaging requirements for chlorosilanes. (a) When § 172.101 of this...

  19. 20 CFR 726.206 - Terms of policies.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Terms of policies. 726.206 Section 726.206 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION, DEPARTMENT OF LABOR FEDERAL COAL MINE HEALTH AND SAFETY ACT OF 1969, AS AMENDED BLACK LUNG BENEFITS; REQUIREMENTS FOR COAL MINE OPERATOR'S INSURANCE...

  20. 27 CFR 25.206 - Removal of beer.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Removal of beer. 25.206... OF THE TREASURY LIQUORS BEER Removals Without Payment of Tax Beer for Personal Or Family Use § 25.206 Removal of beer. Beer made under § 25.205 may be removed from the premises where made for personal or...

  1. 30 CFR 206.56 - Transportation allowances-general.

    Science.gov (United States)

    2010-07-01

    ... oil has been determined under § 206.52 or § 206.53 of this subpart at a point (e.g., sales point or point of value determination) off the lease, MMS shall allow a deduction for the reasonable, actual... sales type code may not exceed 50 percent of the value of the oil at the point of sale as determined...

  2. 9 CFR 113.206 - Wart Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Wart Vaccine, Killed Virus. 113.206... AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.206 Wart Vaccine, Killed Virus. Wart Vaccine, Killed Virus, shall be prepared...

  3. 19 CFR 206.63 - Contents of petition.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Contents of petition. 206.63 Section 206.63... Contents of petition. A petition under section 422(b) of the Trade Act shall include specific information... petition shall include all relevant information that is reasonably available to the petitioner with due...

  4. 14 CFR 125.206 - Pitot heat indication systems.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Pitot heat indication systems. 125.206... Equipment Requirements § 125.206 Pitot heat indication systems. (a) Except as provided in paragraph (b) of... flight instrument pitot heating system unless the airplane is equipped with an operable pitot heat...

  5. 7 CFR 1205.206 - Reporting results of referendum.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Reporting results of referendum. 1205.206 Section 1205.206 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE COTTON...

  6. 31 CFR 206.5 - Collection and deposit procedure exceptions.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Collection and deposit procedure exceptions. 206.5 Section 206.5 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL...

  7. 31 CFR 206.1 - Scope and application.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Scope and application. 206.1 Section 206.1 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY RECEIPTS, DISBURSEMENTS...

  8. 31 CFR 206.4 - Collection and payment mechanisms.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Collection and payment mechanisms. 206.4 Section 206.4 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY...

  9. 31 CFR 206.6 - Cash management planning and review.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Cash management planning and review. 206.6 Section 206.6 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY...

  10. 31 CFR 206.3 - Billing policy and procedures.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Billing policy and procedures. 206.3 Section 206.3 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY RECEIPTS...

  11. 30 CFR 206.265 - Value enhancement of marketable coal.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Value enhancement of marketable coal. 206.265... MANAGEMENT PRODUCT VALUATION Federal Coal § 206.265 Value enhancement of marketable coal. If, prior to use, sale, or other disposition, the lessee enhances the value of coal after the coal has been placed in...

  12. 30 CFR 206.464 - Value enhancement of marketable coal.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Value enhancement of marketable coal. 206.464... MANAGEMENT PRODUCT VALUATION Indian Coal § 206.464 Value enhancement of marketable coal. If, prior to use, sale, or other disposition, the lessee enhances the value of coal after the coal has been placed in...

  13. 30 CFR 75.206 - Conventional roof support.

    Science.gov (United States)

    2010-07-01

    ... HEALTH MANDATORY SAFETY STANDARDS-UNDERGROUND COAL MINES Roof Support § 75.206 Conventional roof support. (a) Except in anthracite mines using non-mechanized mining systems, when conventional roof support... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Conventional roof support. 75.206 Section 75...

  14. 27 CFR 26.206 - Marking packages and cases.

    Science.gov (United States)

    2010-04-01

    ... Coming Into the United States From the Virgin Islands § 26.206 Marking packages and cases. The distiller... distiller, rectifier, or bottler shall plainly print, stamp, or stencil with durable coloring material, in...

  15. 24 CFR 206.105 - Amount of MIP.

    Science.gov (United States)

    2010-04-01

    ... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES HOME EQUITY CONVERSION MORTGAGE INSURANCE Contract Rights and Obligations Mortgage Insurance Premiums § 206.105 Amount of...

  16. 24 CFR 206.103 - Payment of MIP.

    Science.gov (United States)

    2010-04-01

    ... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES HOME EQUITY CONVERSION MORTGAGE INSURANCE Contract Rights and Obligations Mortgage Insurance Premiums § 206.103 Payment... cash, until the contract of insurance is terminated. ...

  17. 24 CFR 206.26 - Change in payment option.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Change in payment option. 206.26... in payment option. (a) General. The payment option may be changed as provided in this section. (b... credit payment option. Until the repairs are completed, the mortgagee shall make no line of credit...

  18. 28 CFR 36.206 - Retaliation or coercion.

    Science.gov (United States)

    2010-07-01

    ... PUBLIC ACCOMMODATIONS AND IN COMMERCIAL FACILITIES General Requirements § 36.206 Retaliation or coercion... opposed any act or practice made unlawful by this part, or because that individual made a charge... any individual in the exercise or enjoyment of, or on account of his or her having exercised or...

  19. 32 CFR 206.5 - Final proposal process.

    Science.gov (United States)

    2010-07-01

    ... the basis of “educational value for the dollar.” NSEP is interested in funding proposals in areas... institution to integrate the efforts of the proposed program into the educational process? What plans are...) MISCELLANEOUS NATIONAL SECURITY EDUCATION PROGRAM (NSEP) GRANTS TO INSTITUTIONS OF HIGHER EDUCATION § 206.5...

  20. 17 CFR 275.206(4)-8 - Pooled investment vehicles.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Pooled investment vehicles... COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT ADVISERS ACT OF 1940 § 275.206(4)-8 Pooled investment vehicles. (a) Prohibition. It shall constitute a fraudulent, deceptive, or manipulative act...

  1. 42 CFR 59.206 - Evaluation and grant award.

    Science.gov (United States)

    2010-10-01

    ...) Development of a capability within family planning service projects to provide pre- and in-service training to... and health services personnel; (iii) Improvement in the utilization and career development of... PLANNING SERVICES Grants for Family Planning Service Training § 59.206 Evaluation and grant award. (a...

  2. 48 CFR 1809.206-70 - Small businesses.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Small businesses. 1809.206...-70 Small businesses. If a small business otherwise eligible for award has been placed in a special... that the small business does not appear to have the capacity to perform, the certificate of competency...

  3. 19 CFR 206.16 - Industry adjustment plan and commitments.

    Science.gov (United States)

    2010-04-01

    ... Section 206.16 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION NONADJUDICATIVE INVESTIGATIONS INVESTIGATIONS RELATING TO GLOBAL AND BILATERAL SAFEGUARD ACTIONS, MARKET DISRUPTION, TRADE DIVERSION, AND REVIEW... determination, any firm in the domestic industry, certified or recognized union or group of workers in the...

  4. 19 CFR 206.15 - Institution of investigation.

    Science.gov (United States)

    2010-04-01

    ....15 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION NONADJUDICATIVE INVESTIGATIONS INVESTIGATIONS RELATING TO GLOBAL AND BILATERAL SAFEGUARD ACTIONS, MARKET DISRUPTION, TRADE DIVERSION, AND REVIEW... the type described in § 206.13 that represents a domestic industry producing a perishable agricultural...

  5. 30 CFR 90.206 - Approved sampling devices; equivalent concentrations.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Approved sampling devices; equivalent... LABOR COAL MINE SAFETY AND HEALTH MANDATORY HEALTH STANDARDS-COAL MINERS WHO HAVE EVIDENCE OF THE DEVELOPMENT OF PNEUMOCONIOSIS Sampling Procedures § 90.206 Approved sampling devices; equivalent...

  6. 44 CFR 206.8 - Reimbursement of other Federal agencies.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Reimbursement of other... Reimbursement of other Federal agencies. (a) Assistance furnished under § 206.5 (a) or (b) of this subpart may... Administrator or the Regional Director may not approve reimbursement of costs incurred while performing work...

  7. 47 CFR 20.6 - CMRS spectrum aggregation limit.

    Science.gov (United States)

    2010-10-01

    ... COMMERCIAL MOBILE RADIO SERVICES § 20.6 CMRS spectrum aggregation limit. (a) Spectrum limitation. No licensee... charged for such services. (10) Any licensee or its affiliate who enters into a joint marketing... management agreements or joint marketing agreements; or (iii) Non-controlling attributable interests in...

  8. 24 CFR 206.25 - Calculation of payments.

    Science.gov (United States)

    2010-04-01

    ... HOME EQUITY CONVERSION MORTGAGE INSURANCE Eligibility; Endorsement Eligible Mortgages § 206.25... principal limit set aside as a line of credit including any set asides for repairs and first year property... credit separately or with monthly payments. If the mortgagor has a line of credit, separately or combined...

  9. 27 CFR 555.206 - Location of magazines.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Location of magazines. 555... EXPLOSIVES, DEPARTMENT OF JUSTICE EXPLOSIVES COMMERCE IN EXPLOSIVES Storage § 555.206 Location of magazines. (a) Outdoor magazines in which high explosives are stored must be located no closer to inhabited...

  10. 24 CFR 206.111 - Due date of MIP.

    Science.gov (United States)

    2010-04-01

    ... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES HOME EQUITY CONVERSION MORTGAGE INSURANCE Contract Rights and Obligations Mortgage Insurance Premiums § 206.111 Due date... of closing and as a condition to the endorsement of the mortgage for insurance. (b) Monthly MIP. Each...

  11. 24 CFR 206.102 - General Insurance Fund.

    Science.gov (United States)

    2010-04-01

    ... Insurance Fund. [60 FR 42761, Aug. 16, 1995] Mortgage Insurance Premiums ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false General Insurance Fund. 206.102... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES...

  12. Coulomb excitation of 206Hg at relativistic energies

    Science.gov (United States)

    Alexander, Tom

    The region of the nuclear chart surrounding the doubly-magic nucleus 208Pb provides a key area to constrain and develop contemporary nuclear structure models. One aspect of particular interest is the transition strength of the first excited 2+ state in even-even nuclei; this work describes the measurement of this value for the case of 206Hg, where the Z=80 line meets the N=126 shell closure. The nuclei of interest were synthesized using relativistic-energy projectile fragmentation at the GSI facility in Germany. They were produced in the fragmentation of a primary 208Pb beam at an energy of 1 GeV per nucleon, and separated and identifed using the Fragment Separator. The secondary beams with an energy of 140 MeV per nucleon were Coulomb excited on a secondary target of 400 mg/cm. 2 gold. Gamma-rays were detected with the Advanced GAmma Tracking Array (AGATA). The precise scattering angle for Doppler-correction was determined with position information from the Lund-York-Cologne-CAlorimeter(LYCCA). Using the sophisticated tracking algorithm native to AGATA in conjunction with pulse-shape analysis, a precise Doppler-correction is performed on the gamma spectra, and using a complex n-dimensional analysis, the B(E2) value for 206Hg is extracted relative to the known value also measured in 206Pb. A total of 409 million 206Hg particles were measured, and a cross-section of 50 mb was determined for the 2+ state at 1068 keV. The measurement of the B(E2) transition strength was found to be 1.109 W.u. This result is compared to a number of theoretical calculations, including two Gogny forces, and a modified shell model parametrization and is found to be smaller than all calculated estimations, implying that the first excited 2. + state in . {206}Hg is uncollective in nature.

  13. Zfp206 regulates ES cell gene expression and differentiation.

    Science.gov (United States)

    Zhang, Wen; Walker, Emily; Tamplin, Owen J; Rossant, Janet; Stanford, William L; Hughes, Timothy R

    2006-01-01

    Understanding transcriptional regulation in early developmental stages is fundamental to understanding mammalian development and embryonic stem (ES) cell properties. Expression surveys suggest that the putative SCAN-Zinc finger transcription factor Zfp206 is expressed specifically in ES cells [Zhang,W., Morris,Q.D., Chang,R., Shai,O., Bakowski,M.A., Mitsakakis,N., Mohammad,N., Robinson,M.D., Zirngibl,R., Somogyi,E. et al., (2004) J. Biol., 3, 21; Brandenberger,R., Wei,H., Zhang,S., Lei,S., Murage,J., Fisk,G.J., Li,Y., Xu,C., Fang,R., Guegler,K. et al., (2004) Nat. Biotechnol., 22, 707-716]. Here, we confirm this observation, and we show that ZFP206 expression decreases rapidly upon differentiation of cultured mouse ES cells, and during development of mouse embryos. We find that there are at least six isoforms of the ZFP206 transcript, the longest being predominant. Overexpression and depletion experiments show that Zfp206 promotes formation of undifferentiated ES cell clones, and positively regulates abundance of a very small set of transcripts whose expression is also specific to ES cells and the two- to four-cell stages of preimplantation embryos. This set includes members of the Zscan4, Thoc4, Tcstv1 and eIF-1A gene families, none of which have been functionally characterized in vivo but whose members include apparent transcription factors, RNA-binding proteins and translation factors. Together, these data indicate that Zfp206 is a regulator of ES cell differentiation that controls a set of genes expressed very early in development, most of which themselves appear to be regulators.

  14. 10 CFR 835.206 - Limits for the embryo/fetus.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Limits for the embryo/fetus. 835.206 Section 835.206... Exposure § 835.206 Limits for the embryo/fetus. (a) The equivalent dose limit for the embryo/fetus from the... provided in § 835.206(a) shall be avoided. (c) If the equivalent dose to the embryo/fetus is determined to...

  15. Meson-exchange effets on 0+-O- β-decay transitions in A = 206 nuclei

    International Nuclear Information System (INIS)

    Kirchbach, M.

    1986-10-01

    It is shown that the renormalization of the weak-axial charge density due to the mesonic exchange effects leads to a reduction of the one-body shell-model log ft-values for the β-decays 206 Hg(0 + ) → 206 Tl(0 - ), and 206 Tl(0 - ) → 206 Pb(0 + ) by about two units and gives a satisfactory agreement with experiment. (author)

  16. 17 CFR 275.206(4)-1 - Advertisements by investment advisers.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Advertisements by investment advisers. 275.206(4)-1 Section 275.206(4)-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT ADVISERS ACT OF 1940 § 275.206(4)-1 Advertisements by investment advisers. (a) It shall...

  17. 24 CFR 206.308 - Continuing education requirements of counselors listed on the HECM Counselor Roster.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Continuing education requirements of counselors listed on the HECM Counselor Roster. 206.308 Section 206.308 Housing and Urban... MORTGAGE INSURANCE HECM Counselor Roster § 206.308 Continuing education requirements of counselors listed...

  18. 48 CFR 206.203 - Set-asides for small business concerns.

    Science.gov (United States)

    2010-10-01

    ... Competition After Exclusion of Sources 206.203 Set-asides for small business concerns. (b) Also no separate... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Set-asides for small business concerns. 206.203 Section 206.203 Federal Acquisition Regulations System DEFENSE ACQUISITION...

  19. 41 CFR 301-71.206 - What must we do if we disallow a travel claim?

    Science.gov (United States)

    2010-07-01

    ... disallow a travel claim? 301-71.206 Section 301-71.206 Public Contracts and Property Management Federal Travel Regulation System TEMPORARY DUTY (TDY) TRAVEL ALLOWANCES AGENCY RESPONSIBILITIES 71-AGENCY TRAVEL ACCOUNTABILITY REQUIREMENTS Travel Claims for Reimbursement § 301-71.206 What must we do if we disallow a travel...

  20. 42 CFR 441.206 - Documentation needed by the Medicaid agency.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Documentation needed by the Medicaid agency. 441.206 Section 441.206 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND... SPECIFIC SERVICES Abortions § 441.206 Documentation needed by the Medicaid agency. FFP is not available in...

  1. 41 CFR 101-27.206 - Procurement of shelf-life materials.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Procurement of shelf-life materials. 101-27.206 Section 101-27.206 Public Contracts and Property Management Federal Property... MANAGEMENT 27.2-Management of Shelf-Life Materials § 101-27.206 Procurement of shelf-life materials. ...

  2. 34 CFR 403.206 - What are the State's responsibilities regarding a State occupational information coordinating...

    Science.gov (United States)

    2010-07-01

    ... occupational information coordinating committee? 403.206 Section 403.206 Education Regulations of the Offices... EDUCATION STATE VOCATIONAL AND APPLIED TECHNOLOGY EDUCATION PROGRAM What Are the Administrative Responsibilities of a State Under the State Vocational and Applied Technology Education Program? § 403.206 What are...

  3. 50 CFR 226.206 - Critical habitat for the Southern Resident killer whale (Orcinus orca).

    Science.gov (United States)

    2010-10-01

    ... killer whale (Orcinus orca). 226.206 Section 226.206 Wildlife and Fisheries NATIONAL MARINE FISHERIES... CRITICAL HABITAT § 226.206 Critical habitat for the Southern Resident killer whale (Orcinus orca). Critical habitat is designated for the Southern Resident killer whale as described in this section. The textual...

  4. 48 CFR 206.302-3 - Industrial mobilization; or engineering, development, or research capability.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Industrial mobilization; or engineering, development, or research capability. 206.302-3 Section 206.302-3 Federal Acquisition... COMPETITION REQUIREMENTS Other Than Full and Open Competition 206.302-3 Industrial mobilization; or...

  5. 29 CFR 1952.206 - Where the plan may be inspected.

    Science.gov (United States)

    2010-07-01

    ... and copied during normal business hours at the following locations: Office of State Programs... 29 Labor 9 2010-07-01 2010-07-01 false Where the plan may be inspected. 1952.206 Section 1952.206..., DEPARTMENT OF LABOR (CONTINUED) APPROVED STATE PLANS FOR ENFORCEMENT OF STATE STANDARDS Minnesota § 1952.206...

  6. 29 CFR 778.206 - Premiums for work outside basic workday or workweek-examples.

    Science.gov (United States)

    2010-07-01

    ...-examples. 778.206 Section 778.206 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION... Overtime § 778.206 Premiums for work outside basic workday or workweek—examples. The effect of section 7(e... workday and workweek. Under one such agreement, for example, such workday and workweek are established as...

  7. 30 CFR 206.62 - Does MMS protect information I provide?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Does MMS protect information I provide? 206.62 Section 206.62 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT PRODUCT VALUATION Indian Oil § 206.62 Does MMS protect information I provide? The MMS will keep...

  8. 42 CFR 137.206 - Why does the IHS need this information?

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Why does the IHS need this information? 137.206 Section 137.206 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Operational Provisions Health Status Reports § 137.206 Why does the IHS...

  9. 28 CFR 2.206 - Travel approval and transfers of supervision.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Travel approval and transfers of supervision. 2.206 Section 2.206 Judicial Administration DEPARTMENT OF JUSTICE PAROLE, RELEASE, SUPERVISION AND RECOMMITMENT OF PRISONERS, YOUTH OFFENDERS, AND JUVENILE DELINQUENTS District of Columbia Supervised Releasees § 2.206 Travel approval and...

  10. 24 CFR 206.51 - Eligibility of mortgages involving a dwelling unit in a condominium.

    Science.gov (United States)

    2010-04-01

    ... a dwelling unit in a condominium. 206.51 Section 206.51 Housing and Urban Development Regulations...; Endorsement Eligible Properties § 206.51 Eligibility of mortgages involving a dwelling unit in a condominium. If the mortgage involves a dwelling unit in a condominium, the project in which the unit is located...

  11. Strengthening of Aluminum Wires Treated with A206/Alumina Nanocomposites

    Directory of Open Access Journals (Sweden)

    David Florián-Algarín

    2018-03-01

    Full Text Available This study sought to characterize aluminum nanocomposite wires that were fabricated through a cold-rolling process, having potential applications in TIG (tungsten inert gas welding of aluminum. A206 (Al-4.5Cu-0.25Mg master nanocomposites with 5 wt % γAl2O3 nanoparticles were first manufactured through a hybrid process combining semi-solid mixing and ultrasonic processing. A206/1 wt % γAl2O3 nanocomposites were fabricated by diluting the prepared master nanocomposites with a monolithic A206 alloy, which was then added to a pure aluminum melt. The fabricated Al–γAl2O3 nanocomposite billet was cold-rolled to produce an Al nanocomposite wire with a 1 mm diameter and a transverse area reduction of 96%. Containing different levels of nanocomposites, the fabricated samples were mechanically and electrically characterized. The results demonstrate a significantly higher strength of the aluminum wires with the nanocomposite addition. Further, the addition of alumina nanoparticles affected the wires’ electrical conductivity compared with that of pure aluminum and aluminum–copper alloys. The overall properties of the new material demonstrate that these wires could be an appealing alternative for fillers intended for aluminum welding.

  12. Strengthening of Aluminum Wires Treated with A206/Alumina Nanocomposites.

    Science.gov (United States)

    Florián-Algarín, David; Marrero, Raúl; Li, Xiaochun; Choi, Hongseok; Suárez, Oscar Marcelo

    2018-03-10

    This study sought to characterize aluminum nanocomposite wires that were fabricated through a cold-rolling process, having potential applications in TIG (tungsten inert gas) welding of aluminum. A206 (Al-4.5Cu-0.25Mg) master nanocomposites with 5 wt % γAl₂O₃ nanoparticles were first manufactured through a hybrid process combining semi-solid mixing and ultrasonic processing. A206/1 wt % γAl₂O₃ nanocomposites were fabricated by diluting the prepared master nanocomposites with a monolithic A206 alloy, which was then added to a pure aluminum melt. The fabricated Al-γAl₂O₃ nanocomposite billet was cold-rolled to produce an Al nanocomposite wire with a 1 mm diameter and a transverse area reduction of 96%. Containing different levels of nanocomposites, the fabricated samples were mechanically and electrically characterized. The results demonstrate a significantly higher strength of the aluminum wires with the nanocomposite addition. Further, the addition of alumina nanoparticles affected the wires' electrical conductivity compared with that of pure aluminum and aluminum-copper alloys. The overall properties of the new material demonstrate that these wires could be an appealing alternative for fillers intended for aluminum welding.

  13. Completion report for Well Cluster ER-20-6

    International Nuclear Information System (INIS)

    1998-02-01

    The Well Cluster ER-20-6 drilling and completion project was conducted during February, March, and April of 1996 in support of the Nevada Environmental Restoration Project at the Nevada Test Site (NTS), Nye County, Nevada. This project is part of the DOE's Underground Test Area (UGTA) subproject at the NTS. The primary UGTA tasks include collecting geological, geophysical, and hydrological data from new and existing wells to define groundwater quality as well as pathways and rates of groundwater migration at the NTS. A program of drilling wells near the sites of selected underground nuclear tests (near-field drilling) was implemented as part of the UGTA subproject to obtain site-specific data on the nature and extent of migration of radionuclides produced by an underground nuclear explosion. The ER-20-6 near-field drilling project was originally planned to be very similar to that recently conducted at Well Cluster ER-20-5, which was designed to obtain data on the existing hydrologic regime near the site of an underground nuclear explosion (IT, 1995; IT, 1996a). However, after further consideration of the goals of the near-field drilling program and the characteristics of the BULLION site, the TWG recommended that the ER-20-6 project be redesigned to accommodate a forced-gradient experiment. This proposed experiment is expected to yield more realistic estimates of transport parameters than can be deduced from sampling and testing natural groundwater flow systems

  14. Completion report for Well Cluster ER-20-6

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-02-01

    The Well Cluster ER-20-6 drilling and completion project was conducted during February, March, and April of 1996 in support of the Nevada Environmental Restoration Project at the Nevada Test Site (NTS), Nye County, Nevada. This project is part of the DOE`s Underground Test Area (UGTA) subproject at the NTS. The primary UGTA tasks include collecting geological, geophysical, and hydrological data from new and existing wells to define groundwater quality as well as pathways and rates of groundwater migration at the NTS. A program of drilling wells near the sites of selected underground nuclear tests (near-field drilling) was implemented as part of the UGTA subproject to obtain site-specific data on the nature and extent of migration of radionuclides produced by an underground nuclear explosion. The ER-20-6 near-field drilling project was originally planned to be very similar to that recently conducted at Well Cluster ER-20-5, which was designed to obtain data on the existing hydrologic regime near the site of an underground nuclear explosion (IT, 1995; IT, 1996a). However, after further consideration of the goals of the near-field drilling program and the characteristics of the BULLION site, the TWG recommended that the ER-20-6 project be redesigned to accommodate a forced-gradient experiment. This proposed experiment is expected to yield more realistic estimates of transport parameters than can be deduced from sampling and testing natural groundwater flow systems.

  15. Reagents for Astatination of Biomolecules. 5. Evaluation of hydrazone linkers in 211At- and 125I-labeled closo-decaborate(2-) conjugates of Fab′ as a means of decreasing kidney retention

    Science.gov (United States)

    Wilbur, D. Scott; Chyan, Ming-Kuan; Hamlin, Donald K.; Nguyen, Holly; Vessella, Robert L.

    2011-01-01

    Evaluation of monoclonal antibody (MAb) fragments (e.g. Fab′, Fab or engineered fragments) as cancer-targeting reagents for therapy with the α-particle emitting radionuclide astatine-211 (211At) has been hampered by low in vivo stability of the label and a propensity of these proteins localize to kidneys. Fortunately, our group has shown that the low stability of the 211At label, generally a meta- or para-[211At]astatobenzoyl conjugate, on MAb Fab′ fragments can be dramatically improved by use of closo-decaborate(2-) conjugates. However, the higher stability of radiolabeled MAb Fab′ conjugates appears to result in retention of the radioactivity in kidneys. This investigation was conducted to evaluate whether the retention of radioactivity in kidney might be decreased by the use of acid-cleavable hydrazone between the Fab′ and the radiolabeled closo-decaborate(2-) moiety. Five conjugation reagents containing sulfhydryl-reactive maleimide groups, a hydrazone functionality and a closo-decaborate(2-) moiety were prepared. In four of the five conjugation reagents, a discrete polyethylene glycol (PEG) linker was used, and one substituent adjacent to the hydrazone was varied (phenyl, benzoate, anisole or methyl) to provide varying acid-sensitivity. In the initial studies, the five maleimido-closo-decaborate(2-) conjugation reagents were radioiodinated (125I or 131I), then conjugated with an anti-PSMA Fab′ (107-1A4 Fab′). Biodistributions of the five radioiodinated Fab′ conjugates were obtained in nude mice at 1, 4 and 24 h post injection (pi). In contrast to closo-decaborate(2-) conjugated to 107-1A4 Fab′ through a non-cleavable linker, two conjugates containing either a benzoate or a methyl substituent on the hydrazone functionality displayed clearance rates from kidney, liver and spleen that were similar to those obtained with directly radioiodinated Fab′ (i.e. no conjugate). The maleimido-closo-decaborate(2-) conjugation reagent containing a benzoate

  16. Spectroscopy of high-spin states of 206Po

    International Nuclear Information System (INIS)

    Baxter, A.M.; Byrne, A.P.; Dracoulis, G.D.; Bark, R.A.; Riess, F.; Stuchbery, A.E.; Kruse, M.C.; Poletti, A.R.

    1990-05-01

    The yrast and near-yrast energy levels of 206 Po have been investigated to over 9 MeV excitation and up to spins with J=24. The measure-ments consisted of γ-γ coincidence data, internal-conversion-electron spectra, time spectra of γ-rays relative to a pulsed beam, excitation functions and γ-ray angular distributions. Two new isomers, with lifetime in the one-nonasecond range,were found. The observed structure is compared with the predictions of empirical shell-model calculations in which 206 Po is regarded as a 208 Pb core with two valence protons and four valence neutron holes. The agreement is generaly satisfactory for the observed odd-parity levels and for even parity levels with J > 12; those with J = 6 to 12 are better accounted for by weak coupling of two valence protons to a 204 Pb core in its 0 + 1, 2 + 1 and 4 + 1 states. 33 refs., 7 tabs., 12 figs

  17. Clusters of galaxies associated with quasars. I. 3C 206

    International Nuclear Information System (INIS)

    Ellingson, E.; Yee, H.K.C.; Green, R.F.; Kinman, T.D.

    1989-01-01

    Multislit spectroscopy and three-color CCD photometry of the galaxies in the cluster associated with the quasar 3C 206 (PKS 0837-12) at z = 0.198 are presented. This cluster is the richest environment of any low-redshift quasar observed in an Abell richness class 1 cluster. The cluster has a very flattened structure and a very concentrated core about the quasar. Most of the galaxies in this field have colors and luminosities consistent with normal galaxies at this redshift. The background-corrected blue fraction of galaxies is consistent with values for other rich clusters. The existence of several blue galaxies in the concentrated cluster core is an anomaly for a region of such high galaxy density, however, suggesting the absence of a substantial intracluster medium. This claim is supported by the Fanaroff-Riley (1974) class II morphology of the radio source. The velocity dispersion calculated from 11 spectroscopically confirmed cluster members is 500 + or - 110 km/s, which is slightly lower than the average for Abell class 1 clusters. A high frequency of interaction between the quasar host galaxy and cluster core members at low relative velocities, and a low intracluster gas pressure, may comprise a favorable environment for quasar activity. The properties of the cluster of galaxies associated with 3C 206 are consistent with this model. 59 refs

  18. 9 CFR 381.206 - Labeling of shipping containers of poultry products offered for entry.

    Science.gov (United States)

    2010-01-01

    ... PRODUCTS INSPECTION AND VOLUNTARY INSPECTION AND CERTIFICATION POULTRY PRODUCTS INSPECTION REGULATIONS... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Labeling of shipping containers of poultry products offered for entry. 381.206 Section 381.206 Animals and Animal Products FOOD SAFETY AND...

  19. Structural analysis and dimerization profile of the SCAN domain of the pluripotency factor Zfp206

    KAUST Repository

    Liang, Yu; Huimei Hong, Felicia; Ganesan, Pugalenthi; Jiang, Sizun; Jauch, Ralf; Stanton, Lawrence W.; Kolatkar, Prasanna R.

    2012-01-01

    Zfp206 (also named as Zscan10) belongs to the subfamily of C2H2 zinc finger transcription factors, which is characterized by the N-terminal SCAN domain. The SCAN domain mediates self-association and association between the members of SCAN family transcription factors, but the structural basis and selectivity determinants for complex formation is unknown. Zfp206 is important for maintaining the pluripotency of embryonic stem cells presumably by combinatorial assembly of itself or other SCAN family members on enhancer regions. To gain insights into the folding topology and selectivity determinants for SCAN dimerization, we solved the 1.85 crystal structure of the SCAN domain of Zfp206. In vitro binding studies using a panel of 20 SCAN proteins indicate that the SCAN domain Zfp206 can selectively associate with other members of SCAN family transcription factors. Deletion mutations showed that the N-terminal helix 1 is critical for heterodimerization. Double mutations and multiple mutations based on the Zfp206SCAN-Zfp110SCAN model suggested that domain swapped topology is a possible preference for Zfp206SCAN-Zfp110SCAN heterodimer. Together, we demonstrate that the Zfp206SCAN constitutes a protein module that enables C2H2 transcription factor dimerization in a highly selective manner using a domain-swapped interface architecture and identify novel partners for Zfp206 during embryonal development. 2012 The Author(s).

  20. 34 CFR 682.206 - Due diligence in making a loan.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 3 2010-07-01 2010-07-01 false Due diligence in making a loan. 682.206 Section 682.206 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF POSTSECONDARY... Due diligence in making a loan. (a) General. (1) Loan-making duties include determining the borrower's...

  1. 9 CFR 93.206 - Declaration and other documents for poultry.

    Science.gov (United States)

    2010-01-01

    ... poultry. 93.206 Section 93.206 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE EXPORTATION AND IMPORTATION OF ANIMALS (INCLUDING POULTRY) AND ANIMAL PRODUCTS IMPORTATION OF CERTAIN ANIMALS, BIRDS, FISH, AND POULTRY, AND CERTAIN ANIMAL, BIRD, AND POULTRY PRODUCTS...

  2. 24 CFR 206.107 - Mortgagee election of assignment or shared premium option.

    Science.gov (United States)

    2010-04-01

    ... § 206.123(a)(2)-(5). (v) The mortgage is a first lien of record and title to the property securing the... under any of the circumstances described in § 206.123(a)(2)-(5). (b) No election for shared appreciation. Shared appreciation mortgages shall be insured by the Secretary only under the shared premium option. [54...

  3. Structural analysis and dimerization profile of the SCAN domain of the pluripotency factor Zfp206

    KAUST Repository

    Liang, Yu

    2012-06-26

    Zfp206 (also named as Zscan10) belongs to the subfamily of C2H2 zinc finger transcription factors, which is characterized by the N-terminal SCAN domain. The SCAN domain mediates self-association and association between the members of SCAN family transcription factors, but the structural basis and selectivity determinants for complex formation is unknown. Zfp206 is important for maintaining the pluripotency of embryonic stem cells presumably by combinatorial assembly of itself or other SCAN family members on enhancer regions. To gain insights into the folding topology and selectivity determinants for SCAN dimerization, we solved the 1.85 crystal structure of the SCAN domain of Zfp206. In vitro binding studies using a panel of 20 SCAN proteins indicate that the SCAN domain Zfp206 can selectively associate with other members of SCAN family transcription factors. Deletion mutations showed that the N-terminal helix 1 is critical for heterodimerization. Double mutations and multiple mutations based on the Zfp206SCAN-Zfp110SCAN model suggested that domain swapped topology is a possible preference for Zfp206SCAN-Zfp110SCAN heterodimer. Together, we demonstrate that the Zfp206SCAN constitutes a protein module that enables C2H2 transcription factor dimerization in a highly selective manner using a domain-swapped interface architecture and identify novel partners for Zfp206 during embryonal development. 2012 The Author(s).

  4. 31 CFR 560.206 - Prohibited trade-related transactions with Iran; goods, technology, or services.

    Science.gov (United States)

    2010-07-01

    ... with Iran; goods, technology, or services. 560.206 Section 560.206 Money and Finance: Treasury... Iran; goods, technology, or services. (a) Except as otherwise authorized pursuant to this part, and... services of Iranian origin or owned or controlled by the Government of Iran; or (2) Goods, technology, or...

  5. 30 CFR 206.176 - How do I perform accounting for comparison?

    Science.gov (United States)

    2010-07-01

    ... paragraphs (b) and (c) of this section, the actual dual accounting value, for royalty purposes, is the... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How do I perform accounting for comparison? 206... REVENUE MANAGEMENT PRODUCT VALUATION Indian Gas § 206.176 How do I perform accounting for comparison? (a...

  6. 30 CFR 206.173 - How do I calculate the alternative methodology for dual accounting?

    Science.gov (United States)

    2010-07-01

    ... measured at facility measurement points whose quality exceeds 1,000 Btu/cf are subject to dual accounting... for dual accounting? 206.173 Section 206.173 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT... the alternative methodology for dual accounting? (a) Electing a dual accounting method. (1) If you are...

  7. 48 CFR 206.303-70 - Acquisitions in support of operations in Iraq or Afghanistan.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Acquisitions in support of operations in Iraq or Afghanistan. 206.303-70 Section 206.303-70 Federal Acquisition Regulations System... Afghanistan. The justification and approval addressed in FAR 6.303 is not required for acquisitions conducted...

  8. 45 CFR 2522.206 - What suitability criteria must I apply to a covered position?

    Science.gov (United States)

    2010-10-01

    ... covered position? 2522.206 Section 2522.206 Public Welfare Regulations Relating to Public Welfare... covered position? An individual is ineligible to serve in a covered position if the individual: (a) Is registered, or required to be registered, on a State sex offender registry or the National Sex Offender...

  9. 19 CFR 206.55 - Investigations to evaluate the effectiveness of relief.

    Science.gov (United States)

    2010-04-01

    ... relief. 206.55 Section 206.55 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION NONADJUDICATIVE INVESTIGATIONS INVESTIGATIONS RELATING TO GLOBAL AND BILATERAL SAFEGUARD ACTIONS, MARKET DISRUPTION, TRADE... facilitating positive adjustment by the domestic industry to import competition, consistent with the reasons...

  10. 19 CFR 206.54 - Investigations with respect to extension of action.

    Science.gov (United States)

    2010-04-01

    .... 206.54 Section 206.54 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION NONADJUDICATIVE INVESTIGATIONS INVESTIGATIONS RELATING TO GLOBAL AND BILATERAL SAFEGUARD ACTIONS, MARKET DISRUPTION, TRADE... recognized union, or group of workers, which is representative of the industry producing the domestic article...

  11. 19 CFR 206.12 - Definitions applicable to subpart B of this part.

    Science.gov (United States)

    2010-04-01

    .... 206.12 Section 206.12 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION NONADJUDICATIVE INVESTIGATIONS INVESTIGATIONS RELATING TO GLOBAL AND BILATERAL SAFEGUARD ACTIONS, MARKET DISRUPTION, TRADE... commitments that a firm in the domestic industry, a certified or recognized union or group of workers in the...

  12. 20 CFR 802.206 - Effect of motion for reconsideration on time for appeal.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Effect of motion for reconsideration on time for appeal. 802.206 Section 802.206 Employees' Benefits BENEFITS REVIEW BOARD, DEPARTMENT OF LABOR... administrative law judge or deputy commissioner shall suspend the running of the time for filing a notice of...

  13. 42 CFR 403.206 - General standards for Medicare supplemental policies.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false General standards for Medicare supplemental policies. 403.206 Section 403.206 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL PROVISIONS SPECIAL PROGRAMS AND PROJECTS Medicare Supplemental Policies...

  14. 17 CFR 275.206(3)-2 - Agency cross transactions for advisory clients.

    Science.gov (United States)

    2010-04-01

    ... advisory clients. 275.206(3)-2 Section 275.206(3)-2 Commodity and Securities Exchanges SECURITIES AND... Agency cross transactions for advisory clients. (a) An investment adviser, or a person registered as a... advisory client, if: (1) The advisory client has executed a written consent prospectively authorizing the...

  15. 30 CFR 206.108 - Does MMS protect information I provide?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Does MMS protect information I provide? 206.108... MANAGEMENT PRODUCT VALUATION Federal Oil § 206.108 Does MMS protect information I provide? Certain information you submit to MMS regarding valuation of oil, including transportation allowances, may be exempt...

  16. 30 CFR 206.365 - Does MMS protect information I provide?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Does MMS protect information I provide? 206.365... MANAGEMENT PRODUCT VALUATION Geothermal Resources § 206.365 Does MMS protect information I provide? Certain information you submit to MMS regarding royalties or fees on geothermal resources or byproducts, including...

  17. 21 CFR 10.206 - Procedures for electronic media coverage of agency public administrative proceedings.

    Science.gov (United States)

    2010-04-01

    ..., whenever possible, provide advance notice to the Press Relations Staff (HFI-20), Office of Public Affairs... required by the presiding officer. If so, the Press Relations Staff will function as a liaison between the... public administrative proceedings. 10.206 Section 10.206 Food and Drugs FOOD AND DRUG ADMINISTRATION...

  18. 17 CFR 275.206(3)-3T - Temporary rule for principal trades with certain advisory clients.

    Science.gov (United States)

    2010-04-01

    ... trades with certain advisory clients. 275.206(3)-3T Section 275.206(3)-3T Commodity and Securities... 1940 § 275.206(3)-3T Temporary rule for principal trades with certain advisory clients. (a) An..., sells to or purchases from an advisory client any security if: (1) The investment adviser exercises no...

  19. 17 CFR 275.206(4)-2 - Custody of funds or securities of clients by investment advisers.

    Science.gov (United States)

    2010-04-01

    ... of clients by investment advisers. 275.206(4)-2 Section 275.206(4)-2 Commodity and Securities... 1940 § 275.206(4)-2 Custody of funds or securities of clients by investment advisers. (a) Safekeeping... client funds or securities unless: (1) Qualified custodian. A qualified custodian maintains those funds...

  20. miR-206 inhibits cell proliferation, migration, and invasion by targeting BAG3 in human cervical cancer.

    Science.gov (United States)

    Wang, Yingying; Tian, Yongjie

    2018-01-02

    miR-206 and bcl2-associated athanogene 3 (BAG3) have been suggested as important regulators in various cancer types. However, the biological role of miR-206 and BAG3 in cervical cancer (CC) remains unclear. Here, we investigated the expressions and mechanisms of miR-206 and BAG3 in cervical cancer using in vitro and in vivo assays. In the present study, miR-206 expression was expressed at a lower level in CC tissues and cells than adjacent normal tissues and NEEC cells. By contrast, BAG3 mRNA and protein were expressed at higher levels in CC tissues and cells. Furthermore, miR-206 overexpression repressed cell proliferation, migration and invasion in vitro, and the 3'-untranslated region (3'-UTR) of BAG3 was a direct target of miR-206. miR-206 overexpression also inhibited EGFR, Bcl-2 and MMP2/9 protein expression, but promoted Bax protein expression. Besides, BAG3 over-expression partially abrogated miR-206-inhibited cell proliferation and invasion, while BAG3 silencing enhanced miR206-mediated inhibition. In vivo assay revealed that miR-206 repressed tumor growth in nude mice xenograft model. In conclusion, miR-206 inhibits cell proliferation, migration, and invasion by targeting BAG3 in human cervical cancer. Thus, miR-206-BAG3 can be used as a useful target for cervical cancer.

  1. 76 FR 72240 - Twenty-Seventh Meeting: RTCA Special Committee 206: Aeronautical Information and Meteorological...

    Science.gov (United States)

    2011-11-22

    ... DEPARTMENT OF TRANSPORTATION Federal Aviation Administration Twenty-Seventh Meeting: RTCA Special... Administration (FAA), U.S. Department of Transportation (DOT). ACTION: Notice of RTCA Special Committee 206..., 2011 FRAC OSED [[Page 72241

  2. Soluble CD206 plasma levels in rheumatoid arthritis reflect decrease in disease activity

    DEFF Research Database (Denmark)

    Heftdal, Line Dam; Stengaard-Pedersen, Kristian; Ørnbjerg, Lykke Midtbøll

    2017-01-01

    internalization and degradation. The soluble form has been suggested as a biomarker of M2A-macrophage activation. The aim of this study was to investigate sCD206 plasma levels in early RA patients initiating anti-TNFα treatment. Plasma levels of sCD206 were measured by ELISA in samples from 155 early RA patients...... from baseline after 6 months. In the ADA group, however, levels remained lower than baseline throughout the treatment period. In conclusion, initially, plasma sCD206 in early RA patients decreased in accordance with disease activity and initiation of DMARD treatment. Treatment with anti-TNFα preserved......Rheumatoid arthritis (RA) is characterized by chronic joint inflammation and infiltration by activated macrophages. TNFα is a central mediator in this process. The mannose receptor, CD206, is a scavenger receptor expressed by M2A-macrophages and dendritic cells. It is involved in collagen...

  3. 5 CFR 892.206 - Can I cancel my waiver and participate in premium conversion?

    Science.gov (United States)

    2010-01-01

    ... (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) FEDERAL FLEXIBLE BENEFITS PLAN: PRE-TAX PAYMENT OF HEALTH BENEFITS PREMIUMS Eligibility and Participation § 892.206 Can I cancel my waiver and participate in premium...

  4. Fusion of 8He with 206Pb around Coulomb barrier energies

    Directory of Open Access Journals (Sweden)

    Raabe R.

    2011-10-01

    Full Text Available The experimental study of the fusion of light neutron-rich nucleus 8He with 206Pb is reported in this work. A fusion stack of 206Pb targets has been used for this study. The most prominent evaporation residue (210Po, which has half-life of 138 days and decays by alpha emission, is populated in the reaction. Radiochemical analysis technique is used to extract the yield of this evaporation residue.

  5. Internal motions in H II regions. XI. The emission nebula sharpless 206

    International Nuclear Information System (INIS)

    Pismis, P.; Hasse, I.

    1982-01-01

    Radial velocities at 142 points are obtained on the H II region S206 by photographic Fabry-Perot interferometry using the reflectors with apertures of 2.1 meters at San Pedro Martir and 1 m at Tonantzintla. The overall velocity agrees with previous determinations. Our velocities cover the western faint extensions of the nebula not studied hitherto. The velocity field is consistent with a directional expansion of S206. (author)

  6. miR-206/133b Cluster: A Weapon against Lung Cancer?

    Directory of Open Access Journals (Sweden)

    Jing-Yu Pan

    2017-09-01

    Full Text Available Lung cancer is a deadly disease that ends numerous lives around the world. MicroRNAs (miRNAs are a group of non-coding RNAs involved in a variety of biological processes, such as cell growth, organ development, and tumorigenesis. The miR-206/133b cluster is located on the human chromosome 6p12.2, which is essential for growth and rebuilding of skeletal muscle. The miR-206/133b cluster has been verified to be dysregulated and plays a crucial role in lung cancer. miR-206 and miR-133b participate in lung tumor cell apoptosis, proliferation, migration, invasion, angiogenesis, drug resistance, and cancer treatment. The mechanisms are sophisticated, involving various target genes and molecular pathways, such as MET, EGFR, and the STAT3/HIF-1α/VEGF signal pathway. Hence, in this review, we summarize the role and potential mechanisms of the miR-206/133b cluster in lung cancer. Keywords: lung cancer, miR-206/133b cluster, miR-206, miR-133b

  7. Neutron capture studies of {sup 206}Pb at a cold neutron beam

    Energy Technology Data Exchange (ETDEWEB)

    Schillebeeckx, P.; Kopecky, S.; Quetel, C.R.; Tresl, I.; Wynants, R. [Institute for Reference Materials and Measurements, European Commission, Joint Research Centre, Geel (Belgium); Belgya, T.; Szentmiklosi, L. [Institute for Energy Security and Environmental Safety, Centre for Energy Research, Budapest (Hungary); Borella, A. [Institute for Reference Materials and Measurements, European Commission, Joint Research Centre, Geel (Belgium); SCK CEN, Mol (Belgium); Mengoni, A. [Nuclear Data Section, International Atomic Energy Agency (IAEA), Wagramerstrasse 5, PO Box 100, Vienna (Austria); Agenzia Nazionale per le Nuove Tecnologie, l' Energia e lo Sviluppo Economico Sostenibile (ENEA), Bologna (Italy)

    2013-11-15

    Gamma-ray transitions following neutron capture in {sup 206}Pb have been studied at the cold neutron beam facility of the Budapest Neutron Centre using a metallic sample enriched in {sup 206}Pb and a natural lead nitrate powder pellet. The measurements were performed using a coaxial HPGe detector with Compton suppression. The observed {gamma} -rays have been incorporated into a decay scheme for neutron capture in {sup 206}Pb. Partial capture cross sections for {sup 206}Pb(n, {gamma}) at thermal energy have been derived relative to the cross section for the 1884 keV transition after neutron capture in {sup 14}N. From the average crossing sum a total thermal neutron capture cross section of 29{sup +2}{sub -1} mb was derived for the {sup 206}Pb(n, {gamma}) reaction. The thermal neutron capture cross section for {sup 206}Pb has been compared with contributions due to both direct capture and distant unbound s-wave resonances. From the same measurements a thermal neutron-induced capture cross section of (649 {+-} 14) mb was determined for the {sup 207}Pb(n, {gamma}) reaction. (orig.)

  8. Overexpression of miR-206 suppresses glycolysis, proliferation and migration in breast cancer cells via PFKFB3 targeting

    Energy Technology Data Exchange (ETDEWEB)

    Ge, Xin; Lyu, Pengwei; Cao, Zhang; Li, Jingruo; Guo, Guangcheng; Xia, Wanjun; Gu, Yuanting, E-mail: zzyuantinggu@126.com

    2015-08-07

    miRNAs, sorting as non-coding RNAs, are differentially expressed in breast tumor and act as tumor promoters or suppressors. miR-206 could suppress the progression of breast cancer, the mechanism of which remains unclear. The study here was aimed to investigate the effect of miR-206 on human breast cancers. We found that miR-206 was down-regulated while one of its predicted targets, 6-Phosphofructo-2-kinase (PFKFB3) was up-regulated in human breast carcinomas. 17β-estradiol dose-dependently decreased miR-206 expression as well as enhanced PFKFB3 mRNA and protein expression in estrogen receptor α (ERα) positive breast cancer cells. Furthermore, we identified that miR-206 directly interacted with 3′-untranslated region (UTR) of PFKFB3 mRNA. miR-206 modulated PFKFB3 expression in MCF-7, T47D and SUM159 cells, which was influenced by 17β-estradiol depending on ERα expression. In addition, miR-206 overexpression impeded fructose-2,6-bisphosphate (F2,6BP) production, diminished lactate generation and reduced cell proliferation and migration in breast cancer cells. In conclusion, our study demonstrated that miR-206 regulated PFKFB3 expression in breast cancer cells, thereby stunting glycolysis, cell proliferation and migration. - Highlights: • miR-206 was down-regulated and PFKFB3 was up-regulated in human breast carcinomas. • 17β-estradiol regulated miR-206 and PFKFB3 expression in ERα+ cancer cells. • miR-206directly interacted with 3′-UTR of PFKFB3 mRNA. • miR-206 fructose-2,6-bisphosphate (F2,6BP) impeded production and lactate generation. • miR-206 reduced cell proliferation and migration in breast cancer cells.

  9. Astatine-211 labeling. A study towards automatic production of astatinated antibodies

    International Nuclear Information System (INIS)

    Emma Aneheim; Per Albertsson; Sture Lindegren; Holger Jensen

    2015-01-01

    Targeted alpha therapy is especially interesting for therapy of microscopic cancer tumors due to short path length and high linear energy transfer of the alpha particles. One of the most promising nuclides for targeted alpha therapy is 211 At. To facilitate larger clinical studies using 211 At, the current manual synthesis of radiolabeled antibodies would benefit from being transferred into an automated method. In this work, successful modifications of the manual synthesis have been performed in order to adapt it to automation. The automatic synthesis has also been tested using the modified synthesis method. (author)

  10. Determination of the neutron resonance parameters for 206Pb and of the thermal neutron capture cross section for 206Pb and 209Bi

    International Nuclear Information System (INIS)

    Borella, A.

    2005-01-01

    Chapter 1 describes the motivation of the measurements (accelerator driven systems, stellar nucleosynthesis, neutron induced reactions on 206 Pb), the present status of the neutron capture data for 206 Pb and 209 Bi and the structure of this work. In Chapter 2 the basic reaction theory underlying this work is described. The neutron induced reaction mechanism and formalism are explained. The parameterisation of the cross section in terms of R-matrix theory is discussed and we put particular emphasis on the statistical behaviour of the resonance parameters and the impact of the angular distribution of gamma rays following neutron capture. The relation between experimental observables and the resonance parameters is discussed together with general comments related to resonance shape analysis. Chapter 3 is focused on the determination of resonance parameters for 206 Pb. We performed high-resolution transmission and capture measurements at the Time-Of-Flight (TOF) facility GELINA of the IRMM at Geel (B) and determined the resonance parameters. For nuclei like 206 Pb, where the total width is dominated by Γ n , the capture area allows to determine G . Transmission measurements were carried out to determine Γ n , and the statistical factor g of resonances. Before performing a Resonance Shape Analysis (RSA) on the transmission and capture data, we verified the neutron flux and resolution at GELINA. We also compared the characteristics of GELINA with those of the n-TOF facility at CERN. A special emphasis is placed on the total energy detection technique using C 6 D 6 detectors. This technique was applied for the determination of the capture cross section. To reduce systematic bias effects on the capture cross section, the response of the detectors was determined by Monte Carlo simulations, which has been validated by experiments. Using these response functions the partial capture cross sections for individual resonances of 206 Pb have been deduced, by unfolding the

  11. Evaluation of composite components on the Bell 206L and Sikorsky S-76 helicopters

    Science.gov (United States)

    Baker, Donald J.

    1990-01-01

    Progress on two programs to evaluate structural composite components in flight service on Bell 206L and Sikorsky S-76 commercial helicopters is described. Forty ship sets of composite components that include the litter door, baggage door, forward fairing, and vertical fin have been installed on Bell Model 206L helicopters that are operating in widely different climates. Component installation started in 1981 and selected components were removed and tested at prescribed intervals over a ten year evaluation. Four horizontal stabilizers and eleven tail rotor spars that are production components on the S-76 helicopter were tested after prescribed periods of service to determine the effects of the operating environment on their performance. Concurrent with the flight evaluation, materials used to fabricate the components were exposed in ground racks and tested at specified intervals to determine the effects of outdoor environments. Results achieved from 123,000 hours of accumulated service on the Bell 206L components and 53,000 hours on the Sikorsky S-76 components are reported. Seventy-eight Bell 206L components were removed and tested statically. Results of seven years of ground exposure of materials used to fabricate the Bell 206L components are presented. Results of tests on four Sikorsky S-76 horizontal stabilizers and eleven tail rotor spars are also presented. Panels of material used to fabricate the Sikorsky S-76 components that were exposed for six years were tested and results are presented.

  12. Interplay among solidification, microstructure, residual strain and hot tearing in B206 aluminum alloy

    Energy Technology Data Exchange (ETDEWEB)

    D’Elia, F., E-mail: f.delia10@gmail.com [Centre for Near-net-shape Processing of Materials, Ryerson University, 101 Gerrard St. East, Toronto, Ontario, Canada M5B 2K3 (Canada); Ravindran, C. [Centre for Near-net-shape Processing of Materials, Ryerson University, 101 Gerrard St. East, Toronto, Ontario, Canada M5B 2K3 (Canada); Sediako, D. [Canadian Neutron Beam Centre, Chalk River Laboratories, Chalk River, Ontario, Canada K0J 1J0 (Canada)

    2015-01-29

    Hot tearing is a complex phenomenon attributed to alloy solidification, microstructure and stress/strain development within a casting. In this research, the conditions associated with the formation of hot tears in B206 aluminum alloy were investigated. Neutron diffraction strain mapping was carried out on three B206 castings with varying levels of titanium (i.e. unrefined, 0.02 and 0.05 wt%). Titanium additions effectively reduced grain size and transformed grain morphology from coarse dendrites to fine globular grains. Further, thermal analysis suggested that grain refinement delayed the onset of dendrite coherency in B206 and therefore enhanced the duration of bulk liquid metal feeding for the refined casting conditions. As a result, the interactive effects of such factors resulted in a more uniform distribution of strain, and subsequent higher resistance to hot tearing for the grain refined castings.

  13. Crystal optimization and preliminary diffraction data analysis of the SCAN domain of Zfp206

    International Nuclear Information System (INIS)

    Liang, Yu; Choo, Siew Hua; Rossbach, Michael; Baburajendran, Nithya; Palasingam, Paaventhan; Kolatkar, Prasanna R

    2012-01-01

    Crystals of the SCAN domain of Zfp206 are tetragonal, belonging to space group I422 with unit-cell parameters a = 67.57, c = 87.54 Å and one molecule in the asymmetric unit, and diffract to 1.85 Å resolution. Zfp206 (also named Zscan10) is a transcription factor that plays an important role in maintaining the pluripotent state of embryonic stem cells. Zfp206 is a member of the SCAN-domain family of C 2 H 2 zinc-finger transcription factors. The SCAN domain is a highly conserved motif of 84 residues which mediates the self-association of and heterodimerization between SCAN-domain family transcription factors. The SCAN domain may therefore be the key to the selective oligomerization of and may combinatorially enhance the regulatory versatility of C 2 H 2 zinc fingers. This paper describes crystallization attempts with the SCAN domain of Zfp206 (Zfp206SCAN) and optimization strategies to obtain diffraction-quality crystals. The best diffracting crystal was grown in a solution consisting of 0.3 M ammonium sulfate, 0.1 M Tris–HCl pH 8.6, 25% PEG 3350, 0.1 M ethylenediaminetetraacetic acid disodium salt dehydrate (EDTA) using the hanging-drop vapour-diffusion technique. Optimized crystals diffracted to 1.85 Å resolution and belonged to space group I422, with unit-cell parameters a = 67.57, c = 87.54 Å. A Matthews analysis indicated the presence of one Zfp206SCAN molecule per asymmetric unit

  14. Astrophysical relevance of the low-energy dipole strength of 206Pb

    Science.gov (United States)

    Tonchev, A. P.; Tsoneva, N.; Goriely, S.; Bhatia, C.; Arnold, C. W.; Hammond, S. L.; Kelley, J. H.; Kwan, E.; Lenske, H.; Piekarewicz, J.; Raut, R.; Rusev, G.; Shizuma, T.; Tornow, W.

    2018-05-01

    The dipole strength of 206Pb was studied below the neutron separation energy using photon scattering experiments at the HIGS facility. Utilizing the technique of nuclear resonance fluorescence with 100% linearly-polarized photon beams, the spins, parities, branching ratios and decay widths of excited states in 206Pb from 4.9 - 8.1 MeV have been measured. The new experimental information is used to reliably predict the neutron capture cross section of 205Pb, an important branch point nucleus along the s-process path of nucleosynthesis.

  15. Astrophysical relevance of the low-energy dipole strength of 206Pb

    Directory of Open Access Journals (Sweden)

    Tonchev A.P.

    2018-01-01

    Full Text Available The dipole strength of 206Pb was studied below the neutron separation energy using photon scattering experiments at the HIGS facility. Utilizing the technique of nuclear resonance fluorescence with 100% linearly-polarized photon beams, the spins, parities, branching ratios and decay widths of excited states in 206Pb from 4.9 - 8.1 MeV have been measured. The new experimental information is used to reliably predict the neutron capture cross section of 205Pb, an important branch point nucleus along the s-process path of nucleosynthesis.

  16. miR-206 represses hypertrophy of myogenic cells but not muscle fibers via inhibition of HDAC4.

    Science.gov (United States)

    Winbanks, Catherine E; Beyer, Claudia; Hagg, Adam; Qian, Hongwei; Sepulveda, Patricio V; Gregorevic, Paul

    2013-01-01

    microRNAs regulate the development of myogenic progenitors, and the formation of skeletal muscle fibers. However, the role miRNAs play in controlling the growth and adaptation of post-mitotic musculature is less clear. Here, we show that inhibition of the established pro-myogenic regulator miR-206 can promote hypertrophy and increased protein synthesis in post-mitotic cells of the myogenic lineage. We have previously demonstrated that histone deacetylase 4 (HDAC4) is a target of miR-206 in the regulation of myogenic differentiation. We confirmed that inhibition of miR-206 de-repressed HDAC4 accumulation in cultured myotubes. Importantly, inhibition of HDAC4 activity by valproic acid or sodium butyrate prevented hypertrophy of myogenic cells otherwise induced by inhibition of miR-206. To test the significance of miRNA-206 as a regulator of skeletal muscle mass in vivo, we designed recombinant adeno-associated viral vectors (rAAV6 vectors) expressing miR-206, or a miR-206 "sponge," featuring repeats of a validated miR-206 target sequence. We observed that over-expression or inhibition of miR-206 in the muscles of mice decreased or increased endogenous HDAC4 levels respectively, but did not alter muscle mass or myofiber size. We subsequently manipulated miR-206 levels in muscles undergoing follistatin-induced hypertrophy or denervation-induced atrophy (models of muscle adaptation where endogenous miR-206 expression is altered). Vector-mediated manipulation of miR-206 activity in these models of cell growth and wasting did not alter gain or loss of muscle mass respectively. Our data demonstrate that although the miR-206/HDAC4 axis operates in skeletal muscle, the post-natal expression of miR-206 is not a key regulator of basal skeletal muscle mass or specific modes of muscle growth and wasting. These studies support a context-dependent role of miR-206 in regulating hypertrophy that may be dispensable for maintaining or modifying the adult skeletal muscle phenotype

  17. 34 CFR 206.1 - What are the special educational programs for students whose families are engaged in migrant and...

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false What are the special educational programs for students whose families are engaged in migrant and other seasonal farmwork? 206.1 Section 206.1 Education..., DEPARTMENT OF EDUCATION SPECIAL EDUCATIONAL PROGRAMS FOR STUDENTS WHOSE FAMILIES ARE ENGAGED IN MIGRANT AND...

  18. 17 CFR 275.206(4)-4 - Financial and disciplinary information that investment advisers must disclose to clients.

    Science.gov (United States)

    2010-04-01

    ... information that investment advisers must disclose to clients. 275.206(4)-4 Section 275.206(4)-4 Commodity and... disclose to clients. (a) It shall constitute a fraudulent, deceptive, or manipulative act, practice, or... fail to disclose to any client or prospective client all material facts with respect to: (1) A...

  19. 27 CFR 19.206 - Curtailment and extension of plant premises for the manufacture of eligible flavors.

    Science.gov (United States)

    2010-04-01

    ... of plant premises for the manufacture of eligible flavors. 19.206 Section 19.206 Alcohol, Tobacco... and extension of plant premises for the manufacture of eligible flavors. (a) General. The premises of... permit the use of the facilities for the manufacture of eligible flavors. (b) Qualifying documents. When...

  20. 18 CFR 376.206 - Delegation of functions of certain Commission staff members.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Delegation of functions... Conditions § 376.206 Delegation of functions of certain Commission staff members. When, by reason of... subordinate employee in the Office or Division of the highest grade and longest period of service in that...

  1. 24 CFR 983.206 - HAP contract amendments (to add or substitute contract units).

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false HAP contract amendments (to add or... Contract § 983.206 HAP contract amendments (to add or substitute contract units). (a) Amendment to substitute contract units. At the discretion of the PHA and subject to all PBV requirements, the HAP contract...

  2. 7 CFR 330.206 - Permits for plant pest movement associated with National Defense projects.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Permits for plant pest movement associated with... (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FEDERAL PLANT PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.206...

  3. 49 CFR 236.206 - Battery or power supply with respect to relay; location.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Battery or power supply with respect to relay..., AND APPLIANCES Automatic Block Signal Systems Standards § 236.206 Battery or power supply with respect to relay; location. The battery or power supply for each signal control relay circuit, where an open...

  4. 30 CFR 206.61 - What records must I keep and produce?

    Science.gov (United States)

    2010-07-01

    ... MANAGEMENT PRODUCT VALUATION Indian Oil § 206.61 What records must I keep and produce? (a) On request, you must make available sales, volume, and transportation data for production you sold, purchased, or..., Indian representatives, or other authorized persons may review and audit such data you possess, and MMS...

  5. 31 CFR 206.10 - Operation of and payments from the Cash Management Improvements Fund.

    Science.gov (United States)

    2010-07-01

    ... SERVICE MANAGEMENT OF FEDERAL AGENCY RECEIPTS, DISBURSEMENTS, AND OPERATION OF THE CASH MANAGEMENT IMPROVEMENTS FUND § 206.10 Operation of and payments from the Cash Management Improvements Fund. (a) The Cash... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Operation of and payments from the...

  6. 46 CFR 180.206 - Survival craft-vessels operating on Great Lakes routes.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Survival craft-vessels operating on Great Lakes routes... Craft § 180.206 Survival craft—vessels operating on Great Lakes routes. (a) Except as allowed by... with the survival craft required by § 180.205 (a) through (e), as appropriate. (b) Each vessel...

  7. 46 CFR 117.206 - Survival craft-vessels operating on Great Lakes routes.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft-vessels operating on Great Lakes routes... PASSENGERS LIFESAVING EQUIPMENT AND ARRANGEMENTS Number and Type of Survival Craft § 117.206 Survival craft... vessel certificated to operate on a Great Lakes route must be provided with the survival craft required...

  8. 7 CFR 205.206 - Crop pest, weed, and disease management practice standard.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Crop pest, weed, and disease management practice... Requirements § 205.206 Crop pest, weed, and disease management practice standard. (a) The producer must use management practices to prevent crop pests, weeds, and diseases including but not limited to: (1) Crop...

  9. 77 FR 30584 - Thirtieth Meeting: RTCA Special Committee 206, Aeronautical Information and Meteorological Data...

    Science.gov (United States)

    2012-05-23

    ... preliminary roadmap SG1 report SG2 report SG3 report SAE G-10 AI ARP Briefing to SC-206 Plenary 12:30 p.m... document for release to the PMC SG3 report PMC decision on TOR revision Action item review Future meeting...

  10. 44 CFR 206.120 - State administration of other needs assistance.

    Science.gov (United States)

    2010-10-01

    ... administrative options. The delivery of assistance under § 206.119 is contingent upon the State choosing an... contingent upon approval of a SAP, which describes the procedures the State will use to deliver assistance... expeditious reporting of allegations of fraud, waste or abuse to DHS Office of Inspector General. (x) Capacity...

  11. 50 CFR 223.206 - Exceptions to prohibitions relating to sea turtles.

    Science.gov (United States)

    2010-10-01

    ...) Fail to employ basket-style longline gear such that the mainline is deployed slack when fishing. (v... set between any two floats. Vessel operators using basket-style longline gear must set a minimum of 10... 14070, Mar. 23, 1999] Editorial Note: For Federal Register citations to § 223.206, see the List of CFR...

  12. 19 CFR 206.2 - Identification of type of petition or request.

    Science.gov (United States)

    2010-04-01

    ....2 Section 206.2 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION NONADJUDICATIVE INVESTIGATIONS INVESTIGATIONS RELATING TO GLOBAL AND BILATERAL SAFEGUARD ACTIONS, MARKET DISRUPTION, TRADE... petition or request, as the case may be, filed by an entity representative of a domestic industry under...

  13. 30 CFR 206.101 - What definitions apply to this subpart?

    Science.gov (United States)

    2010-07-01

    ... disposition of oil produced. Gross proceeds also include, but are not limited to, the following examples: (1... MANAGEMENT PRODUCT VALUATION Federal Oil § 206.101 What definitions apply to this subpart? The following... region at least as large as the limits of an oil field, in which oil has similar quality, economic, and...

  14. 30 CFR 206.100 - What is the purpose of this subpart?

    Science.gov (United States)

    2010-07-01

    ... for the lessee's oil by applying the rules in this subpart to your disposition of the lessee's oil. (c... in this subpart to the lessee's disposition of its oil. (d) If the regulations in this subpart are... MANAGEMENT PRODUCT VALUATION Federal Oil § 206.100 What is the purpose of this subpart? (a) This subpart...

  15. 30 CFR 206.452 - Coal subject to royalties-general provisions.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Coal subject to royalties-general provisions... MINERALS REVENUE MANAGEMENT PRODUCT VALUATION Indian Coal § 206.452 Coal subject to royalties—general provisions. (a) All coal (except coal unavoidably lost as determined by BLM pursuant to 43 CFR group 3400...

  16. 30 CFR 206.253 - Coal subject to royalties-general provisions.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Coal subject to royalties-general provisions... MINERALS REVENUE MANAGEMENT PRODUCT VALUATION Federal Coal § 206.253 Coal subject to royalties—general provisions. (a) All coal (except coal unavoidably lost as determined by BLM under 43 CFR part 3400) from a...

  17. Pygmy and core polarization dipole modes in 206Pb: Connecting nuclear structure to stellar nucleosynthesis

    Science.gov (United States)

    Tonchev, A. P.; Tsoneva, N.; Bhatia, C.; Arnold, C. W.; Goriely, S.; Hammond, S. L.; Kelley, J. H.; Kwan, E.; Lenske, H.; Piekarewicz, J.; Raut, R.; Rusev, G.; Shizuma, T.; Tornow, W.

    2017-10-01

    A high-resolution study of the electromagnetic response of 206Pb below the neutron separation energy is performed using a (γ → ,γ‧) experiment at the HI γ → S facility. Nuclear resonance fluorescence with 100% linearly polarized photon beams is used to measure spins, parities, branching ratios, and decay widths of excited states in 206Pb from 4.9 to 8.1 MeV. The extracted ΣB (E 1) ↑ and ΣB (M 1) ↑ values for the total electric and magnetic dipole strength below the neutron separation energy are 0.9 ± 0.2 e2fm2 and 8.3 ± 2.0 μN2, respectively. These measurements are found to be in very good agreement with the predictions from an energy-density functional (EDF) plus quasiparticle phonon model (QPM). Such a detailed theoretical analysis allows to separate the pygmy dipole resonance from both the tail of the giant dipole resonance and multi-phonon excitations. Combined with earlier photonuclear experiments above the neutron separation energy, one extracts a value for the electric dipole polarizability of 206Pb of αD = 122 ± 10 mb /MeV. When compared to predictions from both the EDF+QPM and accurately calibrated relativistic EDFs, one deduces a range for the neutron-skin thickness of Rskin206 = 0.12- 0.19 fm and a corresponding range for the slope of the symmetry energy of L = 48- 60 MeV. This newly obtained information is also used to estimate the Maxwellian-averaged radiative cross section 205Pb (n , γ)206Pb at 30 keV to be σ = 130 ± 25 mb. The astrophysical impact of this measurement-on both the s-process in stellar nucleosynthesis and on the equation of state of neutron-rich matter-is discussed.

  18. 30 CFR 206.360 - What records must I keep to support my calculations of royalty or fees under this subpart?

    Science.gov (United States)

    2010-07-01

    ... calculations of royalty or fees under this subpart? 206.360 Section 206.360 Mineral Resources MINERALS... Resources § 206.360 What records must I keep to support my calculations of royalty or fees under this subpart? If you determine royalties or direct use fees for your geothermal resource under this subpart...

  19. 30 CFR 206.181 - How do I establish processing costs for dual accounting purposes when I do not process the gas?

    Science.gov (United States)

    2010-07-01

    ... accounting purposes when I do not process the gas? 206.181 Section 206.181 Mineral Resources MINERALS... Processing Allowances § 206.181 How do I establish processing costs for dual accounting purposes when I do not process the gas? Where accounting for comparison (dual accounting) is required for gas production...

  20. Experimental and theoretical investigations of the decays of 206Fr and 208Fr

    International Nuclear Information System (INIS)

    Ritchie, B.G.

    1979-01-01

    206 Fr and 208 Fr were mass separated and observed with large-volume semiconductor detectors in calibrated geometries. Alpha, gamma, and electron singles and gamma-gamma and gamma-electron coincidence data were taken. The alpha decay experiments permitted the determination of the alpha branching ratios for 206 208 Fr as well as 205 207 Fr. The method used includes the information obtained from the electron capture decay studies of those nuclei. The alpha branching ratios obtained are generally higher than those reported previously. Energies and half-lives are in general agreement with previous measurements. The alpha measurements also revealed the presence of a heretofore unobserved alpha-emitting isomer in 206 Fr. The isomer has a half-life of 0.7 +- 0.1 seconds, and the energy of the associated alpha decay is 6.930 +- 0.005 MeV. Gamma data taken with the alpha measurements suggest that the isomeric level is 531 keV above the 206 Fr ground state, with the associated alpha decay populating a level at 391 keV in the 202 At nucleus. Measured alpha branching ratios were analyzed with the Rasmussen reduced width formalism. All observed francium decays were deduced to be unhindered. This study produced detailed level schemes for 206 Rn and 208 Rn. The gamma and electron data permitted the determination of internal conversion coefficients, multipolarities, spins, and parities. It appears from systematics that two different bands of states above J/sup π/ = 4+ are populated by in-beam studies. The deduced level scheme of 208 Rn was studied in the interacting boson approximation (IBA) with the computer code PHINT. The level scheme is readily explained with this model up to around 2 MeV. Good agreement between theory and experiment was also obtained for 204 Rn and 206 Rn, but the limited detail in these decay schemes does not provide conclusive evidence for the applicability of the IBA. 28 figures, 10 tables

  1. [sup 205]Bi/[sup 206]Bi cyclotron production from Pb-isotopes for absorption studies in humans

    Energy Technology Data Exchange (ETDEWEB)

    Fischer, R.; Dresow, B.; Heinrich, H.C. (Universitaetskrankenhaus Eppendorf, Hamburg (Germany). Abt. Medizinische Biochemie); Wendel, J.; Bechtold, V. (Kernforschungszentrum Karlsruhe GmbH (Germany). Inst. fuer Kernphysik)

    1993-12-01

    Pb(p,xn) thick target excitation functions were measured in the energy range 10-38 MeV in order to optimize the production of isotopically pure radiobismuth from [sup nat]Pb, [sup 206]Pb, and [sup 207]Pb. Additionally, the decay of Po-isotopes from deuteron irradiation of natural bismuth ([sup 209]Bi) was exploited for radiobismuth production. [sup 205]Bi was produced from [sup 206]Pb at 20 MeV with only 2% of [sup 206]Bi at 4 weeks post irradiation. Bismuth compounds as used in the treatment of peptic ulcer were labeled with [sup 205]Bi for absorption studies in animals and subjects. (Author).

  2. Coulomb excitation of the two proton-hole nucleus $^{206}$Hg

    CERN Multimedia

    We propose to use Coulomb excitation of the single magic two-proton-hole nucleus $^{206}$Hg. In a single-step excitation both the first 2$^{+}$ and the highly collective octupole 3$^{-}$ states will be populated. Thus, information on both quadrupole and octupole collectivity will be gained in this neutron-rich nucleus. Due to the high beam intensity, we will be able to observe multi-step Coulomb excitation as well, providing further test on theoretical calculations. The results will be used to improve the predictive power of the shell model for more exotic nuclei as we move to lighter N=126 nuclei. The experiment will use the new HIE-ISOLDE facility and the MINIBALL array, and will take advantage of the recently developed $^{206}$Hg beam from the molten lead target.

  3. 206Pb/207Pb ratios in dry deposit samples from the Metropolitan Zone of Mexico Valle

    International Nuclear Information System (INIS)

    Martinez, T.; Lartigue, J.; Marquez, C.

    2007-01-01

    206 Pb/ 207 Pb isotope ratios of dry deposit samples in the Metropolitan Zone of Mexico Valley (MZMV) were determined and correlated with some contemporary environmental material such as gasoline, urban dust, etc., as possible pollution sources, the latter presenting different signatures. 206 Pb/ 207 Pb ratios were determined in samples 'as is' by ICP-MS, using an Elan-6100. A standard material NIST-981 was used to monitor accuracy and to correct mass fractionation. The calculated enrichment factors of lead (taking rubidium as a conservative endogenous element) show its anthropogenic origin with percentages higher than 97.65%. 206 Pb/ 207 Pb ratio in dry deposit samples ranges from 0.816 to a maximum of 1.154, following a normal distribution. Arithmetic mean was 0.9967±0.0864 lower than those of possible pollution sources: 1.1395±0.0165 for gasoline, 1.071±0.008 for industrially derived lead and, for the more radiogenic natural soil and urban dust values ranging from 1.2082±0.022 to 1.211±0.108. The possible origin of lead in gasoline used prior to 1960 is discussed. (author)

  4. 24 CFR 206.131 - Contract rights and obligations for mortgages on individual dwelling units in a condominium.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Contract rights and obligations for... MORTGAGE INSURANCE Contract Rights and Obligations Condominiums § 206.131 Contract rights and obligations...] Termination of Insurance Contract ...

  5. Maternal and foetal outcome of 206 high risk pregnancy cases in border guard hospital, dhaka.

    Science.gov (United States)

    Shapla, N R; Islam, M A; Shahida, S M; Parveen, Z; Lipe, Y S

    2015-04-01

    This observational study was carried out to identify the various types of high risk pregnancy and to determine the maternal and foetal outcome. The study was carried out on 206 pregnant high risk women in the Gynecology and Obstetrics department of Border Guard Hospital, Dhaka from January 2012 to December 2012. During mentioned period among 598 pregnant women 206 high risk pregnancy cases were randomly selected. Pregnant women (gestational age from 34 weeks upto 40 weeks) having medical condition and pregnancy related high risk factors were included and uncomplicated pregnancy, pregnancy before 37 weeks, post dated pregnancy were excluded from this study. Data was collected from semi structured history sheet and data analysis done by percentage. High risk pregnant women were grouped into three. Group A and Group B includes pregnant women having medical condition before and during pregnancy respectively. Group C consists of pregnant women had pregnancy related high risk issues. Among 206 high risk pregnancy cases majority 47.57% women had medical condition during pregnancy, 31.55% patient had medical condition before pregnancy. Among them majority 30.58% of the patient suffered from pregnancy induced hypertension, 15.04% patients suffered from gestational Diabetes Mellitus and premature rupture of membranes were 12.13%. In this study majority 43.68% of high risk pregnant patients were in age group of 30-35 years, 19.90% pregnant women were in age group of >35 years and 19.40% were in age group of upto 20 years. Among study groups maximum 65.04% of the patients were multiparous. Among 206 study population 60.19% high risk pregnant women were at term at the time of delivery and 39.8% women delivered their babies preterm. Caesarean section was done in 69.41% of high risk pregnant women. After delivery majority 77.66% women had no complication, only 10.19%, 8.25%, 2.91% and 0.97% high risk pregnant women suffered from fever, UTI, abdominal wound infection and post

  6. Serum microRNA miR-206 is decreased in hyperthyroidism and mediates thyroid hormone regulation of lipid metabolism in HepG2 human hepatoblastoma cells.

    Science.gov (United States)

    Zheng, Yingjuan; Zhao, Chao; Zhang, Naijian; Kang, Wenqin; Lu, Rongrong; Wu, Huadong; Geng, Yingxue; Zhao, Yaping; Xu, Xiaoyan

    2018-04-01

    The actions of thyroid hormone (TH) on lipid metabolism in the liver are associated with a number of genes involved in lipogenesis and lipid metabolism; however, the underlying mechanisms through which TH impacts on lipid metabolism remain to be elucidated. The present study aimed to investigate the effects of hyperthyroidism on the serum levels of the microRNA (miR) miR‑206 and the role of miR‑206 on TH‑regulated lipid metabolism in liver cells. Serum was obtained from 12 patients diagnosed with hyperthyroidism and 10 healthy control subjects. Human hepatoblastoma (HepG2) cells were used to study the effects of triiodothyronine (T3) and miR‑206 on lipid metabolism. Expression of miR‑206 in serum and cells was determined by reverse transcription‑quantitative polymerase chain reaction analysis. Lipid accumulation in HepG2 cells was assessed with Oil Red O staining. Suppression or overexpression of miR‑206 was performed via transfection with a miR‑206 mimic or miR‑206 inhibitor. Serum miR‑206 was significantly decreased in patients with hyperthyroidism compared with euthyroid controls. Treatment of HepG2 cells with T3 led to reduced total cholesterol (TC) and triglyceride (TG) content, accompanied by reduced miR‑206 expression. Inhibition of endogenous miR‑206 expression decreased intracellular TG and TC content in HepG2 cells. By contrast, overexpression of miR‑206 in HepG2 partially prevented the reduction in TG content induced by treatment with T3. In conclusion, serum miR‑206 expression is reduced in patients with hyperthyroidism. In addition, miR‑206 is involved in T3‑mediated regulation of lipid metabolism in HepG2 cells, indicating a role for miR‑206 in thyroid hormone‑induced disorders of lipid metabolism in the liver.

  7. Higgs Candidates in $e^+ e^-$ Interactions at $\\sqrt{s}$= 206.6 GeV

    CERN Document Server

    Acciarri, M; Adriani, O; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, L; Balandras, A; Baldew, S V; Todorova-Nová, S; Banerjee, Sw; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brochu, F; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Cucciarelli, S; Dai, T S; van Dalen, J A; D'Alessandro, R; De Asmundis, R; Déglon, P L; Degré, A; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Van Dierendonck, D N; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Dufournaud, D; Duinker, P; Durán, I; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ewers, A; Extermann, Pierre; Fabre, M; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Guida, M; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Hofer, H; Holzner, G; Hoorani, H; Hou, S R; Hu, Y; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Khan, R A; Käfer, D; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, J K; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopal, M; Kopp, A; Koutsenko, V F; Kräber, M H; Krämer, R W; Krenz, W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Levchenko, P M; Li Chuan; Likhoded, S A; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Lugnier, L; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mans, J; Marian, G; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Moulik, T; Muanza, G S; Muijs, A J M; Musicar, B; Musy, M; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nisati, A; Nowak, H; Ofierzynski, R A; Organtini, G; Oulianov, A; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Paramatti, R; Park, H K; Park, I H; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Pedace, M; Pensotti, S; Perret-Gallix, D; Petersen, B; Piccolo, D; Pierella, F; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Prokofiev, D O; Prokofev, D; Quartieri, J; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A V; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Rodin, J; Roe, B P; Romero, L; Rosca, A; Rosier-Lees, S; Roth, S; Rosenbleck, C; Rubio, Juan Antonio; Ruggiero, G; Rykaczewski, H; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Sanders, M P; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schopper, Herwig Franz; Schotanus, D J; Schwering, G; Sciacca, C; Seganti, A; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Sushkov, S V; Suter, H; Swain, J D; Szillási, Z; Sztaricskai, T; Tang, X W; Tauscher, Ludwig; Taylor, L; Tellili, B; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Vicinanza, D; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, M; Wang, X L; Wang, Z M; Weber, A; Weber, M; Wienemann, P; Wilkens, H; Wu, S X; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhu, G Y; Zhu, R Y; Zichichi, A; Zilizi, G; Zimmermann, B; Zöller, M

    2000-01-01

    In a search for the Standard Model Higgs boson, carried out on 212.5~$\\mathrm{pb^{-1}}$ of data collected by the L3 detector at the highest LEP centre-of-mass energies, including 116.5~$\\mathrm{pb^{-1}}$ above $\\sqrt{s} = 206$~GeV, an excess of candidates for the process $e^+ e^- \\rightarrow Z^{*}\\rightarrow HZ$ is found for Higgs masses near 114.5~GeV. We present an analysis of our data and the characteristics of our strongest candidates.

  8. Use of cement in concrete according to European standard EN 206-1

    Directory of Open Access Journals (Sweden)

    Christoph Müller

    2012-04-01

    Full Text Available The manufacture of cements with several main constituents (blended cements is of particular importance with regard to reducing climatically relevant CO2 emissions in the cement industry. A wide variety of common cement products exists in the different EU Member States. They match local manufacturing conditions, throughout meeting particular climatic or other local conditions, including building practices. In general, all cements conforming to European Cement Standard EN 197-1 are suitable for the manufacture of concrete according to European Concrete Standard EN 206-1. Depending on the area of application, however, differences related to the cement type may possibly have to be taken into account to ensure the durability of the concretes manufactured with these cements. These regulations were laid down in National Application Documents (NADs to EN 206-1 dependent upon the exposure classes that a structural element is assigned to. This paper deals with the overall concept of EN 206-1 with regard to concrete durability. It gives an overview of the cement types used in Europe and the areas of application of cements conforming to EN 197-1 in concrete conforming to EN 206-1 and various national annexes. The option of combining several main constituents makes blended cements particularly well suited for combining the advantages of individual main constituents, and thus for developing these cements into even more robust systems. This process requires an integrated assessment of all requirements to be met by cements during manufacture and application. From a technical perspective these include the strength formation potential as well as good workability of the concrete and, in particular, the durability of the concrete made from these cements. The effects that the main constituents have with regard to properties relevant to durability can be utilized in particular in cements made from a combination of limestone/blastfurnace slag or limestone/fly ash as

  9. Nucleon transfer reactions to rotational states induced by 206,208PB projectiles

    International Nuclear Information System (INIS)

    Wollersheim, H.J.; DeBoer, F.W.N.; Emling, H.; Grein, H.; Grosse, E.; Spreng, W.; Eckert, G.; Elze, Th.W.; Stelzer, K.; Lauterbach, Ch.

    1986-01-01

    In a systematic study of nucleon transfer reactions accompanied by Coulomb excitation the authors bombarded 152 Sm, 160 Gd and 232 Th with 206, 208 Pb beams at incident energies close to the Coulomb barrier. Particle-gamma coincidence techniques were used to identify excited states of reaction products populated through inelastic scattering and in nucleon transfer reactions. Large cross sections were observed for one- and two-neutron pick-up from 232 Th at an incident energy of 6.4 MeV/μ. The results are analyzed in the framework of semiclassical models

  10. Fission threshold determination of 209Bi and sup(204,206,207,208)Pb by electrofission

    International Nuclear Information System (INIS)

    Tuerck, D.

    1975-01-01

    At the Darmstadt electron linear accelerator the cross sections for the electrofission of 209 Bi were measured for electron energies between 24 and 70 MeV, for the separated lead isotopes sup(204,206,207,208)Pb between 38 and 50 MeV. For the determination of the fission thresholds the cross sections were examined by the virtuel photon method using calculations in first Born approximation for the point nucleus with Coulomb wave functions. The analytic functions fitting the fission probability were based on level densities after the Fermi-gas-model. (orig./WL) [de

  11. MR-Guided vacuum biopsy of 206 contrast-enhancing breast lesions; MRT-gefuehrte Vakuumbiopsie bei 206 Kontrastmittel anreichernden Laesionen der Mamma

    Energy Technology Data Exchange (ETDEWEB)

    Perlet, C.; Schneider, P.; Sittek, H.; Reiser, M.F. [Klinikum der Universitaet Grosshadern, Muenchen (Germany). Inst. fuer Klinische Radiologie; Amaya, B.; Grosse, A.; Heywang-Koebrunner, S.H. [Martin-Luther-Universitaet, Halle (Germany). Klinik fuer Diagnostische Radiologie

    2002-01-01

    Purpose: To determine the accuracy and clinical use of MR-guided vacuum biopsy (VB) of enhancing breast lesions. Material and Methods: 254 lesions were referred to MR-guided vacuum-assisted breast biopsy. In 43 (16%) patients the indication was dropped because the lesions could not be identified at the time VB was scheduled. This was due to hormonal influences (n=37), to too strong compression (n=3) or to misinterpretation of the initial diagnostic MRI. In 5 cases (2%) VB was not performed due to obesity (n=2); problems of access (n=2) or a defect of the MR-unit (n=1). VB was performed on altogether 206 lesions. In 4 cases (2%) VB was unsuccessful. This was immediately realized on the post-interventional images. Thus a false negative diagnosis was avoided. Verification included excision of the cavity in cases with proven malignancy or atypical ductal hyperplasia (ADH) and (for benign lesions) retrospective correlation of VB-histology with pre- and postinterventional MRI and subsequent follow-up. Results: 51/202 successful biopsies proved malignancy. In 7 cases ADH and in 144 cases a benign lesion was diagnosed. One DCIS was underestimated as ADH. All other benign or malignant diagnoses proved to be correct. Conclusion: MR-guided VB allows reliable histological work-up of contrast-enhancing small lesions which are not visible by any other modality. (orig.) [German] Zielsetzung: Evaluation der Wertigkeit und klinischen Anwendbarkeit der MRT-gefuehrten Vakuumbiopsie (VB) bei anreichernden Mammalaesionen. Material und Methoden: Insgesamt wurden 254 Laesionen der MRT-gefuehrten VB zugewiesen. Hiervon entfiel bei 43 Patientinnen (16%) die Biopsieindikation beim Planungs-MRT, da die urspruengliche Anreicherung hormonell (n=37), durch zu starke Kompression (n=3) oder durch eine Fehlinterpretation des vorausgegangenen diagnostischen MRT (n=3) nicht mehr abgrenzbar war. Bei 5 weiteren Laesionen (2%) war die Biopsie nicht moeglich (Adipositas n=2; Zugangsprobleme n=2; MRT

  12. Fatores que influenciaram a evolução de 206 pacientes com traumatismo craniencefálico grave Relevant factors in 206 patients with severe head injury

    Directory of Open Access Journals (Sweden)

    Venâncio Pereira Dantas Filho

    2004-06-01

    Full Text Available A busca de fatores prognósticos para o traumatismo craniencefálico (TCE tem sido alvo de muitos estudos nas últimas décadas. A identificação de indicadores consistentes da evolução destes pacientes tem representado um grande desafio e sua utilidade considerada evidente tanto para orientar o tratamento, quanto para a estimativa do resultado final. Baseados numa casuística de 206 pacientes com TCE grave (8 pontos ou menos pela Escala de Coma de Glasgow - ECG, estudamos a influência de vários fatores sobre a evolução dos pacientes. A gravidade inicial medida pela ECG, a presença de hipertensão intracraniana (níveis acima de 20 mmHg, o tipo de lesão intracraniana e a presença de hipoxia, hipotensão arterial e a associação de hipóxia e hipotensão arterial tiveram influência significativa sobre a evolução dos pacientes. A presença de politraumatismo (pelo menos dois sítios de lesão além do TCE e a idade (acima e abaixo de 40 anos não influenciaram significativamente a evolução dos pacientes desta casuística.The search for head injury prognostic factors has been intense in the last decades. The importance of identification of these factors has been also recognised to treatment orientation and results estimatives. Based on 206 severe head injuried patients series, we analized the influence of factors over the outcome. The initial severity by Glasgow coma scale, the presence of intracranial hypertension (over 20 mmHg, the type of intracranial lesion and the presence of hypoxia, systemic hypotension or both, significantly influenced the results. The presence of multiple traumas (at least two sites of lesion over head injury, as age, did not influence the final results in this series.

  13. Processing and geologic analysis of conventional cores from well ER-20-6 No. 1, Nevada Test Site

    International Nuclear Information System (INIS)

    Prothro, L.B.; Townsend, M.J.; Drellack, S.L. Jr

    1997-09-01

    In 1996, Well Cluster ER-20-6 was drilled on Pahute Mesa in Area 20, in the northwestern corner of the Nevada Test Site (NTS). The three wells of the cluster are located from 166 to 296 meters (m) (544 to 971 feet [ft]) southwest of the site of the underground nuclear test code-named BULLION, conducted in 1990 in Emplacement Hole U-20bd. The well cluster was planned to be the site of a forced-gradient experiment designed to investigate radionuclide transport in groundwater. To obtain additional information on the occurrence of radionuclides, nature of fractures, and lithology, a portion of Well ER-20-6 No. 1, the hole closest to the explosion cavity, was cored for later analysis. Bechtel Nevada (BN) geologists originally prepared the geologic interpretation of the Well Cluster ER-20-6 site and documented the geology of each well in the cluster. However, the cores from Well ER-20-6 No. 1 were not accessible at the time of that work. As the forced-gradient experiment and other radio nuclide migration studies associated with the well cluster progressed, it was deemed appropriate to open the cores, describe the geology, and re-package the core for long-term air-tight storage. This report documents and describes the processing, geologic analysis, and preservation of the conventional cores from Well ER20-6 No. 1

  14. Processing and geologic analysis of conventional cores from well ER-20-6 No. 1, Nevada Test Site

    Energy Technology Data Exchange (ETDEWEB)

    Prothro, L.B., Townsend, M.J.; Drellack, S.L. Jr. [and others

    1997-09-01

    In 1996, Well Cluster ER-20-6 was drilled on Pahute Mesa in Area 20, in the northwestern corner of the Nevada Test Site (NTS). The three wells of the cluster are located from 166 to 296 meters (m) (544 to 971 feet [ft]) southwest of the site of the underground nuclear test code-named BULLION, conducted in 1990 in Emplacement Hole U-20bd. The well cluster was planned to be the site of a forced-gradient experiment designed to investigate radionuclide transport in groundwater. To obtain additional information on the occurrence of radionuclides, nature of fractures, and lithology, a portion of Well ER-20-6 No. 1, the hole closest to the explosion cavity, was cored for later analysis. Bechtel Nevada (BN) geologists originally prepared the geologic interpretation of the Well Cluster ER-20-6 site and documented the geology of each well in the cluster. However, the cores from Well ER-20-6 No. 1 were not accessible at the time of that work. As the forced-gradient experiment and other radio nuclide migration studies associated with the well cluster progressed, it was deemed appropriate to open the cores, describe the geology, and re-package the core for long-term air-tight storage. This report documents and describes the processing, geologic analysis, and preservation of the conventional cores from Well ER20-6 No. 1.

  15. Shell model calculations for levels and transition rates in 204Pb and 206Pb

    International Nuclear Information System (INIS)

    Wang, D.; McEllistrem, M.T.

    1990-01-01

    Level energies and decay rates of both negative and positive parity levels of 206,204 Pb have been calculated through mixed-configuration shell model calculations using the modified surface delta interaction (MSDI), the Schiffer-True central interaction, and another two-body interaction. These calculations were all carried out with a full six-orbit neutron hole space. The predicted low-lying levels with the MSDI are in excellent agreement with experiments, accounting for the energies, spins, and parities of essentially all levels below 3 MeV excitation energy except known particle-hole collective excitations in both nuclei. Almost all calculated E2 and M1 transition rates are consistent with measured branching ratios for γ-ray decay of excited levels. The comparison of the observed and calculated levels demonstrates the important role played by the neutron-hole i 13/2 configuration in the levels of 204 Pb and 206 Pb, and interprets an apparent discrepancy over the character and energy spacings of 0 + levels in 204 Pb

  16. YOUNG STELLAR OBJECTS IN THE LARGE MAGELLANIC CLOUD STAR-FORMING REGION N206

    International Nuclear Information System (INIS)

    Romita, Krista Alexandra; Meixner, M.; Sewilo, M.; Shiao, B.; Carlson, Lynn Redding; Whitney, B.; Babler, B.; Meade, M.; Indebetouw, R.; Hora, J. L.

    2010-01-01

    We present analysis of the energetic star-forming region Henize 206 (N206) located near the southern edge of the Large Magellanic Cloud (LMC) based on photometric data from the Spitzer Surveying the Agents of Galaxy Evolution (SAGE-LMC; IRAC 3.6, 4.5, 5.8, 8.0 μm and MIPS 24 μm), Infrared Survey Facility near-infrared survey (J, H, K s ), and the Magellanic Clouds Photometric Survey (MCPS UBVI) covering a wavelength range of 0.36-24 μm. Young stellar object (YSO) candidates are identified based upon their location in infrared color-magnitude space and classified by the shapes of their spectral energy distributions in comparison with a pre-computed grid of YSO models. We identify 116 YSO candidates: 102 are well characterized by the YSO models, predominately Stage I, and 14 may be multiple sources or young sources with transition disks. Careful examination of the individual sources and their surrounding environment allows us to identify a factor of ∼14.5 more YSO candidates than have already been identified. The total mass of these well-fit YSO candidates is ∼520 M sun . We calculate a current star formation rate of 0.27 x 10 -1 M sun yr -1 kpc -2 . The distribution of YSO candidates appears to follow shells of neutral material in the interstellar medium.

  17. COL Application Content Guide for HTGRs: Revision to RG 1.206, Part 1 - Status Report

    Energy Technology Data Exchange (ETDEWEB)

    Wayne Moe

    2012-08-01

    A combined license (COL) application is required by the Nuclear Regulatory Commission (NRC) for all proposed nuclear plants. The information requirements for a COL application are set forth in 10 CFR 52.79, “Contents of Applications; Technical Information in Final Safety Analysis Report.” An applicant for a modular high temperature gas-cooled reactor (HTGR) must develop and submit for NRC review and approval a COL application which conforms to these requirements. The technical information necessary to allow NRC staff to evaluate a COL application and resolve all safety issues related to a proposed nuclear plant is detailed and comprehensive. To this, Regulatory Guide (RG) 1.206, “Combined License Applications for Nuclear Power Plants” (LWR Edition), was developed to assist light water reactor (LWR) applicants in incorporating and effectively formatting required information for COL application review (Ref. 1). However, the guidance prescribed in RG 1.206 presumes a LWR design proposal consistent with the systems and functions associated with large LWR power plants currently operating under NRC license.

  18. SHELS: A complete galaxy redshift survey with R ≤ 20.6

    International Nuclear Information System (INIS)

    Geller, Margaret J.; Hwang, Ho Seong; Fabricant, Daniel G.; Kurtz, Michael J.; Dell'Antonio, Ian P.; Zahid, Harus Jabran

    2014-01-01

    The SHELS (Smithsonian Hectospec Lensing Survey) is a complete redshift survey covering two well-separated fields (F1 and F2) of the Deep Lens Survey to a limiting R = 20.6. Here we describe the redshift survey of the F2 field (R.A. 2000 = 09 h 19 m 32.4 and decl. 2000 = +30°00'00''). The survey includes 16,294 new redshifts measured with the Hectospec on the MMT. The resulting survey of the 4 deg 2 F2 field is 95% complete to R = 20.6, currently the densest survey to this magnitude limit. The median survey redshift is z = 0.3; the survey provides a view of structure in the range 0.1 ≲ z ≲ 0.6. An animation displays the large-scale structure in the survey region. We provide a redshift, spectral index D n 4000, and stellar mass for each galaxy in the survey. We also provide a metallicity for each galaxy in the range 0.2

  19. $^{206}$ Po sources for production and release studies relevant for high power spallation targets

    CERN Multimedia

    The knowledge of the evaporation behaviour of Po is of essential importance for several scientific and technological applications, like accelerator driven systems (ADS) or the LIEBE project at CERN-ISOLDE. Fundamental investigations on the experimental conditions for the formation of volatile Po species as well as on the chemical composition of the volatile compounds are necessary for a safe operation of such facilities. $^{206}$Po, a mainly $\\gamma$- ray-emitting Po isotope with a half-life of 8.8 d, is best suited for model studies, due to the lower radiation hazard compared to the longer-lived $\\alpha$-emitting isotopes $^{208-210}$Po as well as the easy-to-measure $\\gamma$-ray emission. We propose the production of $^{206}$Po samples in several matrices via the implantation of its precursor $^{210}$Fr into selected metal foils at CERN-ISOLDE. Using these samples, experiments will be carried out at PSI studying the volatilization of Po from different matrices under varying chemical conditions.

  20. Flight service evaluation of composite components on Bell 206L and Sikorsky S-76 helicopters

    Science.gov (United States)

    Baker, D. J.

    1983-01-01

    Progress on two programs to evaluate composite structural components in flight service on commercial helicopters is described. Thirty-six ship sets of composite components that include the litter door, baggage door, forward fairing, and vertical fin were installed on Bell Model 206L helicopters that are operating in widely different climatic areas. Four horizontal stabilizers and ten tail rotor spars that are production components on the S-76 helicopter were tested after prescribed periods of service to determine the effects of the operating environment on their performance. Concurrent with the flight evaluation, specimens from materials used to fabricate the components were exposed in ground racks and tested at specified intervals to determine the effects of outdoor environments. Results achieved from 14,000 hours of accumulated service on the 206L components, tests on a S-76 horizontal stabilizer after 1600 hours of service, tests on a S-76 tail rotor spar after 2300 hours service, and two years of ground based exposure of material coupons are reported.

  1. Measurement of the radiative neutron capture cross section of 206Pb and its astrophysical implications

    CERN Document Server

    Domingo-Pardo, C.; Aerts, G.; Alvarez, H.; Alvarez-Velarde, F.; Andriamonje, S.; Andrzejewski, J.; Assimakopoulos, P.; Audouin, L.; Badurek, G.; Baumann, P.; Becvar, F.; Berthoumieux, E.; Bisterzo, S.; Calvino, F.; Calviani, M.; Cano-Ott, D.; Capote, R.; Carrapico, C.; Cennini, P.; Chepel, V.; Chiaveri, E.; Colonna, N.; Cortes, G.; Couture, A.; Cox, J.; Dahlfors, M.; David, S.; Dillman, I.; Dolfini, R.; Dridi, W.; Duran, I.; Eleftheriadis, C.; Embid-Segura, M.; Ferrant, L.; Ferrari, A.; Ferreira-Marques, R.; Fitzpatrick, L.; Frais-Koelbl, H.; Fujii, K.; Furman, W.; Gallino, R.; Goncalves, I.; Gonzalez-Romero, E.; Goverdovski, A.; Gramegna, F.; Griesmayer, E.; Guerrero, C.; Gunsing, F.; Haas, B.; Haight, R.; Heil, M.; Herrera-Martinez, A.; Igashira, M.; Isaev, M.; Jericha, E.; Kappeler, F.; Kadi, Y.; Karadimos, D.; Karamanis, D.; Kerveno, M.; Ketlerov, V.; Koehler, P.; Konovalov, V.; Kossionides, E.; Krticka, M.; Lamboudis, C.; Leeb, H.; Lindote, A.; Lopes, I.; Lozano, M.; Lukic, S.; Marganiec, J.; Marrone, S.; Massimi, C.; Mastinu, P.; Mengoni, A.; Milazzo, P.M.; Moreau, C.; Mosconi, M.; Neves, F.; Oberhummer, H.; Oshima, M.; O'Brien, S.; Pancin, J.; Papachristodoulou, C.; Papadopoulos, C.; Paradela, C.; Patronis, N.; Pavlik, A.; Pavlopoulos, P.; Perrot, L.; Plag, R.; Plompen, A.; Plukis, A.; Poch, A.; Pretel, C.; Quesada, J.; Rauscher, T.; Reifarth, R.; Rosetti, M.; Rubbia, C.; Rudolf, G.; Rullhusen, P.; Salgado, J.; Sarchiapone, L.; Savvidis, I.; Stephan, C.; Tagliente, G.; Tain, J.L.; Tassan-Got, L.; Tavora, L.; Terlizzi, R.; Vannini, G.; Vaz, P.; Ventura, A.; Villamarin, D.; Vincente, M.C.; Vlachoudis, V.; Vlastou, R.; Voss, F.; Walter, S.; Wendler, H.; Wiescher, M.; Wisshak, K.

    2007-01-01

    The (n, gamma) cross section of 206Pb has been measured at the CERN n_TOF facility with high resolution in the energy range from 1 eV to 600 keV by using two optimized C6D6 detectors. In the investigated energy interval about 130 resonances could be observed, from which 61 had enough statistics to be reliably analyzed via the R-matrix analysis code SAMMY. Experimental uncertainties were minimized, in particular with respect to (i) angular distribution effects of the prompt capture gamma-rays, and to (ii) the TOF-dependent background due to sample-scattered neutrons. Other background components were addressed by background measurements with an enriched 208Pb sample. The effect of the lower energy cutoff in the pulse height spectra of the C6D6 detectors was carefully corrected via Monte Carlo simulations. Compared to previous 206Pb values, the Maxwellian averaged capture cross sections derived from these data are about 20% and 9% lower at thermal energies of 5 keV and 30 keV, respectively. These new results hav...

  2. Overexpression of microRNA-206 in the skeletal muscle from myotonic dystrophy type 1 patients

    Directory of Open Access Journals (Sweden)

    Angelini Corrado

    2010-05-01

    Full Text Available Abstract Background MicroRNAs are highly conserved, noncoding RNAs involved in post-transcriptional gene silencing. They have been shown to participate in a wide range of biological processes, including myogenesis and muscle regeneration. The goal of this study is to test the hypothesis that myo-miRs (myo = muscle + miR = miRNA expression is altered in muscle from patients affected by myotonic dystrophy type 1 (DM1, the most frequently inherited neuromuscular disease in adults. In order to gain better insights about the role of miRNAs in the DM1 pathogenesis, we have also analyzed the muscular expression of miR-103 and miR-107, which have been identified in silico as attractive candidates for binding to the DMPK mRNA. Methods To this aim, we have profiled the expression of miR-133 (miR-133a, miR-133b, miR-1, miR-181 (miR-181a, miR-181b, miR-181c and miR-206, that are specifically induced during myogenesis in cardiac and skeletal muscle tissues. miR-103 and miR-107, highly expressed in brain, heart and muscle have also been included in this study. QRT-PCR experiments have been performed on RNA from vastus lateralis biopsies of DM1 patients (n = 7 and control subjects (n = 4. Results of miRNAs expression have been confirmed by Northern blot, whereas in situ hybridization technique have been performed to localize misexpressed miRNAs on muscle sections from DM1 and control individuals. Results Only miR-206 showed an over-expression in 5 of 7 DM1 patients (threshold = 2, fold change between 1.20 and 13.22, average = 5.37 compared to the control group. This result has been further confirmed by Northern blot analysis (3.37-fold overexpression, R2 = 0.89. In situ hybridization localized miR-206 to nuclear site both in normal and DM1 tissues. Cellular distribution in DM1 tissues includes also the nuclear regions of centralized nuclei, with a strong signal corresponding to nuclear clumps. Conclusions This work provides, for the first time, evidences about

  3. Astatine-211 labelled proteins and their stability in vivo

    International Nuclear Information System (INIS)

    Yi Changhou; Jin Jannan; Zhang Shuyuan; Wang Ketai; Zhang Dayuan; Zhou Maolun

    1989-01-01

    211 At or 131 I labelled proteins, e.g. 211 At-IgG or 211 At-BSA (bovine serum albumin) were prepared by 211 At reaction with the diazo-compound of para-aminobenzoic acid, which is then conjugated with IgG or BSA via an acylation reaction. The 211 At-carbon bond was found metabolically stable under in vivo conditions. For the labelling of proteins with 211 At or 131 I, other methods of direct oxidation are also described. The results show that for the labelling of proteins with 211 At, high rate of incorporation can be obtained with hydrogen peroxide as oxidant, but the labelling of proteins with 131 I is more favourable with the strong oxidant Chloramine-T. (author) 12 refs.; 6 figs

  4. Infrared studies of H II regions: the Sharpless regions S148, 184, 198, 206 and 269

    International Nuclear Information System (INIS)

    Pismis, Paris

    1991-01-01

    We present the results of a combined near-infrared and IRAS mapping study of five H II regions for which fairly complete information at optical and radio wavelengths previously existed. The near-infrared observations, carried out with the 2.1-m telescope at Observatorio de San Pedro Martir (Mexico), allowed us to study the the stellar content at the core of each nebula, while an analysis of extended near-infrared emission zones showed these to arise mainly from ionized gas (S148 and S206) or through scattering and thermal emission from dust grains surrounding a massive young star (S269-IRS2). The analysis of IRAS data, on the other hand, suggests that two different populations of grains contribute to the observed 12- to 100-μm fluxes. (author)

  5. 40 CFR 600.206-08 - Calculation and use of FTP-based and HFET-based fuel economy values for vehicle configurations.

    Science.gov (United States)

    2010-07-01

    ... EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1977 and Later Model Year Automobiles-Procedures... economy value exists for an electric vehicle configuration, all values for that vehicle configuration are... HFET-based fuel economy values for vehicle configurations. 600.206-08 Section 600.206-08 Protection of...

  6. 40 CFR 600.206-86 - Calculation and use of fuel economy values for gasoline-fueled, diesel, and electric vehicle...

    Science.gov (United States)

    2010-07-01

    ... values for gasoline-fueled, diesel, and electric vehicle configurations. 600.206-86 Section 600.206-86...-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1977 and Later Model Year... values for gasoline-fueled, diesel, and electric vehicle configurations. (a) Fuel economy values...

  7. 18 CFR Appendix I to Subpart F of... - Procedures for Compliance With the Endangered Species Act of 1973 Under § 157.206(b)(3)(i)

    Science.gov (United States)

    2010-04-01

    ... Compliance With the Endangered Species Act of 1973 Under § 157.206(b)(3)(i) I Appendix I to Subpart F of... Compliance With the Endangered Species Act of 1973 Under § 157.206(b)(3)(i) The following procedures apply to... ENERGY REGULATIONS UNDER NATURAL GAS ACT APPLICATIONS FOR CERTIFICATES OF PUBLIC CONVENIENCE AND...

  8. 17 CFR 259.206 - Form U-6B-2, for notification of security issues exempt under section 6(b) of the Act.

    Science.gov (United States)

    2010-04-01

    ... of security issues exempt under section 6(b) of the Act. 259.206 Section 259.206 Commodity and... security issues exempt under section 6(b) of the Act. This form shall be filed pursuant to section 6(b) of the Act as the certificate of notification of the issue, sale, renewal, or guaranty of securities...

  9. 5 CFR 2641.206 - One-year restriction on any former senior or very senior employee's representations on behalf of...

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false One-year restriction on any former senior or very senior employee's representations on behalf of, or aid or advice to, a foreign entity. 2641.206 Section 2641.206 Administrative Personnel OFFICE OF GOVERNMENT ETHICS GOVERNMENT ETHICS POST-EMPLOYMENT CONFLICT OF INTEREST RESTRICTIONS...

  10. Circulating macrophage activation markers, CD163 and CD206, are associated with disease severity and treatment response in patients with autoimmune hepatitis

    DEFF Research Database (Denmark)

    Grønbæk, Henning; Kazankov, Konstantin; Jessen, Niels

    Circulating macrophage activation markers, CD163 and CD206, are associated with disease severity and treatment response in patients with autoimmune hepatitis......Circulating macrophage activation markers, CD163 and CD206, are associated with disease severity and treatment response in patients with autoimmune hepatitis...

  11. Non-host disease resistance response in pea (Pisum sativum) pods: Biochemical function of DRR206 and phytoalexin pathway localization.

    Science.gov (United States)

    Seneviratne, Herana Kamal; Dalisay, Doralyn S; Kim, Kye-Won; Moinuddin, Syed G A; Yang, Hong; Hartshorn, Christopher M; Davin, Laurence B; Lewis, Norman G

    2015-05-01

    Continually exposed to potential pathogens, vascular plants have evolved intricate defense mechanisms to recognize encroaching threats and defend themselves. They do so by inducing a set of defense responses that can help defeat and/or limit effects of invading pathogens, of which the non-host disease resistance response is the most common. In this regard, pea (Pisum sativum) pod tissue, when exposed to Fusarium solani f. sp. phaseoli spores, undergoes an inducible transcriptional activation of pathogenesis-related genes, and also produces (+)-pisatin, its major phytoalexin. One of the inducible pathogenesis-related genes is Disease Resistance Response-206 (DRR206), whose role in vivo was unknown. DRR206 is, however, related to the dirigent protein (DP) family. In this study, its biochemical function was investigated in planta, with the metabolite associated with its gene induction being pinoresinol monoglucoside. Interestingly, both pinoresinol monoglucoside and (+)-pisatin were co-localized in pea pod endocarp epidermal cells, as demonstrated using matrix-assisted laser desorption/ionization (MALDI) mass spectrometry imaging. In addition, endocarp epidermal cells are also the site for both chalcone synthase and DRR206 gene expression. Taken together, these data indicate that both (+)-pisatin and pinoresinol monoglucoside function in the overall phytoalexin responses. Copyright © 2014 Elsevier Ltd. All rights reserved.

  12. 30 CFR 206.174 - How do I value gas production when an index-based method cannot be used?

    Science.gov (United States)

    2010-07-01

    ... to consider include prices received in spot sales of gas, residue gas or gas plant products, other... part, or timely, for a quantity of gas, residue gas, or gas plant product. (j) Non-binding MMS reviews..., DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT PRODUCT VALUATION Indian Gas § 206.174 How do I value...

  13. 30 CFR 206.172 - How do I value gas produced from leases in an index zone?

    Science.gov (United States)

    2010-07-01

    ... gas production that is not sold under an arm's-length dedicated contract is the index-based value... safety net prices calculated at § 206.172(e)(4)(i) exceeds the index-based value that applies to the gas... contract is the higher of the index-based value under paragraph (d) of this section or the value of that...

  14. 30 CFR 204.206 - What will MMS do when it receives my request for other relief?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What will MMS do when it receives my request... THE INTERIOR MINERALS REVENUE MANAGEMENT ALTERNATIVES FOR MARGINAL PROPERTIES Accounting and Auditing Relief § 204.206 What will MMS do when it receives my request for other relief? When MMS receives your...

  15. Study of the 2n-evaporation channel in the 4,6He + 206,208Pb reactions

    Czech Academy of Sciences Publication Activity Database

    Lukyanov, S. M.; Penionzhkevich, Y. E.; Astabatian, R. A.; Demekhina, N.A.; Dlouhý, Zdeněk; Ivanov, M.P.; Kalpakchieva, R.; Kulko, A.A.; Markarian, E. R.; Maslov, V. A.; Revenko, R.V.; Skobelev, N. K.; Smirnov, V. I.; Sobolev, Yu. G.; Trazska, W.; Khlebnikov, S. V.

    2009-01-01

    Roč. 670, 4-5 (2009), s. 321-324 ISSN 0370-2693 Institutional research plan: CEZ:AV0Z10480505 Keywords : excitation functions * 208,206Pb Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 5.083, year: 2009

  16. High-spin yrast states in the 206Po, 208Po, 209At and 210At nuclei

    International Nuclear Information System (INIS)

    Rahkonen, Vesa.

    1980-08-01

    High-spin yrast states in the 206 , 208 Po and 209 , 210 At nuclei have been studied with methods of in-beam γ-ray and conversion-electron spectroscopy and with the (α,3n), (α,4n), (p,2n) and ( 3 He,3n) reactions. Several new high-spin states have been identified up to angular momenta of 18-19 h/2π in these nuclei except in 206 Po where the highest spin was (13 - ). In the course of this work two new isomers with half-lives of 15+-3 ns and 4+-2 μs have been observed at 1689 and 4028 keV in 210 At, which have been interpreted as (10 - ) and 19 + states. The previously-known half-lives of 29+-2 and 680+-75 ns have been established for the three-proton states of Jsup(π)=21/2 - and 29/2 + at 1428 and 2429 keV in 209 At, respectively. A half-life of 1.0+-0.2 μs was measured for the 9 - isomer in 206 Po. Shell-model calculations based on the use of the empirical single- and two-particle interaction energies or of the experimental excitation energies belonging to the relevant one-, two- and three-particle states, have been carried out for these 4-6 particle nuclei. Most of the medium-spin yrast states in 206 Po, 208 Po and 209 At have been successfully described assuming the core for these nuclei being 204 Pb or 206 Pb rather than 208 Pb, and including an extra core polarization interaction described by the P 2 force. (author)

  17. Effects of MicroRNA-206 on Osteosarcoma Cell Proliferation, Apoptosis, Migration and Invasion by Targeting ANXA2 Through the AKT Signaling Pathway

    Directory of Open Access Journals (Sweden)

    Bao-Long Pan

    2018-02-01

    Full Text Available Background/Aims: This study aimed to investigate the mechanism by which microRNA-206 (miR-206 affects the proliferation, apoptosis, migration and invasion of osteosarcoma (OS cells by targeting ANXA2 via the AKT signaling pathway. Methods: A total of 132 OS tissues and 120 osteochondroma tissues were examined in this study. The targeting relationship between miR-206 and ANXA2 was verified with a dual-luciferase reporter assay. The miR-206 expression and ANXA2, AKT, PARP, FASN, Survivin, Bax, Mcl-1 and Bcl-1 mRNA and protein expression in the above two groups were examined by qRT-PCR and western blotting. The cultured OS cells were divided into 6 groups: a blank group, negative control (NC group, miR-206 mimic group, miR-206 inhibitor group, si-ANXA2 group and miR-206 inhibitor + si-ANXA2 group. Cell cycle and apoptosis were assessed by flow cytometry, cell migration was examined with a wound-healing assay, and cell invasion was assessed with a Transwell assay. Pearson correlation analysis was used to determine the correlation between ANXA2 mRNA expression and miR-206 expression in OS. Results: OS tissues exhibited increased mRNA and protein expression of ANXA2, AKT, PARP, FASN, Survivin, Mcl-1 and Bcl-2; decreased miR-206 expression; and decreased Bax mRNA and protein expression. ANXA2 mRNA expression was strongly negatively correlated with miR-206 expression in OS. ANXA2 was found to be a miR-206 target gene. In the miR-206 mimic group and the si-ANXA2 group, the mRNA and protein expression of ANXA2, AKT, PARP, FASN, Survivin, Mcl-1 and Bcl-1 decreased markedly, cell proliferation was inhibited, apoptosis was promoted, higher cell growth in G1 phase and decreased growth in S phase was detected, and decreased cell migration and invasion were observed compared with those in the blank group. Conclusion: The current results demonstrate that miR-206 overexpression inhibits OS cell proliferation, migration and invasion and promotes apoptosis through

  18. Isotopomer fractionation during photolysis of nitrous oxide by ultraviolet of 206 to 210 nm

    International Nuclear Information System (INIS)

    Toyoda, S.; Yoshida, N.; Suzuki, T.; Tsuji, K.; Shibuya, K.

    2002-01-01

    Nitrous oxide (N 2 O) is an important trace gas in the stratospheric chemistry as well as in the tropospheric radiative balance. Although there have been observations on the distribution of N 2 O in the atmosphere and its flux from individual sources, the global N 2 O budget is not fully understood. The isotopic information of N 2 O has been useful for constraining the N 2 O cycle since each source and sink has its own isotopic signature and isotope fractionation that is unique to the process. We have recently developed a method to determine isotopomers of N 2 O and showed that intramolecular distribution of 15 N is a parameter that has more fundamental and sensitive information than bulk 15 N abundance for constraining the atmospheric N 2 O budget. Here, we report the fractionation of isotopomers during ultraviolet photolysis of N 2 O in a 206 to 210 nm region. The fractionation factors are different among isotopomers and the site preference between two nitrogen isotopomers becomes larger along with the photolysis. The isotopomer fractionation factors of this representative wavelength are close to the apparent fractionation factors observed in the stratosphere indicating ultraviolet photolysis in the stratosphere is the dominant sink of N 2 O. Sources of atmospheric N 2 O including terrestrial and oceanic biological processes, agricultural activities, industrial formation and fossil fuel combustion are expected to be characterized to better constrain the global budget of N 2 O. (author)

  19. Identification of a Novel GLA Mutation (L206 P) in a Patient with Fabry Disease.

    Science.gov (United States)

    Kim, Ji-Hoon; Kim, Gee-Hee; Park, Hoon-Suk; Choi, Jin-A; Bae, Jung-Min; Cho, Uiju

    2017-03-01

    We report a new α-Galactosidase A (αGal-A) mutation in a 39-year-old Korean born, male Fabry disease patient. Fabry disease is a devastating, progressive inborn error of metabolism caused by X-linked genetic mutations. In this case, the first clinical symptom to occur was in childhood consisting of a burning pain originating in the extremities then radiating inwards to the limbs. This patient also stated to have ringing in his ears, angiokeratomas on his trunk, and cornea verticillata. He visited an outpatient cardiologist due to intermittent and atypical chest discomfort at the age of 39. Electrocardiographic and echocardiographic examination showed left ventricular hypertrophy. A physical examination revealed proteinuria without hematuria. The patient's plasma αGal-A activity was markedly lower than the mean value of the controls. After genetic counseling and obtaining written informed consent, we identified one hemizygous mutation in exon 4 of galactosidase alpha, c.617T>C (p.Leu206 Pro). He was eventually diagnosed as having Fabry disease.

  20. Effect of 222Rn emanation from crystals on their 206Pb/238U age dating

    International Nuclear Information System (INIS)

    Barretto, Paulo M.C.

    2009-01-01

    The escape of radon from certain minerals with high uranium is of particular interest to those concerned with the determination of ages of rocks, minerals and tectonic events. To the extent that radon escapes, these minerals are not closed systems from the thermodynamic point of view and, more particularly, from the geochronological point of view. This investigation aimed to determine the radon escape from zircon crystals and how this fit into the severe isotopic constraints of the concordia dating model. To evaluate the consequences of radon loss on 238 U/ 206 Pb age dating methods, 20 zircon concentrates were analyzed. The observed range of relative percentage of radon loss was of 0.2-12 % and correlations with weathering of the crystals with natural alpha dose and with U-Pb age discordances were found. These correlations indicate relationships between the amount of lattice damage by radiation, the radon leakage out of the crystal and Pb mobility. Some of the stochastic complexities in specific age determinations are also discussed. (author)

  1. Some Peculiarities in the Interaction of $^{6}$He with $^{197}$Au and $^{206}$Pb

    CERN Document Server

    Penionzhkevich, Yu E; Demekhina, N A; Dlouhý, Z; Kalpakchieva, R; Kulko, A A; Lobastov, S P; Lukyanov, S M; Markaryan, E R; Maslov, V A; Muzycjka, Yu A; Oganessian, Yu T; Rassadov, D N; Skobelev, N K; Sobolev, Yu G; Ugryumov, V Yu; Vincour, J; Zholdybaev, T

    2005-01-01

    Excitation functions were measured for fusion followed by the evaporation of neutrons in the reactions $^{206}$Pb($^{6}$He, 2$n$)$^{210}$Po and $^{197}$Au($^{6}$He, $xn$)$^{203 - xn}$Tl, where $x$ = 2-7, as well as for the transfer reactions on a $^{197}$Au target with the formation of the $^{196}$Au, $^{198}$Au and $^{199}$Au isotopes. The experiment was carried out at the Dubna Radioactive Ion Beams (DRIBs) complex of FLNR, JINR. The $^{6}$He-beam intensity was about 5$\\cdot$10$^{6 }$ s$^{-1}$, the maximum energy being (60.3$\\pm $0.4) MeV. A significant increase in the cross section was observed below the Coulomb barrier for the fusion reaction with the evaporation of two neutrons compared to statistical model calculations. Unusual behaviour for the production of $^{198}$Au is observed, whereas the cross section for the formation of $^{199}$Au is very low. The analysis of the data in the framework of the statistical model for the decay of excited nuclei, which took into account the sequential fusion of $^{6...

  2. SUMOylation regulates nuclear localization and stability of TRAIP/RNF206

    International Nuclear Information System (INIS)

    Park, I. Seul; Han, Ye gi; Chung, Hee Jin; Jung, Yong Woo; Kim, Yonghwan; Kim, Hongtae

    2016-01-01

    TRAIP/RNF206 plays diverse roles in cell cycle progression, DNA damage response, and DNA repair pathways. Physiological importance of TRAIP is highlighted by the identification of pathogenic mutations of TRAIP gene in patients diagnosed with primordial dwarfism. Although the diverse functions of TRAIP in the nucleus have been well characterized, molecular mechanism of TRAIP retention in the nucleus has not been determined. Here, we discovered that TRAIP is post-translationally modified by the small ubiquitin-like protein (SUMO). In addition, we identified five SUMOylation sites in TRAIP, and successfully generated SUMOylation deficient mutant of TRAIP. In an attempt to define the functional roles of TRAIP SUMOylation, we discovered that SUMOylation deficient TRAIP is not retained in the nucleus. In addition, protein stability of SUMOylation deficient TRAIP is lower than wild type TRAIP, demonstrating that SUMOylation is critical for both proper subcellular localization and protein stability of TRAIP. Taken together, these findings improve the understanding clinical implication of TRAIP in various diseases including primordial dwarfism and cancers. - Highlights: • TRAIP is post-translationally modified by SUMO. • SUMOylation affects subcellular localization of TRAIP. • SUMOylation regulates protein stability of TRAIP.

  3. SUMOylation regulates nuclear localization and stability of TRAIP/RNF206

    Energy Technology Data Exchange (ETDEWEB)

    Park, I. Seul; Han, Ye gi; Chung, Hee Jin [Department of Biological Sciences, Sungkyunkwan University (SKKU), Suwon 440-746 (Korea, Republic of); Jung, Yong Woo [College of Pharmacy, Korea University, Sejong City 339-700 (Korea, Republic of); Kim, Yonghwan, E-mail: yhkim@sookmyung.ac.kr [Department of Biological Sciences, Sookmyung Women' s University, Seoul 04310 (Korea, Republic of); Kim, Hongtae, E-mail: khtcat@skku.edu [Department of Biological Sciences, Sungkyunkwan University (SKKU), Suwon 440-746 (Korea, Republic of)

    2016-02-19

    TRAIP/RNF206 plays diverse roles in cell cycle progression, DNA damage response, and DNA repair pathways. Physiological importance of TRAIP is highlighted by the identification of pathogenic mutations of TRAIP gene in patients diagnosed with primordial dwarfism. Although the diverse functions of TRAIP in the nucleus have been well characterized, molecular mechanism of TRAIP retention in the nucleus has not been determined. Here, we discovered that TRAIP is post-translationally modified by the small ubiquitin-like protein (SUMO). In addition, we identified five SUMOylation sites in TRAIP, and successfully generated SUMOylation deficient mutant of TRAIP. In an attempt to define the functional roles of TRAIP SUMOylation, we discovered that SUMOylation deficient TRAIP is not retained in the nucleus. In addition, protein stability of SUMOylation deficient TRAIP is lower than wild type TRAIP, demonstrating that SUMOylation is critical for both proper subcellular localization and protein stability of TRAIP. Taken together, these findings improve the understanding clinical implication of TRAIP in various diseases including primordial dwarfism and cancers. - Highlights: • TRAIP is post-translationally modified by SUMO. • SUMOylation affects subcellular localization of TRAIP. • SUMOylation regulates protein stability of TRAIP.

  4. Kinematics of SNRs CTB 109 and G206.9+2.3

    Science.gov (United States)

    Rosado, Margarita; Sánchez-Cruces, Mónica; Ambrocio-Cruz, Patricia

    2017-11-01

    We present results of optical observations in the lines of Hα and [SII] (λ 6717 and 6731 Å) obtained with the UNAM Scanning Fabry-Perot Interferometer PUMA (Rosado et al. 1995,RMxAASC, 3, 263 ) aimed at obtaining the kinematical distance, shock velocity and other important parameters of two supernova remnants (SNRs) with optical counterparts. We discuss on how kinematical distances thus obtained fit with other distance determinations. The studied SNRs are CTB 109 (SNR G109.1 - 1.0) hosting a magnetar (Sánchez-Cruces et al. 2017, in preparation) and the SNR G206.9 + 2.3 (Ambrocio-Cruz et al. 2014,RMxAA, 50, 323), a typical supernova remnant, to have a comparison. In Fig. 1 is depicted the [SII] line emission of two filaments of the optical counterpart of SNR CTB 109. We find complex radial velocity profiles obtained with the Fabry-Perot interferometer, revealing the presence of different velocity components. From these velocity profiles we obtain the kinematical distance, an expansion velocity of 188 km/s and an initial energy of 8.1 x 1050 ergs. These values are rather typical of other SNRs regardless that SNR CTB 109 hosts a magnetar. Thus, the mechanical energy delivered in the supernova explosion forming the magnetar does not seem to impact more than other SNe explosions the interstellar medium. This work has been funded by grants IN103116 and 253085 from DGAPA-UNAM and CONACYT, respectively.

  5. Proteome Analysis of Disease Resistance against Ralstonia solanacearum in Potato Cultivar CT206-10

    Directory of Open Access Journals (Sweden)

    Sangryeol Park

    2016-02-01

    Full Text Available Potato is one of the most important crops worldwide. Its commercial cultivars are highly susceptible to many fungal and bacterial diseases. Among these, bacterial wilt caused by Ralstonia solanacearum causes significant yield loss. In the present study, integrated proteomics and genomics approaches were used in order to identify bacterial wilt resistant genes from Rs resistance potato cultivar CT-206-10. 2-DE and MALDI-TOF/TOF-MS analysis identified eight differentially abundant proteins including glycine-rich RNA binding protein (GRP, tomato stress induced-1 (TSI-1 protein, pathogenesis-related (STH-2 protein and pentatricopeptide repeat containing (PPR protein in response to Rs infection. Further, semi-quantitative RT-PCR identified up-regulation in transcript levels of all these genes upon Rs infection. Taken together, our results showed the involvement of the identified proteins in the Rs stress tolerance in potato. In the future, it would be interesting to raise the transgenic plants to further validate their involvement in resistance against Rs in potato.

  6. Coupled channel effects in quasi-elastic barrier distributions of 16,18O + 206Pb systems

    International Nuclear Information System (INIS)

    Jha, V.; Roy, B.J.; Parkar, V.V.; Kumawat, H.; Pal, U.K.; Pandit, S.K.; Mahata, K.; Shrivastava, A.; Mohanty, A.K.

    2013-01-01

    The fusion barrier distribution and QEBD for the 16 O + 208 Pb have been studied in great detail. The couplings due to the collective excitations of the colliding nuclei are found to have the dominant effect as deduced by the conventional coupled-channels calculations used to explain the experimental QEBD and fusion barrier distributions. In contrast, for the 18 O + 206 Pb system, the role of single neutron stripping (Q-value= -1.308 MeV) and neutron pair transfer (Q-value = + 1.917 MeV) are expected to be significant. In the present work, the QEBD measurements for the 18 O + 206 Pb system are performed for the investigation of these aspects

  7. Flight service evaluation of composite components on the Bell Helicopter model 206L: Design, fabrication and testing

    Science.gov (United States)

    Zinberg, H.

    1982-01-01

    The design, fabrication, and testing phases of a program to obtain long term flight service experience on representative helicopter airframe structural components operating in typical commercial environments are described. The aircraft chosen is the Bell Helicopter Model 206L. The structural components are the forward fairing, litter door, baggage door, and vertical fin. The advanced composite components were designed to replace the production parts in the field and were certified by the FAA to be operable through the full flight envelope of the 206L. A description of the fabrication process that was used for each of the components is given. Static failing load tests on all components were done. In addition fatigue tests were run on four specimens that simulated the attachment of the vertical fin to the helicopter's tail boom.

  8. Ectopic expression of MPF2-like protein WSA206 leads to arrest in silique and seed development in heterologous host

    International Nuclear Information System (INIS)

    Khan, M.R.

    2016-01-01

    MPF2-like genes belonging to STMADS11 clade of MADS-box transcription factors are mostly involved in calyx inflation, floral reversion and fertility. However their role in fertility remained enigmatic. In this study we transformed WSA206 gene paralog - originated through genome duplication in a Solanaceous plant Withaniasomnifera - ectopically in a heterologous host Arabidopsis thaliana. Interesting phenotypes in floral organs and fruits were observed. Overexpression of WSA206 leads to arrest in silique development. The siliques were compressed and size was drastically reduced from 34mm to 3mm. Along with siliques, the seed development was also suppressed as revealed by shriveling of seeds and reduction in seed number. In extreme cases the siliques were devoid of any seeds. In cases where seeds developed, these were impaired in viability. Besides, the transgenic Arabidopsis also exhibited exorbitant growth of calyx to an extent that it resembled inflated calyx in Solanaceae. The calyx remained persistent and encapsulated the under-developed siliques containing non-viable seeds inside. Thus, fertility and sepal development are tightly coupled traits that are controlled by WSA206 paralog in heterologous system. (author)

  9. Radiometric observations of atmospheric attenuation at 20.6 and 31.65 GHz: The Wave Propagation Laboratory data base

    Science.gov (United States)

    Jacobson, Mark D.; Snider, J. B.; Westwater, E. R.

    1993-01-01

    The National Oceanic and Atmospheric Administration (NOAA) Wave Propagation Laboratory (WPL) presently operates five dual-channel microwave radiometers, one triple-channel microwave radiometer, and one six-channel microwave radiometer. The dual-channel radiometers operate at frequencies of 20.6 or 23.87 GHz and 31.4 or 31.65 GHz. The triple-channel radiometer operates at 20.6, 31.65, and 90.0 GHz. The six-channel radiometer operates at frequencies of 20.6, 31.65, 52.85, 53.85, 55.45, and 58.8 GHz. Recent brightness temperature measurements and attenuation values from some of the above radiometers are presented. These radiometric measurements, taken in different locations throughout the world, have given WPL a diverse set of measurements under a variety of atmospheric conditions. We propose to do a more complete attenuation analysis on these measurements in the future. In addition, a new spinning reflector was installed recently for the dual-channel radiometer at the Platteville, Colorado site. This reflector will extend our measurement capabilities during precipating conditions. Locating the three-channel and portable dual-channel radiometers at or near Greeley, Colorado to support the Advanced Communications Technology Satellite (ACTS) program is discussed.

  10. The Correlation of CD206, CD209, and Disease Severity in Behçet’s Disease with Arthritis

    Directory of Open Access Journals (Sweden)

    Bunsoon Choi

    2017-01-01

    Full Text Available The purpose of this study was to clarify the role of pattern recognition receptors in Behçet’s disease (BD. The frequencies of several pattern recognition receptors (CD11b, CD11c, CD32, CD206, CD209, and dectin-1 were analyzed in patients with BD by flow cytometry, and cytokine levels, interleukin- (IL- 18, IL-23, and IL-17A, were compared in plasma. The analysis was performed in active (n=13 and inactive (n=13 stages of BD patients. Rheumatoid arthritis patients (n=19, as a disease control, and healthy control (HC (n=19 were enrolled. The frequencies of CD11b+ and CD32+ cells were significantly increased in active BD patients compared to HC. Disease severity score was correlated to CD11c+, CD206+, and CD209+ in whole leukocytes and CD11b+, CD11c+, CD206+, CD209+, and Dectin-1+ in granulocytes. The plasma levels of IL-17A were significantly different between HC and active BD. IL-18 showed significant difference between active and inactive BD patients. From this study, we concluded the expressions of several pattern recognition receptors were correlated to the joint symptoms of BD.

  11. Serum miRNAs miR-23a, 206, and 499 as Potential Biomarkers for Skeletal Muscle Atrophy

    Directory of Open Access Journals (Sweden)

    Fei Wang

    2017-01-01

    Full Text Available Muscle biopsy has long been expected to be replaced by noninvasive biomarkers with diagnostic value and prognostic applications for muscle atrophy. Growing evidence suggests that circulating microRNAs (miRNAs could act as biomarkers for numerous pathophysiological statuses. In the present study, our results showed that the serum levels of six muscle-specific miRNAs (miR-1/23a/133/206/208b/499 were all elevated in unloading induced mice. The medium levels of these six muscle-specific miRNAs were all elevated in starvation induced atrophic C2C12 myotubes. Moreover, the serum levels of miR-23a/206/499 were induced in participants after 45 days of head-down bed rest (HDBR. The levels of miR-23a/206/499 were positively correlated with the ratio of soleus volume loss in HDBR participants, indicating that they might represent the process of muscle loss. In conclusion, our results demonstrated that circulating miRNAs could serve as useful biochemical and molecular indicators for muscle atrophy diagnosis and disease progression.

  12. Molecular and Structural Characterization of the Tegumental 20.6-kDa Protein in Clonorchis sinensis as a Potential Druggable Target

    Directory of Open Access Journals (Sweden)

    Yu-Jung Kim

    2017-03-01

    Full Text Available The tegument, representing the membrane-bound outer surface of platyhelminth parasites, plays an important role for the regulation of the host immune response and parasite survival. A comprehensive understanding of tegumental proteins can provide drug candidates for use against helminth-associated diseases, such as clonorchiasis caused by the liver fluke Clonorchis sinensis. However, little is known regarding the physicochemical properties of C. sinensis teguments. In this study, a novel 20.6-kDa tegumental protein of the C. sinensis adult worm (CsTegu20.6 was identified and characterized by molecular and in silico methods. The complete coding sequence of 525 bp was derived from cDNA clones and encodes a protein of 175 amino acids. Homology search using BLASTX showed CsTegu20.6 identity ranging from 29% to 39% with previously-known tegumental proteins in C. sinensis. Domain analysis indicated the presence of a calcium-binding EF-hand domain containing a basic helix-loop-helix structure and a dynein light chain domain exhibiting a ferredoxin fold. We used a modified method to obtain the accurate tertiary structure of the CsTegu20.6 protein because of the unavailability of appropriate templates. The CsTegu20.6 protein sequence was split into two domains based on the disordered region, and then, the structure of each domain was modeled using I-TASSER. A final full-length structure was obtained by combining two structures and refining the whole structure. A refined CsTegu20.6 structure was used to identify a potential CsTegu20.6 inhibitor based on protein structure-compound interaction analysis. The recombinant proteins were expressed in Escherichia coli and purified by nickel-nitrilotriacetic acid affinity chromatography. In C. sinensis, CsTegu20.6 mRNAs were abundant in adult and metacercariae, but not in the egg. Immunohistochemistry revealed that CsTegu20.6 localized to the surface of the tegument in the adult fluke. Collectively, our results

  13. Molecular and Structural Characterization of the Tegumental 20.6-kDa Protein in Clonorchis sinensis as a Potential Druggable Target.

    Science.gov (United States)

    Kim, Yu-Jung; Yoo, Won Gi; Lee, Myoung-Ro; Kang, Jung-Mi; Na, Byoung-Kuk; Cho, Shin-Hyeong; Park, Mi-Yeoun; Ju, Jung-Won

    2017-03-04

    The tegument, representing the membrane-bound outer surface of platyhelminth parasites, plays an important role for the regulation of the host immune response and parasite survival. A comprehensive understanding of tegumental proteins can provide drug candidates for use against helminth-associated diseases, such as clonorchiasis caused by the liver fluke Clonorchis sinensis . However, little is known regarding the physicochemical properties of C. sinensis teguments. In this study, a novel 20.6-kDa tegumental protein of the C. sinensis adult worm (CsTegu20.6) was identified and characterized by molecular and in silico methods. The complete coding sequence of 525 bp was derived from cDNA clones and encodes a protein of 175 amino acids. Homology search using BLASTX showed CsTegu20.6 identity ranging from 29% to 39% with previously-known tegumental proteins in C. sinensis . Domain analysis indicated the presence of a calcium-binding EF-hand domain containing a basic helix-loop-helix structure and a dynein light chain domain exhibiting a ferredoxin fold. We used a modified method to obtain the accurate tertiary structure of the CsTegu20.6 protein because of the unavailability of appropriate templates. The CsTegu20.6 protein sequence was split into two domains based on the disordered region, and then, the structure of each domain was modeled using I-TASSER. A final full-length structure was obtained by combining two structures and refining the whole structure. A refined CsTegu20.6 structure was used to identify a potential CsTegu20.6 inhibitor based on protein structure-compound interaction analysis. The recombinant proteins were expressed in Escherichia coli and purified by nickel-nitrilotriacetic acid affinity chromatography. In C. sinensis , CsTegu20.6 mRNAs were abundant in adult and metacercariae, but not in the egg. Immunohistochemistry revealed that CsTegu20.6 localized to the surface of the tegument in the adult fluke. Collectively, our results contribute to a

  14. MicroRNA-206 regulates the secretion of inflammatory cytokines and MMP9 expression by targeting TIMP3 in Mycobacterium tuberculosis-infected THP-1 human macrophages.

    Science.gov (United States)

    Fu, Xiangdong; Zeng, Lihong; Liu, Zhi; Ke, Xue; Lei, Lin; Li, Guobao

    2016-08-19

    Tuberculosis (TB) is a serious disease that is characterized by Mycobacterium tuberculosis (M.tb)-triggered immune system impairment and lung tissue damage shows limited treatment options. MicroRNAs (miRNAs) are regulators of gene expression that play critical roles in many human diseases, and can be up- or downregulated by M.tb infection in macrophage. Recently, tissue inhibitor of matrix metalloproteinase (TIMP) 3 has been found to play roles in regulating macrophage inflammation. Here, we found that TIMP3 expression was regulated by miR-206 in M.tb-infected THP-1 human macrophages. In THP-1 cells infected with M.tb, the miR-206 level was significantly upregulated and the expression of TIMP3 was markedly decreased when the secretion of inflammatory cytokines was increased. Inhibition of miR-206 markedly suppressed inflammatory cytokine secretion and upregulated the expression of TIMP3. In contrast, the upregulation of miR-206 promoted the matrix metalloproteinase (MMP) 9 levels and inhibited TIMP3 levels. Using a dual-luciferase reporter assay, a direct interaction between miR-206 and the 3'-untranslated region (UTR) of TIMP3 was confirmed. SiTIMP3, the small interfering RNA (siRNA) specific for TIMP3, significantly attenuated the suppressive effects of miR-206-inhibitor on inflammatory cytokine secretion and MMP9 expression. Our data suggest that miR-206 may function as an inflammatory regulator and drive the expression of MMP9 in M.tb-infected THP-1 cells by targeting TIMP3, indicating that miR-206 is a potential therapeutic target for patients with TB. Copyright © 2016 Elsevier Inc. All rights reserved.

  15. Higgs Candidates in $e^{+}e^{-}$ Interactions at $\\sqrt{s}$ = 206.6 GeV

    CERN Document Server

    Acciarri, M.; Adriani, O.; Aguilar-Benitez, M.; Alcaraz, J.; Alemanni, G.; Allaby, J.; Aloisio, A.; Alviggi, M.G.; Ambrosi, G.; Anderhub, H.; Andreev, Valery P.; Angelescu, T.; Anselmo, F.; Arefev, A.; Azemoon, T.; Aziz, T.; Bagnaia, P.; Bajo, A.; Baksay, L.; Balandras, A.; Baldew, S.V.; Banerjee, S.; Banerjee, Sw.; Barczyk, A.; Barillere, R.; Bartalini, P.; Basile, M.; Batalova, N.; Battiston, R.; Bay, A.; Becattini, F.; Becker, U.; Behner, F.; Bellucci, L.; Berbeco, R.; Berdugo, J.; Berges, P.; Bertucci, B.; Betev, B.L.; Bhattacharya, S.; Biasini, M.; Biland, A.; Blaising, J.J.; Blyth, S.C.; Bobbink, G.J.; Bohm, A.; Boldizsar, L.; Borgia, B.; Bourilkov, D.; Bourquin, M.; Braccini, S.; Branson, J.G.; Brochu, F.; Buffini, A.; Buijs, A.; Burger, J.D.; Burger, W.J.; Cai, X.D.; Capell, M.; Cara Romeo, G.; Carlino, G.; Cartacci, A.M.; Casaus, J.; Castellini, G.; Cavallari, F.; Cavallo, N.; Cecchi, C.; Cerrada, M.; Cesaroni, F.; Chamizo, M.; Chang, Y.H.; Chaturvedi, U.K.; Chemarin, M.; Chen, A.; Chen, G.; Chen, G.M.; Chen, H.F.; Chen, H.S.; Chiefari, G.; Cifarelli, L.; Cindolo, F.; Civinini, C.; Clare, I.; Clare, R.; Coignet, G.; Colino, N.; Costantini, S.; Cotorobai, F.; de la Cruz, B.; Csilling, A.; Cucciarelli, S.; Dai, T.S.; van Dalen, J.A.; D'Alessandro, R.; de Asmundis, R.; Deglon, P.; Degre, A.; Deiters, K.; della Volpe, D.; Delmeire, E.; Denes, P.; DeNotaristefani, F.; De Salvo, A.; Diemoz, M.; Dierckxsens, M.; van Dierendonck, D.; Dionisi, C.; Dittmar, M.; Dominguez, A.; Doria, A.; Dova, M.T.; Duchesneau, D.; Dufournaud, D.; Duinker, P.; Duran, I.; El Mamouni, H.; Engler, A.; Eppling, F.J.; Erne, F.C.; Ewers, A.; Extermann, P.; Fabre, M.; Falagan, M.A.; Falciano, S.; Favara, A.; Fay, J.; Fedin, O.; Felcini, M.; Ferguson, T.; Fesefeldt, H.; Fiandrini, E.; Field, J.H.; Filthaut, F.; Fisher, P.H.; Fisk, I.; Forconi, G.; Freudenreich, K.; Furetta, C.; Galaktionov, Iouri; Ganguli, S.N.; Garcia-Abia, Pablo; Gataullin, M.; Gau, S.S.; Gentile, S.; Gheordanescu, N.; Giagu, S.; Gong, Z.F.; Grenier, Gerald Jean; Grimm, O.; Gruenewald, M.W.; Guida, M.; van Gulik, R.; Gupta, V.K.; Gurtu, A.; Gutay, L.J.; Haas, D.; Hasan, A.; Hatzifotiadou, D.; Hebbeker, T.; Herve, Alain; Hidas, P.; Hirschfelder, J.; Hofer, H.; Holzner, G.; Hoorani, H.; Hou, S.R.; Hu, Y.; Iashvili, I.; Jin, B.N.; Jones, Lawrence W.; de Jong, P.; Josa-Mutuberria, I.; Khan, R.A.; Kafer, D.; Kaur, M.; Kienzle-Focacci, M.N.; Kim, D.; Kim, J.K.; Kirkby, Jasper; Kiss, D.; Kittel, W.; Klimentov, A.; Konig, A.C.; Kopal, M.; Kopp, A.; Koutsenko, V.; Kraber, M.; Kraemer, R.W.; Krenz, W.; Kruger, A.; Kunin, A.; Ladron de Guevara, P.; Laktineh, I.; Landi, G.; Lebeau, M.; Lebedev, A.; Lebrun, P.; Lecomte, P.; Lecoq, P.; Le Coultre, P.; Lee, H.J.; Le Goff, J.M.; Leiste, R.; Levtchenko, P.; Li, C.; Likhoded, S.; Lin, C.H.; Lin, W.T.; Linde, F.L.; Lista, L.; Liu, Z.A.; Lohmann, W.; Longo, E.; Lu, Y.S.; Lubelsmeyer, K.; Luci, C.; Luckey, David; Lugnier, L.; Luminari, L.; Lustermann, W.; Ma, W.G.; Maity, M.; Malgeri, L.; Malinin, A.; Mana, C.; Mangeol, D.; Mans, J.; Marian, G.; Martin, J.P.; Marzano, F.; Mazumdar, K.; McNeil, R.R.; Mele, S.; Merola, L.; Meschini, M.; Metzger, W.J.; von der Mey, M.; Mihul, A.; Milcent, H.; Mirabelli, G.; Mnich, J.; Mohanty, G.B.; Moulik, T.; Muanza, G.S.; Muijs, A.J.M.; Musicar, B.; Musy, M.; Napolitano, M.; Nessi-Tedaldi, F.; Newman, H.; Niessen, T.; Nisati, A.; Kluge, Hannelies; Ofierzynski, R.; Organtini, G.; Oulianov, A.; Palomares, C.; Pandoulas, D.; Paoletti, S.; Paolucci, P.; Paramatti, R.; Park, H.K.; Park, I.H.; Passaleva, G.; Patricelli, S.; Paul, Thomas Cantzon; Pauluzzi, M.; Paus, C.; Pauss, F.; Pedace, M.; Pensotti, S.; Perret-Gallix, D.; Petersen, B.; Piccolo, D.; Pierella, F.; Pieri, M.; Piroue, P.A.; Pistolesi, E.; Plyaskin, V.; Pohl, M.; Pojidaev, V.; Postema, H.; Pothier, J.; Prokofev, D.O.; Prokofev, D.; Quartieri, J.; Rahal-Callot, G.; Rahaman, M.A.; Raics, P.; Raja, N.; Ramelli, R.; Rancoita, P.G.; Ranieri, R.; Raspereza, A.; Raven, G.; Razis, P.; Ren, D.; Rescigno, M.; Reucroft, S.; Riemann, S.; Riles, Keith; Rodin, J.; Roe, B.P.; Romero, L.; Rosca, A.; Rosier-Lees, S.; Roth, Stefan; Rosenbleck, C.; Rubio, J.A.; Ruggiero, G.; Rykaczewski, H.; Saremi, S.; Sarkar, S.; Salicio, J.; Sanchez, E.; Sanders, M.P.; Schafer, C.; Schegelsky, V.; Schmidt-Kaerst, S.; Schmitz, D.; Schopper, H.; Schotanus, D.J.; Schwering, G.; Sciacca, C.; Seganti, A.; Servoli, L.; Shevchenko, S.; Shivarov, N.; Shoutko, V.; Shumilov, E.; Shvorob, A.; Siedenburg, T.; Son, D.; Smith, B.; Spillantini, P.; Steuer, M.; Stickland, D.P.; Stone, A.; Stoyanov, B.; Straessner, A.; Sudhakar, K.; Sultanov, G.; Sun, L.Z.; Sushkov, S.; Suter, H.; Swain, J.D.; Szillasi, Z.; Sztaricskai, T.; Tang, X.W.; Tauscher, L.; Taylor, L.; Tellili, B.; Timmermans, Charles; Ting, Samuel C.C.; Ting, S.M.; Tonwar, S.C.; Toth, J.; Tully, C.; Tung, K.L.; Uchida, Y.; Ulbricht, J.; Valente, E.; Vesztergombi, G.; Vetlitsky, I.; Vicinanza, D.; Viertel, G.; Villa, S.; Vivargent, M.; Vlachos, S.; Vodopianov, I.; Vogel, H.; Vogt, H.; Vorobev, I.; Vorobov, A.A.; Vorvolakos, A.; Wadhwa, M.; Wallraff, W.; Wang, M.; Wang, X.L.; Wang, Z.M.; Weber, A.; Weber, M.; Wienemann, P.; Wilkens, H.; Wu, S.X.; Wynhoff, S.; Xia, L.; Xu, Z.Z.; Yamamoto, J.; Yang, B.Z.; Yang, C.G.; Yang, H.J.; Yang, M.; Ye, J.B.; Yeh, S.C.; Zalite, A.; Zalite, Yu.; Zhang, Z.P.; Zhu, G.Y.; Zhu, R.Y.; Zichichi, A.; Zilizi, G.; Zimmermann, B.; Zoller, M.

    2000-01-01

    In a search for the Standard Model Higgs boson, carried out on 212.5 pb-1 of data collected by the L3 detector at the highest LEP centre-of-mass energies, including 116.5 pb-1 above root(s) = 206GeV, an excess of candidates for the process e+e- -> Z* -> HZ is found for Higgs masses near 114.5GeV. We present an analysis of our data and the characteristics of our strongest candidates.

  16. Study of the first collective levels of the even-even nuclei between masses 182 and 206; Etude des premiers niveaux collectifs des noyaux pairs-pairs entre les masses 182 et 206

    Energy Technology Data Exchange (ETDEWEB)

    Barloutaud, R; Leveque, A; Lehmann, P; Quidort, J [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires

    1959-07-01

    The reduced probabilities of deexcitation of the first two 2 + levels of {sup 184}W, {sup 186}W, {sup 188}Os, {sup 190}Os, {sup 192}Os and {sup 194}Pt have been deduced from coulombic excitation experiments on these nuclei.The results are included in a chart of the properties of the first two 2 + levels of even-even nuclei situated between masses 182 and 206. The variation of these properties as a function of nuclear distortion is compared with the various theoretical predictions concerning vibration levels. (author) [French] Les probabilites reduites de desexcitation des deux premiers niveaux 2 + de {sup 184}W, {sup 186}W, {sup 188}Os, {sup 190}Os, {sup 192}Os and {sup 194}Pt ont ete deduites des experiences d'excitation coulombienne de ces noyaux. Les resultats sont inseres dans une systematique des proprietes des deux premiers niveaux 2 + des noyaux pairs-pairs situes entre les masses 182 et 206. La variation de ces proprietes en fonction de la deformation nucleaire est comparee aux diverses predictions theoriques concernant les niveaux de vibration. (auteur)

  17. Analysis of elastic scattering cross-section for 18O + 206Pb in the CRC formalism and dependence on the choice of double folding potential

    International Nuclear Information System (INIS)

    Sonika; Roy, B.J.; Parmar, A.; Jha, V.; Pal, U.K.; Pandit, S.K.; Parkar, V.V.; Ramachandran, K.; Mahata, K.; Pal, A.; Santra, S.; Mohanty, A.K.; Sinha, T.; Parihari, A.

    2014-01-01

    Measurement and detailed analysis of elastic scattering and inelastic excitations in 206 Pb( 18 O, 18 O) have been reported here. First, the elastic scattering cross-section was calculated with a bare double folded real potential. The DF potential consists of folding of a harmonic oscillator density distribution to simulate 18 O with the sum of two Fermi density distributions for the proton and neutron in 206 Pb with correct normalizations. Our measured higher energy data for the same system was first analyzed with this DF potential

  18. The novel biomarker of alternative macrophage activation, soluble mannose receptor (sMR/sCD206): Implications in multiple myeloma

    DEFF Research Database (Denmark)

    Andersen, Morten N; Andersen, Niels F; Rødgaard-Hansen, Sidsel

    2015-01-01

    Tumor-associated macrophages (TAMs) play an important role in the pathophysiology of human malignancies. They support growth of cancer cells by promoting angiogenesis, and by inhibiting tumour cell apoptosis and anti-tumor immune reactions. Several membrane proteins are well-described markers...... of human TAMs, including the haemoglobin scavenger receptor CD163 and the macrophage mannose receptor (MR/CD206). Interestingly, both CD163 and MR exist as soluble serum proteins (sCD163 and sMR) that may reflect the activation state of tissue macrophages, including TAMs. Here, we report the first data...... showed significant association with sCD163, which may indicate common origin from CD163+MR+TAMs....

  19. 41 CFR 302-9.206 - What should I do if there is no port or terminal at my authorized point of origin or authorized...

    Science.gov (United States)

    2010-07-01

    ... there is no port or terminal at my authorized point of origin or authorized destination when I transport... Federal Travel Regulation System RELOCATION ALLOWANCES TRANSPORTATION AND STORAGE OF PROPERTY 9-ALLOWANCES... From a Post of Duty § 302-9.206 What should I do if there is no port or terminal at my authorized point...

  20. The importance of residues 195-206 of human blood clotting factor VII in the interaction of factor VII with tissue factor

    International Nuclear Information System (INIS)

    Wildgoose, P.; Kisiel, W.; Kazim, A.L.

    1990-01-01

    Previous studies indicated that human and bovine factor VII exhibit 71% amino acid sequence identity. In the present study, competition binding experiments revealed that the interaction of human factor VII with cell-surface human tissue factor was not inhibited by 100-fold molar excess of bovine factor VII. This finding indicated that bovine and human factor VII are not structurally homologous in the region(s) where human factor VII interacts with human tissue factor. On this premise, the authors synthesized three peptides corresponding to regions of human factor VII that exhibited marked structural dissimilarity to bovine factor VII; these regions of dissimilarity included residues 195-206, 263-274, and 314-326. Peptide 195-206 inhibited the interaction of factor VII with cell-surface tissue factor and the activation of factor X by a complex of factor VIIa and tissue factor half-maximally at concentrations of 1-2 mM. A structurally rearranged form of peptide 195-206 containing an aspartimide residue inhibited these reactions half-maximally at concentrations of 250-300 μM. In contrast, neither peptide 263-274 nor peptide 314-326, at 2 mM concentration, significantly affected either factor VIIa interaction with tissue factor or factor VIIa-mediated activation of factor X. The data provide presumptive evidence that residues 195-206 of human factor VII are involved in the interaction of human factor VII with the extracellular domain of human tissue factor apoprotein

  1. Arvustus : Vello Paatsi. Eesti talurahva loodusteadusliku maailmapildi kujunemine rahvakooli kaudu (1803-1918). - Tallinn : TPÜ Kirjastus, 2003. 206 lk. / Jaan-Mati Punning

    Index Scriptorium Estoniae

    Punning, Jaan-Mati, 1940-2009

    2003-01-01

    Rets. rmt. : Paatsi, Vello. Eesti talurahva loodusteadusliku maailmapildi kujunemine rahvakooli kaudu (1803-1918). - Tallinn : Tallinna Pedagoogikaülikooli kirjastus, 2003. - 206 lk. : ill. - (Tallinna Pedagoogikaülikool. Sotsiaalteaduste dissertatsioonid = Tallinn Pedagogical University. Dissertations on social sciences, 1406-4405 ; 5)

  2. 30 CFR 206.356 - How do I calculate royalty or fees due on geothermal resources I use for direct use purposes?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How do I calculate royalty or fees due on... Resources § 206.356 How do I calculate royalty or fees due on geothermal resources I use for direct use... revised fees schedules using the following formulas: ER02MY07.004 Where: RV = Royalty due as a function of...

  3. 41 CFR 302-10.206 - May my agency assume direct responsibility for the costs of preparing and transporting my mobile...

    Science.gov (United States)

    2010-07-01

    ... direct responsibility for the costs of preparing and transporting my mobile home? 302-10.206 Section 302... ALLOWANCES TRANSPORTATION AND STORAGE OF PROPERTY 10-ALLOWANCES FOR TRANSPORTATION OF MOBILE HOMES AND BOATS... responsibility for the costs of preparing and transporting my mobile home? Yes, your agency may assume direct...

  4. Long Noncoding RNA HOTAIR Modulates MiR-206-mediated Bcl-w Signaling to Facilitate Cell Proliferation in Breast Cancer.

    Science.gov (United States)

    Ding, Wei; Ren, Jin; Ren, Hui; Wang, Dan

    2017-12-08

    LncRNA HOX transcript antisense RNA (HOTAIR) is involved in lots of cancers. The pro-survival protein Bcl-w is frequently found in cancer development. However, the effect of HOTAIR on Bcl-w in breast cancer is not well documented. In this study, we first evaluated the correlation between HOTAIR level and Bcl-w expression in clinical breast cancer tissues. We observed that the expression levels of Bcl-w were much higher in the breast cancer samples than that in their paired noncancerous tissues. Moreover, the levels of HOTAIR were positively associated with those of Bcl-w in clinical breast cancer samples. As expected, we observed that HOTAIR was able to up-regulate the expression of Bcl-w in breast cancer cells. Mechanistically, we found that miR-206 was capable of inhibiting the expression of Bcl-w by directly binding to the 3'UTR of Bcl-w mRNA. Interestingly, HOTAIR could increase the expression of Bcl-w through sequestering miR-206 at post-transcriptional level. Functionally, our data showed that HOTAIR-induced Bcl-w by miR-206 facilitated the proliferation of breast cancer cells. Thus, we conclude that HOTAIR up-regulates Bcl-w to enhance cell proliferation through sequestering miR-206 in breast cancer. Our finding provides new insights into the mechanism of breast cancer mediated by HOTAIR.

  5. Serum miR-206 and other muscle-specific microRNAs as non-invasive biomarkers for Duchenne muscular dystrophy.

    Science.gov (United States)

    Hu, Jun; Kong, Min; Ye, Yuanzhen; Hong, Siqi; Cheng, Li; Jiang, Li

    2014-06-01

    Creatine kinase has been utilized as a diagnostic marker for Duchenne muscular dystrophy (DMD), but it correlates less well with the DMD pathological progression. In this study, we hypothesized that muscle-specific microRNAs (miR-1, -133, and -206) in serum may be useful for monitoring the DMD pathological progression, and explored the possibility of these miRNAs as potential non-invasive biomarkers for the disease. By using real-time quantitative reverse transcription-polymerase chain reaction in a randomized and controlled trial, we detected that miR-1, -133, and -206 were significantly over-expressed in the serum of 39 children with DMD (up to 3.20 ± 1.20, 2(-ΔΔCt) ): almost 2- to 4-fold enriched in comparison to samples from the healthy controls (less than 1.15 ± 0.34, 2(-ΔΔCt) ). To determine whether these miRNAs were related to the clinical features of children with DMD, we analyzed the associations compared to creatine kinase. There were very good inverse correlations between the levels of these miRNAs, especially miR-206, and functional performances: high levels corresponded to low muscle strength, muscle function, and quality of life. Moreover, by receiver operating characteristic curves analyses, we revealed that these miRNAs, especially miR-206, were able to discriminate DMD from controls. Thus, miR-206 and other muscle-specific miRNAs in serum are useful for monitoring the DMD pathological progression, and hence as potential non-invasive biomarkers for the disease. There has been a long-standing need for reliable, non-invasive biomarkers for Duchenne muscular dystrophy (DMD). We found that the levels of muscle-specific microRNAs, especially miR-206, in the serum of DMD were 2- to 4-fold higher than in the controls. High levels corresponded to low muscle strength, muscle function, and quality of life (QoL). These miRNAs were able to discriminate DMD from controls by receiver operating characteristic (ROC) curves analyses. Thus, miR-206 and other

  6. An Activin Receptor IA/Activin-Like Kinase-2 (R206H Mutation in Fibrodysplasia Ossificans Progressiva

    Directory of Open Access Journals (Sweden)

    Rafael Herrera-Esparza

    2013-01-01

    Full Text Available Fibrodysplasia ossificans progressiva (FOP is an exceptionally rare genetic disease that is characterised by congenital malformations of the great toes and progressive heterotopic ossification (HO in specific anatomical areas. This disease is caused by a mutation in activin receptor IA/activin-like kinase-2 (ACVR1/ALK2. A Mexican family with one member affected by FOP was studied. The patient is a 19-year-old female who first presented with symptoms of FOP at 8 years old; she developed spontaneous and painful swelling of the right scapular area accompanied by functional limitation of movement. Mutation analysis was performed in which genomic DNA as PCR amplified using primers flanking exons 4 and 6, and PCR products were digested with Cac8I and HphI restriction enzymes. The most informative results were obtained with the exon 4 flanking primers and the Cac8I restriction enzyme, which generated a 253 bp product that carries the ACVR1 617G>A mutation, which causes an amino acid substitution of histidine for arginine at position 206 of the glycine-serine (GS domain, and its mutation results in the dysregulation of bone morphogenetic protein (BMP signalling that causes FOP.

  7. Bee Venom Phospholipase A2 Alleviate House Dust Mite-Induced Atopic Dermatitis-Like Skin Lesions by the CD206 Mannose Receptor.

    Science.gov (United States)

    Shin, Dasom; Choi, Won; Bae, Hyunsu

    2018-04-02

    Atopic dermatitis (AD) is a chronic inflammatory skin disease characterized by highly pruritic, erythematous, and eczematous skin plaques. We previously reported that phospholipase A2 (PLA2) derived from bee venom alleviates AD-like skin lesions induced by 2,4-dinitrochlorobenzene (DNCB) and house dust mite extract ( Dermatophagoides farinae extract, DFE) in a murine model. However, the underlying mechanisms of PLA2 action in actopic dermatitis remain unclear. In this study, we showed that PLA2 treatment inhibited epidermal thickness, serum immunoglobulin E (IgE) and cytokine levels, macrophage and mast cell infiltration in the ear of an AD model induced by DFE and DNCB. In contrast, these effects were abrogated in CD206 mannose receptor-deficient mice exposed to DFE and DNCB in the ear. These data suggest that bvPLA2 alleviates atopic skin inflammation via interaction with CD206.

  8. Neighborhood Socioeconomic Circumstances and the Co-Occurrence of Unhealthy Lifestyles: Evidence from 206,457 Australians in the 45 and Up Study

    OpenAIRE

    Feng, Xiaoqi; Astell-Burt, Thomas

    2013-01-01

    Background Research on the co-occurrence of unhealthy lifestyles has tended to focus mainly upon the demographic and socioeconomic characteristics of individuals. This study investigated the relevance of neighborhood socioeconomic circumstance for multiple unhealthy lifestyles. Method An unhealthy lifestyle index was constructed for 206,457 participants in the 45 and Up Study (2006?2009) by summing binary responses on smoking, alcohol, physical activity and five diet-related variables. Higher...

  9. Fabrication of Al/A206–Al2O3 nano/micro composite by combining ball milling and stir casting technology

    International Nuclear Information System (INIS)

    Tahamtan, S.; Halvaee, A.; Emamy, M.; Zabihi, M.S.

    2013-01-01

    Highlights: ► Uniform distribution of alumina particles in molten Al alloy by using MMMC. ► Improvement in wettability of alumina particles with molten Al alloy by using MMMC. ► Porosity content in Al/A206-alumina composite decreased by using MMMC. ► Improvement in tensile strength of Al/A206-alumina composite by using MMMC. ► Decrease in interfacial reaction product by incorporating MMMC in semi-solid state. - Abstract: Al206/5vol.%Al 2 O 3p cast composites were fabricated by the injection of reinforcing particles into molten Al alloy in two different forms, i.e. as Al 2 O 3 particles and milled particulates of alumina with Al and Mg powders. The resultant milled powders (Master Metal Matrix Composite (MMMC)) were then added into the molten Al alloy both in semi-solid state and above liquidus temperature. Effects of powder addition technique, reinforcement particle size and casting temperature on distribution and incorporation of reinforcing particles into molten Al alloy were investigated. Morphology evolution of powders during milling, microscopic examinations of composite and matrix alloy were studied by scanning electron microscopy (SEM). X-ray diffraction (XRD) analysis was also used to determine the possible interaction between powders after ball milling process. Results showed that injection of powders in the form of MMMC leads to considerable improvement in incorporation and distribution of Al 2 O 3p in the Al206 matrix alloy leading to the improvement in tensile properties. Improvement in tensile properties is attributed to the better wetting of Al 2 O 3p by melt as well as removing microchannels and roughness on alumina particles as a consequence of ball milling process

  10. Molecular and Structural Characterization of the Tegumental 20.6-kDa Protein in Clonorchis sinensis as a Potential Druggable Target

    OpenAIRE

    Kim, Yu-Jung; Yoo, Won Gi; Lee, Myoung-Ro; Kang, Jung-Mi; Na, Byoung-Kuk; Cho, Shin-Hyeong; Park, Mi-Yeoun; Ju, Jung-Won

    2017-01-01

    The tegument, representing the membrane-bound outer surface of platyhelminth parasites, plays an important role for the regulation of the host immune response and parasite survival. A comprehensive understanding of tegumental proteins can provide drug candidates for use against helminth-associated diseases, such as clonorchiasis caused by the liver fluke Clonorchis sinensis. However, little is known regarding the physicochemical properties of C. sinensis teguments. In this study, a novel 20.6...

  11. Impaired osteogenic differentiation associated with connexin43/microRNA-206 in steroid-induced avascular necrosis of the femoral head.

    Science.gov (United States)

    Liu, Gang; Luo, Gaobin; Bo, Zhandong; Liang, Xiaonan; Huang, Jie; Li, Donghui

    2016-08-01

    Connexin(Cx)43 and microRNA(miR)-206 play an important role in osteogenesis. However, their role in steroid-induced femoral head osteonecrosis (SANFH) is still ambiguous. The present study aimed to establish a rabbit model and investigate osteogenesis in steroid-induced femoral head osteonecrosis occurring via Cx43/miR-206 and the changes of Wnt/β-catenin signal pathway-related proteins. A total of 72 adult New Zealand white rabbits were divided randomly into a model group (Group A) and a control group (Group B) of 36 rabbits each. Group A was injected intravenously with lipopolysaccharide (10μg/kg body weight, once per day). After 48h, three injections of methylprednisolone (MPS; 20mg/kg body weight) were administered intramuscularly at 24-hour intervals. Group B were fed and housed under identical conditions but received saline injections. All animals were sacrificed at two, four, and eight weeks from the first MPS injection. Typical early osteonecrosis symptoms were observed in Group A. The expression of miR-206 in Group A was significantly higher than that of Group B. The mRNA and protein levels of Cx43, β-catenin, runt-related transcription factor 2, and alkaline phosphatase gradually decreased while Dickkopf-1 (Dkk-1) gradually increased in Group A compared with Group B. These findings indicated that Cx43/miR-206 is involved in the pathogenesis of early stage SANFH and may be associate with Wnt/β-catenin signal pathway. Copyright © 2016 Elsevier Inc. All rights reserved.

  12. (3He,xn), (3He,pxn) and (3He, fission) reactions on 206Pb between 80 and 200MeV

    International Nuclear Information System (INIS)

    Andre, C.; Gauvin, H.; Le Beyec, Y.; Porile, N.T.

    1976-01-01

    The reactions induced in 206 Pb by 3 He particles having energies between 80 and 200MeV have been studied. Excitation functions for ( 3 He,xn) with x=3 to 14 and for ( 3 He,pxn) with x=2 to 5 have been obtained. Angular distributions of fission fragments were measured at 100, 125, 150 and 175MeV and total fission cross-sections were deduced from the data. On the basis of these results, analysis is attempted to examine the characteristics of reaction mechanisms. From these results it is concluded that non-compound processes play an important role in the reactions. Two features are characteristic of these processes: large cross-sections for charged particle emission and angular distribution of fission fragments closed to isotropy in the laboratory system. In the energy range 25 to 45MeV/nucleon, a comparison was made between the present results and those from an experimental study of α-particle induced reactions on 206 Pb. Also a comparison was made with an α-nucleus collision model applied to 206 Pb. All the observations strongly suggest a breakup of the projectile 3 He followed by the interactions of the fragments with the target nucleus [fr

  13. The glucokinase mutation p.T206P is common among MODY patients of Jewish Ashkenazi descent.

    Science.gov (United States)

    Gozlan, Yael; Tenenbaum, Ariel; Shalitin, Shlomit; Lebenthal, Yael; Oron, Tal; Cohen, Ohad; Phillip, Moshe; Gat-Yablonski, Galia

    2012-09-01

    Maturity-onset diabetes of the young (MODY) is characterized by an autosomal dominant mode of inheritance; a primary defect in insulin secretion with non-ketotic hyperglycemia, age of onset under 25 yr; and lack of autoantibodies. Heterozygous mutations in glucokinase (GCK) are associated with mild fasting hyperglycemia and gestational diabetes mellitus while homozygous or compound heterozygous GCK mutations result in permanent neonatal diabetes mellitus. Given that both the Israeli-Arabic and the various Israeli-Jewish communities tend to maintain ethnic seclusion, we speculated that it would be possible to identify a relatively narrow spectrum of mutations in the Israeli population. To characterize the genetic basis of GCK-MODY in the different ethnic groups of the Israeli population. Patients with clinically identified GCK-MODY and their first degree family members. Molecular analysis of GCK was performed on genomic DNA using polymerase chain reaction, denaturing gradient gel electrophoresis (DGGE), and sequencing. Bioinformatic model was preformed using the NEST program. Mutations in GCK were identified in 25 families and were all family-specific, except c.616A>C. p.T206P. This mutation was identified in six unrelated families, all patients from a Jewish-Ashkenazi descent, thus indicating an ethno-genetic correlation. A simple, fast, and relatively cheap DGGE/restriction-digestion assay was developed. The high incidence of the mutant allele in GCK-MODY patients of Jewish-Ashkenazi descent suggests a founder effect. We propose that clinically identified GCK-MODY patients of Jewish-Ashkenazi origin be first tested for this mutation. © 2011 John Wiley & Sons A/S.

  14. 207Pb-206Pb zircon ages of eastern and western Dharwar craton, southern India : Evidence for contemporaneous Archaean crust

    Science.gov (United States)

    Maibam, B.; Goswami, J. N.; Srinivasan, R.

    2009-04-01

    Dharwar craton is one of the major Archaean crustal blocks in the Indian subcontinent. The craton is comprised of two blocks, western and eastern. The western domain is underlain by orthogneisses and granodiorites (ca. 2.9-3.3 Ga) collectively termed as Peninsular Gneiss [e.g., 1] interspersed with older tracts of metasedimentary and metamorphosed igneous suites (Sargur Group and Dharwar Group; [2]). The eastern part of the craton is dominated by Late Archaean (2.50-2.75 Ga) granitoids and their gneissic equivalents. They are interspersed with schist belts (also of Sargur Group and Dharwar Group), which are lithologically similar to the Dharwar Supergroup in the western block, but are in different metamorphic dress. Here we report 207Pb-206Pb age of zircons separated from the metasedimentary and gneissic samples from the two blocks to constrain the evolution of the Dharwar craton during the early Archaean. Detrital zircons of the metasedimentary rocks from both the blocks show a wide range of overlapping ages between ~2.9 to >3.5 Ga. Zircon ages of the orthogneisses from the two blocks showed that most of the analysed grains of the eastern Dharwar block are found to be of the age as old as the western Dharwar gneisses. Imprints of younger events could be discerned from the presence of overgrowths in zircons from the studied samples throughout the craton. Our data suggest that crust forming cycles in the two blocks of the Dharwar craton occurred contemporaneously during the Archaean. References [1] Beckinsale, R.D., Drury, S.A., Holt, R.W. (1980) Nature 283, 469-470. [2] Swami Nath J., Ramakrishnan M., Viswanatha M.N. (1976) Rec. Geol. Surv. Ind., 107, 149-175.

  15. Effects of silicon, copper and iron on static and dynamic properties of alloy 206 (aluminum-copper) in semi-solids produced by the SEED process

    Science.gov (United States)

    Lemieux, Alain

    The advantages of producing metal parts by rheocasting are generally recognised for common foundry alloys of Al-Si. However, other more performing alloys in terms of mechanical properties could have a great interest in specialized applications in the automotive industry, while remaining competitive in the forming. Indeed, the growing demand for more competitive products requires the development of new alloys better suited to semi-solid processes. Among others, Al-Cu alloys of the 2XX series are known for their superior mechanical strength. However, in the past, 2XX alloys were never candidates for pressure die casting. The main reason is their propensity to hot tearing. Semi-solid processes provide better conditions for molding with the rheological behavior of dough and molding temperatures lower reducing this type of defect. In the initial phase, this research has studied factors that reduce hot tearing susceptibility of castings produced by semi-solid SEED of alloy 206. Subsequently, a comparative study on the tensile properties and fatigue was performed on four variants of the alloy 206. The results of tensile strength and fatigue were compared with the specifications for applications in the automotive industry and also to other competing processes and alloys. During this study, several metallurgical aspects were analyzed. The following main points have been validated: i) the main effects of compositional variations of silicon, iron and copper alloy Al-Cu (206) on the mechanical properties, and ii) certain relationships between the mechanism of hot cracking and the solidification rate in semi-solid. Parts produced from the semi-solid paste coming from the SEED process combined with modified 206 alloys have been successfully molded and achieved superior mechanical properties than the requirements of the automotive industry. The fatigue properties of the two best modified 206 alloys were higher than those of A357 alloy castings and are close to those of the

  16. CD206+ Cell Number Differentiates Influenza A (H1N1pdm09 from Seasonal Influenza A Virus in Fatal Cases

    Directory of Open Access Journals (Sweden)

    Heidi G. Rodriguez-Ramirez

    2014-01-01

    Full Text Available In 2009, a new influenza A (H1N1 virus affected many persons around the world. There is an urgent need for finding biomarkers to distinguish between influenza A (H1N1pdm09 and seasonal influenza virus. We investigated these possible biomarkers in the lung of fatal cases of confirmed influenza A (H1N1pdm09. Cytokines (inflammatory and anti-inflammatory and cellular markers (macrophages and lymphocytes subpopulation markers were analyzed in lung tissue from both influenza A (H1N1pdm09 and seasonal influenza virus. High levels of IL-17, IFN-γ, and TNF-α positive cells were identical in lung tissue from the influenza A (H1N1pdm09 and seasonal cases when compared with healthy lung tissue (P<0.05. Increased IL-4+ cells, and CD4+ and CD14+ cells were also found in high levels in both influenza A (H1N1pdm09 and seasonal influenza virus (P<0.05. Low levels of CD206+ cells (marker of alternatively activated macrophages marker in lung were found in influenza A (H1N1pdm09 when compared with seasonal influenza virus (P<0.05, and the ratio of CD206/CD14+ cells was 2.5-fold higher in seasonal and noninfluenza group compared with influenza A (H1N1pdm09 (P<0.05. In conclusion, CD206+ cells differentiate between influenza A (H1N1pdm09 and seasonal influenza virus in lung tissue of fatal cases.

  17. Passive mode locking of an in-band-pumped Ho:YLiF4 laser at 2.06 μm.

    Science.gov (United States)

    Coluccelli, Nicola; Lagatsky, Alexander; Di Lieto, Alberto; Tonelli, Mauro; Galzerano, Gianluca; Sibbett, Wilson; Laporta, Paolo

    2011-08-15

    We demonstrate the passive mode-locking operation of an in-band-pumped Ho:YLiF(4) laser at 2.06 μm using a semiconductor saturable absorber mirror based on InGaAsSb quantum wells. A transform-limited pulse train with minimum duration of 1.1 ps and average power of 0.58 W has been obtained at a repetition frequency of 122 MHz. A maximum output power of 1.7 W has been generated with a corresponding pulse duration of 1.9 ps. © 2011 Optical Society of America

  18. Circulating miR-1, miR-133a, and miR-206 levels are increased after a half-marathon run.

    Science.gov (United States)

    Gomes, Clarissa P C; Oliveira, Getúlio P; Madrid, Bibiano; Almeida, Jeeser A; Franco, Octávio L; Pereira, Rinaldo W

    2014-11-01

    Circulating miRNAs are potential biomarkers that can be important molecules driving cell-to-cell communication. To investigate circulating muscle-specific miRNAs in recreational athletes. Three miRNAs from whole plasma before and after a half-marathon were analyzed by qPCR. MiR-1, -133a, and -206 significantly increased after the race. Increased levels of miRNAs after exercise point to potential biomarkers and to the possibility of being functional players following endurance training. These miRNAs are potential biomarkers of muscle damage or adaptation to exercise.

  19. Testing the mutually enhanced magicity effect in nuclear incompressibility via the giant monopole resonance in the {sup 204,206,208}Pb isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Patel, D. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Joint Institute for Nuclear Astrophysics, University of Notre Dame, Notre Dame, IN 46556 (United States); Garg, U., E-mail: garg@nd.edu [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Joint Institute for Nuclear Astrophysics, University of Notre Dame, Notre Dame, IN 46556 (United States); Fujiwara, M. [Research Center for Nuclear Physics, Osaka University, Osaka 567-0047 (Japan); Adachi, T. [Kernfysisch Versneller Instituut, University of Groningen, 9747 AA Groningen (Netherlands); Akimune, H. [Department of Physics, Konan University, Kobe 568-8501 (Japan); Berg, G.P.A. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Joint Institute for Nuclear Astrophysics, University of Notre Dame, Notre Dame, IN 46556 (United States); Harakeh, M.N. [Kernfysisch Versneller Instituut, University of Groningen, 9747 AA Groningen (Netherlands); GANIL, CEA/DSM-CNRS/IN2P3, 14076 Cean (France); Itoh, M. [Cyclotron and Radioisotope Center, Tohoku University, Sendai 980-8578 (Japan); Iwamoto, C. [Department of Physics, Konan University, Kobe 568-8501 (Japan); Long, A.; Matta, J.T. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Joint Institute for Nuclear Astrophysics, University of Notre Dame, Notre Dame, IN 46556 (United States); Murakami, T. [Division of Physics and Astronomy, Kyoto University, Kyoto 606-8502 (Japan); Okamoto, A. [Department of Physics, Konan University, Kobe 568-8501 (Japan); Sault, K. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Talwar, R. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Joint Institute for Nuclear Astrophysics, University of Notre Dame, Notre Dame, IN 46556 (United States); Uchida, M. [Department of Physics, Tokyo Institute of Technology, Tokyo 152-8850 (Japan); and others

    2013-10-07

    Using inelastic α-scattering at extremely forward angles, including 0°, the strength distributions of the isoscalar giant monopole resonance (ISGMR) have been measured in the {sup 204,206,208}Pb isotopes in order to examine the proposed mutually enhanced magicity (MEM) effect on the nuclear incompressibility. The MEM effect had been suggested as a likely explanation of the “softness” of nuclear incompressibility observed in the ISGMR measurements in the Sn and Cd isotopes. Our experimental results rule out any manifestation of the MEM effect in nuclear incompressibility and leave the question of the softness of the open-shell nuclei unresolved still.

  20. Spectroscopic study of 206,207,208Pb isotopes by high resolution analysis of 24.5 MeV proton scattering

    International Nuclear Information System (INIS)

    Vallois, G.

    1968-03-01

    206,207,208 pb have been studied by 24.5 MeV proton inelastic scattering with a resolution of 20 keV. The angular distributions of the differential cross-sections corresponding to the different excited levels have been measured in a large angular region and analysed with the DWBA.This work shows that it exists between 4 and 5 MeV of excitation energy some strongly excited levels corresponding to transfer momenta l = 2, 4, 6 and 8. The single particle-hole models do not explain these states; so it will probably be necessary to introduce some several particle - hole configurations. (author) [fr

  1. Understanding the two neutron transfer reaction mechanism in {sup 206}Pb({sup 18}O,{sup 16}O){sup 208}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Parmar, A.; Sonika [Nuclear Physics Division, Bhabha Atomic Research Centre, Mumbai - 400 085 (India); Roy, B.J., E-mail: bjroy@barc.gov.in [Nuclear Physics Division, Bhabha Atomic Research Centre, Mumbai - 400 085 (India); Jha, V.; Pal, U.K. [Nuclear Physics Division, Bhabha Atomic Research Centre, Mumbai - 400 085 (India); Sinha, T. [High Energy Nuclear and Particle Physics Division, Saha Institute of Nuclear Physics, Kolkata - 700 064 (India); Pandit, S.K.; Parkar, V.V.; Ramachandran, K.; Mahata, K.; Santra, S.; Mohanty, A.K. [Nuclear Physics Division, Bhabha Atomic Research Centre, Mumbai - 400 085 (India)

    2015-08-15

    The absolute cross sections for elastic scattering and two-neutron transfer reaction for {sup 18}O + {sup 206}Pb system have been measured at an incident energy near the Coulomb barrier. Detailed coupled reaction channel calculations have been carried out for description of the measured angular distributions for the elastic scattering and transfer reactions simultaneously. The two-neutron transfer reaction {sup 206}Pb({sup 18}O, {sup 16}O){sup 208}Pb in the g.s. → g.s. transition is analyzed in (i) extreme cluster model assuming a di-neutron transfer, (ii) two-step successive transfer, and (iii) microscopic approach (independent coordinate scheme) of simultaneous transfer of two neutrons. The relative importance of one step simultaneous transfer versus two-step successive transfer has been studied. Present analysis suggests dominance of cluster transfer of a di-neutron. The contribution from the two-step sequential processes is less significant, however, the combined “two-step plus simultaneous (microscopic)” calculations give a reasonably good agreement with the measurement. The possibility of multi-step route via projectile and target excitations and contribution from such indirect transfer paths to the present two-neutron transfer cross section has been investigated.

  2. Amphiregulin enhances VEGF-A production in human chondrosarcoma cells and promotes angiogenesis by inhibiting miR-206 via FAK/c-Src/PKCδ pathway.

    Science.gov (United States)

    Wang, Chao-Qun; Huang, Yu-Wen; Wang, Shih-Wei; Huang, Yuan-Li; Tsai, Chun-Hao; Zhao, Yong-Ming; Huang, Bi-Fei; Xu, Guo-Hong; Fong, Yi-Chin; Tang, Chih-Hsin

    2017-01-28

    Chondrosarcoma is the second most common primary malignancy of bone after myeloma and osteosarcoma. Chondrosarcoma development may be linked to angiogenesis, which is principally elicited by vascular endothelial growth factor-A (VEGF-A). The expression of VEGF-A has been recognized as a prognostic marker in angiogenesis. Amphiregulin (AR), an epidermal growth factor receptor ligand, promotes tumor proliferation, metastasis and angiogenesis. However, the role of AR in VEGF-A expression and angiogenesis in human chondrosarcoma remains largely unknown. This current study shows that AR promoted VEGF-A production and induced angiogenesis of human endothelial progenitor cells. Moreover, AR-enhanced VEGF-A expression and angiogenesis involved the FAK, c-Src and PKCδ signaling pathways, while miR-206 expression was negatively mediated by AR via the FAK, c-Src and PKCδ pathways. Our results illustrate the clinical significance between AR, VEGF-A and miR-206, as well as tumor stage, in human chondrosarcoma. AR may represent a novel therapeutic target in the metastasis and angiogenesis of chondrosarcoma. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  3. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  4. Reaction of aromatic diazonium salts with carrier-free radioiodine and astatine, evidence for complex formation

    International Nuclear Information System (INIS)

    Meyer, G.J.; Roessler, K.; Stoecklin, G.

    1979-01-01

    Systematic studies of the astatodiazoniation reaction and a comparison with iododediazoniation under comparable conditions are reported. The yields for all astatohalobenzenes and -toluenes were nearly constant and unaffected by the nature of the diazonium compound, its isomeric form, and the number of isomers used at the same time. Only astatofluorobenzenes were obtained at higher yields. An electron-transfer mechanism is proposed for dediazoniation at these low halide concentration levels. At sufficient thermal excitation levels the electron transfer leads to the dissociation of nitrogen, while the phenyl and halogen radicals recombine. The isomer distribution found for some of the derivatives from dediazoniation may also be due to steric effects

  5. Astatine-211-labeled biotin conjugates resistant to biotinidase for use in pretargeted radioimmunotherapy

    International Nuclear Information System (INIS)

    Foulon, Catherine F.; Alston, Kevin L.; Zalutsky, Michael R.

    1998-01-01

    We report herein the preparation and biological evaluation of two radioastatinated biotin conjugates, (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide. Both conjugates were stable in the presence of human serum and cerebrospinal fluid as well as murine serum, indicating a resistance to degradation to biotinidase. The normal tissue clearance of (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide was rapid, as observed previously with their iodo analogues. Also reported are the first syntheses of N-succinimidyl 5-[ 211 At]astato-3-pyridinecarboxylate and 3-[ 211 At]astatoaniline, two reagents of potential utility for labeling proteins and peptides with 211 At

  6. Microdosimetry of astatine-211 and comparison with that of iodine-125

    International Nuclear Information System (INIS)

    Unak, T.

    2001-01-01

    211 At is an alpha and Auger emitter radionuclide and has been frequently used for labeling of different kind of chemical agents. 125 I is also known as an effective Auger emitter. The radionuclides which emit short range and high LET radiations such as alpha particles and Auger electrons have high radiotoxic effectiveness on the living systems. The microdosimetric data are suitable to clarify the real radiotoxic effectiveness and to get the detail of diagnostic and therapeutic application principles of these radionuclides. In this study, the energy and dose absorptions by cell nucleus from alpha particles and Auger electrons emitted by 211 At have been calculated using a Monte Carlo calculation program (code: UNMOC). For these calculations two different model corresponding to the cell nucleus have been used and the data obtained were compared with the data earlier obtained for 125 I. As a result, the radiotoxicity of 211 At is in the competition with 125 I. In the case of a specific agent labelled with 211 At or 125 I is incorporated into the cell or cell nucleus, but non-bound to DNA or not found very close to it, 211 At should considerably be much more radiotoxic than 125 I, but in the case of the labelled agent is bound to DNA or take a place very close to it, the radiotoxicity of 125 I should considerably be higher than 211 At. (author)

  7. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-211 Isolation

    International Nuclear Information System (INIS)

    Wilbur, Daniel Scott

    2016-01-01

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O'Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-year project with 1 year no-cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211 At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211 At capture (>95%) from 8M HCl solutions and release with conc. NH 4 OH (~50-80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211 At when loading [ 211 At]astatate appeared to be similar to that of [ 211 At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211 At on PEG columns was lower (e.g. 80-90%) from solutions of 8M HNO 3 , but higher capture rates (e.g. 99%) can be obtained when 10M HNO 3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211 At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-automated 211 At isolation studies have been conducted with full-scale target dissolution and 211 At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO 3 was used (rather than HCl) for loading the 211 At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211 At separation from bismuth, which allow use of HNO 3 /HCl mixtures for loading and NaOH for eluting 211 At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  8. The potential of 211Astatine for NIS-mediated radionuclide therapy in prostate cancer

    International Nuclear Information System (INIS)

    Willhauck, Michael J.; Sharif Samani, Bibi-Rana; Goeke, Burkhard; Wolf, Ingo; Senekowitsch-Schmidtke, Reingard; Stark, Hans-Juergen; Meyer, Geerd J.; Knapp, Wolfram H.; Morris, John C.; Spitzweg, Christine

    2008-01-01

    We reported recently the induction of selective iodide uptake in prostate cancer cells (LNCaP) by prostate-specific antigen (PSA) promoter-directed sodium iodide symporter (NIS) expression that allowed a significant therapeutic effect of 131 I. In the current study, we studied the potential of the high-energy alpha-emitter 211 At, also transported by NIS, as an alternative radionuclide after NIS gene transfer in tumors with limited therapeutic efficacy of 131 I due to rapid iodide efflux. We investigated uptake and therapeutic efficacy of 211 At in LNCaP cells stably expressing NIS under the control of the PSA promoter (NP-1) in vitro and in vivo. NP-1 cells concentrated 211 At in a perchlorate-sensitive manner, which allowed a dramatic therapeutic effect in vitro. After intrapertoneal injection of 211 At (1 MBq), NP-1 tumors accumulated approximately 16% ID/g 211 At (effective half-life 4.6 h), which resulted in a tumor-absorbed dose of 1,580 ± 345 mGy/MBq and a significant tumor volume reduction of up to 82 ± 19%, while control tumors continued their growth exponentially. A significant therapeutic effect of 211 At has been demonstrated in prostate cancer after PSA promoter-directed NIS gene transfer in vitro and in vivo suggesting a potential role for 211 At as an attractive alternative radioisotope for NIS-targeted radionuclide therapy, in particular in smaller tumors with limited radionuclide retention time. (orig.)

  9. Sci-Thur AM: YIS – 01: New technologies for astatine-211 targeted alpha therapy research

    Energy Technology Data Exchange (ETDEWEB)

    Crawford, Jason; Yang, Hua; Schaffer, Paul; Ruth, Thomas [University of Victoria, Victoria, BC (Canada); TRIUMF, Vancouver, BC (Canada)

    2016-08-15

    Purpose: The short-range, densely ionizing α-particles emitted by {sup 211}At (t{sub 1/2}=7.2h) are well suited for the treatment of diffuse microscopic disease, using cancer targeting biomolecules. {sup 211}At availability is limited by the rarity of α-cyclotrons required for standard production. Image-based dosimetry is also limited for {sup 211}At, which emits low intensity X-rays. Our goal was to leverage state-of-the-art infrastructure at TRIUMF to produce and evaluate two related isotopes, {sup 211}Rn (t{sub 1/2}=14.6h, 73% decay to {sup 211}At) as a generator for {sup 211}At, and {sup 209}At (t{sub 1/2}=5.4h, X-ray/gamma-ray emitter) as a novel 211At surrogate for preclinical imaging studies. Methods: Produced by spallation of uranium with 480 MeV protons, mass separated ion beams of short-lived francium isotopes were implanted into NaCl targets where {sup 211}Rn or {sup 209}At were produced by radioactive decay, in situ. {sup 211}Rn was transferred to dodecane from which {sup 211}At was efficiently extracted and evaluated for clinical applicability. High energy SPECT/CT was evaluated for measuring {sup 209}At activity distributions in mice and phantoms. Results: Our small scale {sup 211}Rn/{sup 211}At generator system provided high purity {sup 211}At samples. The methods are immediately scalable to the level of radioactivity required for in vivo experiments with {sup 211}At. {sup 209}At-based high energy SPECT imaging was determined suitable for pursuing image-based dosimetry in mouse tumour models. In the future, we will utilize quantitative {sup 209}At-SPECT for image-based dose calculations. Conclusion: These early studies provided a foundation for future endeavours with {sup 211}At-based α-therapy. Canada is now significantly closer to clinical targeted α-therapy of cancer.

  10. Targeted radionuclide therapy with astatine-211: Oxidative dehalogenation of astatobenzoate conjugates.

    Science.gov (United States)

    Teze, David; Sergentu, Dumitru-Claudiu; Kalichuk, Valentina; Barbet, Jacques; Deniaud, David; Galland, Nicolas; Maurice, Rémi; Montavon, Gilles

    2017-05-31

    211 At is a most promising radionuclide for targeted alpha therapy. However, its limited availability and poorly known basic chemistry hamper its use. Based on the analogy with iodine, labelling is performed via astatobenzoate conjugates, but in vivo deastatination occurs, particularly when the conjugates are internalized in cells. Actually, the chemical or biological mechanism responsible for deastatination is unknown. In this work, we show that the C-At "organometalloid" bond can be cleaved by oxidative dehalogenation induced by oxidants such as permanganates, peroxides or hydroxyl radicals. Quantum mechanical calculations demonstrate that astatobenzoates are more sensitive to oxidation than iodobenzoates, and the oxidative deastatination rate is estimated to be about 6 × 10 6 faster at 37 °C than the oxidative deiodination one. Therefore, we attribute the "internal" deastatination mechanism to oxidative dehalogenation in biological compartments, in particular lysosomes.

  11. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  12. Use of interhalogen exchange for preparation of astatine-benzene and iodo-benzene

    International Nuclear Information System (INIS)

    Kolachkovski, A.; Khalkin, V.A.

    1976-01-01

    Experimental testing of interhalogen exchange between the solid and liquid phases has been carried out at 155 deg C with particular reference to a NaOH-Na 131 I-BrPh system. Iodine transition rate is dependent on the process duration and alkali amount. The relative amounts of 131 IPh resultant from the reaction of interhalogen exchange is evaluated by paper chromatography. The results obtained may be considered as those which provide experimental support for the assumed efficiency of the production of 131 IPh based on the reaction of interhalogen exchange to yield 70-80% 131 IPh

  13. Preparation and evaluation of an astatine-211-labeled sigma receptor ligand for alpha radionuclide therapy

    International Nuclear Information System (INIS)

    Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira

    2015-01-01

    Introduction: Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated 131 I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[ 131 I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[ 131 I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[ 211 At]pAtV, an 211 At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. Methods: The radiolabeled sigma receptor ligand (+)-[ 211 At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[ 211 At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. Results: The lipophilicity of (+)-[ 211 At]pAtV was similar to that of (+)-[ 125 I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1 h post-injection were also similar between (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV. Namely, (+)-[ 211 At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. Conclusion: These results indicate that (+)-[ 211 At]pAtV could function as an new agent for alpha-radionuclide receptor therapy.

  14. Preparation and evaluation of an astatine-211-labeled sigma receptor ligand for alpha radionuclide therapy.

    Science.gov (United States)

    Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira

    2015-11-01

    Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated (131)I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[(131)I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[(131)I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[(211)At]pAtV, an (211)At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. The radiolabeled sigma receptor ligand (+)-[(211)At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[(211)At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[(211)At]pAtV and (+)-[(125)I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. The lipophilicity of (+)-[(211)At]pAtV was similar to that of (+)-[(125)I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1h post-injection were also similar between (+)-[(211)At]pAtV and (+)-[(125)I]pIV. Namely, (+)-[(211)At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. These results indicate that (+)-[(211)At]pAtV could function as an new agent for alpha-radionuclide receptor therapy. Copyright © 2015 Elsevier Inc. All rights reserved.

  15. Mapping the boundaries of the seniority regime and collective motion: Coulomb excitation studies of N = 122 isotones $^{206}$Po and $^{208}$Rn

    CERN Multimedia

    Butler, P; Voulot, D; Rahkila, P J; Darby, I G; Grahn, T; Bree, N C F; Julin, R J; Diriken, J V J; Jenkins, D G; Kroell, T; Huyse, M L

    In regions near magic nuclei, seniority can be regarded as a good quantum number. In the N = 122 isotones above the Z = 82 shell closure relative high-$\\textit{j}\\,$ single-particle proton orbitals dominate the structure and thus levels up to $\\textit{I}$ = 2$\\textit{j}$ - 1 could, in principle, be understood within the seniority scheme. While B(E2) values usually increase within the band with increasing $\\textit{I}$, the seniority scheme can lead to a contrasting result. The present proposal addresses this phenomenon through the measurements of previously unknown B(E2; 0$^{+}\\rightarrow$ 2$^{+}$) values in $^{206}$Po and $^{208}$Rn. The proposed Coulomb excitation measurements of radioactive beams will be carried out at the REX-ISOLDE facility using the MINIBALL $\\gamma$-ray spectrometer.

  16. High-slope-efficiency 2.06 μm Ho: YLF laser in-band pumped by a fiber-coupled broadband diode.

    Science.gov (United States)

    Ji, Encai; Liu, Qiang; Nie, Mingming; Cao, Xuezhe; Fu, Xing; Gong, Mali

    2016-03-15

    We first demonstrate the laser performance of a compact 2.06 μm Ho: YLF laser resonantly pumped by a broadband fiber-coupled diode. In continuous-wave (CW) operation, maximum output power of 1.63 W, corresponding to a slope efficiency of 89.2%, was obtained with a near diffraction-limited beam quality. In actively Q-switched operation, maximum pulse energy of 1.1 mJ was achieved at the repetition frequency of 100 Hz. The minimum pulse duration was 43 ns. The performance in both the CW and Q-switched regimes indicates that the current fiber-coupled diode in-band pumped Ho: YLF laser has great potential in certain conditions that require several watts of output power or several millijoules of short pulse energy.

  17. Calculations and Evaluations of Cross Sections for n + 204,206,207,208,natPb Reactions in the En ≤ 250 MeV Energy Range

    International Nuclear Information System (INIS)

    Han Yinlu; Shen Qingbiao; Zhang Zhengjun; Cai Chonghai

    2005-01-01

    The quality and reliability of the computational simulation of a macroscopic nuclear device are directly related to the quality of the underlying basic nuclear data. To meet these needs, according to advanced nuclear models that account for details of nuclear structure and the quantum nature of nuclear reaction and the experimental data of total, nonelastic, and elastic scattering cross sections, and elastic scattering angular distributions of Pb and its isotopes, all cross sections of neutron-induced reaction, angular distributions, energy spectra, especially the double-differential cross sections for neutron, proton, deuteron, triton, helium, and alpha emissions are calculated and analyzed for n + 204,206,207,208,nat Pb at incident neutron energies below 20 MeV by using the UNF nuclear model code. At neutron incident energies 20 n ≤ 250 MeV, MEND codes are used. Theoretical calculations are compared with existing experimental data and other evaluated data from ENDF/B-VI and JENDL-3

  18. Advances in Interlaboratory Testing and Evaluation of Bituminous Materials State-of-the-Art Report of the RILEM Technical Committee 206-ATB

    CERN Document Server

    Bahia, Hussain; Canestrari, Francesco; Roche, Chantal; Benedetto, Hervé; Piber, Herald; Sybilski, Dariusz

    2013-01-01

    This STAR on asphalt materials presents the achievements of RILEM TC 206 ATB, acquired over many years of interlaboratory tests and international knowledge exchange. It covers experimental aspects of bituminous binder fatigue testing; the background on compaction methods and imaging techniques for characterizing asphalt mixtures including validation of a new imaging software; it focuses on experimental questions and analysis tools regarding mechanical wheel tracking tests, comparing results from different labs and using finite element techniques. Furthermore, long-term rutting prediction and evaluation for an Austrian road are discussed, followed by an extensive analysis and test program on interlayer bond testing of three different test sections which were specifically constructed for this purpose. Finally, the key issue of manufacturing reclaimed hot mix asphalt in the laboratory is studied and recommendations for laboratory ageing of bituminous mixtures are given.

  19. MiR-206 functions as a tumor suppressor and directly targets K-Ras in human oral squamous cell carcinoma [Retraction

    Directory of Open Access Journals (Sweden)

    Lin FO

    2016-10-01

    Full Text Available The Editor-in-Chief and Publisher of OncoTargets and Therapy have been alerted to unacceptable levels of duplication with another published paper: Zhang D, Ni Z, Xu X, and Xiao J. MiR-32 Functions as a Tumor Suppressor and Directly Targets EZH2 in Human Oral Squamous Cell Carcinoma. Medical Science Monitor. 20:2527–2535, 2014.Accordingly, we retract Lin FO, Yao LJ, Xiao J, Liu DF, and Ni ZY. MiR-206 functions as a tumor suppressor and directly targets K-Ras in human oral squamous cell carcinoma. OncoTargets and Therapy. 2014;7:1583–1591.This Retraction relates to 

  20. Correction to “Advancing the Conversation: Next Steps for Lesbian, Gay, Bisexual, Trans, and Queer (LGBTQ Health Sciences Librarianship” on 105(4 October, page 325. DOI: http://dx.doi.org/10.5195/jmla.2017.206

    Directory of Open Access Journals (Sweden)

    Katherine G. Akers

    2018-01-01

    Full Text Available Corrects author name in reference #11 of “Advancing the Conversation: Next Steps For Lesbian, Gay, Bisexual, Trans, and Queer (LGBTQ Health Sciences Librarianship” on 105(4 October, page 325. DOI: http://dx.doi.org/10.5195/jmla.2017.206.

  1. Spectroscopic study of {sup 206,207,208}Pb isotopes by high resolution analysis of 24.5 MeV proton scattering; Etude spectroscopique des isotopes 206, 207 et 208 du plomb par analyse a haute resolution de la diffusion de protons de 24,5 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Vallois, G [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1968-03-01

    {sup 206,207,208}pb have been studied by 24.5 MeV proton inelastic scattering with a resolution of 20 keV. The angular distributions of the differential cross-sections corresponding to the different excited levels have been measured in a large angular region and analysed with the DWBA.This work shows that it exists between 4 and 5 MeV of excitation energy some strongly excited levels corresponding to transfer momenta l = 2, 4, 6 and 8. The single particle-hole models do not explain these states; so it will probably be necessary to introduce some several particle - hole configurations. (author) [French] Les isotopes 206, 207 et 208 du plomb ont ete etudies par diffusion inelastique de protons de 24,5 MeV avec une resolution de 20 keV. Les distributions angulaires des sections efficaces differentielles correspondant aux differents niveaux excites ont ete mesurees sur un large domaine angulaire et analysees a l'aide de la DWBA. Ce travail met en evidence l'existence, entre 4 et 5 MeV d'excitation, de niveaux fortement excites correspondant a des moments de transfert de 2, 4, 6 et 8. Les modeles a simple particule-trou ne rendant pas compte de ces niveaux, il faudra sans doute recourir a des configurations a plusieurs particules-trous pour les expliquer. (auteur)

  2. Summary of micrographic analysis of selected core samples from Well ER-20-6n number 1 in support of matrix diffusion testing

    International Nuclear Information System (INIS)

    1998-01-01

    ER-20-6number s ign1 was cored to determine fracture and lithologic properties proximal to the BULLION test cavity. Selected samples from ER-20-6number s ign1 were subjected to matrix and/or fracture diffusion experiments to assess solute movement in this environment. Micrographic analysis of these samples suggests that the similarity in bulk chemical composition results in very similar mineral assemblages forming along natural fractures. These samples are all part of the mafic-poor Calico Hills Formation and exhibit fracture-coating mineral assemblages dominated by mixed illite/smectite clay and illite, with local opaline silica (2,236 and 2, 812 feet), and zeolite (at 2,236 feet). Based on this small sample population, the magnitude to which secondary phases have formed on fracture surfaces bears an apparently inverse relationship to the competency of the host lithology, reflected by variations in the degree of fracturing and the development of secondary phases on fracture surfaces. In the flow breccia at 2,851 feet, thinly developed, localized coatings are developed along persistent open fracture apertures in this competent rock type. Fractures in the devitrified lava from 2,812 feet are irregular, and locally blocked by secondary mineral phases. Natural fractures on the zeolitized tuff from 2,236 feet are discontinuous and irregular and typically obstructed with secondary mineral phases. There are also a second set of clean fractures in the 2,236 foot sample which lack secondary mineral phases and are interpreted to have been induced by the BULLION test. Based on these results, it is expected that matrix diffusion will be enhanced in samples where potentially transmissive fractures exhibit the greatest degree of obstruction (2,236>2,812=2,835>2,851). It is unclear what influence the induced fractures observed at 2,236 feet may have on diffusion given the lack of knowledge on their extent. It is assumed that the bulk matrix diffusion characteristics of the

  3. Association of elevated pretransplant sCD30 levels with graft loss in 206 patients treated with modern immunosuppressive therapies after renal transplantation.

    Science.gov (United States)

    Heinemann, Falko M; Rebmann, Vera; Witzke, Oliver; Philipp, Thomas; Broelsch, Christoph E; Grosse-Wilde, Hans

    2007-03-27

    Recent reports suggest that high pretransplant serum levels of soluble CD30 (sCD30) are a risk factor for rejections after kidney transplantation. The aim of our study was to elucidate the predictive value of pretransplant sCD30 levels for kidney transplantation outcome in a single-center patient cohort that has been treated with modern immunosuppressive therapies after transplantation. We retrospectively analyzed sCD30 in multiple pretransplant sera from 206 patients, of whom 174 were transplanted with a cadaveric kidney and 32 patients received an allograft from a living donor. Renal function after transplantation was estimated by measuring serum creatinine and by rejection diagnosis. We could demonstrate a statistically significant association between increased pretransplant sCD30 values and graft failures (P=0.005). Receiver operating curve analysis revealed a cutoff value of 124 U/mL pretransplant sCD30. A multivariate analysis confirmed pretransplant sCD30 values >124 U/mL (P=0.011) and rejection episodes (PsCD30 levels and the incidence of graft failure, but we could not confirm that the development of rejection episodes is correlated with pretransplant sCD30 values.

  4. Depth profile of production yields of {sup nat}Pb(p, xn) {sup 206,205,204,203,202,201}Bi nuclear reactions

    Energy Technology Data Exchange (ETDEWEB)

    Mokhtari Oranj, Leila [Division of Advanced Nuclear Engineering, POSTECH, Pohang 37673 (Korea, Republic of); Jung, Nam-Suk; Kim, Dong-Hyun; Lee, Arim; Bae, Oryun [Pohang Accelerator Laboratory, POSTECH, Pohang 37673 (Korea, Republic of); Lee, Hee-Seock, E-mail: lee@postech.ac.kr [Pohang Accelerator Laboratory, POSTECH, Pohang 37673 (Korea, Republic of)

    2016-11-01

    Experimental and simulation studies on the depth profiles of production yields of {sup nat}Pb(p, xn) {sup 206,205,204,203,202,201}Bi nuclear reactions were carried out. Irradiation experiments were performed at the high-intensity proton linac facility (KOMAC) in Korea. The targets, irradiated by 100-MeV protons, were arranged in a stack consisting of natural Pb, Al, Au foils and Pb plates. The proton beam intensity was determined by activation analysis method using {sup 27}Al(p, 3p1n){sup 24}Na, {sup 197}Au(p, p1n){sup 196}Au, and {sup 197}Au(p, p3n){sup 194}Au monitor reactions and also by Gafchromic film dosimetry method. The yields of produced radio-nuclei in the {sup nat}Pb activation foils and monitor foils were measured by HPGe spectroscopy system. Monte Carlo simulations were performed by FLUKA, PHITS/DCHAIN-SP, and MCNPX/FISPACT codes and the calculated data were compared with the experimental results. A satisfactory agreement was observed between the present experimental data and the simulations.

  5. Depth profiles of production yields of natPb(p, xn206,205,204,203,202 Bi reactions using 100-MeV proton beam

    Directory of Open Access Journals (Sweden)

    Oranj Leila Mokhtari

    2017-01-01

    Full Text Available In this study, results of the experimental study on the depth profiles of production yields of 206,205,204,203,202Bi radio-nuclei in the natural Pb target irradiated by a 100-MeV proton beam are presented. Irradiation was performed at proton linac facility (KOMAC in Korea. The target, irradiated by 100-MeV protons, was arranged in a stack consisting of natural Pb, Al, Au foils and Pb plates. The proton beam intensity was determined by activation analysis method using 27Al(p, 3p1n24Na, 197Au(p, p1n196Au, and 197Au(p, p3n194Au monitor reactions and also using dosimetry method by a Gafchromic film. The production yields of produced Bi radio-nuclei in the natural Pb foils and monitor reactions were measured by gamma-ray spectroscopy. Monte Carlo simulations were performed by FLUKA, PHITS, and MCNPX codes and compared with the measurements in order to verify validity of physical models and nuclear data libraries in the Monte Carlo codes. A fairly good agreement was observed between the present experimental data and the simulations by FLUKA, PHITS, and MCNPX. However, physical models and the nuclear data relevant to the end of range of protons in the codes need to be improved.

  6. Neutron scattering cross sections for 204,206Pb and neutron and proton amplitudes of E2 and E3 excitations

    International Nuclear Information System (INIS)

    Hicks, S.F.; Hanly, J.M.; Hicks, S.E.; Shen, G.R.; McEllistrem, M.T.

    1994-01-01

    Differential elastic and inelastic scattering cross sections have been measured for neutrons incident on 204 Pb and 206 Pb at energies of 2.5, 4.6, and 8.0 MeV and total cross sections in 100-keV steps from 250 keV to 4.0 MeV. Both spherical and coupled-channels analyses have been used to interpret this large set of data, together with other cross sections extending to 8 MeV. Several purposes motivate this work. The first is to establish the dispersion-corrected mean field appropriate for these nuclei. A consistent description of the energy dependent neutron scattering potential includes a dispersion relation connecting the real and imaginary parts of the potential; the resultant potential relates the energy dependent scattering field to one representing bound single particle levels. Dispersion relations using both the single channel and coupled-channels models have been examined; both give very similar results. The second motivation is to deduce neutron and proton excitation strengths of the lowest-energy quadrupole and octupole excitations seen via neutron scattering, and to compare those strengths with similar values derived from electromagnetic exciton, heavy-ion and pion scattering. The role of target neutrons in both collective excitations was found to be enhanced compared to the proton role

  7. J-UNIO protocol used for NMR structure determination of the 206-residue protein NP-346487.1 from Streptococcus pneumoniae TIGR4

    Energy Technology Data Exchange (ETDEWEB)

    Jaudzems, Kristaps [Latvian Institute of Organic Synthesis (Latvia); Pedrini, Bill [Paul Scherrer Institute (PSI), SwissFEL Project (Switzerland); Geralt, Michael; Serrano, Pedro; Wüthrich, Kurt, E-mail: wuthrich@scripps.edu [The Scripps Research Institute, Department of Integrative Structural and Computational Biology (United States)

    2015-01-15

    The NMR structure of the 206-residue protein NP-346487.1 was determined with the J-UNIO protocol, which includes extensive automation of the structure determination. With input from three APSY-NMR experiments, UNIO-MATCH automatically yielded 77 % of the backbone assignments, which were interactively validated and extended to 97 %. With an input of the near-complete backbone assignments and three 3D heteronuclear-resolved [{sup 1}H,{sup 1}H]-NOESY spectra, automated side chain assignment with UNIO-ATNOS/ASCAN resulted in 77 % of the expected assignments, which was extended interactively to about 90 %. Automated NOE assignment and structure calculation with UNIO-ATNOS/CANDID in combination with CYANA was used for the structure determination of this two-domain protein. The individual domains in the NMR structure coincide closely with the crystal structure, and the NMR studies further imply that the two domains undergo restricted hinge motions relative to each other in solution. NP-346487.1 is so far the largest polypeptide chain to which the J-UNIO structure determination protocol has successfully been applied.

  8. Studying Angular Distribution of Neutron for (p,n) Reaction from 0.5 GeV to 1.5 GeV on some Heavy Targets 238U, 206Pb, 197Au, 186W

    International Nuclear Information System (INIS)

    Nguyen Mong Giao; Tran Thanh Dung; Nguyen Thi Ai Thu; Huynh Thi Xuan Tham

    2010-08-01

    The angular distributions of neutron are calculated for a spallation reaction induced by proton energy from 0.5 GeV to 1.5 GeV on target nuclei 206 Pb, 197 Au, 238 U, 186 W. In this report, we use nuclear data of JENDL-HE with evaluated proton induced cross-sections up to 3 GeV. The obtained results have been discussed in detail. (author)

  9. Suzaku View of the Swift/BAT Active Galactic Nuclei. V. Torus Structure of Two Luminous Radio-Loud Active Galactic Nuclei (3C 206 and PKS 0707-35)

    Science.gov (United States)

    Tazaki, Fumie; Ueda, Yoshihiro; Terashima, Yuichi; Mushotzky, Richard F.; Tombesi, Francesco

    2013-01-01

    We present the results from broadband X-ray spectral analysis of 3C 206 and PKS 0707-35 with Suzaku and Swift/BAT, two of the most luminous unobscured and obscured radio-loud active galactic nuclei (AGNs) with hard X-ray luminosities of 10(sup 45.5) erg per second and 10(sup 44.9) erg per second (14-195 keV), respectively. Based on the radio core luminosity, we estimate that the X-ray spectrum of 3C 206 contains a significant (60% in the 14-195 keV band) contribution from the jet, while it is negligible in PKS 0707-35.We can successfully model the spectra with the jet component (for 3C 206), the transmitted emission, and two reflection components from the torus and the accretion disk. The reflection strengths from the torus are found to be R(sub torus)(=Omega/2pi) = 0.29 +/- 0.18 and 0.41 +/- 0.18 for 3C 206 and PKS 0707-35, respectively, which are smaller than those in typical Seyfert galaxies. Utilizing the torus model by Ikeda et al., we quantify the relation between the half-opening angle of a torus (theta(sub oa)) and the equivalent width of an iron-K line. The observed equivalent width of 3C 206, less than 71 eV, constrains the column density in the equatorial plane to N(sup eq)(sub H) lesst han 10(sup 23) per square centimeter, or the half-opening angle to theta(sub oa) greater than 80 deg. if N(sup eq)(sub H) = 10(sup 24) per square centimeter is assumed. That of PKS 0707-35, 72 +/- 36 eV, is consistent with N(sup eq)(sub H) 10(sup 23) per square centimeter. Our results suggest that the tori in luminous radio-loud AGNs are only poorly developed. The trend is similar to that seen in radio-quiet AGNs, implying that the torus structure is not different between AGNs with jets and without jets.

  10. Neighborhood socioeconomic circumstances and the co-occurrence of unhealthy lifestyles: evidence from 206,457 Australians in the 45 and up study.

    Science.gov (United States)

    Feng, Xiaoqi; Astell-Burt, Thomas

    2013-01-01

    Research on the co-occurrence of unhealthy lifestyles has tended to focus mainly upon the demographic and socioeconomic characteristics of individuals. This study investigated the relevance of neighborhood socioeconomic circumstance for multiple unhealthy lifestyles. An unhealthy lifestyle index was constructed for 206,457 participants in the 45 and Up Study (2006-2009) by summing binary responses on smoking, alcohol, physical activity and five diet-related variables. Higher scores indicated the co-occurrence of unhealthy lifestyles. Association with self-rated health, quality of life; and risk of psychological distress was investigated using multilevel logistic regression. Association between the unhealthy lifestyle index with neighborhood characteristics (local affluence and geographic remoteness) were assessed using multilevel linear regression, adjusting for individual-level characteristics. Nearly 50% of the sample reported 3 or 4 unhealthy lifestyles. Only 1.5% reported zero unhealthy lifestyles and 0.2% had all eight. Compared to people who scored zero, those who scored 8 (the 'unhealthiest' group) were 7 times more likely to rate their health as poor (95%CI 3.6, 13.7), 5 times more likely to report poor quality of life (95%CI 2.6, 10.1), and had a 2.6 times greater risk of psychological distress (95%CI 1.8, 3.7). Higher scores among men decreased with age, whereas a parabolic distribution was observed among women. Neighborhood affluence was independently associated with lower scores on the unhealthy lifestyle index. People on high incomes scored higher on the unhealthy lifestyle index if they were in poorer neighborhoods, while those on low incomes had fewer unhealthy lifestyles if living in more affluent areas. Residents of deprived neighborhoods tend to report more unhealthy lifestyles than their peers in affluent areas, regardless of their individual demographic and socioeconomic characteristics. Future research should investigate the trade-offs of

  11. Effect of national wealth on BMI: An analysis of 206,266 individuals in 70 low-, middle- and high-income countries.

    Directory of Open Access Journals (Sweden)

    Mohd Masood

    Full Text Available This study explores the relationship between BMI and national-wealth and the cross-level interaction effect of national-wealth and individual household-wealth using multilevel analysis.Data from the World Health Survey conducted in 2002-2004, across 70 low-, middle- and high-income countries was used. Participants aged 18 years and over were selected using multistage, stratified cluster sampling. BMI was used as outcome variable. The potential determinants of individual-level BMI were participants' sex, age, marital-status, education, occupation, household-wealth and location(rural/urban at the individual-level. The country-level factors used were average national income (GNI-PPP and income inequality (Gini-index. A two-level random-intercepts and fixed-slopes model structure with individuals nested within countries was fitted, treating BMI as a continuous outcome.The weighted mean BMI and standard-error of the 206,266 people from 70-countries was 23.90 (4.84. All the low-income countries were below the 25.0 mean BMI level and most of the high-income countries were above. All wealthier quintiles of household-wealth had higher scores in BMI than lowest quintile. Each USD10000 increase in GNI-PPP was associated with a 0.4 unit increase in BMI. The Gini-index was not associated with BMI. All these variables explained 28.1% of country-level, 4.9% of individual-level and 7.7% of total variance in BMI. The cross-level interaction effect between GNI-PPP and household-wealth was significant. BMI increased as the GNI-PPP increased in first four quintiles of household-wealth. However, the BMI of the wealthiest people decreased as the GNI-PPP increased.Both individual-level and country-level factors made an independent contribution to the BMI of the people. Household-wealth and national-income had significant interaction effects.

  12. Effect of national wealth on BMI: An analysis of 206,266 individuals in 70 low-, middle- and high-income countries

    Science.gov (United States)

    Reidpath, Daniel D.

    2017-01-01

    Background This study explores the relationship between BMI and national-wealth and the cross-level interaction effect of national-wealth and individual household-wealth using multilevel analysis. Methods Data from the World Health Survey conducted in 2002–2004, across 70 low-, middle- and high-income countries was used. Participants aged 18 years and over were selected using multistage, stratified cluster sampling. BMI was used as outcome variable. The potential determinants of individual-level BMI were participants’ sex, age, marital-status, education, occupation, household-wealth and location(rural/urban) at the individual-level. The country-level factors used were average national income (GNI-PPP) and income inequality (Gini-index). A two-level random-intercepts and fixed-slopes model structure with individuals nested within countries was fitted, treating BMI as a continuous outcome. Results The weighted mean BMI and standard-error of the 206,266 people from 70-countries was 23.90 (4.84). All the low-income countries were below the 25.0 mean BMI level and most of the high-income countries were above. All wealthier quintiles of household-wealth had higher scores in BMI than lowest quintile. Each USD10000 increase in GNI-PPP was associated with a 0.4 unit increase in BMI. The Gini-index was not associated with BMI. All these variables explained 28.1% of country-level, 4.9% of individual-level and 7.7% of total variance in BMI. The cross-level interaction effect between GNI-PPP and household-wealth was significant. BMI increased as the GNI-PPP increased in first four quintiles of household-wealth. However, the BMI of the wealthiest people decreased as the GNI-PPP increased. Conclusion Both individual-level and country-level factors made an independent contribution to the BMI of the people. Household-wealth and national-income had significant interaction effects. PMID:28662041

  13. Lu-Hf isotope constraints on plume-lithosphere interaction during emplacement of the Bushveld Large Igneous Province at 2.06 Ga: Implications for the structure and evolution of the Kaapvaal Craton's lithospheric mantle

    Science.gov (United States)

    Zirakparvar, N. A.; Mathez, E. A.; Rajesh, H.; Vervoort, J. D.; Choe, S.

    2016-12-01

    The Bushveld Large Igneous Province (B-LIP) comprises a diverse array of >30 magma bodies that intruded the Kaapvaal Craton at 2.06 Ga. In this talk we use zircon and bulk-rock Lu-Hf isotope data to show that the B-LIP formed in response to the arrival of a plume(s) from the deep mantle. New zircon Hf isotope compositions for four B-LIP bodies yield intrusion-specific average ɛHf (2.06 Ga) values that range from -20.7 ± 2.8 to -2.7 ± 2.8, largely consistent with literature zircon data for other B-LIP intrusions. Bulk-rock solution ɛHf (2.06 Ga) values for a variety of B-LIP intrusions range from -2.1 ± 0.2 to -10.6 ± 0.2. Because the most radiogenic Hf isotope compositions across the entire B-LIP are nearly primordial with an ɛHf (2.06 Ga) close to 0, it is likely that the heat source of the B-LIP was a plume(s) from deep mantle. The Hf isotope data further suggests that individual intrusions in the B-LIP can be grouped into four categories based on their ultimate sources: 1) melts generated in subduction and plume modified continental lithospheric mantle; 2) melts generated by melting of a mafic-ultramafic reservoir composed of older ( 2.7 Ga) plume-related material trapped in the Kaapvaal lithosphere; 3) melts generated in the mid- to upper crust; and 4) melts generated from the 2.06 Ga mantle plume itself. The presence of 2.7 Ga mafic-ultramafic material in the Kaapvaal lithosphere may have acted to strengthen the lithosphere so that it was able to resist being dispered by the arrival of the B-LIP plume at 2.06 Ga. Because the B-LIP extends into a 2.7 Ga aged suture zone between the Kaapvaal and Zimbabwe cratons, it is also possible to understand the role of the lithospheric mantle in producing the Lu-Hf signatures observed in the various B-LIP intrusions as a function of two different types of the continental lithosphere: The very old lithosphere comprising the Kaapvaal Craton and the somewhat younger lithosphere comprising the suture zone. A basic

  14. Improved 206Pb/238U microprobe geochronology by the monitoring of a trace-element-related matrix effect; SHRIMP, ID-TIMS, ELA-ICP-MS and oxygen isotope documentation for a series of zircon standards

    Science.gov (United States)

    Black, L.P.; Kamo, S.L.; Allen, C.M.; Davis, D.W.; Aleinikoff, J.N.; Valley, J.W.; Mundil, R.; Campbell, I.H.; Korsch, R.J.; Williams, I.S.; Foudoulis, C.

    2004-01-01

    Precise isotope dilution-thermal ionisation mass spectrometry (ID-TIMS) documentation is given for two new Palaeozoic zircon standards (TEMORA 2 and R33). These data, in combination with results for previously documented standards (AS3, SL13, QGNG and TEMORA 1), provide the basis for a detailed investigation of inconsistencies in 206Pb/238U ages measured by microprobe. Although these ages are normally consistent between any two standards, their relative age offsets are often different from those established by ID-TIMS. This is true for both sensitive high-resolution ion-microprobe (SHRIMP) and excimer laser ablation-inductively coupled plasma-mass spectrometry (ELA-ICP-MS) dating, although the age offsets are in the opposite sense for the two techniques. Various factors have been investigated for possible correlations with age bias, in an attempt to resolve why the accuracy of the method is worse than the indicated precision. Crystallographic orientation, position on the grain-mount and oxygen isotopic composition are unrelated to the bias. There are, however, striking correlations between the 206Pb/238U age offsets and P, Sm and, most particularly, Nd abundances in the zircons. Although these are not believed to be the primary cause of this apparent matrix effect, they indicate that ionisation of 206Pb/238U is influenced, at least in part, by a combination of trace elements. Nd is sufficiently representative of the controlling trace elements that it provides a quantitative means of correcting for the microprobe age bias. This approach has the potential to reduce age biases associated with different techniques, different instrumentation and different standards within and between laboratories. Crown Copyright ?? 2004 Published by Elsevier B.V. All rights reserved.

  15. Three novel serum biomarkers, miR-1, miR-133a, and miR-206 for Limb-girdle muscular dystrophy, Facioscapulohumeral muscular dystrophy, and Becker muscular dystrophy.

    Science.gov (United States)

    Matsuzaka, Yasunari; Kishi, Soichiro; Aoki, Yoshitsugu; Komaki, Hirofumi; Oya, Yasushi; Takeda, Shin-Ichi; Hashido, Kazuo

    2014-11-01

    Muscular dystrophies are a clinically and genetically heterogeneous group of inherited myogenic disorders. In clinical tests for these diseases, creatine kinase (CK) is generally used as diagnostic blood-based biomarker. However, because CK levels can be altered by various other factors, such as vigorous exercise, etc., false positive is observed. Therefore, three microRNAs (miRNAs), miR-1, miR-133a, and miR-206, were previously reported as alternative biomarkers for duchenne muscular dystrophy (DMD). However, no alternative biomarkers have been established for the other muscular dystrophies. We, therefore, evaluated whether these miR-1, miR-133a, and miR-206 can be used as powerful biomarkers using the serum from muscular dystrophy patients including DMD, myotonic dystrophy 1 (DM1), limb-girdle muscular dystrophy (LGMD), facioscapulohumeral muscular dystrophy (FSHD), becker muscular dystrophy (BMD), and distal myopathy with rimmed vacuoles (DMRV) by qualitative polymerase chain reaction (PCR) amplification assay. Statistical analysis indicated that all these miRNA levels in serum represented no significant differences between all muscle disorders examined in this study and controls by Bonferroni correction. However, some of these indicated significant differences without correction for testing multiple diseases (P < 0.05). The median values of miR-1 levels in the serum of patients with LGMD, FSHD, and BMD were approximately 5.5, 3.3 and 1.7 compared to that in controls, 0.68, respectively. Similarly, those of miR-133a and miR-206 levels in the serum of BMD patients were about 2.5 and 2.1 compared to those in controls, 1.03 and 1.32, respectively. Taken together, our data demonstrate that levels of miR-1, miR-133a, and miR-206 in serum of BMD and miR-1 in sera of LGMD and FSHD patients showed no significant differences compared with those of controls by Bonferroni correction. However, the results might need increase in sample sizes to evaluate these three miRNAs as

  16. E0 and E2 decay of low-lying 0+ states in the even-even nuclei 206Pb, 208Po, 112-120 Sn and 112114Cd

    International Nuclear Information System (INIS)

    Julin, Rauno.

    1979-04-01

    Several new methods of in-beam conversion-electron and γ-ray spectrometry, applicable in the determination of E0 and E2 decay properties of low-lying 0 + states in even-mass nuclei, have been developed. The main attention has been paid to direct lifetime-measurement and coincidence methods based on the use of the natural pulsing of a cyclotron beam. With the aid of these methods, the similarity of the absolute decay rates of the two-neutron-hole 0 + 2 states in the N = 124 nuclei 206 Pb and 208 Po has been shown. A systematic investigation of the de-excitation of the 0 + 2 and 0 + 3 states in 112 , 11 4 , 116 , 118 , 120 Sn has been carried out. Twelve E0 transitions connecting the 0 + states have been observed, including very strong low-energy E0 transitions between the excited 0 + states, and several absolute transition probabilities have been determined. Furthermore, the new techniques have been applied successfully in determining the absolute E0 and E2 transition rates from the 0 + 2 and 0 + 3 states in 112 Cd and 114 Cd. The use of isotope-shift data in the calculation of the monopole strengths in 206 Pb and 208 Po is discussed. The results on even Sn and Cd nuclei are discussed within the framework of the coexistence of different shapes and of configuration mixing. (author)

  17. 211 At-labeled agents for alpha-immunotherapy: On the in vivo stability of astatine-agent bonds

    OpenAIRE

    Ayed , Tahra ,; Pilmé , Julien; Tézé , David; Bassal , Fadel ,; Barbet , Jacques ,; Chérel , Michel; Champion , Julie ,; Maurice , Rémi; Montavon , Gilles ,; Galland , Nicolas ,

    2016-01-01

    International audience; The application of 211 At to targeted cancer therapy is currently hindered by the rapid deastatination that occurs in vivo. As the deastatination mechanism is unknown, we tackled this issue from the viewpoint of the intrinsic properties of At-involving chemical bonds. An apparent correlation has been evidenced between in vivo stability of 211 At-labeled compounds and the AtÀR (R ¼ C, B) bond enthalpies obtained from relativistic quantum mechanical calculations. Further...

  18. Preparation and biological evaluation of an astatine-211 labeled biotin conjugate: Biotinyl-3-[211At]astatoanilide

    International Nuclear Information System (INIS)

    Foulon, Catherine F.; Schoultz, Bent W.; Zalutsky, Michael R.

    1997-01-01

    Biotinyl-3-[ 211 At]astatoanilide ([ 211 At]AtBA) was prepared in more than 80% yield by destannylation. In vitro, [ 211 At]AtBA exhibited a high affinity for streptavidin, and was stable after incubation in human serum, cerebrospinal fluid and distilled water, whereas it was rapidly degraded in mouse serum. HPLC analysis showed that the main degradation pathway in mouse serum was the cleavage of [ 211 At]astatoaniline. In mice, [ 211 At]AtBA and its 125 I-labeled analogue cleared rapidly from most tissues; however, there was some evidence for dehalogenation of both tracers

  19. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  20. U/Pb (SHRIMP), 207Pb/206Pb, Rb/Sr, Sm/Nd e K/Ar geochronology of granite-greenstone terrains of Gaviao Block: implications for the Proterozoic and Archean evolution of Sao Francisco Craton, Brazil

    International Nuclear Information System (INIS)

    Leal, Luiz Rogerio Bastos

    1998-01-01

    The Gaviao Block (GB) in the northern portion of the Sao Francisco Craton-Northeast of Brazil, constitutes one of the oldest Archean fragments of the South American Platform Archean crust. GB underwent several events of juvenile accretion and reworking of continental crust along its evolutionary history, notably between the Archean and the Paleoproterozoic. 207 Pb/ 206 Pb isotopic analyses were carried out in two zircons populations from strongly migmatized TTG terranes found in the proximity of Brumado: the first population (7 crystals) is taken as representative of the crystallization period of the TTG terranes at 3300 ± 45 Ma; the second (2 crystals) represents the age of the first even of metamorphism/migmatization at 2910 ± 10 Ma. 207 Pb/ 206 Pb analyses in zircons from an outcrop of non-migmatized TTG in the area yielded a 3202 ± 15 Ma age (4 crystals), interpreted to be the crystallization period of the gneiss protolith. Sm/Nd analyses on the TTG rocks of the Brumado region yielded T DM model ages varying between 3.26 and 3.36 Ga and ε Nd (t) between -3.5 and +0.7. These data suggest the occurrence of juvenile accretions to the continental crust during the Archean, with differential involvement of crustal materials. The geochemical data of rare earth elements corresponding to the TTG terranes revealed moderate LRRE contents (La N =83,5), low HREE contents (La N =2,5) and a fairly fractionated pattern (La/Yb) N =34, besides lack of negative Eu anomaly, showing that these rocks have similar compositions to those TTG terranes of cratonic continents, as well as some Archean rocks from CSF (e.g. Sete Voltas, Boa Vista). Finally, the youngest ages present in GB rocks (ca. 1.2-0.45 Ga) represent the role played by tectono thermal events, which produced partial or total rejuvenation of the Rb/Sr and K/Ar isotopic systems during the Espinhaco and Brasiliano cycles. In particular, K/Ar ages illustrate the effect of younger regional cooling episodes related to the

  1. Tracking atmospheric sulphur pollution from the study of Racomitrium lanuginosum mosses in Iceland: A multi-isotope approach (δ34S, 206Pb/204Pb, δ13C and δ15N)

    Science.gov (United States)

    Proust, E.; Widory, D.; Gautason, B.; Rogers, K.; Morrison, J.

    2010-12-01

    Among terrestrial plants, the applicability of mosses as monitoring organisms of atmospheric pollutants is a world-wide accepted technique due to their special biological and morphologic characteristics as nonvascular plants. They are commonly regarded as the best bioindicators of air quality because they can accumulate sulphur (S) and other elements to a far greater level than is necessary for their physiological needs. This study aims at using different isotope systematics δ34S, 206Pb/204Pb, δ13C and δ15N) to help understand the origin of S in the atmophsere of Reykjavik and its vicinity, and especially the potential contribution of surrounding geothermal plants. The selected Icelandic woolly fringe moss (Racomitrium lanuginosum (Hedw.) Brid.) is extremely common in lava fields and gravely and stony areas. Samples were taken in four distinct sampling sites around the city of Reykjavik: Bláfjöll area (south-eastern suburb of the city), and close to three power plants: Hellisheioarvirkjun (northern suburb of the city), Svartsengi (south-western suburb of the city) and Nesjavellir (north-eastern suburb of the city). Results show that, whatever the sampling context is, S is controlled by a binary mixing, between i) a high δ34S (around 16‰) end-member, characteristic of mosses from Hellisheioarvirkjun, and ii) a low δ34S (around -2‰) end-member, characteristic of mosses from Nesjavellir. The multi-isotope approach, confirms this binary relation and helps to constrain the different end-members involved.

  2. Characterization and Functional Analysis of Extracellular Vesicles and Muscle-Abundant miRNAs (miR-1, miR-133a, and miR-206 in C2C12 Myocytes and mdx Mice.

    Directory of Open Access Journals (Sweden)

    Yasunari Matsuzaka

    Full Text Available Duchenne muscular dystrophy (DMD is a progressive neuromuscular disorder. Here, we show that the CD63 antigen, which is located on the surface of extracellular vesicles (EVs, is associated with increased levels of muscle-abundant miRNAs, namely myomiRs miR-1, miR-133a, and miR-206, in the sera of DMD patients and mdx mice. Furthermore, the release of EVs from the murine myoblast C2C12 cell line was found to be modulated by intracellular ceramide levels in a Ca2+-dependent manner. Next, to investigate the effects of EVs on cell survival, C2C12 myoblasts and myotubes were cultured with EVs from the sera of mdx mice or C2C12 cells overexpressing myomiRs in presence of cellular stresses. Both the exposure of C2C12 myoblasts and myotubes to EVs from the serum of mdx mice, and the overexpression of miR-133a in C2C12 cells in presence of cellular stress resulted in a significant decrease in cell death. Finally, to assess whether miRNAs regulate skeletal muscle regeneration in vivo, we intraperitoneally injected GW4869 (an inhibitor of exosome secretion into mdx mice for 5 and 10 days. Levels of miRNAs and creatine kinase in the serum of GW4869-treated mdx mice were significantly downregulated compared with those of controls. The tibialis anterior muscles of the GW4869-treated mdx mice showed a robust decrease in Evans blue dye uptake. Collectively, these results indicate that EVs and myomiRs might protect the skeletal muscle of mdx mice from degeneration.

  3. 76 FR 13059 - Airworthiness Directives; Bell Helicopter Textron Canada Limited (BHTC) Model 206A, 206B, 206L...

    Science.gov (United States)

    2011-03-10

    ...;Prices of new books are listed in the first FEDERAL REGISTER issue of each #0;week. #0; #0; #0; #0;#0..., which contained the requirements of this amendment. The incorporation by reference of certain..., economic, environmental, and energy aspects of the AD. We will consider all comments received by the...

  4. 31 CFR 515.206 - Exempt transactions.

    Science.gov (United States)

    2010-07-01

    ... credit issued by a Cuban bank and confirmed by an American bank. These are permissible transactions under... enhancements. (b) Donation of food. The prohibitions contained in this part do not apply to transactions incident to the donation of food to nongovernmental organizations or individuals in Cuba. [54 FR 5233, Feb...

  5. 44 CFR 206.376 - Loan cancellation.

    Science.gov (United States)

    2010-10-01

    ... leases are not considered operating expenses. Under accrual accounting, expenses are recognized as soon... accrual (measurable and available). (3) “Three-full-fiscal-year period following the disaster” means...

  6. 47 CFR 76.206 - Candidate rates.

    Science.gov (United States)

    2010-10-01

    ... Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES MULTICHANNEL VIDEO AND... system practices offered to commercial advertisers that enhance the value of advertising spots must be... any discount privileges that affect the value of advertising, such as bonus spots, time-sensitive make...

  7. 5 CFR 2606.206 - Fees.

    Science.gov (United States)

    2010-01-01

    ... satisfactory assurance of full payment where the requester has a history of prompt payment of Privacy Act fees... case of requesters with no history of payment; or (B) The requester has previously failed to pay a Privacy Act fee charged in a timely fashion (i.e., within 30 days of the date of the billing). In such...

  8. 18 CFR 157.206 - Standard conditions.

    Science.gov (United States)

    2010-04-01

    ... Discharge Elimination System Program, 40 CFR part 122 et seq.; (ii) Clean Air Act, as amended (42 U.S.C... this section only if it adheres to Commission staff's current “Upland Erosion Control, Revegetation and... any new compressor station, compression added to an existing station, or any modification, upgrade or...

  9. 44 CFR 206.115 - Appeals.

    Science.gov (United States)

    2010-10-01

    ... want to purchase; or (10) Any other eligibility-related decision. (b) Appeals must be in writing and...; (7) Termination of direct housing assistance; (8) Denial of a request to purchase a FEMA-provided...) Applicants must appeal to the Regional Administrator or his/her designee for decisions made under this...

  10. 44 CFR 206.434 - Eligibility.

    Science.gov (United States)

    2010-10-01

    ... wetlands management practices; and (ii) No new structure(s) will be built on the property except as... designated area; (3) Be in conformance with 44 CFR part 9, Floodplain Management and Protection of Wetlands..., recreational, or wetlands management usage and proper floodplain management policies and practices, which the...

  11. 24 CFR 904.206 - Funding.

    Science.gov (United States)

    2010-04-01

    ... the initial counseling and training there is likely to be some turnover and follow-up counseling and... community resources to be utilized; (v) The methods of counseling and training to be utilized; (vi) The...

  12. 44 CFR 206.117 - Housing assistance.

    Science.gov (United States)

    2010-10-01

    ... comply with applicable State and local codes and ordinances, as well as 44 CFR part 9, Floodplain.... Repairs may include utilities and residential infrastructure (such as private access routes, privately... reduce the likelihood of future damage to damaged residences, utilities or infrastructure. (iv) Eligible...

  13. 44 CFR 206.377 - Loan repayment.

    Science.gov (United States)

    2010-10-01

    ... interest amount due will be computed separately for each Treasury disbursement as follows: I = P X R X T, where I = the amount of simple interest, P = the principal amount disbursed; R = the interest rate of... Assistant Administrator for the Disaster Assistance Directorate. Interest will accrue on outstanding cash...

  14. 13 CFR 400.206 - Environmental requirements.

    Science.gov (United States)

    2010-01-01

    ... capital loan means money used by an ongoing business concern to fund its existing operations. (3... other cases, potentially affect: (A) A floodplain; (B) A wetland; (C) Important farmlands, or prime... supportive studies have been conducted to assure that such studies are objective and comprehensive in scope...

  15. Publications | Page 206 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Managing climate risk for agriculture and water resources development in South Africa : quantifying the costs, benefits and risks associated with planning and management alternatives; final scientific report (restricted access). Population growth and subsequent economic growth are major factors placing exponential strain ...

  16. 44 CFR 206.375 - Loan administration.

    Science.gov (United States)

    2010-10-01

    ... writing at least 10 days prior to the proposed disbursement date in order to ensure timely receipt of the... Loan shall establish necessary accounting records, consistent with local government's financial... examination, have access to any books, documents, papers, and records that pertain to Federal funds...

  17. Publications | Page 206 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Fine granular aspect analysis using latent structural models (restricted access). In this paper, we present a structural learning model for joint sentiment classification and aspect analysis of text at various levels of granularity. Online reviews have become a major resource where users find opinions or comments on products ...

  18. 44 CFR 206.111 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... return of another, according to the Internal Revenue Code. It may also mean the minor children of a couple not living together, where the children live in the affected residence with the parent or guardian... and Urban Development as being adequate for existing rental housing in a particular area. Financial...

  19. 27 CFR 9.206 - Shawnee Hills.

    Science.gov (United States)

    2010-04-01

    ... Routes 3 and 150 in the town of Chester (Randolph County), proceed northeast on Route 150 to its... Counties, and continue east along the Perry-Jackson County line to State Route 4; then (3) Proceed... 13 and 127 divide in the town of Murphysboro; then (5) Proceed east on State Route 13 through the...

  20. 44 CFR 206.347 - Requirements.

    Science.gov (United States)

    2010-10-01

    ... grant is to be combined with other funding, resulting in an expansion of the facility beyond the... Federal funding; and (iv) Additional measures required. (c) Permanent restoration assistance. For each... such channel or structure before October 18, 1982; (ii) Expansion of the facility beyond its...

  1. WE-AB-206-03: Workshop

    International Nuclear Information System (INIS)

    Lu, Z.

    2016-01-01

    The involvement of medical physicists in diagnostic ultrasound imaging service is increasing due to QC and accreditation requirements. The goal of this ultrasound hands-on workshop is to demonstrate quality control (QC) testing in diagnostic ultrasound and to provide updates in ACR ultrasound accreditation requirements. The first half of this workshop will include two presentations reviewing diagnostic ultrasound QA/QC and ACR ultrasound accreditation requirements. The second half of the workshop will include live demonstrations of basic QC tests. An array of ultrasound testing phantoms and ultrasound scanners will be available for attendees to learn diagnostic ultrasound QC in a hands-on environment with live demonstrations and on-site instructors. The targeted attendees are medical physicists in diagnostic imaging. Learning Objectives: Gain familiarity with common elements of a QA/QC program for diagnostic ultrasound imaging dentify QC tools available for testing diagnostic ultrasound systems and learn how to use these tools Learn ACR ultrasound accreditation requirements Jennifer Walter is an employee of American College of Radiology on Ultrasound Accreditation.

  2. 12 CFR 206.3 - Prudential standards.

    Science.gov (United States)

    2010-01-01

    ... market disturbances, market movements favorable to the bank, increases in activity, operational problems... limits; (ii) The volatility of the exposure; and (iii) The financial condition of the correspondent. (3...

  3. 13 CFR 500.206 - Environmental requirements.

    Science.gov (United States)

    2010-01-01

    ...) Responsibilities and procedures for preparation of an environmental assessment. (i) The Executive Director will...) Responsibilities and procedures for preparation of an environmental impact statement. (i) If after an environmental... integrated use of the natural and social sciences and the environmental design arts.” 42 U.S.C. 4332(A). If...

  4. 30 CFR 206.151 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... an oil and gas lessee for the disposition of the gas, residue gas, and gas plant products produced... geographic region at least as large as the defined limits of an oil and/or gas field, in which oil and/or gas... consideration creates an obligation. Field means a geographic region situated over one or more subsurface oil...

  5. Reference: 206 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available olism to soluble DCA-glucose or associated polar conjugates. Instead, the knockou...eeding studies were carried out with [14C]-TCP, rates and routes of metabolism were identical in the wild type and knock...sis, additional UGTs could compensate for the conjugation of TCP in the knockout. TCP was equally toxic to w...ild type and ugt72B1 plants, while surprisingly, the knockouts were less sensitiv...ized. Extracts from the knockout ugt72B1 plants showed radically reduced conjugating activity towards DCA an

  6. 9 CFR 205.206 - Farm products.

    Science.gov (United States)

    2010-01-01

    ... must specify by name) Apples, apricots, avocados, bananas, cherries, coffee, dates, figs, grapes (& raisins), nectarines, olives, papayas, peaches, pears, persimmons, pineapples, plums (& prunes...

  7. Publications | Page 206 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... sexual and reproductive health in Ahmedabad, India (restricted access). Young women and men are deeply situated in patriarchal systems where core structures of dominations remained unmoved. This thesis aims to better understand the sexual and reproductive health of young women married during their adolescence ...

  8. 12 CFR 206.4 - Credit exposure.

    Science.gov (United States)

    2010-01-01

    ... current market value of the collateral; (2) The proceeds of checks and other cash items deposited in an... that may be sold in ordinary circumstances with reasonable promptness at a fair market value determined... cannot obtain adequate information concerning the capital ratios of the correspondent, the bank shall...

  9. 30 CFR 206.451 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... trust by the United States or who holds title subject to Federal restriction against alienation. Indian... to Federal restriction against alienation. Lease means any contract, profit-share arrangement, joint...

  10. 44 CFR 206.364 - Loan application.

    Science.gov (United States)

    2010-10-01

    ... assets for a stated period of time, and the proposed means of financing the expenditures. For loan... within sixty days of the date of the disapproval. Decision by the Assistant Administrator for the...

  11. 50 CFR 648.206 - Framework provisions.

    Science.gov (United States)

    2010-10-01

    ... restrictions; (11) Closed seasons; (12) Minimum fish size; (13) Trip limits; (14) Seasonal, area, or industry sector quotas; (15) Measures to describe and identify essential fish habitat (EFH), fishing gear management measures to protect EFH, and designation of habitat areas of particular concern within EFH; (16...

  12. 44 CFR 206.251 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... HOMELAND SECURITY DISASTER ASSISTANCE FEDERAL DISASTER ASSISTANCE Public Assistance Insurance Requirements... result of a major disaster. (b) Building means a walled and roofed structure, other than a gas, or liquid storage tank, that is principally above ground and affixed to a permanent site, as well as a manufactured...

  13. 44 CFR 206.2 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... of Columbia, Puerto Rico, the Virgin Islands, Guam, American Samoa, and the Commonwealth of the...) United States: The 50 States, the District of Columbia, Puerto Rico, the Virgin Islands, Guam, American... or otherwise duly recognized tax-exempt local, State, or national organization or group which has...

  14. 44 CFR 206.221 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... buildings, structures, equipment, or systems used to provide emergency services, such as fire protection... Definitions. (a) Educational institution means: (1) Any elementary school as defined by section 801(c) of the Elementary and Secondary Education Act of 1965; or (2) Any secondary school as defined by section 801(h) of...

  15. Reseña de: Aguiar Andrade, Amélia y Millán da Costa, Adelaide (Eds. La ville Médiévale en Débat. Instituto de Estudos Medievais, Lisboa, 2013, 206 páginas (Estudos, 8, (Idiomas Francés, Español e Inglés. ISBN: 978-989-97066-9-9.

    Directory of Open Access Journals (Sweden)

    Ana María Rivera Medina

    2017-05-01

    Full Text Available Aguiar Andrade, Amélia y Millán da Costa, Adelaide (Eds. La ville Médiévale en Débat. Instituto de Estudos Medievais, Lisboa, 2013, 206 páginas (Estudos, 8, (Idiomas Francés, Español e Inglés. isbn: 978-989-97066-9-9.

  16. Inactivation of human osteosarcoma cells in vitro by 211At-TP-3 monoclonal antibody: Comparison with astatine-211 and external-beam X rays

    International Nuclear Information System (INIS)

    Larsen, R.H.; Bruland, O.S.; Hoff, P.; Alstad, J.; Lindmo, T.; Rofstad, E.K.

    1994-01-01

    The potential usefulness of α-particle radioimmunotherapy in the treatment of osteosarcoma was studied in vitro by using the monoclonal antibody TP-3 and cells of three human osteosarcoma cell lines (OHS, SAOS and KPDX) differing in antigen expression. Cell survival curves were established after treatment with (a) 211 At-TP-3 of different specific activities, (b) 211 At-labeled bovine serum albumin (BSA), (c) free 211 At and (d) external-beam X rays. The three osteosarcoma cell lines showed similar survival curves, whether treated with external-beam X rays, 211 At-BSA or free 211 At. The D o 's were lower for free 211 At than for 211 At-BSA. The survival curves for 211 At-TP-3 treatment, on the other hand, differed significantly among the cell lines, suggesting that sensitivity to 211 At-TP-3 treatment was governed by cellular properties other than sensitivity to external-beam X rays. The cellular property most important for sensitivity to 211 At-TP-3 treatment was the antigen expression. Cell inactivation after 211 At-TP-3 treatment increased substantially with increasing specific activity of the 211 At-TP-3. At high specific activities, the cytotoxic effect of 211 At-TP-3 was significantly higher than that of 211 At-BSA. In conclusion, 211 At-TP-3 has the potential to give clinically favorable therapeutic ratios in the treatment of osteosarcoma. 39 refs., 5 figs., 2 tabs

  17. 49 CFR 571.206 - Standard No. 206; Door locks and door retention components.

    Science.gov (United States)

    2010-10-01

    ... be instrumented with an accelerometer and data processing system that conforms to the requirements... is parallel to the direction of test platform travel. (ii) Maintaining a minimum acceleration level... illustrated in Figure 8 to the mounting provisions of the hinge system. Hinge attitude is configured to...

  18. U/Pb (SHRIMP), {sup 207}Pb/{sup 206}Pb, Rb/Sr, Sm/Nd e K/Ar geochronology of granite-greenstone terrains of Gaviao Block: implications for the Proterozoic and Archean evolution of Sao Francisco Craton, Brazil; Geocronologia U/Pb (SHRIMP), {sup 207}Pb/{sup 206}Pb, Rb/Sr, Sm/Nd e K/Ar dos terrenos granito-greenstone do Bloco do Gaviao: implicacoes para a evolucao arqueana e proterozoica do craton do Sao Francisco, Brasil

    Energy Technology Data Exchange (ETDEWEB)

    Leal, Luiz Rogerio Bastos

    1998-07-01

    The Gaviao Block (GB) in the northern portion of the Sao Francisco Craton-Northeast of Brazil, constitutes one of the oldest Archean fragments of the South American Platform Archean crust. GB underwent several events of juvenile accretion and reworking of continental crust along its evolutionary history, notably between the Archean and the Paleoproterozoic. {sup 207}Pb/{sup 206}Pb isotopic analyses were carried out in two zircons populations from strongly migmatized TTG terranes found in the proximity of Brumado: the first population (7 crystals) is taken as representative of the crystallization period of the TTG terranes at 3300 {+-} 45 Ma; the second (2 crystals) represents the age of the first even of metamorphism/migmatization at 2910 {+-} 10 Ma. {sup 207} Pb/{sup 206} Pb analyses in zircons from an outcrop of non-migmatized TTG in the area yielded a 3202 {+-} 15 Ma age (4 crystals), interpreted to be the crystallization period of the gneiss protolith. Sm/Nd analyses on the TTG rocks of the Brumado region yielded T{sub DM} model ages varying between 3.26 and 3.36 Ga and {epsilon}{sub Nd}{sup (t)} between -3.5 and +0.7. These data suggest the occurrence of juvenile accretions to the continental crust during the Archean, with differential involvement of crustal materials. The geochemical data of rare earth elements corresponding to the TTG terranes revealed moderate LRRE contents (La{sub N}=83,5), low HREE contents (La{sub N}=2,5) and a fairly fractionated pattern (La/Yb){sub N}=34, besides lack of negative Eu anomaly, showing that these rocks have similar compositions to those TTG terranes of cratonic continents, as well as some Archean rocks from CSF (e.g. Sete Voltas, Boa Vista). Finally, the youngest ages present in GB rocks (ca. 1.2-0.45 Ga) represent the role played by tectono thermal events, which produced partial or total rejuvenation of the Rb/Sr and K/Ar isotopic systems during the Espinhaco and Brasiliano cycles. In particular, K/Ar ages illustrate the

  19. Measurement of the 209Bi(n ,4 n )206Bi and 169Tm(n ,3 n )167Tm cross sections between 23.5 and 30.5 MeV relevant to reaction-in-flight neutron studies at the National Ignition Facility

    Science.gov (United States)

    Gooden, M. E.; Bredeweg, T. A.; Champine, B.; Combs, D. C.; Finch, S.; Hayes-Sterbenz, A.; Henry, E.; Krishichayan, Rundberg, R.; Tornow, W.; Wilhelmy, J.; Yeamans, C.

    2017-08-01

    At the National Ignition Facility, experiments are being performed to measure charged-particle stopping powers in the previously unexplored warm dense plasma regime. These measurements are done using reaction-in-flight (RIF) neutrons from an inertial confinement fusion system. RIF neutrons are produced with a continuum of energies up to 30 MeV. By making activation measurements utilizing threshold reactions for neutrons in the energy range of 15 206Bi reaction, with a threshold of 22.5 MeV. The cross sections were measured at the 10 MV tandem Van De Graaff accelerator at the Triangle Universities Nuclear Laboratory with quasimonoenergetic neutrons between 23.5 and 30.5 MeV, where few previous measurements have been made. Cross-section data are compared to calculations and other available measurements.

  20. 30 CFR 206.158 - Processing allowances-general.

    Science.gov (United States)

    2010-07-01

    ... relationship. Natural gas liquids (NGL's) shall be considered as one product. (c)(1) Except as provided in... condition, including dehydration, separation, compression, or storage, even if those functions are performed...

  1. 24 CFR 1003.206 - Program administration costs.

    Science.gov (United States)

    2010-04-01

    ... reasonable administrative costs and carrying charges related to the planning and execution of community... this section and in § 1003.205—Eligible planning, urban environmental design and policy-planning... documents related to the program for submission to HUD; (vii) Coordinating the resolution of audit and...

  2. MO-AB-206-01: PET Physics

    Energy Technology Data Exchange (ETDEWEB)

    Turkington, T. [Duke University Medical Center (United States)

    2016-06-15

    This education session will cover the physics and operation principles of gamma cameras and PET scanners. The first talk will focus on PET imaging. An overview of the principles of PET imaging will be provided, including positron decay physics, and the transition from 2D to 3D imaging. More recent advances in hardware and software will be discussed, such as time-of-flight imaging, and improvements in reconstruction algorithms that provide for options such as depth-of-interaction corrections. Quantitative applications of PET will be discussed, as well as the requirements for doing accurate quantitation. Relevant performance tests will also be described. Learning Objectives: Be able to describe basic physics principles of PET and operation of PET scanners. Learn about recent advances in PET scanner hardware technology. Be able to describe advances in reconstruction techniques and improvements Be able to list relevant performance tests. The second talk will focus on gamma cameras. The Nuclear Medicine subcommittee has charged a task group (TG177) to develop a report on the current state of physics testing of gamma cameras, SPECT, and SPECT/CT systems. The report makes recommendations for performance tests to be done for routine quality assurance, annual physics testing, and acceptance tests, and identifies those needed satisfy the ACR accreditation program and The Joint Commission imaging standards. The report is also intended to be used as a manual with detailed instructions on how to perform tests under widely varying conditions. Learning Objectives: At the end of the presentation members of the audience will: Be familiar with the tests recommended for routine quality assurance, annual physics testing, and acceptance tests of gamma cameras for planar imaging. Be familiar with the tests recommended for routine quality assurance, annual physics testing, and acceptance tests of SPECT systems. Be familiar with the tests of a SPECT/CT system that include the CT images for SPECT reconstructions. Become knowledgeable of items to be included in annual acceptance testing reports including CT dosimetry and PACS monitor measurements. T. Turkington, GE Healthcare.

  3. 44 CFR 206.226 - Restoration of damaged facilities.

    Science.gov (United States)

    2010-10-01

    ... Register of Historic Properties. If an applicable standard requires repair in a certain manner, costs... reconstruction. Demolition and removal of the old facility is also an eligible cost. (3) When relocation is.... (d) Standards. For the costs of Federal, State, and local repair or replacement standards which...

  4. 48 CFR 15.206 - Amending the solicitation.

    Science.gov (United States)

    2010-10-01

    ... the contract file and formalize the notice with an amendment (see subpart 4.5, Electronic Commerce in... protection (see 15.207(b) and 15.306(e)). (e) If, in the judgment of the contracting officer, based on market...

  5. All projects related to | Page 206 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... LOW INCOME GROUPS, FOOD SUPPLY, WATER QUALITY, AGRICULTURAL LEGISLATION, GENDER ANALYSIS, INTERDISCIPLINARY RESEARCH, POLICY MAKING. Region: India, Central Asia, Far East Asia, South Asia, United Kingdom. Program: Agriculture and Food Security. Total Funding: CA$ 342,400.00.

  6. 42 CFR 438.206 - Availability of services.

    Science.gov (United States)

    2010-10-01

    ... (CONTINUED) MEDICAL ASSISTANCE PROGRAMS MANAGED CARE Quality Assessment and Performance Improvement Access.... (iii) The numbers and types (in terms of training, experience, and specialization) of providers...

  7. 24 CFR 92.206 - Eligible project costs.

    Science.gov (United States)

    2010-04-01

    ... community facilities which are located within the same building as the housing and which are for the use of... in a neighborhood revitalization strategy under 24 CFR 91.215(e)(2) or a Federally designated... affirmative marketing and fair housing information to prospective homeowners and tenants as required by § 92...

  8. 41 CFR 101-39.206 - Seasonal or unusual requirements.

    Science.gov (United States)

    2010-07-01

    ... VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.2-GSA Interagency Fleet Management System Services... requirements for vehicles or related services shall inform the GSA IFMS fleet management center as far in... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Seasonal or unusual...

  9. 44 CFR 206.171 - Crisis counseling assistance and training.

    Science.gov (United States)

    2010-10-01

    ... description of the organizational structure of the program, including designation by the Governor of an... assistance based on recommendations of the Regional Administrator and the Secretary; (ii) Obligate funds and... books, documents, papers, and records that pertain to Federal funds, equipment, and supplies received...

  10. MO-DE-206-02: Cellular Metabolism of FDG

    Energy Technology Data Exchange (ETDEWEB)

    Cherry, S. [University of California-Davis (United States)

    2016-06-15

    In this symposium jointly sponsored by the World Molecular Imaging Society (WMIS) and the AAPM, luminary speakers on imaging metabolism will discuss three impactful topics. The first presentation on Cellular Metabolism of FDG will be given by Guillem Pratx (Stanford). This presentation will detail new work on looking at how the most common molecular imaging agent, fluoro-deoxy-glucose is metabolized at a cellular level. This will be followed by a talk on an improved approach to whole-body PET imaging by Simon Cherry (UC Davis). Simon’s work on a new whole-body PET imaging system promises to have dramatic improvement in our ability to detect and characterize cancer using PET. Finally, Jim Bankson (MD Anderson) will discuss extremely sophisticated approaches to quantifying hyperpolarized-13-C pyruvate metabolism using MR imaging. This technology promises to compliment the exquisite sensitivity of PET with an ability to measure not just uptake, but tumor metabolism. Learning Objectives: Understand the metabolism of FDG at a cellular level. Appreciate the engineering related to a novel new high-sensitivity whole-body PET imaging system. Understand the process of hyperpolarization, how pyruvate relates to metabolism and how advanced modeling can be used to better quantify this data. G. Pratx, Funding: 5R01CA186275, 1R21CA193001, and Damon Runyon Cancer Foundation. S. Cherry, National Institutes of Health; University of California, Davis; Siemens Medical SolutionsJ. Bankson, GE Healthcare; NCI P30-CA016672; CPRIT PR140021-P5.

  11. MO-DE-206-01: Cellular Metabolism of FDG

    Energy Technology Data Exchange (ETDEWEB)

    Pratx, G. [Stanford University (United States)

    2016-06-15

    In this symposium jointly sponsored by the World Molecular Imaging Society (WMIS) and the AAPM, luminary speakers on imaging metabolism will discuss three impactful topics. The first presentation on Cellular Metabolism of FDG will be given by Guillem Pratx (Stanford). This presentation will detail new work on looking at how the most common molecular imaging agent, fluoro-deoxy-glucose is metabolized at a cellular level. This will be followed by a talk on an improved approach to whole-body PET imaging by Simon Cherry (UC Davis). Simon’s work on a new whole-body PET imaging system promises to have dramatic improvement in our ability to detect and characterize cancer using PET. Finally, Jim Bankson (MD Anderson) will discuss extremely sophisticated approaches to quantifying hyperpolarized-13-C pyruvate metabolism using MR imaging. This technology promises to compliment the exquisite sensitivity of PET with an ability to measure not just uptake, but tumor metabolism. Learning Objectives: Understand the metabolism of FDG at a cellular level. Appreciate the engineering related to a novel new high-sensitivity whole-body PET imaging system. Understand the process of hyperpolarization, how pyruvate relates to metabolism and how advanced modeling can be used to better quantify this data. G. Pratx, Funding: 5R01CA186275, 1R21CA193001, and Damon Runyon Cancer Foundation. S. Cherry, National Institutes of Health; University of California, Davis; Siemens Medical SolutionsJ. Bankson, GE Healthcare; NCI P30-CA016672; CPRIT PR140021-P5.

  12. JCSC_128_2_201-206_SI.doc

    Indian Academy of Sciences (India)

    The emission spectra of compound [AuL] in methanol at (a) different excited wavelengths. (b) at normalized intensity. Chart S1. Chemical Structure of natural amino acids and biologically important thiols. Figure S3. Fluorescence spectra obtained for the titration of [AuL] with different amino acids in methanol, λex = 390 nm.

  13. 29 CFR 780.206 - Planting and lawn mowing.

    Science.gov (United States)

    2010-07-01

    ... plant fruit trees and berry stock not raised by their employer would be considered as engaged in... mowing. (a) The planting of trees and bushes is within the scope of agriculture where it constitutes a... of such trees or bushes). Thus, employees of the nurseryman who raised such nursery stock are doing...

  14. 24 CFR 206.129 - Payment of claim.

    Science.gov (United States)

    2010-04-01

    ... limit on the claim amount. (c) Shared appreciation mortgages. The terms mortgage balance and accrued... appreciated value of the property. (d) Amount of payment—mortgagee acquires title or is unsuccessful bidder...) subtracting from that total the amount for which the property was sold (or the appraised value determined...

  15. 7 CFR 1280.206 - Certification of organizations.

    Science.gov (United States)

    2010-01-01

    ... organization; (4) Sources from which the operating funds of the organization are derived; (5) The functions of... objectives of the Act. (c) Primary Considerations. The primary considerations in determining the eligibility...

  16. WE-H-206-00: Advances in Preclinical Imaging

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2016-06-15

    Lihong V. Wang: Photoacoustic tomography (PAT), combining non-ionizing optical and ultrasonic waves via the photoacoustic effect, provides in vivo multiscale functional, metabolic, and molecular imaging. Broad applications include imaging of the breast, brain, skin, esophagus, colon, vascular system, and lymphatic system in humans or animals. Light offers rich contrast but does not penetrate biological tissue in straight paths as x-rays do. Consequently, high-resolution pure optical imaging (e.g., confocal microscopy, two-photon microscopy, and optical coherence tomography) is limited to penetration within the optical diffusion limit (∼1 mm in the skin). Ultrasonic imaging, on the contrary, provides fine spatial resolution but suffers from both poor contrast in early-stage tumors and strong speckle artifacts. In PAT, pulsed laser light penetrates tissue and generates a small but rapid temperature rise, which induces emission of ultrasonic waves due to thermoelastic expansion. The ultrasonic waves, orders of magnitude less scattering than optical waves, are then detected to form high-resolution images of optical absorption at depths up to 7 cm, conquering the optical diffusion limit. PAT is the only modality capable of imaging across the length scales of organelles, cells, tissues, and organs (up to whole-body small animals) with consistent contrast. This rapidly growing technology promises to enable multiscale biological research and accelerate translation from microscopic laboratory discoveries to macroscopic clinical practice. PAT may also hold the key to label-free early detection of cancer by in vivo quantification of hypermetabolism, the quintessential hallmark of malignancy. Learning Objectives: To understand the contrast mechanism of PAT To understand the multiscale applications of PAT Benjamin M. W. Tsui: Multi-modality molecular imaging instrumentation and techniques have been major developments in small animal imaging that has contributed significantly to biomedical research during the past decade. The initial development was an extension of clinical PET/CT and SPECT/CT from human to small animals and combine the unique functional information obtained from PET and SPECT with anatomical information provided by the CT in registered multi-modality images. The requirements to image a mouse whose size is an order of magnitude smaller than that of a human have spurred advances in new radiation detector technologies, novel imaging system designs and special image reconstruction and processing techniques. Examples are new detector materials and designs with high intrinsic resolution, multi-pinhole (MPH) collimator design for much improved resolution and detection efficiency compared to the conventional collimator designs in SPECT, 3D high-resolution and artifact-free MPH and sparse-view image reconstruction techniques, and iterative image reconstruction methods with system response modeling for resolution recovery and image noise reduction for much improved image quality. The spatial resolution of PET and SPECT has improved from ∼6–12 mm to ∼1 mm a few years ago to sub-millimeter today. A recent commercial small animal SPECT system has achieved a resolution of ∼0.25 mm which surpasses that of a state-of-art PET system whose resolution is limited by the positron range. More recently, multimodality SA PET/MRI and SPECT/MRI systems have been developed in research laboratories. Also, multi-modality SA imaging systems that include other imaging modalities such as optical and ultrasound are being actively pursued. In this presentation, we will provide a review of the development, recent advances and future outlook of multi-modality molecular imaging of small animals. Learning Objectives: To learn about the two major multi-modality molecular imaging techniques of small animals. To learn about the spatial resolution achievable by the molecular imaging systems for small animal today. To learn about the new multi-modality imaging instrumentation and techniques that are being developed. Sang Hyun Cho; X-ray fluorescence (XRF) imaging, such as x-ray fluorescence computed tomography (XFCT), offers unique capabilities for accurate identification and quantification of metals within the imaging objects. As a result, it has emerged as a promising quantitative imaging modality in recent years, especially in conjunction with metal-based imaging probes. This talk will familiarize the audience with the basic principles of XRF/XFCT imaging. It will also cover the latest development of benchtop XFCT technology. Additionally, the use of metallic nanoparticles such as gold nanoparticles, in conjunction with benchtop XFCT, will be discussed within the context of preclinical multimodal multiplexed molecular imaging. Learning Objectives: To learn the basic principles of XRF/XFCT imaging To learn the latest advances in benchtop XFCT development for preclinical imaging Funding support received from NIH and DOD; Funding support received from GE Healthcare; Funding support received from Siemens AX; Patent royalties received from GE Healthcare; L. Wang, Funding Support: NIH; COI: Microphotoacoustics; S. Cho, Yes: ;NIH/NCI grant R01CA155446 DOD/PCRP grant W81XWH-12-1-0198.

  17. 24 CFR 570.206 - Program administrative costs.

    Science.gov (United States)

    2010-04-01

    ... preliminary surveys and analysis of market needs; (2) Site and utility plans, narrative descriptions of the... the salary, wages, and related costs of each person whose job includes any program administration...

  18. 7 CFR 20.6 - Submission of reports.

    Science.gov (United States)

    2010-01-01

    ... specified in paragraph (k) of this section, a report by marketing year on the applicable forms contained in... quantity of outstanding export sales from the previous report by country of destination. (ii) Quantity of... cancelled and quantity of buyback contracts made during the week. (v) Changes in destination during the week...

  19. WE-DE-206-00: MRI Physics

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2016-06-15

    Magnetic resonance imaging (MRI) has become an essential part of clinical imaging due to its ability to render high soft tissue contrast. Instead of ionizing radiation, MRI use strong magnetic field, radio frequency waves and field gradients to create diagnostic useful images. It can be used to image the anatomy and also functional and physiological activities within the human body. Knowledge of the basic physical principles underlying MRI acquisition is vitally important to successful image production and proper image interpretation. This lecture will give an overview of the spin physics, imaging principle of MRI, the hardware of the MRI scanner, and various pulse sequences and their applications. It aims to provide a conceptual foundation to understand the image formation process of a clinical MRI scanner. Learning Objectives: Understand the origin of the MR signal and contrast from the spin physics level. Understand the main hardware components of a MRI scanner and their purposes Understand steps for MR image formation including spatial encoding and image reconstruction Understand the main kinds of MR pulse sequences and their characteristics.

  20. 44 CFR 206.191 - Duplication of benefits.

    Science.gov (United States)

    2010-10-01

    ... to section 408 of the Stafford Act. (iii) Small Business Administration and Farmers Home Administration disaster loans; (iv) Other Needs assistance, pursuant to section 408 of the Stafford Act or its... resources it must consider before it does so. (4) If following the delivery sequence concept would adversely...

  1. 19 CFR 206.14 - Contents of petition.

    Science.gov (United States)

    2010-04-01

    ..., wholesalers, or retailers), and a downward trend in production, profits, wages, productivity, or employment... sought, including the type, amount, and duration, and the specific purposes therefor, which may include...

  2. 19 CFR 206.34 - Contents of petition.

    Science.gov (United States)

    2010-04-01

    ..., wholesalers, or retailers), and a downward trend in production, profits, wages, productivity, or employment... and purpose thereof. A statement describing the import relief sought, including the type, amount, and...

  3. 9 CFR 206.2 - Swine contract library.

    Science.gov (United States)

    2010-01-01

    ... lean percent or other merits of the carcass that are used to determine the amount of the premiums and... one business day of the change, expiration, or withdrawal. (Approved by the Office of Management and...

  4. Dicty_cDB: VSI206 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available adnsgaknlyviavkgikgrlnrlpsagvgdmvm atvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnilgpvak ecsdlwpkvatn...kgrlnrlpsagvgdmvm atvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnilgpvak ecsdlwpkvatnagtiv*INTHKVKTIXK

  5. 30 CFR 206.157 - Determination of transportation allowances.

    Science.gov (United States)

    2010-07-01

    ... a series of outgoing pipelines; (5) Gas Research Institute (GRI) fees. The GRI conducts research... industry and gas customers. GRI fees are allowable provided such fees are mandatory in FERC-approved...

  6. 44 CFR 206.223 - General work eligibility.

    Science.gov (United States)

    2010-10-01

    ... facilities must be submitted through a State or political subdivision of the State. (e) Negligence. No assistance will be provided to an applicant for damages caused by its own negligence. If negligence by...

  7. Publications | Page 206 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, de la mise en commun des connaissances et de la formation. Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons à ...

  8. 5 CFR 551.206 - Administrative exemption criteria.

    Science.gov (United States)

    2010-01-01

    ... evaluation of possible courses of conduct, and acting or making a decision after the various possibilities..., an employee can exercise discretion and independent judgment even if the employee's decisions or... require that decisions made by an employee have a finality that goes with unlimited authority and a...

  9. 32 CFR 206.3 - Overall program emphasis.

    Science.gov (United States)

    2010-07-01

    ... capacity to improve instruction, broaden access, and assess student learning. NSEP's objective is not to... technology, how it is to be developed and applied and how student learning will be impacted. ... or to improve the quality of study abroad instruction. Proposals can address issues concerning either...

  10. WE-H-206-00: Advances in Preclinical Imaging

    International Nuclear Information System (INIS)

    2016-01-01

    Lihong V. Wang: Photoacoustic tomography (PAT), combining non-ionizing optical and ultrasonic waves via the photoacoustic effect, provides in vivo multiscale functional, metabolic, and molecular imaging. Broad applications include imaging of the breast, brain, skin, esophagus, colon, vascular system, and lymphatic system in humans or animals. Light offers rich contrast but does not penetrate biological tissue in straight paths as x-rays do. Consequently, high-resolution pure optical imaging (e.g., confocal microscopy, two-photon microscopy, and optical coherence tomography) is limited to penetration within the optical diffusion limit (∼1 mm in the skin). Ultrasonic imaging, on the contrary, provides fine spatial resolution but suffers from both poor contrast in early-stage tumors and strong speckle artifacts. In PAT, pulsed laser light penetrates tissue and generates a small but rapid temperature rise, which induces emission of ultrasonic waves due to thermoelastic expansion. The ultrasonic waves, orders of magnitude less scattering than optical waves, are then detected to form high-resolution images of optical absorption at depths up to 7 cm, conquering the optical diffusion limit. PAT is the only modality capable of imaging across the length scales of organelles, cells, tissues, and organs (up to whole-body small animals) with consistent contrast. This rapidly growing technology promises to enable multiscale biological research and accelerate translation from microscopic laboratory discoveries to macroscopic clinical practice. PAT may also hold the key to label-free early detection of cancer by in vivo quantification of hypermetabolism, the quintessential hallmark of malignancy. Learning Objectives: To understand the contrast mechanism of PAT To understand the multiscale applications of PAT Benjamin M. W. Tsui: Multi-modality molecular imaging instrumentation and techniques have been major developments in small animal imaging that has contributed significantly to biomedical research during the past decade. The initial development was an extension of clinical PET/CT and SPECT/CT from human to small animals and combine the unique functional information obtained from PET and SPECT with anatomical information provided by the CT in registered multi-modality images. The requirements to image a mouse whose size is an order of magnitude smaller than that of a human have spurred advances in new radiation detector technologies, novel imaging system designs and special image reconstruction and processing techniques. Examples are new detector materials and designs with high intrinsic resolution, multi-pinhole (MPH) collimator design for much improved resolution and detection efficiency compared to the conventional collimator designs in SPECT, 3D high-resolution and artifact-free MPH and sparse-view image reconstruction techniques, and iterative image reconstruction methods with system response modeling for resolution recovery and image noise reduction for much improved image quality. The spatial resolution of PET and SPECT has improved from ∼6–12 mm to ∼1 mm a few years ago to sub-millimeter today. A recent commercial small animal SPECT system has achieved a resolution of ∼0.25 mm which surpasses that of a state-of-art PET system whose resolution is limited by the positron range. More recently, multimodality SA PET/MRI and SPECT/MRI systems have been developed in research laboratories. Also, multi-modality SA imaging systems that include other imaging modalities such as optical and ultrasound are being actively pursued. In this presentation, we will provide a review of the development, recent advances and future outlook of multi-modality molecular imaging of small animals. Learning Objectives: To learn about the two major multi-modality molecular imaging techniques of small animals. To learn about the spatial resolution achievable by the molecular imaging systems for small animal today. To learn about the new multi-modality imaging instrumentation and techniques that are being developed. Sang Hyun Cho; X-ray fluorescence (XRF) imaging, such as x-ray fluorescence computed tomography (XFCT), offers unique capabilities for accurate identification and quantification of metals within the imaging objects. As a result, it has emerged as a promising quantitative imaging modality in recent years, especially in conjunction with metal-based imaging probes. This talk will familiarize the audience with the basic principles of XRF/XFCT imaging. It will also cover the latest development of benchtop XFCT technology. Additionally, the use of metallic nanoparticles such as gold nanoparticles, in conjunction with benchtop XFCT, will be discussed within the context of preclinical multimodal multiplexed molecular imaging. Learning Objectives: To learn the basic principles of XRF/XFCT imaging To learn the latest advances in benchtop XFCT development for preclinical imaging Funding support received from NIH and DOD; Funding support received from GE Healthcare; Funding support received from Siemens AX; Patent royalties received from GE Healthcare; L. Wang, Funding Support: NIH; COI: Microphotoacoustics; S. Cho, Yes: ;NIH/NCI grant R01CA155446 DOD/PCRP grant W81XWH-12-1-0198

  11. 19 CFR 206.33 - Who may file a petition.

    Science.gov (United States)

    2010-04-01

    ... product may petition for provisional relief with respect to imports of such product from Canada or Mexico... the date the allegation of injury is included in the petition. (c) The President is authorized to provide import relief with respect to an article from Canada or Mexico during the period provided for in...

  12. 19 CFR 10.206 - Value content requirement.

    Science.gov (United States)

    2010-04-01

    ... business which either are not allocable to the specific merchandise or are not related to the growth... incorporated in an article which are either: (i) Wholly the growth, product, or manufacture of a beneficiary... incurred in the growth, production, or manufacture of the material, including general expenses; (B) An...

  13. 19 CFR 206.6 - Report to the President.

    Science.gov (United States)

    2010-04-01

    ... Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION NONADJUDICATIVE INVESTIGATIONS INVESTIGATIONS RELATING TO GLOBAL AND BILATERAL SAFEGUARD ACTIONS, MARKET DISRUPTION, TRADE DIVERSION, AND REVIEW OF... factors other than imports which may be a cause of serious injury or threat thereof to the domestic...

  14. 19 CFR 206.13 - Who may file a petition.

    Science.gov (United States)

    2010-04-01

    ... Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION NONADJUDICATIVE INVESTIGATIONS INVESTIGATIONS RELATING TO GLOBAL AND BILATERAL SAFEGUARD ACTIONS, MARKET DISRUPTION, TRADE DIVERSION, AND REVIEW OF... recognized union, or group of workers, that is representative of a domestic industry producing an article...

  15. 48 CFR 49.206-1 - Submission of settlement proposals.

    Science.gov (United States)

    2010-10-01

    ... accounting data. Actual, standard (appropriately adjusted), or average costs may be used in preparing settlement proposals if they are determined under generally recognized accounting principles consistently... not be required to maintain unduly elaborate cost accounting systems merely because their contracts...

  16. 34 CFR 685.206 - Borrower responsibilities and defenses.

    Science.gov (United States)

    2010-07-01

    ... parent borrower, of the student, including any Federal Consolidation Loan or Direct Consolidation Loan... enrollment status, financial assistance, and employment records). (b)(1) The borrower shall promptly notify...

  17. 40 CFR 421.206 - Pretreatment standards for new sources.

    Science.gov (United States)

    2010-07-01

    ... GUIDELINES AND STANDARDS NONFERROUS METALS MANUFACTURING POINT SOURCE CATEGORY Secondary Mercury Subcategory... wastewater pollutants in secondary mercury process wastewater introduced into a POTW shall not exceed the following values: (a) Spent battery electrolyte. PSNS for the Secondary Mercury Subcategory Pollutant or...

  18. 48 CFR 5.206 - Notices of subcontracting opportunities.

    Science.gov (United States)

    2010-10-01

    ... subcontracts, to increase participation by qualified HUBZone small business, small, small disadvantaged, women-owned small business, veteran-owned small business and service-disabled veteran-owned small business.... (b) The notices must describe— (1) The business opportunity; (2) Any prequalification requirements...

  19. FORMULA 206-1x BIO-WASH™

    Science.gov (United States)

    Technical product bulletin: this surface washing agent is most effective on hydrocarbon and bio-organic soiling on hard surfaces including beaches, shorelines, and rocks; specifically to aid in the removal of oil and oil saturated soiling.

  20. 12 CFR 206.5 - Capital levels of correspondents.

    Science.gov (United States)

    2010-01-01

    ... not identical to the definition of that term as used for the purposes of the prompt corrective action... capital levels. A bank shall obtain information to demonstrate that a correspondent is at least adequately..., Thrift Financial Report, financial statement, or bank rating report for the correspondent. For a foreign...

  1. 30 CFR 206.262 - Determination of transportation allowances.

    Science.gov (United States)

    2010-07-01

    ... production for the mutual benefit of the lessee and the lessor, then MMS shall require that the... depreciation and a return on undepreciated capital investment in accordance with paragraph (b)(2)(iv)(A) of... other alternative without approval of the MMS. (A) To compute depreciation, the lessee may elect to use...

  2. 30 CFR 206.259 - Determination of washing allowances.

    Science.gov (United States)

    2010-07-01

    ... market the production for the mutual benefit of the lessee and the lessor, then MMS shall require that... reported period, including operating and maintenance expenses, overhead, and either depreciation and a... other alternative without approval of the MMS. (A) To compute depreciation, the lessee may elect to use...

  3. 30 CFR 206.153 - Valuation standards-processed gas.

    Science.gov (United States)

    2010-07-01

    ... reports for royalty purposes is subject to monitoring, review, and audit. For purposes of this section.... (iv) How to value over-delivered volumes under a cash-out program. This paragraph applies to situations where a pipeline purchases gas from a lessee according to a cash-out program under a...

  4. 30 CFR 206.152 - Valuation standards-unprocessed gas.

    Science.gov (United States)

    2010-07-01

    ... to monitoring, review, and audit. For purposes of this section, gas which is sold or otherwise...'s value. (iv) How to value over-delivered volumes under a cash-out program. This paragraph applies to situations where a pipeline purchases gas from a lessee according to a cash-out program under a...

  5. 41 CFR 101-6.206 - Illustrative applications.

    Science.gov (United States)

    2010-07-01

    ... policies, the services and benefits of the program or activity it administers may not in fact be equally... use of any academic, dormitory, eating, recreational, or other facilities of the recipient. (c) In the... receiving the benefits or services of the program is prohibited. (d) In the program involving the donation...

  6. 32 CFR 206.4 - Proposal development and review.

    Science.gov (United States)

    2010-07-01

    ... representatives from the research, business, and government communities. Every effort will be made to ensure balance (geographical, ethnic, gender, institutional type, subject matter) across the entire competition... following issues in the preliminary proposal: (1) How the proposal addresses issues of national capacity in...

  7. 44 CFR 206.344 - Limitations on Federal expenditures.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF HOMELAND SECURITY DISASTER ASSISTANCE FEDERAL DISASTER ASSISTANCE Coastal Barrier Resources Act... within the Coastal Barrier Resources System, including but not limited to: (a) Construction... any project to prevent the erosion of, or to otherwise stabilize, any inlet, shoreline, or inshore...

  8. 29 CFR 2200.206 - Disclosure of information.

    Science.gov (United States)

    2010-07-01

    ... working days after a case is designated for Simplified Proceedings, the Secretary shall provide the employer, free of charge, copies of the narrative (Form OSHA 1-A) and the worksheet (Form OSHA 1-B), or their equivalents. (2) Within 30 calendar days after a case is designated for Simplified Proceedings...

  9. 44 CFR 206.118 - Disposal of housing units.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF HOMELAND SECURITY DISASTER ASSISTANCE FEDERAL DISASTER ASSISTANCE Federal Assistance to..., has a site that complies with local codes and ordinances and part 9 of this Title. (ii) Adjustment to... providing temporary housing to disaster victims in major disasters and emergencies. As a condition of the...

  10. 33 CFR 160.206 - Information required in an NOA.

    Science.gov (United States)

    2010-07-01

    ... CDC (1) Vessel Information: (i) Name; X X X (ii) Name of the registered owner; X X X (iii) Country of registry; X X X (iv) Call sign; X X X (v) International Maritime Organization (IMO) international number or... (vi) Name of the operator; X X X (vii) Name of the charterer; and X X X (viii) Name of classification...

  11. 30 CFR 206.150 - Purpose and scope.

    Science.gov (United States)

    2010-07-01

    ... terms. (b) If the regulations in this subpart are inconsistent with: (1) A Federal statute; (2) A... established under this subpart; or (4) An express provision of an oil and gas lease subject to this subpart... terms. [61 FR 5464, Feb. 12, 1996, as amended at 70 FR 11877, Mar. 10, 2005] ...

  12. 44 CFR 206.42 - Responsibilities of coordinating officers.

    Science.gov (United States)

    2010-10-01

    ... applications, and counsel individuals, families and businesses concerning available assistance; (3) Coordinate... their appropriate disaster assistance roles under their own legislative authorities and operational... and local disaster relief activities, and implementation of the State emergency plan. The functions...

  13. 24 CFR 206.113 - Late charge and interest.

    Science.gov (United States)

    2010-04-01

    ... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES HOME EQUITY CONVERSION MORTGAGE INSURANCE Contract Rights and Obligations Mortgage Insurance Premiums...

  14. MO-AB-206-01: PET Physics

    International Nuclear Information System (INIS)

    Turkington, T.

    2016-01-01

    This education session will cover the physics and operation principles of gamma cameras and PET scanners. The first talk will focus on PET imaging. An overview of the principles of PET imaging will be provided, including positron decay physics, and the transition from 2D to 3D imaging. More recent advances in hardware and software will be discussed, such as time-of-flight imaging, and improvements in reconstruction algorithms that provide for options such as depth-of-interaction corrections. Quantitative applications of PET will be discussed, as well as the requirements for doing accurate quantitation. Relevant performance tests will also be described. Learning Objectives: Be able to describe basic physics principles of PET and operation of PET scanners. Learn about recent advances in PET scanner hardware technology. Be able to describe advances in reconstruction techniques and improvements Be able to list relevant performance tests. The second talk will focus on gamma cameras. The Nuclear Medicine subcommittee has charged a task group (TG177) to develop a report on the current state of physics testing of gamma cameras, SPECT, and SPECT/CT systems. The report makes recommendations for performance tests to be done for routine quality assurance, annual physics testing, and acceptance tests, and identifies those needed satisfy the ACR accreditation program and The Joint Commission imaging standards. The report is also intended to be used as a manual with detailed instructions on how to perform tests under widely varying conditions. Learning Objectives: At the end of the presentation members of the audience will: Be familiar with the tests recommended for routine quality assurance, annual physics testing, and acceptance tests of gamma cameras for planar imaging. Be familiar with the tests recommended for routine quality assurance, annual physics testing, and acceptance tests of SPECT systems. Be familiar with the tests of a SPECT/CT system that include the CT images for SPECT reconstructions. Become knowledgeable of items to be included in annual acceptance testing reports including CT dosimetry and PACS monitor measurements. T. Turkington, GE Healthcare

  15. 30 CFR 206.104 - What publications are acceptable to MMS?

    Science.gov (United States)

    2010-07-01

    ... buyers and sellers frequently use; (2) Publications frequently mentioned in purchase or sales contracts; (3) Publications that use adequate survey techniques, including development of estimates based on...

  16. 27 CFR 70.206 - Discharge of liens; redemption by United States.

    Science.gov (United States)

    2010-04-01

    ... this section, shall constitute prima facie evidence of the regularity of the redemption. When a... include the amount of the obligation secured by such lien to the extent legally satisfied by reason of the... obligation secured by such lien to the extent legally satisfied by reason of the sale and (B) Any additional...

  17. 44 CFR 206.6 - Donation or loan of Federal equipment and supplies.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Donation or loan of Federal... Donation or loan of Federal equipment and supplies. (a) In any major disaster or emergency, the... governments for use and distribution by them for the purposes of the Stafford Act. (b) A donation or loan may...

  18. SU-G-206-15: Effects of Dose Reduction On Emphysema Score

    International Nuclear Information System (INIS)

    Lo, P; Wahi-Anwar, M; Kim, H; Young, S; Hoffman, J; McNitt-Gray, M

    2016-01-01

    Purpose: The purpose of this study was to investigate the effects of reducing radiation dose levels on emphysema scores from lung cancer screening CT exams. Methods: 52 cases were selected from the National Lung Screening Trial (NLST) patients for which we had both the image series and the raw CT data. All scans were acquired with fixed effective mAs (25 for standard-sized patients, 40 for large patients) on a 64-slice scanner (Sensation 64, Siemens Healthcare) using 120kV, 64×0.6mm collimation and pitch 1.0. All images were reconstructed with 1mm slice thickness, B50 kernel. Based on a previously-published technique, we added noise to the raw data to simulate reduced-dose versions at 50% and 25% of the original dose (approximately 1.0- and 0.5-mGy CTDIvol). Lung segmentations were obtained via region growing from manual seed point at a threshold of 600HU followed by manual removal of trachea and major airways. Lung segmentations were only performed on original dose scans, and mapped to simulated reduced-dose scans. Emphysema scores based on relative area of lung with attenuation values lower than −950HU (RA950) were computed for all cases. Results: Average RA950 of all 50 cases were 31.6 (±5.5), 32.5 (±4.9) and 32.8 (±4.6) for 100%, 50% and 25% dose level respectively. The average absolute difference in RA950 between simulated and original dose scans were 1.0 (±0.7) and 1.4 (±1.1) for 50% and 25% dose level respectively. Conclusion: RA950 is relatively robust to dose level, with a difference of no more than 5 from the original dose scans. The average RA950 of this population was high for a two reasons: This was a high risk population of patients with substantial smoking history; The use of B50 kernel, which may be biased towards high emphysema scores. Further exploration with smoother kernels will be conducted in the future. Institutional research agreement, Siemens Healthcare; Past recipient, research grant support, Siemens Healthcare; Consultant, Toshiba America Medical Systems; Consultant, Samsung Electronics; NIH grant support from U01 CA181156

  19. TU-H-206-01: An Automated Approach for Identifying Geometric Distortions in Gamma Cameras

    Energy Technology Data Exchange (ETDEWEB)

    Mann, S; Nelson, J [Clinical Imaging Physics Group and Carl E. Ravin Advanced Imaging Laboratories, Department of Radiology, Duke University Medical Center, Durham, North Carolina 27705 and Medical Physics Graduate Program, Duke University, Durham, North Carolina 27705 (United States); Samei, E [Clinical Imaging Physics Group and Carl E. Ravin Advanced Imaging Laboratories, Department of Radiology, Duke University Medical Center, Durham, North Carolina 27705 and Departments of Physics, Electrical and Computer Engineering, and Biomedical Engineering, and Medical Physics Graduate Program, Duke University, Durham, North Carolina 27705 (United States)

    2016-06-15

    Purpose: To develop a clinically-deployable, automated process for detecting artifacts in routine nuclear medicine (NM) quality assurance (QA) bar phantom images. Methods: An artifact detection algorithm was created to analyze bar phantom images as part of an ongoing QA program. A low noise, high resolution reference image was acquired from an x-ray of the bar phantom with a Philips Digital Diagnost system utilizing image stitching. NM bar images, acquired for 5 million counts over a 512×512 matrix, were registered to the template image by maximizing mutual information (MI). The MI index was used as an initial test for artifacts; low values indicate an overall presence of distortions regardless of their spatial location. Images with low MI scores were further analyzed for bar linearity, periodicity, alignment, and compression to locate differences with respect to the template. Findings from each test were spatially correlated and locations failing multiple tests were flagged as potential artifacts requiring additional visual analysis. The algorithm was initially deployed for GE Discovery 670 and Infinia Hawkeye gamma cameras. Results: The algorithm successfully identified clinically relevant artifacts from both systems previously unnoticed by technologists performing the QA. Average MI indices for artifact-free images are 0.55. Images with MI indices < 0.50 have shown 100% sensitivity and specificity for artifact detection when compared with a thorough visual analysis. Correlation of geometric tests confirms the ability to spatially locate the most likely image regions containing an artifact regardless of initial phantom orientation. Conclusion: The algorithm shows the potential to detect gamma camera artifacts that may be missed by routine technologist inspections. Detection and subsequent correction of artifacts ensures maximum image quality and may help to identify failing hardware before it impacts clinical workflow. Going forward, the algorithm is being deployed to monitor data from all gamma cameras within our health system.

  20. SU-G-TeP2-06: Development of Novel Radiochromic Films for Radiotherapy Dosimetry

    Energy Technology Data Exchange (ETDEWEB)

    Alqathami, M; Lee, H; Ibbott, G [UT MD Anderson Cancer Center, Houston, TX (United States); Won Choi, G [UT MD Anderson Cancer Center, Houston, TX-Texas (United States); Blencowe, A [The University of South Australia, South Australia, SA (Australia); Wen, Z [MD Anderson Cancer Center, Houston, TX (United States); Adamovics, J [Department of Chemistry and Biology, Rider University, Skillman, NJ (United States)

    2016-06-15

    Purpose: To develop and evaluate novel radiochromic films for quality assurance in radiotherapy dosimetry. Materials and Methods: Novel radiochromic film compositions were formulated using leuco crystal violet (LCV) as a reporting system and tetrabromoethane as a free radical source. The film matrix used consisted of polyurethane polymer mixed with dibutyl phthalate plasticizer (20 wt%). The concentration of the radical initiator was kept constant at 10 wt% and the concentration of the LCV dye varied (1 and 2 wt%). To ensure uniform thickness of the film, its precursors were sandwiched between two pieces of glass separated by a 1 mm gap between during the curing process. The films were cut into pieces and were irradiated with a 6 MV X-ray beam to selected doses. The change in optical density was measured using a flatbed scanner and a spectrophotometer. Results: The results showed that all film formulations exhibited a linear response with dose and an absorption maximum at ∼ 590 nm. The formulation with 2 wt% LCV was ∼ 30% more sensitive to dose than the formulation with 1 wt% LCV. Both films were very deformable. In addition, the radiochromic response of the film was found to bleach over a short period of time (few weeks) allowing the film to be reused for dose verification measurements. Conclusion: Both film formulations displayed excellent sensitivity and linearity to radiation dose and thus can be used for the 2D dosimetry of clinical megavoltage and kilovoltage X-ray beams. In addition, the thickness of the film could easily be increased allowing for their potential use as a deformable bolus material. However, thicker films would need more optimization of the manufacturing procedure to ensure consistent material uniformity and sensitivity are recommended.

  1. 44 CFR 206.181 - Use of gifts and bequests for disaster assistance purposes.

    Science.gov (United States)

    2010-10-01

    ... assistance to self-employed persons (with no employees) to reestablish their businesses; and (3) Other... grounds of race, color, religion, national origin, sex, age, or economic status. (8) Funds awarded to a... for the Disaster Assistance Directorate shall review the facts and make a determination. If the award...

  2. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (206-0613-272217)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  3. RCT: Module 2.06, Air Sampling Program and Methods, Course 8772

    Energy Technology Data Exchange (ETDEWEB)

    Hillmer, Kurt T. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-07-19

    The inhalation of radioactive particles is the largest cause of an internal radiation dose. Airborne radioactivity measurements are necessary to ensure that the control measures are and continue to be effective. Regulations govern the allowable effective dose equivalent to an individual. The effective dose equivalent is determined by combining the external and internal dose equivalent values. Typically, airborne radioactivity levels are maintained well below allowable levels to keep the total effective dose equivalent small. This course will prepare the student with the skills necessary for RCT qualification by passing quizzes, tests, and the RCT Comprehensive Phase 1, Unit 2 Examination (TEST 27566) and will provide in-the-field skills.

  4. 34 CFR 206.20 - What must be included in an application?

    Science.gov (United States)

    2010-07-01

    ... inservice training; (ii) Training and technical assistance; (iii) Staff travel; (iv) Student travel; (v... SECONDARY EDUCATION, DEPARTMENT OF EDUCATION SPECIAL EDUCATIONAL PROGRAMS FOR STUDENTS WHOSE FAMILIES ARE...

  5. SU-D-206-07: CBCT Scatter Correction Based On Rotating Collimator

    International Nuclear Information System (INIS)

    Yu, G; Feng, Z; Yin, Y; Qiang, L; Li, B; Huang, P; Li, D

    2016-01-01

    Purpose: Scatter correction in cone-beam computed tomography (CBCT) has obvious effect on the removal of image noise, the cup artifact and the increase of image contrast. Several methods using a beam blocker for the estimation and subtraction of scatter have been proposed. However, the inconvenience of mechanics and propensity to residual artifacts limited the further evolution of basic and clinical research. Here, we propose a rotating collimator-based approach, in conjunction with reconstruction based on a discrete Radon transform and Tchebichef moments algorithm, to correct scatter-induced artifacts. Methods: A rotating-collimator, comprising round tungsten alloy strips, was mounted on a linear actuator. The rotating-collimator is divided into 6 portions equally. The round strips space is evenly spaced on each portion but staggered between different portions. A step motor connected to the rotating collimator drove the blocker to around x-ray source during the CBCT acquisition. The CBCT reconstruction based on a discrete Radon transform and Tchebichef moments algorithm is performed. Experimental studies using water phantom and Catphan504 were carried out to evaluate the performance of the proposed scheme. Results: The proposed algorithm was tested on both the Monte Carlo simulation and actual experiments with the Catphan504 phantom. From the simulation result, the mean square error of the reconstruction error decreases from 16% to 1.18%, the cupping (τcup) from 14.005% to 0.66%, and the peak signal-to-noise ratio increase from 16.9594 to 31.45. From the actual experiments, the induced visual artifacts are significantly reduced. Conclusion: We conducted an experiment on CBCT imaging system with a rotating collimator to develop and optimize x-ray scatter control and reduction technique. The proposed method is attractive in applications where a high CBCT image quality is critical, for example, dose calculation in adaptive radiation therapy. We want to thank Dr. Lei Xing and Dr. Yong Yang in the Stanford University School of Medicine for this work. This work was jointly supported by NSFC (61471226), Natural Science Foundation for Distinguished Young Scholars of Shandong Province (JQ201516), and China Postdoctoral Science Foundation (2015T80739, 2014M551949).

  6. WE-AB-206-01: Diagnostic Ultrasound Imaging Quality Assurance

    Energy Technology Data Exchange (ETDEWEB)

    Zagzebski, J. [University of Wisconsin (United States)

    2016-06-15

    The involvement of medical physicists in diagnostic ultrasound imaging service is increasing due to QC and accreditation requirements. The goal of this ultrasound hands-on workshop is to demonstrate quality control (QC) testing in diagnostic ultrasound and to provide updates in ACR ultrasound accreditation requirements. The first half of this workshop will include two presentations reviewing diagnostic ultrasound QA/QC and ACR ultrasound accreditation requirements. The second half of the workshop will include live demonstrations of basic QC tests. An array of ultrasound testing phantoms and ultrasound scanners will be available for attendees to learn diagnostic ultrasound QC in a hands-on environment with live demonstrations and on-site instructors. The targeted attendees are medical physicists in diagnostic imaging. Learning Objectives: Gain familiarity with common elements of a QA/QC program for diagnostic ultrasound imaging dentify QC tools available for testing diagnostic ultrasound systems and learn how to use these tools Learn ACR ultrasound accreditation requirements Jennifer Walter is an employee of American College of Radiology on Ultrasound Accreditation.

  7. MO-AB-206-02: Testing Gamma Cameras Based On TG177 WG Report

    Energy Technology Data Exchange (ETDEWEB)

    Halama, J. [Loyola Univ. Medical Center (United States)

    2016-06-15

    This education session will cover the physics and operation principles of gamma cameras and PET scanners. The first talk will focus on PET imaging. An overview of the principles of PET imaging will be provided, including positron decay physics, and the transition from 2D to 3D imaging. More recent advances in hardware and software will be discussed, such as time-of-flight imaging, and improvements in reconstruction algorithms that provide for options such as depth-of-interaction corrections. Quantitative applications of PET will be discussed, as well as the requirements for doing accurate quantitation. Relevant performance tests will also be described. Learning Objectives: Be able to describe basic physics principles of PET and operation of PET scanners. Learn about recent advances in PET scanner hardware technology. Be able to describe advances in reconstruction techniques and improvements Be able to list relevant performance tests. The second talk will focus on gamma cameras. The Nuclear Medicine subcommittee has charged a task group (TG177) to develop a report on the current state of physics testing of gamma cameras, SPECT, and SPECT/CT systems. The report makes recommendations for performance tests to be done for routine quality assurance, annual physics testing, and acceptance tests, and identifies those needed satisfy the ACR accreditation program and The Joint Commission imaging standards. The report is also intended to be used as a manual with detailed instructions on how to perform tests under widely varying conditions. Learning Objectives: At the end of the presentation members of the audience will: Be familiar with the tests recommended for routine quality assurance, annual physics testing, and acceptance tests of gamma cameras for planar imaging. Be familiar with the tests recommended for routine quality assurance, annual physics testing, and acceptance tests of SPECT systems. Be familiar with the tests of a SPECT/CT system that include the CT images for SPECT reconstructions. Become knowledgeable of items to be included in annual acceptance testing reports including CT dosimetry and PACS monitor measurements. T. Turkington, GE Healthcare.

  8. MO-AB-206-00: Nuclear Medicine Physics and Testing

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2016-06-15

    This education session will cover the physics and operation principles of gamma cameras and PET scanners. The first talk will focus on PET imaging. An overview of the principles of PET imaging will be provided, including positron decay physics, and the transition from 2D to 3D imaging. More recent advances in hardware and software will be discussed, such as time-of-flight imaging, and improvements in reconstruction algorithms that provide for options such as depth-of-interaction corrections. Quantitative applications of PET will be discussed, as well as the requirements for doing accurate quantitation. Relevant performance tests will also be described. Learning Objectives: Be able to describe basic physics principles of PET and operation of PET scanners. Learn about recent advances in PET scanner hardware technology. Be able to describe advances in reconstruction techniques and improvements Be able to list relevant performance tests. The second talk will focus on gamma cameras. The Nuclear Medicine subcommittee has charged a task group (TG177) to develop a report on the current state of physics testing of gamma cameras, SPECT, and SPECT/CT systems. The report makes recommendations for performance tests to be done for routine quality assurance, annual physics testing, and acceptance tests, and identifies those needed satisfy the ACR accreditation program and The Joint Commission imaging standards. The report is also intended to be used as a manual with detailed instructions on how to perform tests under widely varying conditions. Learning Objectives: At the end of the presentation members of the audience will: Be familiar with the tests recommended for routine quality assurance, annual physics testing, and acceptance tests of gamma cameras for planar imaging. Be familiar with the tests recommended for routine quality assurance, annual physics testing, and acceptance tests of SPECT systems. Be familiar with the tests of a SPECT/CT system that include the CT images for SPECT reconstructions. Become knowledgeable of items to be included in annual acceptance testing reports including CT dosimetry and PACS monitor measurements. T. Turkington, GE Healthcare.

  9. SU-G-206-15: Effects of Dose Reduction On Emphysema Score

    Energy Technology Data Exchange (ETDEWEB)

    Lo, P; Wahi-Anwar, M; Kim, H [University of California, Los Angeles, Los Angeles, CA (United States); Young, S; Hoffman, J [UCLA, Los Angeles, CA (United States); McNitt-Gray, M [UCLA School of Medicine, Los Angeles, CA (United States)

    2016-06-15

    Purpose: The purpose of this study was to investigate the effects of reducing radiation dose levels on emphysema scores from lung cancer screening CT exams. Methods: 52 cases were selected from the National Lung Screening Trial (NLST) patients for which we had both the image series and the raw CT data. All scans were acquired with fixed effective mAs (25 for standard-sized patients, 40 for large patients) on a 64-slice scanner (Sensation 64, Siemens Healthcare) using 120kV, 64×0.6mm collimation and pitch 1.0. All images were reconstructed with 1mm slice thickness, B50 kernel. Based on a previously-published technique, we added noise to the raw data to simulate reduced-dose versions at 50% and 25% of the original dose (approximately 1.0- and 0.5-mGy CTDIvol). Lung segmentations were obtained via region growing from manual seed point at a threshold of 600HU followed by manual removal of trachea and major airways. Lung segmentations were only performed on original dose scans, and mapped to simulated reduced-dose scans. Emphysema scores based on relative area of lung with attenuation values lower than −950HU (RA950) were computed for all cases. Results: Average RA950 of all 50 cases were 31.6 (±5.5), 32.5 (±4.9) and 32.8 (±4.6) for 100%, 50% and 25% dose level respectively. The average absolute difference in RA950 between simulated and original dose scans were 1.0 (±0.7) and 1.4 (±1.1) for 50% and 25% dose level respectively. Conclusion: RA950 is relatively robust to dose level, with a difference of no more than 5 from the original dose scans. The average RA950 of this population was high for a two reasons: This was a high risk population of patients with substantial smoking history; The use of B50 kernel, which may be biased towards high emphysema scores. Further exploration with smoother kernels will be conducted in the future. Institutional research agreement, Siemens Healthcare; Past recipient, research grant support, Siemens Healthcare; Consultant, Toshiba America Medical Systems; Consultant, Samsung Electronics; NIH grant support from U01 CA181156.

  10. MO-DE-206-00: Joint AAPM-WMIS Symposium: Metabolic Imaging of Cancer

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2016-06-15

    In this symposium jointly sponsored by the World Molecular Imaging Society (WMIS) and the AAPM, luminary speakers on imaging metabolism will discuss three impactful topics. The first presentation on Cellular Metabolism of FDG will be given by Guillem Pratx (Stanford). This presentation will detail new work on looking at how the most common molecular imaging agent, fluoro-deoxy-glucose is metabolized at a cellular level. This will be followed by a talk on an improved approach to whole-body PET imaging by Simon Cherry (UC Davis). Simon’s work on a new whole-body PET imaging system promises to have dramatic improvement in our ability to detect and characterize cancer using PET. Finally, Jim Bankson (MD Anderson) will discuss extremely sophisticated approaches to quantifying hyperpolarized-13-C pyruvate metabolism using MR imaging. This technology promises to compliment the exquisite sensitivity of PET with an ability to measure not just uptake, but tumor metabolism. Learning Objectives: Understand the metabolism of FDG at a cellular level. Appreciate the engineering related to a novel new high-sensitivity whole-body PET imaging system. Understand the process of hyperpolarization, how pyruvate relates to metabolism and how advanced modeling can be used to better quantify this data. G. Pratx, Funding: 5R01CA186275, 1R21CA193001, and Damon Runyon Cancer Foundation. S. Cherry, National Institutes of Health; University of California, Davis; Siemens Medical SolutionsJ. Bankson, GE Healthcare; NCI P30-CA016672; CPRIT PR140021-P5.

  11. MO-DE-206-03: Quantifying Metabolism with Hyperpolarized MR

    Energy Technology Data Exchange (ETDEWEB)

    Bankson, J. [The University of Texas M.D. Anderson Cancer Center (United States)

    2016-06-15

    In this symposium jointly sponsored by the World Molecular Imaging Society (WMIS) and the AAPM, luminary speakers on imaging metabolism will discuss three impactful topics. The first presentation on Cellular Metabolism of FDG will be given by Guillem Pratx (Stanford). This presentation will detail new work on looking at how the most common molecular imaging agent, fluoro-deoxy-glucose is metabolized at a cellular level. This will be followed by a talk on an improved approach to whole-body PET imaging by Simon Cherry (UC Davis). Simon’s work on a new whole-body PET imaging system promises to have dramatic improvement in our ability to detect and characterize cancer using PET. Finally, Jim Bankson (MD Anderson) will discuss extremely sophisticated approaches to quantifying hyperpolarized-13-C pyruvate metabolism using MR imaging. This technology promises to compliment the exquisite sensitivity of PET with an ability to measure not just uptake, but tumor metabolism. Learning Objectives: Understand the metabolism of FDG at a cellular level. Appreciate the engineering related to a novel new high-sensitivity whole-body PET imaging system. Understand the process of hyperpolarization, how pyruvate relates to metabolism and how advanced modeling can be used to better quantify this data. G. Pratx, Funding: 5R01CA186275, 1R21CA193001, and Damon Runyon Cancer Foundation. S. Cherry, National Institutes of Health; University of California, Davis; Siemens Medical SolutionsJ. Bankson, GE Healthcare; NCI P30-CA016672; CPRIT PR140021-P5.

  12. TU-H-206-03: Characterizing B1 Inhomogeneities in DCE MRI

    Energy Technology Data Exchange (ETDEWEB)

    Gach, H [Washington University in St. Louis, St. Louis, MO (United States); Mason, N [University of Pittsburgh, Pittsburgh, PA (United States)

    2016-06-15

    Purpose: Dynamic Contrast Enhanced (DCE) MRI is a valuable technique for measuring perfusion and permeability characteristics of tumors. Exogenous contrast concentrations are calculated based on changes in T{sub 1} measured using fast 3D gradient echo (FLASH) sequences. However, the slab selective pulses used in 3D MRI may result in B{sub 1} inhomogeneities across the volume of interest that can lead to errors in T{sub 1} and thus the estimated gadolinium concentration. We compared three FLASH DCE sequences (GRE, TWIST, and VIBE) to determine their signal homogeneity across slices and the accuracy in calculating T{sub 1} using acquisitions with variable flip angles. Methods: The sequences were tested at 3 T on a Siemens mMR (VB20P) using a doped water phantom 3.75 g/L NiSO{sub 4} - 6H{sub 2}O + 5 g/L NaCl (T{sub 1} = 104 ms) and a 2% agar, 0.67% NaCl phantom (T{sub 1}= 1.71 s). 2D EPI B{sub 1} maps and inversion recovery T{sub 1}maps were acquired for ground truth. 3D MRI was acquired at different flip angles to generate a T{sub 1} map. Regions of interest were drawn to measure signal inside the phantoms as a function of slice position. The T{sub 1} for each slice ROI was fit to the FLASH steady-state model of magnetization. Results: Based on the data, GRE gave the most uniform signal homogeneity and T{sub 1} values in the middle slices of the 3D volume. The 3D VIBE sequence had the largest region of signal inhomogeneity compared to the 3D GRE and TWIST sequences. VIBE’s B{sub 1} inhomogeneity is inconsistent at low flip angles. However, VIBE resulted in more slices with T{sub 1} values similar to the ground truth. Conclusion: The central 1/3 of the slices yielded signals that result in T{sub 1} fits consistent with the ground truth. However, the remaining slices required some form of B{sub 1} inhomogeneity correction for quantitative DCE analysis. The research was supported in part by NIH NCI Grant R01CA159471.

  13. 30 CFR 206.351 - What definitions apply to this subpart?

    Science.gov (United States)

    2010-07-01

    ..., conducted in accordance with generally accepted accounting and auditing standards, of royalty or fee payment compliance activities of lessees or other interest holders who pay royalties, fees, rents, or bonuses on... been assigned an obligation to make royalty, fee, or other payments required by the lease. This...

  14. 23 CFR 450.206 - Scope of the statewide transportation planning process.

    Science.gov (United States)

    2010-04-01

    ... consideration and implementation of projects, strategies, and services that will address the following factors... local planned growth and economic development patterns; (6) Enhance the integration and connectivity of... analysis of the factors should be based on the scale and complexity of many issues, including...

  15. SU-D-206-04: Iterative CBCT Scatter Shading Correction Without Prior Information

    International Nuclear Information System (INIS)

    Bai, Y; Wu, P; Mao, T; Gong, S; Wang, J; Niu, T; Sheng, K; Xie, Y

    2016-01-01

    Purpose: To estimate and remove the scatter contamination in the acquired projection of cone-beam CT (CBCT), to suppress the shading artifacts and improve the image quality without prior information. Methods: The uncorrected CBCT images containing shading artifacts are reconstructed by applying the standard FDK algorithm on CBCT raw projections. The uncorrected image is then segmented to generate an initial template image. To estimate scatter signal, the differences are calculated by subtracting the simulated projections of the template image from the raw projections. Since scatter signals are dominantly continuous and low-frequency in the projection domain, they are estimated by low-pass filtering the difference signals and subtracted from the raw CBCT projections to achieve the scatter correction. Finally, the corrected CBCT image is reconstructed from the corrected projection data. Since an accurate template image is not readily segmented from the uncorrected CBCT image, the proposed scheme is iterated until the produced template is not altered. Results: The proposed scheme is evaluated on the Catphan©600 phantom data and CBCT images acquired from a pelvis patient. The result shows that shading artifacts have been effectively suppressed by the proposed method. Using multi-detector CT (MDCT) images as reference, quantitative analysis is operated to measure the quality of corrected images. Compared to images without correction, the method proposed reduces the overall CT number error from over 200 HU to be less than 50 HU and can increase the spatial uniformity. Conclusion: An iterative strategy without relying on the prior information is proposed in this work to remove the shading artifacts due to scatter contamination in the projection domain. The method is evaluated in phantom and patient studies and the result shows that the image quality is remarkably improved. The proposed method is efficient and practical to address the poor image quality issue of CBCT images. This work is supported by the Zhejiang Provincial Natural Science Foundation of China (Grant No. LR16F010001), National High-tech R&D Program for Young Scientists by the Ministry of Science and Technology of China (Grant No. 2015AA020917).

  16. 31 CFR 500.206 - Exemption of information and informational materials.

    Science.gov (United States)

    2010-07-01

    ... a book to Vietnam directly from San Francisco aboard a chartered aircraft, and receives payment by..., and to advance royalties of $10,000 to the musician. The music written in Vietnam is to be recorded in...

  17. TU-H-206-02: Novel Linearly-Filled Derenzo PET Phantom Design

    International Nuclear Information System (INIS)

    Graves, S; Cox, B; Valdovinos, H; Jeffery, J; Eliceiri, K; Barnhart, T; Nickles, R; Farhoud, M

    2016-01-01

    Purpose: To design a linearly-filled Derenzo positron emission tomography (PET) phantom, eliminating the extraneous radioisotope volumes in a conventional reservoir-type design. This activity reduction combined with the elimination of bubbles in smaller phantom channels would significantly reduce personnel dose, radioisotope cost, and would improve image quality by reducing out-of-slice activity scatter. Methods: A computer-aided design (CAD) was created of a modular Derenzo phantom consisting of three phantom layers with gaskets between the layers. The central piece contains the active pattern volume and channels connecting adjacent rods in a serpentine pattern. The two end-pieces contained an inlet and an outlet for filling purposes. Phantom prototypes were 3D printed on a Viper Si2 stereolithography machine. The two gaskets were fabricated from silicon sheets using a PLS 6.75 laser cutter. Phantoms were held together by pass-through glass-filled nylon bolts and nuts. Phantoms were filled with "5"2Mn, "6"4Cu, "7"4Br, and "1"2"4I for testing, and were imaged on a Siemens Inveon MicroPET scanner. Results: Four phantom prototypes were constructed using male Leur Lock fittings for inlet/outlet ports. 3D printed layers were sanded to ensure proper coupling to the silicon gaskets. The filling volume for each prototype was approximately 2.4 mL. The filling process was found to be rapid, leak-tight, and with minimal back-pressure. PET images were reconstructed by OSEM3D, and axial slices along the phantom pattern length were averaged to provide final images. Image distortion was isotope dependent with "5"2Mn and "6"4Cu having the least distortion and "1"2"4I having the most distortion. Conclusion: These results indicate that the linearlyfilled Derenzo design improves on conventional reservoir-type designs by eliminating potential bubbles in small channels and by reducing activity level, radioisotope volume, radioisotope cost, personnel dose, filling time, and out-of-slice activity scatter The method described in this abstract has been filed as a patent application to the US Patent and Trade Office by the Wisconsin Alumni Research Foundation (WARF).

  18. WE-DE-206-02: MRI Hardware - Magnet, Gradient, RF Coils

    Energy Technology Data Exchange (ETDEWEB)

    Kocharian, A. [Methodist Hospital (United States)

    2016-06-15

    Magnetic resonance imaging (MRI) has become an essential part of clinical imaging due to its ability to render high soft tissue contrast. Instead of ionizing radiation, MRI use strong magnetic field, radio frequency waves and field gradients to create diagnostic useful images. It can be used to image the anatomy and also functional and physiological activities within the human body. Knowledge of the basic physical principles underlying MRI acquisition is vitally important to successful image production and proper image interpretation. This lecture will give an overview of the spin physics, imaging principle of MRI, the hardware of the MRI scanner, and various pulse sequences and their applications. It aims to provide a conceptual foundation to understand the image formation process of a clinical MRI scanner. Learning Objectives: Understand the origin of the MR signal and contrast from the spin physics level. Understand the main hardware components of a MRI scanner and their purposes Understand steps for MR image formation including spatial encoding and image reconstruction Understand the main kinds of MR pulse sequences and their characteristics.

  19. TH-AB-206-01: Advances in Radionuclide Therapy - From Radioiodine to Nanoparticles

    International Nuclear Information System (INIS)

    Humm, J.

    2016-01-01

    In the past few decades, the field of nuclear medicine has made long strides with the continued advancement of related sciences and engineering and the availability of diagnostic and therapeutic radionuclides. Leveraging these advancements while combining the advantages of therapeutic and diagnostic radionuclides into one radiopharmaceutical has also created a new subfield “theranostics” in nuclear medicine that has the potential to further propel the field into the future. This session is composed of two talks; one focused on the physics principles of theranostics from properties of beta and alpha emitting radionuclides to dosimetric models and quantification; while the second describes preclinical and clinical applications of theranostics and discusses the challenges and opportunities of bringing them to the clinic. At the end of the session the listener should be able to identify: The different properties of beta and alpha emitting radionuclides Which radionuclides are selected for which nuclear medicine therapies and why How PET can be used to accurately quantify the uptake of tumor targeting molecules How individualized dosimetry can be performed from the management of thyroid cancer to novel radiolabeled antibody therapies Promising pre-clinical radiopharmaceutical pairs in prostate cancer and melanoma. Promising clinical Theranostics in neuroendocrine cancers. Challenges of bringing Theranostics to the clinic. E. Delpassand, RITA Foundation -Houston; SBIR Grant; CEO and share holder of RadioMedix.

  20. 15 CFR 2011.206 - Suspension or revocation of individual certificates.

    Science.gov (United States)

    2010-01-01

    ... Agreements OFFICE OF THE UNITED STATES TRADE REPRESENTATIVE ALLOCATION OF TARIFF-RATE QUOTA ON IMPORTED... appealed to the Director, Import Policy and Trade Analysis Division, Foreign Agricultural Service (FAS), U...

  1. 24 CFR 960.206 - Waiting list: Local preferences in admission to public housing program.

    Science.gov (United States)

    2010-04-01

    ... only adopt or implement residency preferences in accordance with non-discrimination and equal... otherwise denying admission to the program based on the race, color, ethnic origin, gender, religion... or who have been notified that they are hired to work in a residency preference area must be treated...

  2. 44 CFR 206.45 - Loans of non-Federal share.

    Science.gov (United States)

    2010-10-01

    ... advance. Simple interest will be computed from the date of the disbursement of each drawdown of the loan... Assistant Administrator for the Disaster Assistance Directorate together with the Chief Financial Officer... to assume their financial responsibility under such cost sharing provisions: (i) As a result of...

  3. TH-AB-206-01: Advances in Radionuclide Therapy - From Radioiodine to Nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Humm, J. [Memorial Sloan-Kettering Cancer Center (United States)

    2016-06-15

    In the past few decades, the field of nuclear medicine has made long strides with the continued advancement of related sciences and engineering and the availability of diagnostic and therapeutic radionuclides. Leveraging these advancements while combining the advantages of therapeutic and diagnostic radionuclides into one radiopharmaceutical has also created a new subfield “theranostics” in nuclear medicine that has the potential to further propel the field into the future. This session is composed of two talks; one focused on the physics principles of theranostics from properties of beta and alpha emitting radionuclides to dosimetric models and quantification; while the second describes preclinical and clinical applications of theranostics and discusses the challenges and opportunities of bringing them to the clinic. At the end of the session the listener should be able to identify: The different properties of beta and alpha emitting radionuclides Which radionuclides are selected for which nuclear medicine therapies and why How PET can be used to accurately quantify the uptake of tumor targeting molecules How individualized dosimetry can be performed from the management of thyroid cancer to novel radiolabeled antibody therapies Promising pre-clinical radiopharmaceutical pairs in prostate cancer and melanoma. Promising clinical Theranostics in neuroendocrine cancers. Challenges of bringing Theranostics to the clinic. E. Delpassand, RITA Foundation -Houston; SBIR Grant; CEO and share holder of RadioMedix.

  4. TH-AB-206-00: Challenges and Opportunities for Nuclear Medicine Theranostics

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2016-06-15

    In the past few decades, the field of nuclear medicine has made long strides with the continued advancement of related sciences and engineering and the availability of diagnostic and therapeutic radionuclides. Leveraging these advancements while combining the advantages of therapeutic and diagnostic radionuclides into one radiopharmaceutical has also created a new subfield “theranostics” in nuclear medicine that has the potential to further propel the field into the future. This session is composed of two talks; one focused on the physics principles of theranostics from properties of beta and alpha emitting radionuclides to dosimetric models and quantification; while the second describes preclinical and clinical applications of theranostics and discusses the challenges and opportunities of bringing them to the clinic. At the end of the session the listener should be able to identify: The different properties of beta and alpha emitting radionuclides Which radionuclides are selected for which nuclear medicine therapies and why How PET can be used to accurately quantify the uptake of tumor targeting molecules How individualized dosimetry can be performed from the management of thyroid cancer to novel radiolabeled antibody therapies Promising pre-clinical radiopharmaceutical pairs in prostate cancer and melanoma. Promising clinical Theranostics in neuroendocrine cancers. Challenges of bringing Theranostics to the clinic. E. Delpassand, RITA Foundation -Houston; SBIR Grant; CEO and share holder of RadioMedix.

  5. People and things. CERN Courier, September 1980, v. 20(6)

    International Nuclear Information System (INIS)

    Anon.

    1980-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events: ; At the 66th Session of the CERN Council on 27 June the project to construct a large electron-positron storage ring, known as LEP, as Europe's next major facility for high energy physics research was formally presented for the first time; A meeting, organized jointly by DESY and the Max-Planck Institute in Munich, will be held in Munich on 24-25 October for those interested in the construction and later use of the proposed HERA electron-proton colliding ring; On 19 June papers were signed at Fermilab extending the collaboration in high energy physics between the USA and China which first took formal form early in 1979; At the end of May, a second International Symposium on the History of Particle Physics was held at Fermilab; The Government of the Canadian province of Alberta has given interim funding for the conceptual design of an accelerator complex which will consist primarily of a heavy ion synchrotron giving ions up to A = 40 and 600 MeV/amu. The project has the acronym 'MARIA' — Medical Accelerator Research Institute, Alberta; On 16, 17 June a Cryogenic Workshop was held at Fermilab to focus on helium refrigeration systems for superconducting high energy accelerators. ; A few years ago, when the 5 GeV electron synchrotron NINA at the Daresbury Laboratory was in its final years of operation, the magnets of NINA seemed to be built into every new accelerator proposal then emerging in Europe. Now, with the machine closed down, the magnets remain available and Daresbury would like to see them in action again if anyone could make good use of them

  6. Helicopter Noise Definition Report UH-60A, S-76, A-109, 206-L

    Science.gov (United States)

    1981-12-01

    idealized monopole , dipole or quadrapole radiator of acoustical energy. In each case the equation is supplemented by the addition of a specific...acoustical radiation patterns are hybrids; combinations of monopoles , dipoles, quadrapoles and various other anomolous acoustical interactions...4 ft, C2-6 Mic. 6, Sideline 284m North 4 ft. C2-7 Mics. 1G, Centerline Center (Ground) C2-8 Mice 1H, Centerline Center 33 ft, C2-9 .Mic. 5G, Sideline

  7. WE-AB-206-01: Diagnostic Ultrasound Imaging Quality Assurance

    International Nuclear Information System (INIS)

    Zagzebski, J.

    2016-01-01

    The involvement of medical physicists in diagnostic ultrasound imaging service is increasing due to QC and accreditation requirements. The goal of this ultrasound hands-on workshop is to demonstrate quality control (QC) testing in diagnostic ultrasound and to provide updates in ACR ultrasound accreditation requirements. The first half of this workshop will include two presentations reviewing diagnostic ultrasound QA/QC and ACR ultrasound accreditation requirements. The second half of the workshop will include live demonstrations of basic QC tests. An array of ultrasound testing phantoms and ultrasound scanners will be available for attendees to learn diagnostic ultrasound QC in a hands-on environment with live demonstrations and on-site instructors. The targeted attendees are medical physicists in diagnostic imaging. Learning Objectives: Gain familiarity with common elements of a QA/QC program for diagnostic ultrasound imaging dentify QC tools available for testing diagnostic ultrasound systems and learn how to use these tools Learn ACR ultrasound accreditation requirements Jennifer Walter is an employee of American College of Radiology on Ultrasound Accreditation.

  8. WE-AB-206-02: ACR Ultrasound Accreditation: Requirements and Pitfalls

    International Nuclear Information System (INIS)

    Walter, J.

    2016-01-01

    The involvement of medical physicists in diagnostic ultrasound imaging service is increasing due to QC and accreditation requirements. The goal of this ultrasound hands-on workshop is to demonstrate quality control (QC) testing in diagnostic ultrasound and to provide updates in ACR ultrasound accreditation requirements. The first half of this workshop will include two presentations reviewing diagnostic ultrasound QA/QC and ACR ultrasound accreditation requirements. The second half of the workshop will include live demonstrations of basic QC tests. An array of ultrasound testing phantoms and ultrasound scanners will be available for attendees to learn diagnostic ultrasound QC in a hands-on environment with live demonstrations and on-site instructors. The targeted attendees are medical physicists in diagnostic imaging. Learning Objectives: Gain familiarity with common elements of a QA/QC program for diagnostic ultrasound imaging dentify QC tools available for testing diagnostic ultrasound systems and learn how to use these tools Learn ACR ultrasound accreditation requirements Jennifer Walter is an employee of American College of Radiology on Ultrasound Accreditation.

  9. 77 FR 3030 - Twenty-Eighth Meeting: RTCA Special Committee 206: Aeronautical Information and Meteorological...

    Science.gov (United States)

    2012-01-20

    ... and normal definitions Review proposed TOR changes ConUse Review February 7, 2012 ConUse Review... proposed TOR changes and new or modified Sub-groups' roles and responsibilities Decision to release ConUse...] BILLING CODE 4910-13-P ...

  10. 34 CFR 206.10 - What types of services may be provided?

    Science.gov (United States)

    2010-07-01

    ...) Stipends. (B) Scholarships. (C) Student travel. (D) Career-oriented work-study. (E) Books and supplies. (F... their first year of college or university. (iv) Housing support for student living in institutional... SECONDARY EDUCATION, DEPARTMENT OF EDUCATION SPECIAL EDUCATIONAL PROGRAMS FOR STUDENTS WHOSE FAMILIES ARE...

  11. 22 CFR 1203.735-206 - Economic and financial activities of employees abroad.

    Science.gov (United States)

    2010-04-01

    ... one's official title in any private business transactions or in advertisements for business purposes. (b)-(c) [Reserved] (d) Business activities of non-U.S. citizen employees. A non-U.S citizen employee abroad may engage in outside business activities with the prior approval of the head of the overseas...

  12. SU-G-206-02: Impact of Focal Spot Sizes On CT Image Quality

    International Nuclear Information System (INIS)

    Bache, S; Rong, J

    2016-01-01

    Purpose: To quantify a radiology team’s assessment of image quality differences between two CT scanner models currently in clinical use, with emphasis on spatial resolution that could be impacted by focal spot size. Methods: Modulation Transfer Functions (MTF) measurements were performed by scanning the impulse source insert module of the Catphan 600 at 120/140 kVp with both large (LFS) and small (SFS) focal spots and reconstructed to 2.5mm and 5.0mm thicknesses on a GE Discovery CT750 HD and a LightSpeed VCT CT scanner. MTFs were calculated by summing the 2D PSF along one-dimension to obtain line-spread-function (LSF), and calculating the Fourier Transform of the zero-padded and background corrected LSF. Spatial resolution performance was evaluated by comparing MTF curves, 50% and 10% MTF cutoff, and total area under the MTF curve (AUC). In addition, images of the Catphan high-contrast module and a Kagaku anthropomorphic body phantom were acquired from the HD scanner for visual comparisons. Results: For each scanner model, SFS was superior to LFS spatial resolution with respect to 50%/10% MTF cutoff and AUC. For the HD, 50%/10% cutoff was 4.29/7.22cm-1 for the LFS and 4.43/7.45cm-1 for the SFS. VCT outperformed HD, with 50%/10% cutoff of 4.40/7.29 cm-1 for LFS and 4.62/7.47cm-1 for SFS. Scanner model performance in order of decreasing AUC performance was VCT SFS (7.43), HD SFS (7.20), VCT LFS (7.09) and HD LFS (6.93). Visual evaluations of Kagaku phantom images confirmed that VCT outperformed HD. Conclusion: VCT outperformed HD and small focal spot is desired for either model over large focal spot in term of spatial resolution – in agreement with radiologist feedback of overall image quality. In-depth evaluations of clinical impact and focal spot selection mechanisms is currently being assessed.

  13. SU-D-206-04: Iterative CBCT Scatter Shading Correction Without Prior Information

    Energy Technology Data Exchange (ETDEWEB)

    Bai, Y; Wu, P; Mao, T; Gong, S; Wang, J; Niu, T [Sir Run Run Shaw Hospital, Zhejiang University School of Medicine, Institute of Translational Medicine, Zhejiang University, Hangzhou, Zhejiang (China); Sheng, K [Department of Radiation Oncology, University of California, Los Angeles, School of Medicine, Los Angeles, CA (United States); Xie, Y [Institute of Biomedical and Health Engineering, Shenzhen Institutes of Advanced Technology, Chinese Academy of Sciences, Shenzhen, Guangdong (China)

    2016-06-15

    Purpose: To estimate and remove the scatter contamination in the acquired projection of cone-beam CT (CBCT), to suppress the shading artifacts and improve the image quality without prior information. Methods: The uncorrected CBCT images containing shading artifacts are reconstructed by applying the standard FDK algorithm on CBCT raw projections. The uncorrected image is then segmented to generate an initial template image. To estimate scatter signal, the differences are calculated by subtracting the simulated projections of the template image from the raw projections. Since scatter signals are dominantly continuous and low-frequency in the projection domain, they are estimated by low-pass filtering the difference signals and subtracted from the raw CBCT projections to achieve the scatter correction. Finally, the corrected CBCT image is reconstructed from the corrected projection data. Since an accurate template image is not readily segmented from the uncorrected CBCT image, the proposed scheme is iterated until the produced template is not altered. Results: The proposed scheme is evaluated on the Catphan©600 phantom data and CBCT images acquired from a pelvis patient. The result shows that shading artifacts have been effectively suppressed by the proposed method. Using multi-detector CT (MDCT) images as reference, quantitative analysis is operated to measure the quality of corrected images. Compared to images without correction, the method proposed reduces the overall CT number error from over 200 HU to be less than 50 HU and can increase the spatial uniformity. Conclusion: An iterative strategy without relying on the prior information is proposed in this work to remove the shading artifacts due to scatter contamination in the projection domain. The method is evaluated in phantom and patient studies and the result shows that the image quality is remarkably improved. The proposed method is efficient and practical to address the poor image quality issue of CBCT images. This work is supported by the Zhejiang Provincial Natural Science Foundation of China (Grant No. LR16F010001), National High-tech R&D Program for Young Scientists by the Ministry of Science and Technology of China (Grant No. 2015AA020917).

  14. 45 CFR 206.10 - Application, determination of eligibility and furnishing of assistance.

    Science.gov (United States)

    2010-10-01

    ... desires, by an individual(s) of his choice (who need not be a lawyer) in the various aspects of the... services available, and the rights and responsibilities of applicants for and recipients of assistance...

  15. TU-H-206-03: Characterizing B1 Inhomogeneities in DCE MRI

    International Nuclear Information System (INIS)

    Gach, H; Mason, N

    2016-01-01

    Purpose: Dynamic Contrast Enhanced (DCE) MRI is a valuable technique for measuring perfusion and permeability characteristics of tumors. Exogenous contrast concentrations are calculated based on changes in T 1 measured using fast 3D gradient echo (FLASH) sequences. However, the slab selective pulses used in 3D MRI may result in B 1 inhomogeneities across the volume of interest that can lead to errors in T 1 and thus the estimated gadolinium concentration. We compared three FLASH DCE sequences (GRE, TWIST, and VIBE) to determine their signal homogeneity across slices and the accuracy in calculating T 1 using acquisitions with variable flip angles. Methods: The sequences were tested at 3 T on a Siemens mMR (VB20P) using a doped water phantom 3.75 g/L NiSO 4 - 6H 2 O + 5 g/L NaCl (T 1 = 104 ms) and a 2% agar, 0.67% NaCl phantom (T 1 = 1.71 s). 2D EPI B 1 maps and inversion recovery T 1 maps were acquired for ground truth. 3D MRI was acquired at different flip angles to generate a T 1 map. Regions of interest were drawn to measure signal inside the phantoms as a function of slice position. The T 1 for each slice ROI was fit to the FLASH steady-state model of magnetization. Results: Based on the data, GRE gave the most uniform signal homogeneity and T 1 values in the middle slices of the 3D volume. The 3D VIBE sequence had the largest region of signal inhomogeneity compared to the 3D GRE and TWIST sequences. VIBE’s B 1 inhomogeneity is inconsistent at low flip angles. However, VIBE resulted in more slices with T 1 values similar to the ground truth. Conclusion: The central 1/3 of the slices yielded signals that result in T 1 fits consistent with the ground truth. However, the remaining slices required some form of B 1 inhomogeneity correction for quantitative DCE analysis. The research was supported in part by NIH NCI Grant R01CA159471.

  16. MO-AB-206-02: Testing Gamma Cameras Based On TG177 WG Report

    International Nuclear Information System (INIS)

    Halama, J.

    2016-01-01

    This education session will cover the physics and operation principles of gamma cameras and PET scanners. The first talk will focus on PET imaging. An overview of the principles of PET imaging will be provided, including positron decay physics, and the transition from 2D to 3D imaging. More recent advances in hardware and software will be discussed, such as time-of-flight imaging, and improvements in reconstruction algorithms that provide for options such as depth-of-interaction corrections. Quantitative applications of PET will be discussed, as well as the requirements for doing accurate quantitation. Relevant performance tests will also be described. Learning Objectives: Be able to describe basic physics principles of PET and operation of PET scanners. Learn about recent advances in PET scanner hardware technology. Be able to describe advances in reconstruction techniques and improvements Be able to list relevant performance tests. The second talk will focus on gamma cameras. The Nuclear Medicine subcommittee has charged a task group (TG177) to develop a report on the current state of physics testing of gamma cameras, SPECT, and SPECT/CT systems. The report makes recommendations for performance tests to be done for routine quality assurance, annual physics testing, and acceptance tests, and identifies those needed satisfy the ACR accreditation program and The Joint Commission imaging standards. The report is also intended to be used as a manual with detailed instructions on how to perform tests under widely varying conditions. Learning Objectives: At the end of the presentation members of the audience will: Be familiar with the tests recommended for routine quality assurance, annual physics testing, and acceptance tests of gamma cameras for planar imaging. Be familiar with the tests recommended for routine quality assurance, annual physics testing, and acceptance tests of SPECT systems. Be familiar with the tests of a SPECT/CT system that include the CT images for SPECT reconstructions. Become knowledgeable of items to be included in annual acceptance testing reports including CT dosimetry and PACS monitor measurements. T. Turkington, GE Healthcare

  17. SU-D-206-07: CBCT Scatter Correction Based On Rotating Collimator

    Energy Technology Data Exchange (ETDEWEB)

    Yu, G; Feng, Z [Shandong Normal University, Jinan, Shandong (China); Yin, Y [Shandong Cancer Hospital and Institute, China, Jinan, Shandong (China); Qiang, L [Zhang Jiagang STFK Medical Device Co, Zhangjiangkang, Suzhou (China); Li, B [Shandong Academy of Medical Sciences, Jinan, Shandong provice (China); Huang, P [Shandong Province Key Laboratory of Medical Physics and Image Processing Te, Ji’nan, Shandong province (China); Li, D [School of Physics and Electronics, Shandong Normal University, Jinan, Shandong (China)

    2016-06-15

    Purpose: Scatter correction in cone-beam computed tomography (CBCT) has obvious effect on the removal of image noise, the cup artifact and the increase of image contrast. Several methods using a beam blocker for the estimation and subtraction of scatter have been proposed. However, the inconvenience of mechanics and propensity to residual artifacts limited the further evolution of basic and clinical research. Here, we propose a rotating collimator-based approach, in conjunction with reconstruction based on a discrete Radon transform and Tchebichef moments algorithm, to correct scatter-induced artifacts. Methods: A rotating-collimator, comprising round tungsten alloy strips, was mounted on a linear actuator. The rotating-collimator is divided into 6 portions equally. The round strips space is evenly spaced on each portion but staggered between different portions. A step motor connected to the rotating collimator drove the blocker to around x-ray source during the CBCT acquisition. The CBCT reconstruction based on a discrete Radon transform and Tchebichef moments algorithm is performed. Experimental studies using water phantom and Catphan504 were carried out to evaluate the performance of the proposed scheme. Results: The proposed algorithm was tested on both the Monte Carlo simulation and actual experiments with the Catphan504 phantom. From the simulation result, the mean square error of the reconstruction error decreases from 16% to 1.18%, the cupping (τcup) from 14.005% to 0.66%, and the peak signal-to-noise ratio increase from 16.9594 to 31.45. From the actual experiments, the induced visual artifacts are significantly reduced. Conclusion: We conducted an experiment on CBCT imaging system with a rotating collimator to develop and optimize x-ray scatter control and reduction technique. The proposed method is attractive in applications where a high CBCT image quality is critical, for example, dose calculation in adaptive radiation therapy. We want to thank Dr. Lei Xing and Dr. Yong Yang in the Stanford University School of Medicine for this work. This work was jointly supported by NSFC (61471226), Natural Science Foundation for Distinguished Young Scholars of Shandong Province (JQ201516), and China Postdoctoral Science Foundation (2015T80739, 2014M551949).

  18. Sexospécificités | Page 206 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Langue English. La culture illicite du pavot à opium contribue à la subsistance de millions de paysans afghans, mais il se trouve qu'elle constitue également une source de revenus importants pour les bandes criminalisées. Read more about La culture du pavot à opium : quelle politique pour l'Afghanistan ? Langue French.

  19. 42 CFR 420.206 - Disclosure of persons having ownership, financial, or control interest.

    Science.gov (United States)

    2010-10-01

    ... paragraph (a)(1) of this section, is related to another as spouse, parent, child, or sibling. (3) The name... ownership or control interest or position as managing employee, and the nature of the relationship with the...

  20. 5 CFR 591.206 - How does OPM establish COLA areas?

    Science.gov (United States)

    2010-01-01

    ... ALLOWANCES AND DIFFERENTIALS Cost-of-Living Allowance and Post Differential-Nonforeign Areas Cost-Of-Living... where agencies pay employees a COLA by virtue of living costs that are substantially higher than those...

  1. TH-AB-206-00: Challenges and Opportunities for Nuclear Medicine Theranostics

    International Nuclear Information System (INIS)

    2016-01-01

    In the past few decades, the field of nuclear medicine has made long strides with the continued advancement of related sciences and engineering and the availability of diagnostic and therapeutic radionuclides. Leveraging these advancements while combining the advantages of therapeutic and diagnostic radionuclides into one radiopharmaceutical has also created a new subfield “theranostics” in nuclear medicine that has the potential to further propel the field into the future. This session is composed of two talks; one focused on the physics principles of theranostics from properties of beta and alpha emitting radionuclides to dosimetric models and quantification; while the second describes preclinical and clinical applications of theranostics and discusses the challenges and opportunities of bringing them to the clinic. At the end of the session the listener should be able to identify: The different properties of beta and alpha emitting radionuclides Which radionuclides are selected for which nuclear medicine therapies and why How PET can be used to accurately quantify the uptake of tumor targeting molecules How individualized dosimetry can be performed from the management of thyroid cancer to novel radiolabeled antibody therapies Promising pre-clinical radiopharmaceutical pairs in prostate cancer and melanoma. Promising clinical Theranostics in neuroendocrine cancers. Challenges of bringing Theranostics to the clinic. E. Delpassand, RITA Foundation -Houston; SBIR Grant; CEO and share holder of RadioMedix.

  2. 44 CFR 206.110 - Federal assistance to individuals and households.

    Science.gov (United States)

    2010-10-01

    ... emergency. FEMA will adjust the $25,000 limit annually to reflect changes in the Consumer Price Index (CPI) for All Urban Consumers that the Department of Labor publishes. (c) Multiple types of assistance. One..., convenience to the individuals and households and the suitability and availability of the types of assistance...

  3. 17 CFR 275.206(4)-3 - Cash payments for client solicitations.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Cash payments for client... for client solicitations. (a) It shall be unlawful for any investment adviser required to be... client at the time of the solicitation or referral; or (iii) Other than a solicitor specified in...

  4. : tous les projets | Page 206 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: Capacity building, Science and Technology, MEDIA, FRENCH SPEAKING AFRICA, JOURNALISM, COMPUTER NETWORKS, BUSINESS ORGANIZATION. Région: Middle East, North of Sahara, South of Sahara, Central Asia, Far East Asia, South Asia. Programme: Économies en réseaux. Financement total : CA$ ...

  5. 31 CFR 598.206 - Holding of funds in interest-bearing accounts; investment and reinvestment.

    Science.gov (United States)

    2010-07-01

    ... a money market fund or in U.S. Treasury bills. (2) For purposes of this section, a rate is... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Holding of funds in interest-bearing... same. (c) Blocked funds held in instruments the maturity of which exceeds 180 days at the time the...

  6. 19 CFR 206.17 - Limited disclosure of certain confidential business information under administrative protective...

    Science.gov (United States)

    2010-04-01

    ... along with such person's partners, associates, employer, and employees, for up to seven years following...; (3) In the case of an attorney, accountant, or other professional, referral to the ethics panel of...

  7. Training of U.S. Air Traffic Controllers. (IDA Report No. R-206).

    Science.gov (United States)

    Henry, James H.; And Others

    The report reviews the evolution of existing national programs for air traffic controller training, estimates the number of persons requiring developmental and supplementary training, examines present controller selection and training programs, investigates performance measurement methods, considers standardization and quality control, discusses…

  8. 42 CFR 57.206 - Eligibility and selection of health professions student loan applicants.

    Science.gov (United States)

    2010-10-01

    ... AND HUMAN SERVICES GRANTS GRANTS FOR CONSTRUCTION OF TEACHING FACILITIES, EDUCATIONAL IMPROVEMENTS....) applicants, and determine the amount of student loans by considering: (1) The financial resources available... other resources available to the student through the school. For purposes of establishing priority for...

  9. 30 CFR 206.354 - How do I determine generating deductions?

    Science.gov (United States)

    2010-07-01

    ... depreciation method based on the life of the geothermal project, usually the term of the electricity sales... specifications of the power conversion cycle. (2)(i) You may include a return on capital you invested in the...

  10. 14 CFR 206.3 - Transportation of newspersons by all-cargo carriers.

    Science.gov (United States)

    2010-01-01

    ... collecting data for preparation of feature news, pictorial or like articles provided that the transportation... feature news, pictorial, or like articles which are to appear in newspapers or magazines, or on radio or...

  11. 30 CFR 206.180 - How do I determine an actual processing allowance?

    Science.gov (United States)

    2010-07-01

    ... lessor to market the production for the mutual benefit of you and the lessor, then MMS will require that... maintenance expenses, overhead, and either depreciation and a return on undepreciated capital investment (in... allowable expenses. (iv) You may use either depreciation with a return on undepreciable capital investment...

  12. 30 CFR 206.359 - How do I determine byproduct transportation allowances?

    Science.gov (United States)

    2010-07-01

    ... the production for the mutual benefit of the lessee and the lessor, MMS will require you to determine... under paragraph (f) of this section; and either (3) Depreciation under paragraphs (g) and (h) of this... compute depreciation, you must use a straight-line depreciation method based on either the life of the...

  13. 30 CFR 206.171 - What definitions apply to this subpart?

    Science.gov (United States)

    2010-07-01

    ... United States or who holds title subject to Federal restriction against alienation. Indian tribe means... restriction against alienation. Lease means any contract, profit-share arrangement, joint venture, or other...

  14. 30 CFR 206.51 - What definitions apply to this subpart?

    Science.gov (United States)

    2010-07-01

    ... Federal restriction against alienation. Individual Indian mineral owner means any Indian for whom minerals... Federal restriction against alienation. Lease means any contract, profit-share arrangement, joint venture...

  15. 42 CFR 3.206 - Confidentiality of patient safety work product.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Confidentiality of patient safety work product. 3... individually identifiable health information in such patient safety work product, the direct identifiers listed at 45 CFR 164.514(e)(2) have been removed. (5) Disclosure of nonidentifiable patient safety work...

  16. 30 CFR 206.178 - How do I determine a transportation allowance?

    Science.gov (United States)

    2010-07-01

    ... on undepreciated capital investment (in accordance with paragraph (b)(2)(iv)(A) of this section), or... depreciation with a return on undepreciated capital investment or a return on depreciable capital investment... undepreciated capital investment, you will multiply the undepreciated capital investment in the transportation...

  17. 30 CFR 206.353 - How do I determine transmission deductions?

    Science.gov (United States)

    2010-07-01

    ...) Depreciation under paragraphs (g) and (h) of this section and a return on undepreciated capital investment under paragraphs (g) and (i) of this section or (iv) A return on the capital investment in the..., are not allowable expenses. (g) To compute costs associated with capital investment, a lessee may use...

  18. 32 CFR 206.1 - Major characteristics of the NSEP institutional grants program.

    Science.gov (United States)

    2010-07-01

    ... international relationships and worked and studied along-side foreign experts. (3) To develop a cadre of... curricula which: (1) Improves the quality and infrastructure of international education; (2) Addresses... used to strengthen the national capacity in international education. While “operational” support for...

  19. 34 CFR 206.5 - What definitions apply to these programs?

    Science.gov (United States)

    2010-07-01

    ... ENGAGED IN MIGRANT AND OTHER SEASONAL FARMWORK-HIGH SCHOOL EQUIVALENCY PROGRAM AND COLLEGE ASSISTANCE...; or (C) Is beyond the age of compulsory school attendance in that State and has the ability to benefit... awards a bachelor's degree; or (B) At least a two-year program that is acceptable for full credit toward...

  20. 78 FR 51808 - 34th Meeting: RTCA Special Committee 206, Aeronautical Information and Meteorological Data Link...

    Science.gov (United States)

    2013-08-21

    ... to Support ATC Winds SC-214 Briefing TOR Changes Other business Sub-Groups meetings Sep 24-26... MET Delivery Architecture Recommendations review Sep 27, Friday, Closing Plenary Sub-Groups reports Appoval for AIS and MET Delivery Architecture Recommendations document to enter FRAC Action item review...