WorldWideScience

Sample records for astatine 205

  1. Organic chemistry of astatine

    International Nuclear Information System (INIS)

    The paper surveys the investigations on the chemical behaviour of astatine in organic systems and deals with the preparation and identification of its organic compounds. A discussion is given on some of the physico-chemical properties of these compounds determined by extrapolation techniques as well as by direct measurement. The biomedical importance of 211At-labelled compounds is briefly referred to. (authors)

  2. Bibliography of astatine chemistry and biomedical applications

    International Nuclear Information System (INIS)

    An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)

  3. Astatine-211: production and availability.

    Science.gov (United States)

    Zalutsky, Michael R; Pruszynski, Marek

    2011-07-01

    The 7.2-h half life radiohalogen (211)At offers many potential advantages for targeted α-particle therapy; however, its use for this purpose is constrained by its limited availability. Astatine-211 can be produced in reasonable yield from natural bismuth targets via the (209)Bi(α,2n)(211)At nuclear reaction utilizing straightforward methods. There is some debate as to the best incident α-particle energy for maximizing 211At production while minimizing production of (210)At, which is problematic because of its 138.4-day half life α-particle emitting daughter, (210)Po. The intrinsic cost for producing (211)At is reasonably modest and comparable to that of commercially available (123)I. The major impediment to (211)At availability is attributed to the need for a medium energy α-particle beam for its production. On the other hand, there are about 30 cyclotrons in the world that have the beam characteristics required for (211)At production. PMID:22201707

  4. Recent advances in the organic chemistry of astatine

    International Nuclear Information System (INIS)

    Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211At species, 211At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs

  5. Dosimetrical considerations in astatine-211 radioimmunotherapy

    International Nuclear Information System (INIS)

    Several dosimetrical quantities have been suggested for use in alpha-particle dosimetry. To evaluate the expected biological effect when using these quantities, a Monte Carlo program was set to register the single-event distribution of both specific energy and alpha-particle track length to a cell nucleus (r=5.6 μm). Distributions were acquired for both 'bound' (simulating the effect of 211At-labelled antibodies bound to antigens on cell surfaces (r=7.0 μm)) as well as 'non-bound' (simulating 211At-labelled antibodies that have not bound to a cell) astatine-211. From these distributions, various theoretical cell survival curves were established for 3 different dosimetrical quantities, i.e. specific energy, number of alpha-particle hits and total track length. The survival curves for all quantities are presented for the corresponding mean absorbed dose in order to facilitate comparisons of the expected effects of using the 3 different quantities for both distributions of 211At decays. The theoretical survival curves presented here could, combined with experiments using 'bound' and 'non-bound' 211At in a single-cell suspension, reveal which dosimetrical quantity is most suitable for 211 At-radioimmunotherapy. (author)

  6. Discovery of the astatine, radon, francium, and radium isotopes

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  7. Extraction of astatine isotopes for development of radiopharmaceuticals using a 211Rn-211At generator

    International Nuclear Information System (INIS)

    In order to utilize a 211At isotope, a promising α-emitter for radionuclide therapy, the chemical properties of astatine isotopes are studied. We have examined wet chemistry methods through the distribution ratios of astatine in liquid-liquid extraction. The astatine isotopes have been found to be well extracted into DIPE and MIBK. We observed that the distribution ratio of astatine isotopes increases with concentrations of HCl greater than 3 M, while it decreases with the HCl concentration less than 2 M. The results will be useful for development of the 211Rn-211At generator. (author)

  8. Astatine-211-Labeled Targeted Radiotherapeutics: An Update

    International Nuclear Information System (INIS)

    The heavy halogen 211At was first proposed for use in α-particle targeted radiotherapy more than 30 years ago and continues to be one of the most promising radionuclides for this purpose. Although its 7.2-h half life is not ideal for intravenously administered whole antibodies, it is compatible with the pharmacokinetics of antibody fragments, peptides, aptamers and organic molecules. Its diverse chemistry allows its incorporation into a wide array of targeting vehicles, relying on its chemical similarity to iodine to provide a useful point of departure. On the other hand, the relatively low carbon-astatine bond strength is challenging. In common with the other α-emitters being discussed at this symposium, lack of reliable availability is one of the biggest hurdles in the use of 211At for targeted radiotherapy. However, in the case of 211At, it is not a question of production cost or availability of target material, because 211At can be produced in reasonable yield from natural bismuth targets. Rather, the difficulty is the lack of cyclotrons equipped with the medium energy α-particle beams required for its production. If the infrastructure for producing 211At is to be improved to the stage where 211At-labeled radiopharmaceuticals can have a meaningful impact, several developments must occur. First, the ability to produce clinically relevant levels of 211At that can be shipped to remote locations in chemically tractable form must be demonstrated. Approaches under consideration include compensating for radiolysis-mediated effects and the consideration of alternative chemistries. Second, strategies for compensating for heterogeneities in dose deposition must be developed, hopefully in a way that is compatible with approval for human use. And third, it is essential that more clinical trials be performed with 211At-labeled therapeutics, particularly in settings of minimum residual disease where the radiobiological advantages of α-particles can be best exploited. Our

  9. Scrutinizing "Invisible" astatine: A challenge for modern density functionals.

    Science.gov (United States)

    Sergentu, Dumitru-Claudiu; David, Grégoire; Montavon, Gilles; Maurice, Rémi; Galland, Nicolas

    2016-06-01

    The main-group 6p elements did not receive much attention in the development of recent density functionals. In many cases it is still difficult to choose among the modern ones a relevant functional for various applications. Here, we illustrate the case of astatine species (At, Z = 85) and we report the first, and quite complete, benchmark study on several properties concerning such species. Insights on geometries, transition energies and thermodynamic properties of a set of 19 astatine species, for which reference experimental or theoretical data has been reported, are obtained with relativistic (two-component) density functional theory calculations. An extensive set of widely used functionals is employed. The hybrid meta-generalized gradient approximation (meta-GGA) PW6B95 functional is overall the best choice. It is worth noting that the range-separated HSE06 functional as well as the old and very popular B3LYP and PBE0 hybrid-GGAs appear to perform quite well too. Moreover, we found that astatine chemistry in solution can accurately be predicted using implicit solvent models, provided that specific parameters are used to build At cavities. © 2016 Wiley Periodicals, Inc. PMID:27059181

  10. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  11. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates.

    Science.gov (United States)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Svedhem, Sofia; Lindegren, Sture

    2016-03-16

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single cancer cells. A promising radioactive nuclide for this type of therapy is astatine-211. Astatine-211 attached to tumor-specific antibodies as carrier molecules is a system currently under investigation for use in targeted alpha therapy. In the common radiolabeling procedure, astatine is coupled to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies. PMID:26791409

  12. IT 205 Uop Material - it205dotcom

    OpenAIRE

    honey

    2015-01-01

    IT 205 Entire Course For more course tutorials visit www.uopit205.com   IT 205 Week 1 CheckPoint Systems Development Life Cycle  IT 205 Week 1 DQ 1 and DQ 2  IT 205 Week 2 CheckPoint Personal Computer Hardware Matrix  IT 205 Week 2 Assignment Computer Systems Scenarios  IT 205 Week 3 DQ 1 and DQ 2  IT 205 Week 3 CheckPoint Operating Systems  IT 205 Week 4 Exercise Potential IT Professions – Part 1  ...

  13. Astatine-211: production, injection into monoclonal antibodies radiological effect, possible application to cancer treatment

    International Nuclear Information System (INIS)

    Methods developed in the Laboratory of Nuclear Problems, JINR, for producing astatine-211 and injecting it into monoclonal antibodies are described. The use of its diethylene triamine penta-acetic acid complex is shown to be the most effective method of injecting astatine into a biomolecules. The biological effect of the α-particles emitted from the astatine-211 is investigated using Chinese hamster fibroblasts and Ehrlich carcinoma cells. It is established that the mitotic activity depression, number of degenerating cells, number of cells with chromosome aberrations, and cellular surviving fraction depend on the concentration of the radionuclide in the medium 'in vitro'. The RBE of α-particles in comparison with 60Co γ-rays is 3. Injection of astatine-211 absorbed on tellurium particles into mice with ascitic tumors resulted in prolongation of their life or elimination of the tumors. (author). 39 refs, 7 figs

  14. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    OpenAIRE

    Rothe, S.; A. N. Andreyev; Antalic, S; Borschevsky, A.; Capponi, L.; Cocolios, T.E.; Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the io...

  15. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    Science.gov (United States)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-07-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and physical properties for use in targeted therapies for cancer. Due to the very short range of the emitted α-particles, this therapy is particularly suited to treating occult, disseminated cancers. Astatine is not intrinsically tumour-specific; therefore, it requires an appropriate tumour-specific targeting vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method that combines dry distillation of astatine-211 and a synthesis module for producing radiopharmaceuticals into a process platform. This platform will standardize production of astatinated radiopharmaceuticals, and hence, it will facilitate large clinical studies focused on this promising, but chemically challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies.

  16. 9 CFR 205.205 - Fees.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Fees. 205.205 Section 205.205 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE CLEAR TITLE-PROTECTION FOR PURCHASERS OF FARM PRODUCTS...

  17. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-01-01

    vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method......To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....

  18. Study of Astatine (III) reactions with O, S and N ligands in solution

    International Nuclear Information System (INIS)

    Full text of publication follows. Astatine (At, Z=85: [Xe]4f145d106s26p5) belongs to the halogen group and is located below iodine in the periodic table. One of its isotopes (211At) appears promising as a therapeutic agent in nuclear medicine (Ref.1) owing to the energy of the alpha particles emitted during the disintegration of its nucleus and its short physical half-life (7.2 h). Since there are no stable isotopes of astatine, the chemistry of this element remains poorly understood. Generally, At is supposed to behave as a halogen (Ref.2) but it has been shown recently in our group that astatine presents a metallic behaviour in aqueous solution: it notably exists as At+ and AtO+ species under the oxidation states +I and +III (Ref.3). At the present time, the number of studies dealing with the complexation properties of the cationic forms of astatine remains limited (Ref.4), owing to its low availability. In this work, we have investigated the reactions of AtO+ species with different hetero-atomic (N, S, O) model ligands. A combined approach based on experimental and theoretical studies has been used (Ref.5). On account of the difficulties of experimental investigations of astatine species, the reactivity of AtO+ was explored using a competition method founded on astatine distributions between two distinct phases. Furthermore, for each AtO+/ ligand complex, the nature of the species formed and the associated thermodynamic constants were determined by computational modeling (DFT calculations). In this framework, an original computational methodology was developed to take into account the specificities of astatine, notably the associated relativistic effects. The computed equilibrium constants have been confronted with the experimental results. This comparison demonstrates an outstanding coherence between experience and theory. Furthermore, the analysis of the results shows a key role of solvent effects on astatine chemistry. Lastly, a specific reactivity for the

  19. Some aspects of the organic, biological and inorganic chemistry of astatine

    International Nuclear Information System (INIS)

    Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments (209At, 210At, 211At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)

  20. Astatine-211 Pathway from Radiochemistry to Clinical Investigation

    International Nuclear Information System (INIS)

    Particularly in clinical settings where tumour burden is low and cancers are located in close proximity to essential normal tissue structures, α-particle emitting radionuclides can offer significant advantages for targeted radionuclide therapy. One of the first alpha emitters to be evaluated for this purpose is the 7.2-h half-life radiohalogen Astatine-211 (211At). From a commercialization-potential perspective 211At, is less appealing than the longer half-life alpha particle emitters Radium-223, Actinium-225 and Thorium-227, which have become the focus of many laboratories. However, if methods for providing a better supply of 211At could be developed, this alpha emitter would be the radionuclide of choice for many potential therapeutic applications. With regard to the production of 211At, this can be readily be accomplished by bombarding natural bismuth targets with 28−29.5 MeV alpha particles via the 209Bi(α,2n)211At reaction. The goal is to utilize an alpha particle beam energy that provides the required balance for maximizing 211At production while minimizing creation of 210At, which is problematic because of its 138.4-day half life alpha-particle emitting daughter, 210Po. For most intended clinical applications, alpha particle beam energy of about 29 MeV offers the best compromise between maximizing yield and providing 211At with sufficient radionuclidic purity for clinical use. Clinically relevant levels of 211At have been produced at several institutions using both internal and external cyclotron targets

  1. ASH ACC 205 NEW Tutorials /ashacc205dotcom

    OpenAIRE

    yamini63

    2015-01-01

    ACC 205 Entire Course(New)   For more course tutorials visit www.ashacc205.com   ACC 205 Week 1 DQ 1 Accounting Equation ACC 205 Week 1 DQ 2 Accounts ACC 205 Week 1 Journal Balance Sheet Journal ACC 205 Week 2 DQ 1 Accounting Cycle ACC 205 Week 2 DQ 2 Bank Reconciliation ACC 205 Week 2 Journal Income Statement Journal ACC 205 Week 3 DQ 1 LIFO vs. FIFO ACC 205 Week 3 DQ 2 Depreciation ACC 205 Week 3 Journal Inventory Journal ACC...

  2. ACC 205 NEW TUTORIAL / Uoptutorial

    OpenAIRE

    Richard

    2015-01-01

    For more course tutorials visit www.uoptutorial.com   ACC 205 Week 1 DQ 1 Accounting Equation   ACC 205 Week 1 DQ 2 Accounts   ACC 205 Week 1 Journal Balance Sheet Journal   ACC 205 Week 2 DQ 1 Accounting Cycle   ACC 205 Week 2 DQ 2 Bank Reconciliation   ACC 205 Week 2 Journal Income Statement Journal   ACC 205 Week 3 DQ 1 LIFO vs. FIFO   ACC 205 Week 3 DQ 2 Depreciation   ...

  3. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  4. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    International Nuclear Information System (INIS)

    A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)

  5. Labelling prospects of astatine-211 with immunoglobulins (IgG): some general considerations

    International Nuclear Information System (INIS)

    The tumour therapeutic potential of the short lived alpha emitting radiohalogen 211At has been already been well recognised in the field of radioimmuno therapy. There is no evidence as such to show that astatine itself is a tumour seeking isotope. Therefore it has to be tagged to tumour seeking compound such as a drug or a protein preferably an antibody (IgG). In this communication, the labelling parameters which are required to be investigated for obtaining a stable product which could be useful as radioimmuno therapeutic agent, are described. (author). 6 refs

  6. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron anity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photodetachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral linewidth of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in o-line tests by the clear observation of the photodetachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148 [1].

  7. Extraction of 211At-astatine from hydrochloric acid solutions by means of TOPO, TBP, and triphenylphosphine

    International Nuclear Information System (INIS)

    The extraction behaviour of astatine was studied under defined conditions from hydrochloride acid solutions (cHCl>0.1 M or 1 and 2M). Therefore other effects like adsorption, reduction or hydrolysis can be excluded. The present work describes the extraction with tri- n- octylphosphinoxide (TOPO), tri- n-butylphosphate (TBP) and tri-phenylphosphine in chloroform. (orig.)

  8. No-carrier-added astatination of N-succinimidyl-3-(tri-n-butylstannyl) benzoate (ATE) via electrophilic destannylation

    International Nuclear Information System (INIS)

    The no-carrier-added synthesis of N-succinimidyl 3-[211At]astato-benzoate from N-succinimidyl 3-(tri-n-butylstannyl)benzoate (ATE) is described. The nature of the solvent in which the 211At was isolated from the target was an important factor influencing both the radiochemical yields and the nature of the incorporated astatine activity. (orig.)

  9. 211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    211At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At- to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At- anions, but first of all because of the kinetic inertness of low spin rhodium(III) d6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh3+. The experiments related to optimization of the reaction conditions were performed with the 131I, basing on a chemical similarity of I- to At-. The experiments with 211At were then carried out under the conditions found optimal for I-. The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211At-Rh(16-S4-diol) complex

  10. ACC 205 NEW ASH Tutorial / Uoptutorial

    OpenAIRE

    Albert Camus

    2015-01-01

    For more course tutorials visit www.uoptutorial.com   ACC 205 Week 1 DQ 1 Accounting Equation   ACC 205 Week 1 DQ 2 Accounts   ACC 205 Week 1 Journal Balance Sheet Journal   ACC 205 Week 2 DQ 1 Accounting Cycle   ACC 205 Week 2 DQ 2 Bank Reconciliation   ACC 205 Week 2 Journal Income Statement Journal   ACC 205 Week 3 DQ 1 LIFO vs. FIFO   ACC 205 Week 3 DQ 2 Depreciation   ...

  11. ACC 205new Course Tutorial / tutorialrank

    OpenAIRE

    welcome8888

    2015-01-01

    For more course tutorials visit www.tutorialrank.com Tutorial Purchased: 5 Times, Rating: A+ ACC 205 Week 1 DQ 1 Accounting Equation   ACC 205 Week 1 DQ 2 Accounts   ACC 205 Week 1 Journal Balance Sheet Journal   ACC 205 Week 2 DQ 1 Accounting Cycle   ACC 205 Week 2 DQ 2 Bank Reconciliation   ACC 205 Week 2 Journal Income Statement Journal   ACC 205 Week 3 DQ 1 LIFO vs. FIFO   ACC 205 Week 3...

  12. ACC 205 NEW Tutorial Course/Uoptutorial

    OpenAIRE

    neha

    2015-01-01

    For More Course Tutorials Visit www.uoptutorial.com   ACC 205 Week 1 DQ 1 Accounting Equation   ACC 205 Week 1 DQ 2 Accounts   ACC 205 Week 1 Journal Balance Sheet Journal   ACC 205 Week 2 DQ 1 Accounting Cycle   ACC 205 Week 2 DQ 2 Bank Reconciliation   ACC 205 Week 2 Journal Income Statement Journal   ACC 205 Week 3 DQ 1 LIFO vs. FIFO   ACC 205 Week 3 DQ 2 Depreciation   ...

  13. ACC 205 NEW Course Tutorial / Tutorialrank

    OpenAIRE

    charles

    2015-01-01

    For more course tutorials visit www.tutorialrank.com Tutorial Purchased: 5 Times, Rating: A+ ACC 205 Week 1 DQ 1 Accounting Equation   ACC 205 Week 1 DQ 2 Accounts   ACC 205 Week 1 Journal Balance Sheet Journal   ACC 205 Week 2 DQ 1 Accounting Cycle   ACC 205 Week 2 DQ 2 Bank Reconciliation   ACC 205 Week 2 Journal Income Statement Journal   ACC 205 Week 3 DQ 1 LIFO vs. FIFO   ACC 205 Week 3...

  14. ACC 205 ASH Tutorial/Uoptutorial

    OpenAIRE

    Stella,, Maurizio

    2015-01-01

    For more course tutorials visit www.uoptutorial.com   ACC 205 Week 1 DQ 1 Accounting Equation  ACC 205 Week 1 DQ 2 Accounts  ACC 205 Week 1 Journal Balance Sheet Journal  ACC 205 Week 2 DQ 1 Accounting Cycle  ACC 205 Week 2 DQ 2 Bank Reconciliation  ACC 205 Week 2 Journal Income Statement Journal  ACC 205 Week 3 DQ 1 LIFO vs. FIFO  ACC 205 Week 3 DQ 2 Depreciation  ACC 205 Week 3 Journal Inventory Journal...

  15. 48 CFR 31.205-7 - Contingencies.

    Science.gov (United States)

    2010-10-01

    ... REQUIREMENTS CONTRACT COST PRINCIPLES AND PROCEDURES Contracts With Commercial Organizations 31.205-7... negotiation of appropriate contractual coverage. (See, for example, 31.205-6(g) and 31.205-19.)...

  16. ECO 205 ASH COURSES TUTORIAL/UOPHELP

    OpenAIRE

    ulfaa123

    2015-01-01

    For more course tutorials visit www.uophelp.com   ECO 205 Week 1 CheckPoint Principles of Economics ECO 205 Week 1 DQ 1 and DQ 2 ECO 205 Week 2 CheckPoint Industry Research Part I ECO 205 Week 2 Assignment Supply and Demand (appendix C) ECO 205 Week 3 CheckPoint Industry Research Part II (appendix B) ECO 205 Week 3 DQ 1 and DQ 2 ECO 205 Week 4 CheckPoint International Trade Debate Part I ECO 205 Week 4 CheckPoint International Trade Debate Part &nb...

  17. ECO 205 ASH COURSE Tutorial/UOPHELP

    OpenAIRE

    JOHNY

    2015-01-01

    For more course tutorials visit www.uophelp.com   ECO 205 Week 1 CheckPoint Principles of Economics ECO 205 Week 1 DQ 1 and DQ 2 ECO 205 Week 2 CheckPoint Industry Research Part I ECO 205 Week 2 Assignment Supply and Demand (appendix C) ECO 205 Week 3 CheckPoint Industry Research Part II (appendix B) ECO 205 Week 3 DQ 1 and DQ 2 ECO 205 Week 4 CheckPoint International Trade Debate Part I ECO 205 Week 4 CheckPoint International Trade Debate Part &nb...

  18. ECO 205 uop course tutorial/tutorialoutlet

    OpenAIRE

    naresh 1

    2015-01-01

    For more course tutorials visit www.tutorialoutlet.com     ECO 205 Week 1 CheckPoint Principles of Economics ECO 205 Week 1 DQ 1 and DQ 2 ECO 205 Week 2 CheckPoint Industry Research Part I ECO 205 Week 2 Assignment Supply and Demand (appendix C) ECO 205 Week 3 CheckPoint Industry Research Part II (appendix B) ECO 205 Week 3 DQ 1 and DQ 2 ECO 205 Week 4 CheckPoint International Trade Debate Part I ECO 205 Week 4 CheckPoint International Tra...

  19. Unexpected Behavior of the Heaviest Halogen Astatine in the Nucleophilic Substitution of Aryliodonium Salts.

    Science.gov (United States)

    Guérard, François; Lee, Yong-Sok; Baidoo, Kwamena; Gestin, Jean-François; Brechbiel, Martin W

    2016-08-22

    Aryliodonium salts have become precursors of choice for the synthesis of (18) F-labeled tracers for nuclear imaging. However, little is known on the reactivity of these compounds with heavy halides, that is, radioiodide and astatide, at the radiotracer scale. In the first comparative study of radiohalogenation of aryliodonium salts with (125) I(-) and (211) At(-) , initial experiments on a model compound highlight the higher reactivity of astatide compared to iodide, which could not be anticipated from the trends previously observed within the halogen series. Kinetic studies indicate a significant difference in activation energy (Ea =23.5 and 17.1 kcal mol(-1) with (125) I(-) and (211) At(-) , respectively). Quantum chemical calculations suggest that astatination occurs via the monomeric form of an iodonium complex whereas iodination occurs via a heterodimeric iodonium intermediate. The good to excellent regioselectivity of halogenation and high yields achieved with diversely substituted aryliodonium salts indicate that this class of compounds is a promising alternative to the stannane chemistry currently used for heavy radiohalogen labeling of tracers in nuclear medicine. PMID:27305065

  20. 32 CFR 205.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 205.5 Section 205.5 National... USE CERTIFICATES (EUCs) § 205.5 Responsibilities. (a) The Under Secretary of Defense (Acquisition... in § 205.6. This responsibility may not be delegated by the Directors of Defense Agencies; it may...

  1. 7 CFR 205.301 - Product composition.

    Science.gov (United States)

    2010-01-01

    ... nature of the product only as provided in § 205.305. (e) Livestock feed. (1) A raw or processed livestock... 7 Agriculture 3 2010-01-01 2010-01-01 false Product composition. 205.301 Section 205.301... PROVISIONS NATIONAL ORGANIC PROGRAM Labels, Labeling, and Market Information § 205.301 Product...

  2. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  3. Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

    CERN Document Server

    Andreyev, Andrei

    2013-01-01

    Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

  4. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  5. 49 CFR 571.205 - Standard No. 205, Glazing materials.

    Science.gov (United States)

    2010-10-01

    ... the possibility of occupants being thrown through the vehicle windows in collisions. S3.Application..., multipurpose passenger vehicles, trucks, buses, motorcycles, slide-in campers, pickup covers designed to carry... manufacturer may, at its option, comply with 49 CFR 571.205(a) of this section. S3.2Incorporation by...

  6. ACC 205 NEW Ash Course tutorial/uophelp

    OpenAIRE

    RGNSDD

    2015-01-01

    ACC 205 Week 1 DQ 1 Accounting Equation ACC 205 Week 1 DQ 2 Accounts ACC 205 Week 1 Exercise Assignment Basic Accounting Equations ACC 205 Week 1 Journal Balance Sheet Journal ACC 205 Week 2 DQ 1 Accounting Cycle ACC 205 Week 2 DQ 2 Bank Reconciliation ACC 205 Week 2 Exercise Assignment Revenue and Expenses ACC 205 Week 2 Journal Income Statement Journal ACC 205 Week 3 DQ 1 LIFO vs ACC 205 Week 3 DQ 2 Depreciation ACC 205 Week 3 Exercise Assignment Inventory A...

  7. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  8. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  9. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    International Nuclear Information System (INIS)

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  10. 48 CFR 1443.205 - Contract clauses.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clauses. 1443.205 Section 1443.205 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR CONTRACT MANAGEMENT CONTRACT MODIFICATIONS Change Orders 1443.205 Contract clauses. BPCs may establish procedures,...

  11. 48 CFR 17.205 - Documentation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Documentation. 17.205 Section 17.205 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 17.205 Documentation. (a) The...

  12. 21 CFR 205.7 - Personnel.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Personnel. 205.7 Section 205.7 Food and Drugs FOOD... FOR STATE LICENSING OF WHOLESALE PRESCRIPTION DRUG DISTRIBUTORS § 205.7 Personnel. The State licensing authority shall require that personnel employed in wholesale distribution have appropriate education...

  13. 40 CFR 240.205-1 - Requirement.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Requirement. 240.205-1 Section 240.205-1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE THERMAL PROCESSING OF SOLID WASTES Requirements and Recommended Procedures § 240.205-1...

  14. 20 CFR 655.205 - Recruitment period.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Recruitment period. 655.205 Section 655.205... Agricultural Employment § 655.205 Recruitment period. (a) If the OFLC Administrator determines that the... carry out the assurances contained in § 655.203 with respect to the recruitment of U.S. workers....

  15. 40 CFR 91.205 - Banking.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Banking. 91.205 Section 91.205... EMISSIONS FROM MARINE SPARK-IGNITION ENGINES Averaging, Banking, and Trading Provisions § 91.205 Banking. (a... banking. (i) For outboard engines in model year (MY) 1997, a manufacturer may bank positive...

  16. 40 CFR 90.205 - Banking.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Banking. 90.205 Section 90.205... EMISSIONS FROM NONROAD SPARK-IGNITION ENGINES AT OR BELOW 19 KILOWATTS Certification Averaging, Banking, and Trading Provisions § 90.205 Banking. (a)(1) Beginning August 1, 2007, a manufacturer of a Class I...

  17. 40 CFR 89.205 - Banking.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Banking. 89.205 Section 89.205... EMISSIONS FROM NEW AND IN-USE NONROAD COMPRESSION-IGNITION ENGINES Averaging, Banking, and Trading Provisions § 89.205 Banking. (a) Requirements for Tier 1 engines rated at or above 37 kW. (1) A...

  18. 10 CFR 205.7 - Service.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Service. 205.7 Section 205.7 Energy DEPARTMENT OF ENERGY OIL ADMINISTRATIVE PROCEDURES AND SANCTIONS General Provisions § 205.7 Service. (a) All orders... personally or by registered or certified mail or by regular United States mail (only when service is...

  19. 40 CFR 240.205 - Air quality.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Air quality. 240.205 Section 240.205 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE THERMAL PROCESSING OF SOLID WASTES Requirements and Recommended Procedures § 240.205 Air quality....

  20. 40 CFR 205.162-1 - Warranty.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Warranty. 205.162-1 Section 205.162-1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Motorcycles § 205.162-1 Warranty. (a) The vehicle manufacturer who...

  1. 40 CFR 205.153 - Engine displacement.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Engine displacement. 205.153 Section 205.153 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Motorcycles § 205.153 Engine displacement. (a)...

  2. 40 CFR 205.5 - Exemptions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Exemptions. 205.5 Section 205.5 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS General Provisions § 205.5 Exemptions....

  3. 40 CFR 205.162-2 - Tampering.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Tampering. 205.162-2 Section 205.162-2 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Motorcycles § 205.162-2 Tampering. (a) For each configuration of...

  4. 40 CFR 205.156 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false 205.156 Section 205.156 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Motorcycles § 205.156...

  5. 40 CFR 205.160-3 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false 205.160-3 Section 205.160-3 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Motorcycles § 205.160-3...

  6. 40 CFR 205.157 - Requirements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Requirements. 205.157 Section 205.157 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Motorcycles § 205.157 Requirements....

  7. 10 CFR 1015.205 - Credit reports.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Credit reports. 1015.205 Section 1015.205 Energy... Administrative Collection of Claims § 1015.205 Credit reports. (a) In order to aid DOE in making appropriate... administrative costs; and the likelihood of collecting the claim, DOE may institute a credit investigation of...

  8. 12 CFR 347.205 - Record maintenance.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Record maintenance. 347.205 Section 347.205 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION REGULATIONS AND STATEMENTS OF GENERAL POLICY INTERNATIONAL BANKING Foreign Banks § 347.205 Record maintenance. The records of each insured branch shall...

  9. 22 CFR 20.5 - Survivor benefits.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Survivor benefits. 20.5 Section 20.5 Foreign Relations DEPARTMENT OF STATE PERSONNEL BENEFITS FOR CERTAIN FORMER SPOUSES § 20.5 Survivor benefits. (a) Type of benefits. A former spouse who meets the eligibility requirements of § 20.3 is entitled...

  10. 7 CFR 205.311 - USDA Seal.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false USDA Seal. 205.311 Section 205.311 Agriculture... PROVISIONS NATIONAL ORGANIC PROGRAM Labels, Labeling, and Market Information § 205.311 USDA Seal. (a) The USDA seal described in paragraphs (b) and (c) of this section may be used only for raw or...

  11. 7 CFR 205.663 - Mediation.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Mediation. 205.663 Section 205.663 Agriculture... PROVISIONS NATIONAL ORGANIC PROGRAM Administrative Compliance § 205.663 Mediation. Any dispute with respect... acceptance by the certifying agent. Mediation shall be requested in writing to the applicable...

  12. 33 CFR 117.205 - Connecticut River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Connecticut River. 117.205 Section 117.205 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.205 Connecticut River. (a)...

  13. 40 CFR 205.50 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Applicability. 205.50 Section 205.50 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks § 205.50 Applicability. (a) Except as...

  14. 40 CFR 205.51 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Definitions. 205.51 Section 205.51 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks § 205.51 Definitions. (a) As used in this...

  15. 40 CFR 205.55 - Requirements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Requirements. 205.55 Section 205.55 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks § 205.55 Requirements....

  16. 40 CFR 205.58-1 - Warranty.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Warranty. 205.58-1 Section 205.58-1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks § 205.58-1 Warranty. (a) The vehicle...

  17. 40 CFR 205.58-2 - Tampering.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Tampering. 205.58-2 Section 205.58-2 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks § 205.58-2 Tampering. (a) For each...

  18. 40 CFR 205.54 - Test procedures.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Test procedures. 205.54 Section 205.54 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks § 205.54 Test procedures. The procedures...

  19. 32 CFR 48.205 - Election form.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Election form. 48.205 Section 48.205 National... SERVICEMAN'S FAMILY PROTECTION PLAN Election of Options § 48.205 Election form. The form for making election after October 31, 1968, is prescribed as Election of Options, Retired Serviceman's Family...

  20. ACC 205(NEW) UOP COURSE TUTORIAL/UOPHELP

    OpenAIRE

    MADHU

    2015-01-01

    For more course tutorials visit www.uophelp.com   ACC 205 Week 1 DQ 1 Accounting Equation ACC 205 Week 1 DQ 2 Accounts ACC 205 Week 1 Exercise Assignment Basic Accounting Equations ACC 205 Week 1 Journal Balance Sheet Journal ACC 205 Week 2 DQ 1 Accounting Cycle ACC 205 Week 2 DQ 2 Bank Reconciliation ACC 205 Week 2 Exercise Assignment Revenue and Expenses ACC 205 Week 2 Journal Income Statement Journal ACC 205 Week 3 DQ 1 LIFO vs. FIFO (New) ...

  1. 48 CFR 2131.205-41 - Taxes.

    Science.gov (United States)

    2010-10-01

    ....S.C. 8714(c) or other Federal law prohibits the imposition of taxes, fees, or other monetary... preempted tax is an unallowable expense under FAR 31.205-41(b)(3). (c) Paragraph (b)(1) of FAR 31.205-41 is...) Notwithstanding any other provision in FAR 31.205-41, an amount equal to the “DAC Tax” is an allowable tax...

  2. 48 CFR 12.205 - Offers.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Offers. 12.205 Section 12... ACQUISITION OF COMMERCIAL ITEMS Special Requirements for the Acquisition of Commercial Items 12.205 Offers. (a) Where technical information is necessary for evaluation of offers, agencies should, as part of...

  3. 49 CFR 1560.205 - Redress process.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 9 2010-10-01 2010-10-01 false Redress process. 1560.205 Section 1560.205... Redress process. (a) If an individual believes he or she has been improperly or unfairly delayed or... individual may seek assistance through the redress process established under this section. (b) An...

  4. 38 CFR 3.205 - Marriage.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Marriage. 3.205 Section 3..., Compensation, and Dependency and Indemnity Compensation Evidence Requirements § 3.205 Marriage. (a) Proof of marriage. Marriage is established by one of the following types of evidence: (1) Copy or abstract of...

  5. 9 CFR 205.206 - Farm products.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Farm products. 205.206 Section 205.206 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE CLEAR TITLE-PROTECTION FOR PURCHASERS OF FARM...

  6. 9 CFR 205.201 - System operator.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false System operator. 205.201 Section 205.201 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE CLEAR TITLE-PROTECTION FOR PURCHASERS OF FARM...

  7. 9 CFR 205.106 - Farm products.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Farm products. 205.106 Section 205.106 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE CLEAR TITLE-PROTECTION FOR PURCHASERS OF FARM...

  8. 9 CFR 205.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Definitions. 205.1 Section 205.1 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE CLEAR TITLE-PROTECTION FOR PURCHASERS OF FARM...

  9. 9 CFR 205.107 - Crop year.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Crop year. 205.107 Section 205.107 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE CLEAR TITLE-PROTECTION FOR PURCHASERS OF FARM...

  10. 21 CFR 558.205 - Dichlorvos.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Dichlorvos. 558.205 Section 558.205 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS, FEEDS... gestation feed to provide 1,000 milligrams per head daily during last 30 days of gestation....

  11. 15 CFR 970.205 - Vessel safety.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Vessel safety. 970.205 Section 970.205... safety. In order to provide a basis for the necessary determinations with respect to the safety of life... Safety of Life at Sea, 1974 (SOLAS 74) possesses current valid SOLAS 74 certificates; (2) That...

  12. 48 CFR 1631.205-41 - Taxes.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Taxes. 1631.205-41 Section... PROCEDURES Contracts With Commercial Organizations 1631.205-41 Taxes. 5 U.S.C. 8909(f)(1) prohibits the imposition of taxes, fees, or other monetary payment, directly or indirectly, on FEHB premiums by any...

  13. 40 CFR 205.151 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Definitions. 205.151 Section 205.151 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION... the rounded off volumetric engine capacity used for marketing purposes by the motorcycle...

  14. 40 CFR 600.205-77 - Recordkeeping.

    Science.gov (United States)

    2010-07-01

    ....205-77 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) ENERGY POLICY FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1977 and Later Model Year Automobiles-Procedures for Calculating Fuel Economy Values § 600.205-77 Recordkeeping....

  15. Stability and in vivo behavior of Rh[16aneS4-diol]211At complex: A potential precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    Introduction: The heavy halogen 211At is of great interest for targeted radiotherapy because it decays by the emission of short-range, high-energy α-particles. However, many astatine compounds that have been synthesized are unstable in vivo, providing motivation for seeking other 211At labeling strategies. One relatively unexplored approach is to utilize prosthetic groups based on astatinated rhodium (III) complex stabilized with a tetrathioether macrocyclic ligand – Rh[16aneS4-diol]211At. The purpose of the current study was to evaluate the in vitro and in vivo stability of this complex in comparison to its iodine analog – Rh[16aneS4-diol]131I. Methods: Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I complexes were synthesized and purified by HPLC. The stability of both complexes was evaluated in vitro by incubation in phosphate-buffered saline (PBS) and human serum at different temperatures. The in vivo behavior of the two radiohalogenated complexes was assessed by a paired-label biodistribution study in normal Balb/c mice. Results: Both complexes were synthesized in high yield and purity. Almost no degradation was observed for Rh[16aneS4-diol]131I in PBS over a 72 h incubation. The astatinated analog exhibited good stability in PBS over 14 h. A slow decline in the percentage of intact complex was observed for both tracers in human serum. In the biodistribution study, retention of 211At in most tissues was higher than that of 131I at all time points, especially in spleen and lungs. Renal clearance of Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I predominated, with 84.1 ± 2.3% and 94.6 ± 0.9% of injected dose excreted via the urine at 4 h. Conclusions: The Rh[16aneS4-diol]211At complex might be useful for constructing prosthetic groups for the astatination of biomolecules and further studies are planned to evaluate this possibility

  16. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D., Scott

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  17. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    International Nuclear Information System (INIS)

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET α-emitter astatine-211 (211At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 (123I), 340-fold for technetium-99m pertechnetate (99mTcO4-) and 60-fold for 211At. Cellular 211At accumulation was found to be dependent on extracellular Na+ ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and 99mTcO4- uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated 211At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and 211At were rapidly (apparent t1/2 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times (123I), 25 times (99mTcO4-) and 10 times (211At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of 123I and 211At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for 123I, 5.2 h for 211At) and preliminary dosimetric calculations indicate high tumour absorbed doses (3.5 Gy/MBqtumour for 131I and 50.3 Gy/MBqtumour for 211At). In

  18. Dicty_cDB: CFH205 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFH205 (Link to dictyBase) - G00206 DDB0216245 Contig-U03274-1 CFH205P (Lin ... w*syir*ye*igw**w*ffn*f frsncns*yrsirtiq*flcks*sfsh*nts *nts titwfxnqnniyqxs*ik*nkf Frame C: fynlkniyi*inndn ... DNA Score E Sequences producing significant alignments : (bits) Value CFH205 (CFH205Q) /CSM/CF/CFH2-A/CFH2 ...

  19. 10 CFR 603.205 - Nature of the project.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Nature of the project. 603.205 Section 603.205 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS TECHNOLOGY INVESTMENT AGREEMENTS Appropriate Use of Technology Investment Agreements § 603.205 Nature of the project. Judgments relating to the nature of...

  20. 48 CFR 1631.205-10 - Cost of money.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Cost of money. 1631.205-10... AND PROCEDURES Contracts With Commercial Organizations 1631.205-10 Cost of money. For the purposes of FAR 31.205-10(b)(3), the estimated facilities capital cost of money is specifically identified if...

  1. 40 CFR 205.171 - Selective enforcement auditing (SEA) requirements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Selective enforcement auditing (SEA) requirements. 205.171 Section 205.171 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Motorcycle Exhaust Systems § 205.171 Selective enforcement auditing...

  2. 40 CFR 205.160 - Selective enforcement auditing (SEA) requirements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Selective enforcement auditing (SEA) requirements. 205.160 Section 205.160 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Motorcycles § 205.160 Selective enforcement auditing...

  3. 7 CFR 205.690 - OMB control number.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false OMB control number. 205.690 Section 205.690... PROVISIONS NATIONAL ORGANIC PROGRAM Administrative Miscellaneous § 205.690 OMB control number. The control number assigned to the information collection requirements in this part by the Office of Management...

  4. 49 CFR 382.205 - On-duty use.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false On-duty use. 382.205 Section 382.205 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL MOTOR CARRIER SAFETY... ALCOHOL USE AND TESTING Prohibitions § 382.205 On-duty use. No driver shall use alcohol while...

  5. 7 CFR 62.205 - Conflict of interest.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Conflict of interest. 62.205 Section 62.205 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards... Definitions Service § 62.205 Conflict of interest. No USDA official shall review any program documentation...

  6. 48 CFR 31.205-38 - Selling costs.

    Science.gov (United States)

    2010-10-01

    ... efforts, other than advertising, are included within the definition of public relations at 31.205-1(a...) Selling activity includes the following broad categories: (1) Advertising. Advertising is defined at 31.205-1(b), and advertising costs are subject to the allowability provisions of 31.205-1(d) and (f)....

  7. 45 CFR 205.130 - State financial participation.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false State financial participation. 205.130 Section 205... ADMINISTRATION-PUBLIC ASSISTANCE PROGRAMS § 205.130 State financial participation. State plan requirements: (a) A State plan for financial assistance under title I, IV-A, X, XIV, or XVI (AABD) of the Social...

  8. 10 CFR 205.82 - Where to file.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Where to file. 205.82 Section 205.82 Energy DEPARTMENT OF ENERGY OIL ADMINISTRATIVE PROCEDURES AND SANCTIONS Interpretation § 205.82 Where to file. A request for interpretation shall be filed with the General Counsel or his delegate or with the appropriate Regional...

  9. 10 CFR 205.81 - What to file.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false What to file. 205.81 Section 205.81 Energy DEPARTMENT OF ENERGY OIL ADMINISTRATIVE PROCEDURES AND SANCTIONS Interpretation § 205.81 What to file. (a) A person filing under this subpart shall file a “Request for Interpretation,” which should be clearly labeled...

  10. 10 CFR 205.13 - Where to file.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Where to file. 205.13 Section 205.13 Energy DEPARTMENT OF ENERGY OIL ADMINISTRATIVE PROCEDURES AND SANCTIONS General Provisions § 205.13 Where to file. (a) Except as otherwise specifically provided in other subparts of this part, all documents to be filed with...

  11. 7 CFR 205.306 - Labeling of livestock feed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Labeling of livestock feed. 205.306 Section 205.306... feed. (a) Livestock feed products described in § 205.301(e)(1) and (e)(2) may display on any package... modify the name of the feed product; (2) The USDA seal; (3) The seal, logo, or other identifying mark...

  12. 40 CFR 205.160-1 - Test request.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Test request. 205.160-1 Section 205.160-1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Motorcycles § 205.160-1 Test request. (a) The Administrator...

  13. 40 CFR 205.162 - In-use requirements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false In-use requirements. 205.162 Section 205.162 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Motorcycles § 205.162 In-use requirements....

  14. 40 CFR 205.160-4 - Testing procedures.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Testing procedures. 205.160-4 Section 205.160-4 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Motorcycles § 205.160-4 Testing procedures....

  15. 40 CFR 205.160-7 - Continued testing.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Continued testing. 205.160-7 Section 205.160-7 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Motorcycles § 205.160-7 Continued testing. (a)...

  16. 48 CFR 231.205-22 - Legislative lobbying costs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Legislative lobbying costs. 231.205-22 Section 231.205-22 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS... Contracts With Commercial Organizations 231.205-22 Legislative lobbying costs. (a) Costs associated...

  17. 7 CFR 205.236 - Origin of livestock.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Origin of livestock. 205.236 Section 205.236... PROVISIONS NATIONAL ORGANIC PROGRAM Organic Production and Handling Requirements § 205.236 Origin of... management beginning no later than the second day of life; (2) Dairy animals. Milk or milk products must...

  18. 25 CFR 161.205 - How are range improvements treated?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false How are range improvements treated? 161.205 Section 161.205 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER NAVAJO PARTITIONED LANDS GRAZING PERMITS General Provisions § 161.205 How are range improvements treated? (a)...

  19. 48 CFR 731.205-70 - Overseas recruitment incentive.

    Science.gov (United States)

    2010-10-01

    ... incentive. 731.205-70 Section 731.205-70 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL... Organizations 731.205-70 Overseas recruitment incentive. Note: the term employee as used in this section means... recruitment incentive (ORI), to the extent the ORI: Is authorized by the contractor's normal policy...

  20. 10 CFR 205.85 - Decision and effect.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Decision and effect. 205.85 Section 205.85 Energy DEPARTMENT OF ENERGY OIL ADMINISTRATIVE PROCEDURES AND SANCTIONS Interpretation § 205.85 Decision and effect... statement of the information upon which it is based and a legal analysis of and conclusions regarding...

  1. 48 CFR 615.205-70 - Use of English language.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Use of English language. 615.205-70 Section 615.205-70 Federal Acquisition Regulations System DEPARTMENT OF STATE CONTRACTING... Information 615.205-70 Use of English language. The requirements of DOSAR 614.201-70 also apply...

  2. 48 CFR 731.205-46 - Travel costs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Travel costs. 731.205-46 Section 731.205-46 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT GENERAL....205-46 Travel costs. It is USAID policy to require prior written approval of international travel...

  3. 48 CFR 31.205-14 - Entertainment costs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Entertainment costs. 31.205-14 Section 31.205-14 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL....205-14 Entertainment costs. Costs of amusement, diversions, social activities, and any...

  4. 12 CFR Appendix B to Part 205 - Federal Enforcement Agencies

    Science.gov (United States)

    2010-01-01

    ... ELECTRONIC FUND TRANSFERS (REGULATION E) Pt. 205, App. B Appendix B to Part 205—Federal Enforcement Agencies The following list indicates which Federal agency enforces Regulation E (12 CFR part 205) for... above Federal Trade Commission, Electronic Fund Transfers, Washington, D.C. 20580....

  5. 46 CFR 205.5 - Contracts containing disputes article.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Contracts containing disputes article. 205.5 Section 205... AUDIT APPEALS; POLICY AND PROCEDURE § 205.5 Contracts containing disputes article. When a contract contains a disputes article, the disputes article will govern the bases for negotiating disputes...

  6. 40 CFR 205.3 - Number and gender.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Number and gender. 205.3 Section 205.3... EQUIPMENT NOISE EMISSION CONTROLS General Provisions § 205.3 Number and gender. As used in this part, words in the -singular shall be deemed to import -the plural, and words in the masculine -gender shall...

  7. 9 CFR 113.205 - Newcastle Disease Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... Virus. 113.205 Section 113.205 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.205 Newcastle Disease Vaccine, Killed Virus. Newcastle Disease...

  8. 40 CFR 205.55-1 - General requirements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false General requirements. 205.55-1 Section 205.55-1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks § 205.55-1...

  9. 40 CFR 205.55-2 - Compliance with standards.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Compliance with standards. 205.55-2 Section 205.55-2 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks § 205.55-2...

  10. 40 CFR 205.57-1 - Test request.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Test request. 205.57-1 Section 205.57-1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks § 205.57-1 Test request. (a)...

  11. 40 CFR 205.54-2 - Sound data acquisition system.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Sound data acquisition system. 205.54-2 Section 205.54-2 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks § 205.54-2...

  12. 40 CFR 205.52 - Vehicle noise emission standards.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Vehicle noise emission standards. 205.52 Section 205.52 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks § 205.52...

  13. 40 CFR 205.55-4 - Labeling-compliance.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Labeling-compliance. 205.55-4 Section 205.55-4 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks § 205.55-4...

  14. 40 CFR 205.57-2 - Test vehicle sample selection.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Test vehicle sample selection. 205.57-2 Section 205.57-2 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks § 205.57-2...

  15. 40 CFR 205.55-3 - Configuration identification.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Configuration identification. 205.55-3 Section 205.55-3 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks § 205.55-3...

  16. 40 CFR 205.55-5 - Labeling-exterior. [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Labeling-exterior. 205.55-5 Section 205.55-5 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks § 205.55-5...

  17. 40 CFR 205.57-8 - Continued testing.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Continued testing. 205.57-8 Section 205.57-8 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks § 205.57-8...

  18. 40 CFR 205.58 - In-use requirements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false In-use requirements. 205.58 Section 205.58 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks § 205.58 In-use requirements....

  19. 40 CFR 205.57-4 - Testing procedures.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Testing procedures. 205.57-4 Section 205.57-4 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks § 205.57-4...

  20. 5 CFR 870.205 - Amount of Optional insurance.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Amount of Optional insurance. 870.205 Section 870.205 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) FEDERAL EMPLOYEES' GROUP LIFE INSURANCE PROGRAM Types and Amount of Insurance § 870.205 Amount of Optional insurance. (a) Option...

  1. 7 CFR 205.509 - Peer review panel.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Peer review panel. 205.509 Section 205.509 Agriculture... PROVISIONS NATIONAL ORGANIC PROGRAM Accreditation of Certifying Agents § 205.509 Peer review panel. The Administrator shall establish a peer review panel pursuant to the Federal Advisory Committee Act (FACA) (5...

  2. 49 CFR 365.205 - Contents of the protest.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Contents of the protest. 365.205 Section 365.205... APPLICATIONS FOR OPERATING AUTHORITY How To Oppose Requests for Authority § 365.205 Contents of the protest. (a) All information upon which the protestant plans to rely is put into the protest. (b) A protest must...

  3. 27 CFR 25.205 - Production.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Production. 25.205 Section... Production. (a) Any adult may produce beer, without payment of tax, for personal or family use and not for... that age before commencing the production of beer. This exemption does not authorize the production...

  4. 12 CFR 205.7 - Initial disclosures.

    Science.gov (United States)

    2010-01-01

    ... operator as defined in § 205.16(a)(1), when the consumer initiates an electronic fund transfer or makes a balance inquiry, and by any network used to complete the transaction. (c) Addition of electronic fund... and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM ELECTRONIC...

  5. 5 CFR 720.205 - Agency plans.

    Science.gov (United States)

    2010-01-01

    ... factors) identification of those occupational categories and positions suitable for external recruitment...) AFFIRMATIVE EMPLOYMENT PROGRAMS Federal Equal Opportunity Recruitment Program § 720.205 Agency plans. (a) Each agency must have an up-to-date equal opportunity recruitment program plan covering recruitment...

  6. 7 CFR 205.237 - Livestock feed.

    Science.gov (United States)

    2010-01-01

    ...) The producer of an organic livestock operation must provide livestock with a total feed ration... § 205.603 may be used as feed additives and supplements. (b) The producer of an organic operation must... specific stage of life; (3) Feed plastic pellets for roughage; (4) Feed formulas containing urea or...

  7. 48 CFR 31.205-41 - Taxes.

    Science.gov (United States)

    2010-10-01

    ... accordance with generally accepted accounting principles. Fines and penalties are not considered taxes. (2... taxable income and pretax income as reflected by the books of account and financial statements. (c) Taxes... REQUIREMENTS CONTRACT COST PRINCIPLES AND PROCEDURES Contracts With Commercial Organizations 31.205-41...

  8. 23 CFR 645.205 - Policy.

    Science.gov (United States)

    2010-04-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS UTILITIES Accommodation of Utilities § 645.205 Policy. (a) Pursuant to the provisions of 23 CFR 1.23, it is in the public interest for... location and manner of installation. (d) When utilities cross or otherwise occupy the right-of-way of...

  9. 5 CFR 2640.205 - Employee responsibility.

    Science.gov (United States)

    2010-01-01

    ... action in a matter which an employee knows would affect his financial interest or the interest of another... interest. An employee who is unsure whether an exemption is applicable in a particular case, should consult... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Employee responsibility. 2640.205...

  10. 42 CFR 59.205 - Project requirements.

    Science.gov (United States)

    2010-10-01

    ... Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS GRANTS FOR FAMILY PLANNING SERVICES Grants for Family Planning Service Training § 59.205 Project requirements. An approvable... to train personnel for programs where abortion is a method of family planning. (2) No portion of...

  11. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    Energy Technology Data Exchange (ETDEWEB)

    Petrich, T.; Helmeke, H.-J.; Meyer, G.J.; Knapp, W.H.; Poetter, E. [Department of Nuclear Medicine, Medizinische Hochschule Hannover (Germany)

    2002-07-01

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET {alpha}-emitter astatine-211 ({sup 211}At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 ({sup 123}I), 340-fold for technetium-99m pertechnetate ({sup 99m}TcO{sub 4}{sup -}) and 60-fold for {sup 211}At. Cellular {sup 211}At accumulation was found to be dependent on extracellular Na{sup +} ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and {sup 99m}TcO{sub 4}{sup -} uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated {sup 211}At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and {sup 211}At were rapidly (apparent t{sub 1/2} 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times ({sup 123}I), 25 times ({sup 99m}TcO{sub 4}{sup -}) and 10 times ({sup 211}At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of {sup 123}I and {sup 211}At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for {sup 123}I, 5.2 h for {sup 211}At) and

  12. Analysis list: Su(var)205 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Su(var)205 Adult,Embryo,Larvae + dm3 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3.../target/Su(var)205.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/target/Su(var)205.5.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/dm3/target/Su(var)205.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/c...olo/Su(var)205.Adult.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/colo/Su(v...ar)205.Embryo.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/colo/Su(var)205.Larvae.tsv http://dbarchive.bioscience

  13. CY205 conversion of the NAMMU program

    International Nuclear Information System (INIS)

    The NAMMU program has been converted from an IBM double precision version to a CY205 single precision version. Due to different dialects among compilers, differences on system levels and machine dependencies some changes to the code have been made. They are documented in this report. A scalar optimized version is delivered. Direct vectorization did not improve performance. Changes in program logic is necessary to take advantage of the the vector capabilities. That and a study of the input-output operations are needed to improve performance. (author)

  14. 45 CFR 205.30 - Methods of administration.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Methods of administration. 205.30 Section 205.30 Public Welfare Regulations Relating to Public Welfare OFFICE OF FAMILY ASSISTANCE (ASSISTANCE PROGRAMS), ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL...

  15. 45 CFR 205.101 - Organization for administration.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Organization for administration. 205.101 Section... PROGRAMS), ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION-PUBLIC ASSISTANCE PROGRAMS § 205.101 Organization for administration. (a) A State plan...

  16. 17 CFR 205.6 - Sanctions and discipline.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Sanctions and discipline. 205... ISSUER § 205.6 Sanctions and discipline. (a) A violation of this part by any attorney appearing and..., regardless of whether the attorney may also be subject to discipline for the same conduct in a...

  17. 1 CFR 20.5 - Sources of information.

    Science.gov (United States)

    2010-01-01

    ... 1 General Provisions 1 2010-01-01 2010-01-01 false Sources of information. 20.5 Section 20.5... information. Pertinent sources of information useful to the public, in areas of public interest such as... should be provided with each agency statement. These sources of information shall plainly identify...

  18. 19 CFR 10.205 - Country of origin criteria.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Country of origin criteria. 10.205 Section 10.205... Country of origin criteria. (a) General. Except as otherwise provided in paragraph (b) of this section, an... growth, product, or manufacture of a beneficiary country; or (2) A new or different article of...

  19. 46 CFR 109.205 - Inspection of boilers and machinery.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Inspection of boilers and machinery. 109.205 Section 109... OPERATIONS Tests, Drills, and Inspections § 109.205 Inspection of boilers and machinery. The chief engineer or engineer in charge, before he assumes charge of the boilers and machinery of a unit shall...

  20. 27 CFR 44.205 - To contiguous foreign countries.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false To contiguous foreign countries. 44.205 Section 44.205 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... proprietor in advance will not prevent the Customs officer from requiring a landing certificate for...

  1. 21 CFR 137.205 - Bromated whole wheat flour.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Bromated whole wheat flour. 137.205 Section 137... Cereal Flours and Related Products § 137.205 Bromated whole wheat flour. Bromated whole wheat flour... of ingredients, prescribed for whole wheat flour by § 137.200, except that potassium bromate is...

  2. 45 CFR 205.70 - Availability of agency program manuals.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Availability of agency program manuals. 205.70... GENERAL ADMINISTRATION-PUBLIC ASSISTANCE PROGRAMS § 205.70 Availability of agency program manuals. State... (AABD) of the Social Security Act must provide that: (a) Program manuals and other policy...

  3. 7 CFR 65.205 - Perishable agricultural commodity.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Perishable agricultural commodity. 65.205 Section 65... COMMODITIES, MACADAMIA NUTS, PECANS, PEANUTS, AND GINSENG General Provisions Definitions § 65.205 Perishable agricultural commodity. Perishable agricultural commodity means fresh and frozen fruits and vegetables of...

  4. The [NII] 205 micron Emission in Local Luminous Infrared Galaxies

    CERN Document Server

    Zhao, Yinghe; Xu, C Kevin; Gao, Yu; Lord, Steven D; Charmandaris, Vassilis; Diaz-Santos, Tanio; Evans, Aaron; Howell, Justin; Petric, Andreea O; van der Werf, Paul P; Sanders, David B

    2016-01-01

    In this paper, we present the measurements of the [NII] 205micron line ([NII]205) for a flux-limited sample of 122 (ultra-)luminous infrared galaxies [(U)LIRGs] and 20 additional normal galaxies, obtained with the Herschel Space Observatory. We explore the far-infrared (FIR) color dependence of the [NII]205 (L[NII]205) to the total infrared (LIR) luminosity ratio, and find that L[NII]205/LIR only depends modestly on the 70-to-160 micron flux density ratio (f70/f160) when f70/f160 0.6. We also investigate the relation between L[NII]205 and star formation rate (SFR), and show that L[NII]205 has a nearly linear correlation with SFR, albeit the intercept of such relation varies somewhat with f60/f100, consistent with our previous conclusion that \\NIIab\\ emission can serve as a SFR indicator with an accuracy of ~0.4 dex, or ~0.2 dex if f60/f100 is known independently. Furthermore, together with the ISO measurements of [NII] 122 micron emission we use a total of ~200 galaxies to derive the local [NII]205 luminosit...

  5. 48 CFR 31.205-34 - Recruitment costs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Recruitment costs. 31.205....205-34 Recruitment costs. (a) Subject to paragraph (b) of this subsection, the following costs are... positions; or (2) Includes material that is not relevant for recruitment purposes, such as...

  6. 49 CFR 377.205 - Presentation of freight bills.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Presentation of freight bills. 377.205 Section 377... Household Goods Freight Forwarders § 377.205 Presentation of freight bills. (a) “To be prepaid” shipments... freight bill or a group of freight bills presented at one time shall state that “failure timely to...

  7. 7 CFR 205.671 - Exclusion from organic sale.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Exclusion from organic sale. 205.671 Section 205.671..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) ORGANIC FOODS PRODUCTION ACT PROVISIONS NATIONAL ORGANIC PROGRAM Administrative Inspection and Testing, Reporting, and Exclusion from...

  8. 40 CFR 205.152 - Noise emission standards.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Noise emission standards. 205.152 Section 205.152 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT... standard. For the purpose of Low-Noise-Emission Product certification pursuant to 40 CFR part...

  9. 40 CFR 205.57-3 - Test vehicle preparation.

    Science.gov (United States)

    2010-07-01

    ... Section 205.57-3 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks § 205.57-3 Test vehicle... like products during early production so long as the resulting testing is not biased by the...

  10. 40 CFR 205.171-3 - Test motorcycle sample selection.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Test motorcycle sample selection. 205... ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Motorcycle Exhaust Systems § 205.171-3 Test motorcycle sample selection. A test motorcycle to be used for selective enforcement audit...

  11. 9 CFR 205.203 - Place of filing EFS.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Place of filing EFS. 205.203 Section 205.203 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE CLEAR TITLE-PROTECTION FOR PURCHASERS OF...

  12. 9 CFR 205.103 - EFS-minimum information.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false EFS-minimum information. 205.103 Section 205.103 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE CLEAR TITLE-PROTECTION FOR PURCHASERS OF...

  13. 48 CFR 31.205-46 - Travel costs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Travel costs. 31.205-46....205-46 Travel costs. (a) Costs for transportation, lodging, meals, and incidental expenses. (1) Costs... at the time of travel as set forth in the— (i) Federal Travel Regulation, prescribed by the...

  14. 5 CFR 2608.205 - Processing demands or requests.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Processing demands or requests. 2608.205 Section 2608.205 Administrative Personnel OFFICE OF GOVERNMENT ETHICS ORGANIZATION AND PROCEDURES... official records and information. (b) The Office of Government Ethics will process requests in the order...

  15. 7 CFR 761.205 - Computing the formula allocation.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Computing the formula allocation. 761.205 Section 761... Funds to State Offices § 761.205 Computing the formula allocation. (a) The formula allocation for FO or... program that the National Office allocates to a State Office. formula allocation = (amount available...

  16. 48 CFR 31.205-27 - Organization costs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Organization costs. 31.205... CONTRACTING REQUIREMENTS CONTRACT COST PRINCIPLES AND PROCEDURES Contracts With Commercial Organizations 31.205-27 Organization costs. (a) Except as provided in paragraph (b) of this section, expenditures...

  17. 20 CFR 718.205 - Death due to pneumoconiosis.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Death due to pneumoconiosis. 718.205 Section... DEATH DUE TO PNEUMOCONIOSIS Determining Entitlement to Benefits § 718.205 Death due to pneumoconiosis. (a) Benefits are provided to eligible survivors of a miner whose death was due to pneumoconiosis....

  18. 40 CFR 205.57 - Selective enforcement auditing requirements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Selective enforcement auditing requirements. 205.57 Section 205.57 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks §...

  19. 48 CFR 1631.205-73 - FEHBP interest expense.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true FEHBP interest expense. 1631.205-73 Section 1631.205-73 Federal Acquisition Regulations System OFFICE OF PERSONNEL MANAGEMENT...) Liquidation of long-term securities would cost more than the cost of the interest; (4) The interest...

  20. 40 CFR 205.59 - Recall of noncomplying vehicles.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Recall of noncomplying vehicles. 205... ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks § 205.59 Recall... order to the manufacturer to recall and repair or modify any vehicle distributed in commerce not...

  1. 37 CFR 205.3 - Waiver of rules.

    Science.gov (United States)

    2010-07-01

    ... procedural, enforceable at law by a party against the Copyright Office, the Library of Congress, or the... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Waiver of rules. 205.3 Section 205.3 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT...

  2. 37 CFR 205.23 - Scope of testimony.

    Science.gov (United States)

    2010-07-01

    ... for reconsideration. (C) Copyright law or other law. (D) The actions of another Office employee. (v... Section 205.23 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE... in Which the Office Is Not a Party § 205.23 Scope of testimony. (a)(1) If a Copyright Office...

  3. 48 CFR 31.205-30 - Patent costs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Patent costs. 31.205-30....205-30 Patent costs. (a) The following patent costs are allowable to the extent that they are incurred... patent application where title or royalty-free license is to be conveyed to the Government. (b)...

  4. Durable donor engraftment after radioimmunotherapy using α-emitter astatine-211-labeled anti-CD45 antibody for conditioning in allogeneic hematopoietic cell transplantation.

    Science.gov (United States)

    Chen, Yun; Kornblit, Brian; Hamlin, Donald K; Sale, George E; Santos, Erlinda B; Wilbur, D Scott; Storer, Barry E; Storb, Rainer; Sandmaier, Brenda M

    2012-02-01

    To reduce toxicity associated with external γ-beam radiation, we investigated radioimmunotherapy with an anti-CD45 mAb labeled with the α-emitter, astatine-211 ((211)At), as a conditioning regimen in dog leukocyte antigen-identical hematopoietic cell transplantation (HCT). Dose-finding studies in 6 dogs treated with 100 to 618 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) without HCT rescue demonstrated dose-dependent myelosuppression with subsequent autologous recovery, and transient liver toxicity in dogs treated with (211)At doses less than or equal to 405 μCi/kg. Higher doses of (211)At induced clinical liver failure. Subsequently, 8 dogs were conditioned with 155 to 625 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) before HCT with dog leukocyte antigen-identical bone marrow followed by a short course of cyclosporine and mycophenolate mofetil immunosuppression. Neutropenia (1-146 cells/μL), lymphopenia (0-270 cells/μL), and thrombocytopenia (1500-6560 platelets/μL) with prompt recovery was observed. Seven dogs had long-term donor mononuclear cell chimerism (19%-58%), whereas 1 dog treated with the lowest (211)At dose (155 μCi/kg) had low donor mononuclear cell chimerism (5%). At the end of follow-up (18-53 weeks), only transient liver toxicity and no renal toxicity had been observed. In conclusion, conditioning with (211)At-labeled anti-CD45 mAb is safe and efficacious and provides a platform for future clinical trials of nonmyeloablative transplantation with radioimmunotherapy-based conditioning. PMID:22134165

  5. 48 CFR 1631.205-75 - Selling costs.

    Science.gov (United States)

    2010-10-01

    ... enrollees information about their choices among health plans (but see FAR 31.205-1 ‘Public relations and advertising costs’, and The Federal Employees Health Benefits Handbook for Personnel and Payroll...

  6. 48 CFR 731.205-6 - Compensation for personal services.

    Science.gov (United States)

    2010-10-01

    ... base salary plus overseas recruitment incentive, if any (see AIDAR 731.205-70) exceeds the USAID... such approval after internal Agency procedures for review/approval of salaries in excess of the...

  7. 48 CFR 31.205-48 - Research and development costs.

    Science.gov (United States)

    2010-10-01

    ... GENERAL CONTRACTING REQUIREMENTS CONTRACT COST PRINCIPLES AND PROCEDURES Contracts With Commercial..., means the type of technical effort described in 31.205-18 but sponsored by a grant or required in...

  8. 10 CFR 205.192A - Burden of proof.

    Science.gov (United States)

    2010-01-01

    ... Remedial Order proceeding the ERA has the burden of establishing a prima facie case as to the validity of... supplemental information that may be made available under § 205.193A. (b) Once a prima facie case has...

  9. 48 CFR 2131.205-70 - Major subcontractor service charge.

    Science.gov (United States)

    2010-10-01

    ... MANAGEMENT, FEDERAL EMPLOYEES GROUP LIFE INSURANCE FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT COST PRINCIPLES AND PROCEDURES Contracts With Commercial Organizations 2131.205-70 Major... major subcontractor only from the risk charge or service charge negotiated between OPM and...

  10. 48 CFR 1631.205-80 - Major subcontractor service charges.

    Science.gov (United States)

    2010-10-01

    ... insurance risk or underwriting, when costs are determined on the basis of actual costs incurred or... MANAGEMENT FEDERAL EMPLOYEES HEALTH BENEFITS ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT COST PRINCIPLES AND PROCEDURES Contracts With Commercial Organizations 1631.205-80 Major...

  11. Dicty_cDB: VHN205 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHN205 (Link to dictyBase) - - - Contig-U16579-1 VHN205P (Link to Original ... skeftlkaevgkgsitmeftyg*vdpkvwvnsl**gy*vigskvkvaltl vtl *aereag*NSCTIEWDIRVTDRNPGHQLAVEEELSF--- ---TGITGLWQ ... atirwimaerl*vrihsrnanqm l*svnvvgnirllvgdhfql*ti*liavtl qfpsgycggwlnsnlyprsaqlfdcrrlsn elgavsfrvafsyeglrlfh ... skeftlkaevgkgsitmeftyg*vdpkvwvnsl**gy*vigskvkvaltl vtl *aereag*NSCTIEWDIRVTDRNPGHQLAVEEELSF--- ---hrdnwlva ... rnchagslvcrfi*qnsdlplpsvg*wlnasksesiletqtkc frv*ml*vtl gcwwgttfnfkpyd*sllhcsflpvivvgg*iliyilvplnssivddyqm ...

  12. miRNA-205 affects infiltration and metastasis of breast cancer

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Zhouquan [Department of Chest Surgery, The First Affiliated Hospital of Medical College, Xi’an Jiaotong University, Xi’an 710061 (China); Department of Tumor, SenGong Hospital of Shaanxi, Xi’an 710300 (China); Liao, Hehe; Deng, Zhiping; Yang, Po; Du, Ning; Zhanng, Yunfeng [Department of Chest Surgery, The First Affiliated Hospital of Medical College, Xi’an Jiaotong University, Xi’an 710061 (China); Ren, Hong, E-mail: renhongs2000@yahoo.com.cn [Department of Chest Surgery, The First Affiliated Hospital of Medical College, Xi’an Jiaotong University, Xi’an 710061 (China)

    2013-11-08

    Highlights: •We detected expression of miR-205 in breast cancer cell lines and tissue samples. •We suggest miR-205 is downregulated in human breast cancer tissues and MCF7 cells. •We suggest the lower expression of miR-205 play a role in breast cancer onset. •These data suggest that miR-205 directly targets HER3 in human breast cancer. -- Abstract: Background: An increasing number of studies have shown that miRNAs are commonly deregulated in human malignancies, but little is known about the function of miRNA-205 (miR-205) in human breast cancer. The present study investigated the influence of miR-205 on breast cancer malignancy. Methods: The expression level of miR-205 in the MCF7 breast cancer cell line was determined by quantitative (q)RT-PCR. We then analyzed the expression of miR-205 in breast cancer and paired non-tumor tissues. Finally, the roles of miR-205 in regulating tumor proliferation, apoptosis, migration, and target gene expression were studied by MTT assay, flow cytometry, qRT-PCR, Western blotting and luciferase assay. Results: miR-205 was downregulated in breast cancer cells or tissues compared with normal breast cell lines or non-tumor tissues. Overexpression of miR-205 reduced the growth and colony-formation capacity of MCF7 cells by inducing apoptosis. Overexpression of miR-205 inhibited MCF7 cell migration and invasiveness. By bioinformation analysis, miR-205 was predicted to bind to the 3′ untranslated regions of human epidermal growth factor receptor (HER)3 mRNA, and upregulation of miR-205 reduced HER3 protein expression. Conclusion: miR-205 is a tumor suppressor in human breast cancer by post-transcriptional inhibition of HER3 expression.

  13. 32 CFR 37.205 - What judgments must I make about the nature of the project?

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false What judgments must I make about the nature of the project? 37.205 Section 37.205 National Defense Department of Defense OFFICE OF THE SECRETARY OF... Investment Agreements § 37.205 What judgments must I make about the nature of the project? You must:...

  14. 45 CFR 170.205 - Content exchange standards and implementation specifications for exchanging electronic health...

    Science.gov (United States)

    2010-10-01

    ... specifications for exchanging electronic health information. 170.205 Section 170.205 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH INFORMATION TECHNOLOGY HEALTH INFORMATION TECHNOLOGY STANDARDS... TECHNOLOGY Standards and Implementation Specifications for Health Information Technology § 170.205...

  15. 48 CFR 31.205-25 - Manufacturing and production engineering costs.

    Science.gov (United States)

    2010-10-01

    ... deploying pilot production lines; (3) Improving current production functions, such as plant layout... production engineering costs. 31.205-25 Section 31.205-25 Federal Acquisition Regulations System FEDERAL... Commercial Organizations 31.205-25 Manufacturing and production engineering costs. (a) The costs...

  16. 20 CFR 661.205 - What is the role of the State Board?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false What is the role of the State Board? 661.205 Section 661.205 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR STATEWIDE... State Governance Provisions § 661.205 What is the role of the State Board? The State Board must...

  17. 40 CFR 2.205 - Final confidentiality determination by EPA legal office.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Final confidentiality determination by EPA legal office. 2.205 Section 2.205 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL PUBLIC INFORMATION Confidentiality of Business Information § 2.205 Final confidentiality determination by EPA legal office. (a) Role of EPA...

  18. 46 CFR 14.205 - Production of credentials by merchant mariner signing shipping articles.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Production of credentials by merchant mariner signing shipping articles. 14.205 Section 14.205 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY MERCHANT....205 Production of credentials by merchant mariner signing shipping articles. On engagement for...

  19. 48 CFR 31.205-1 - Public relations and advertising costs.

    Science.gov (United States)

    2010-10-01

    ... advertising costs. 31.205-1 Section 31.205-1 Federal Acquisition Regulations System FEDERAL ACQUISITION... Organizations 31.205-1 Public relations and advertising costs. (a) Public relations means all functions and... such as advertising, customer relations, etc. (b) Advertising means the use of media to promote...

  20. 14 CFR 1216.205 - Procedures for evaluating NASA actions impacting floodplains and wetlands.

    Science.gov (United States)

    2010-01-01

    ... impacting floodplains and wetlands. 1216.205 Section 1216.205 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION ENVIRONMENTAL QUALITY Floodplain and Wetlands Management § 1216.205 Procedures for evaluating NASA actions impacting floodplains and wetlands. (a) Before taking any action a...

  1. 40 CFR 205.57-5 - Reporting of the test results.

    Science.gov (United States)

    2010-07-01

    ... under 40 CFR 205.1 et seq., all the data reported herein are a true and accurate representation of such... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Reporting of the test results. 205.57-5 Section 205.57-5 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED)...

  2. 40 CFR 205.57-9 - Prohibition on distribution in commerce; manufacturer's remedy.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Prohibition on distribution in commerce; manufacturer's remedy. 205.57-9 Section 205.57-9 Protection of Environment ENVIRONMENTAL... Medium and Heavy Trucks § 205.57-9 Prohibition on distribution in commerce; manufacturer's remedy....

  3. 14 CFR 205.7 - Cancellation, withdrawal, modification, expiration, or replacement of insurance coverage.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Cancellation, withdrawal, modification, expiration, or replacement of insurance coverage. 205.7 Section 205.7 Aeronautics and Space OFFICE OF THE... LIABILITY INSURANCE § 205.7 Cancellation, withdrawal, modification, expiration, or replacement of...

  4. 48 CFR 1631.205-77 - FEHBP start-up and other nonrecurring costs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true FEHBP start-up and other nonrecurring costs. 1631.205-77 Section 1631.205-77 Federal Acquisition Regulations System OFFICE OF PERSONNEL... COST PRINCIPLES AND PROCEDURES Contracts With Commercial Organizations 1631.205-77 FEHBP start-up...

  5. 46 CFR 10.205 - Validity of a merchant mariner credential.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Validity of a merchant mariner credential. 10.205 Section 10.205 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY MERCHANT MARINE OFFICERS AND SEAMEN MERCHANT MARINER CREDENTIAL General Requirements for All Merchant Mariner Credentials § 10.205 Validity...

  6. 5 CFR 880.205 - Determinations of death.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Determinations of death. 880.205 Section... Determinations of death. OPM does not make findings of presumed death. A claimant for CSRS, FERS, or FEGLI death... § 880.207 must submit a death certificate or other legal certification of death issued by an...

  7. 40 CFR 205.155 - Motorcycle class and manufacturer abbreviation.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Motorcycle class and manufacturer...) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Motorcycles § 205.155 Motorcycle class and manufacturer abbreviation. (a) Motorcycles must be grouped into classes determined...

  8. 40 CFR 205.170 - Testing by the Administrator.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Testing by the Administrator. 205.170... the Administrator. (a)(1) In order for the Administrator to determine whether such exhaust systems or a manufacturer's test facility conform to applicable regulations, the Administrator may require...

  9. 40 CFR 205.159 - Testing by the Administrator.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Testing by the Administrator. 205.159... Administrator. (a)(1) In order for the Administrator to determine whether such vehicles or a manufacturer's test facility conform to applicable regulations, the Administrator may require that vehicles to be...

  10. 40 CFR 205.56 - Testing by the Administrator.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Testing by the Administrator. 205.56... Administrator. (a)(1) The Administrator may require that any vehicles to be tested pursuant to the Act be... in which the Administrator conducts such tests, the EPA test facility itself, and the test...

  11. 48 CFR 31.205-44 - Training and education costs.

    Science.gov (United States)

    2010-10-01

    ... where suitable public education is not available may be included in overseas differential pay. (f... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Training and education... Organizations 31.205-44 Training and education costs. Costs of training and education that are related to...

  12. 42 CFR 50.205 - Consent form requirements.

    Science.gov (United States)

    2010-10-01

    ... APPLICABILITY Sterilization of Persons in Federally Assisted Family Planning Projects § 50.205 Consent form... form, and (iii) To the best of his or her knowledge and belief, the individual to be sterilized... knowledge and belief, the individual to be sterilized appeared mentally competent and knowingly...

  13. 27 CFR 555.205 - Movement of explosive materials.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Movement of explosive..., FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE EXPLOSIVES COMMERCE IN EXPLOSIVES Storage § 555.205 Movement of explosive materials. All explosive materials must be kept in locked magazines meeting...

  14. 41 CFR 50-205.4 - Plan of cooperation.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Plan of cooperation. 50... OFFICERS AND EMPLOYEES § 50-205.4 Plan of cooperation. Each agreement under this part shall incorporate a plan of cooperation between the Department of Labor and the State agency. The plan shall include...

  15. 48 CFR 31.205-36 - Rental costs.

    Science.gov (United States)

    2010-10-01

    ... personal property acquired under “operating leases” as defined in Statement of Financial Accounting Standards No. 13 (FAS-13), Accounting for Leases. (See 31.205-11 for Capital Leases.) (b) The following... CONTRACTING REQUIREMENTS CONTRACT COST PRINCIPLES AND PROCEDURES Contracts With Commercial Organizations...

  16. 20 CFR 205.7 - Termination of employee representative status.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Termination of employee representative status... RETIREMENT ACT EMPLOYEE REPRESENTATIVE § 205.7 Termination of employee representative status. The employee... she is employed loses any of the characteristics essential to the existence of employee...

  17. 7 CFR 205.238 - Livestock health care practice standard.

    Science.gov (United States)

    2010-01-01

    ... stock, when used prior to the last third of gestation but not during lactation for progeny that are to... nonsynthetic substance prohibited in § 205.604. (2) Administer any animal drug, other than vaccinations, in the... drugs in violation of the Federal Food, Drug, and Cosmetic Act; or (7) Withhold medical treatment from...

  18. 14 CFR 125.205 - Equipment requirements: Airplanes under IFR.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Equipment requirements: Airplanes under IFR... CERTIFICATION AND OPERATIONS: AIRPLANES HAVING A SEATING CAPACITY OF 20 OR MORE PASSENGERS OR A MAXIMUM PAYLOAD... Equipment Requirements § 125.205 Equipment requirements: Airplanes under IFR. No person may operate...

  19. 31 CFR 205.23 - What requirements apply to estimates?

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false What requirements apply to estimates... Treasury-State Agreement § 205.23 What requirements apply to estimates? The following requirements apply when we and a State negotiate a mutually agreed upon funds transfer procedure based on an estimate...

  20. 14 CFR 13.205 - Administrative law judges.

    Science.gov (United States)

    2010-01-01

    ... the administrative law judge imposes any sanction not specified in this subpart, a party may file an... party may file a motion, pursuant to § 13.218(f)(6), requesting that an administrative law judge be... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Administrative law judges. 13.205...

  1. 48 CFR 53.205-1 - Paid advertisements.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Paid advertisements. 53... (CONTINUED) CLAUSES AND FORMS FORMS Prescription of Forms 53.205-1 Paid advertisements. SF 1449, prescribed in 53.212, shall be used to place orders for paid advertisements as specified in 5.503....

  2. 48 CFR 31.205-28 - Other business expenses.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Other business expenses... GENERAL CONTRACTING REQUIREMENTS CONTRACT COST PRINCIPLES AND PROCEDURES Contracts With Commercial Organizations 31.205-28 Other business expenses. The following types of recurring costs are allowable...

  3. 40 CFR 205.157-2 - Compliance with standards.

    Science.gov (United States)

    2010-07-01

    ... Section 205.157-2 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT... of testing by the Administrator and selective enforcement auditing with regard to each vehicle... Auditing verify according to the requirements of (b)(1) and/or (c)(1) of this section any configurations...

  4. 48 CFR 231.205-70 - External restructuring costs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false External restructuring... PROCEDURES Contracts With Commercial Organizations 231.205-70 External restructuring costs. (a) Scope. This subsection— (1) Prescribes policies and procedures for allowing contractor external restructuring costs...

  5. 48 CFR 931.205-19 - Insurance and indemnification.

    Science.gov (United States)

    2010-10-01

    ....205-19 Insurance and indemnification. (f) The contracting officer shall insert the clause at 952.231-71, Insurance-litigation and claims, in non-management and operating cost reimbursement contracts... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Insurance...

  6. 14 CFR 67.205 - Ear, nose, throat, and equilibrium.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Ear, nose, throat, and equilibrium. 67.205..., nose, throat, and equilibrium. Ear, nose, throat, and equilibrium standards for a second-class airman...) 35 50 50 60 (b) No disease or condition of the middle or internal ear, nose, oral cavity, pharynx,...

  7. Prognostic significance of miR-205 in endometrial cancer.

    Directory of Open Access Journals (Sweden)

    Mihriban Karaayvaz

    Full Text Available PURPOSE: microRNAs have emerged as key regulators of gene expression, and their altered expression has been associated with tumorigenesis and tumor progression. Thus, microRNAs have potential as both cancer biomarkers and/or potential novel therapeutic targets. Although accumulating evidence suggests the role of aberrant microRNA expression in endometrial carcinogenesis, there are still limited data available about the prognostic significance of microRNAs in endometrial cancer. The goal of this study is to investigate the prognostic value of selected key microRNAs in endometrial cancer by the analysis of archival formalin-fixed paraffin-embedded tissues. EXPERIMENTAL DESIGN: Total RNAs were extracted from 48 paired normal and endometrial tumor specimens using Trizol based approach. The expression of miR-26a, let-7g, miR-21, miR-181b, miR-200c, miR-192, miR-215, miR-200c, and miR-205 were quantified by real time qRT-PCR expression analysis. Targets of the differentially expressed miRNAs were quantified using immunohistochemistry. Statistical analysis was performed by GraphPad Prism 5.0. RESULTS: The expression levels of miR-200c (P<0.0001 and miR-205 (P<0.0001 were significantly increased in endometrial tumors compared to normal tissues. Kaplan-Meier survival analysis revealed that high levels of miR-205 expression were associated with poor patient overall survival (hazard ratio, 0.377; Logrank test, P = 0.028. Furthermore, decreased expression of a miR-205 target PTEN was detected in endometrial cancer tissues compared to normal tissues. CONCLUSION: miR-205 holds a unique potential as a prognostic biomarker in endometrial cancer.

  8. 76 FR 68301 - Airworthiness Directives; Bell Helicopter Textron, Inc. (Bell), Model 205A-1, 205B, 210, and 212...

    Science.gov (United States)

    2011-11-04

    ... same type designs, this AD supersedes AD 2010-03-03 (75 FR 5681, February 4, 2010), retaining the same... airworthiness directive (AD) for Bell Model 205B and 212 helicopters with certain main rotor blade (blade... of the helicopter. Since issuing AD 2010-03-03 (75 FR 5681, February 4, 2010), we have...

  9. 41 CFR 101-27.205 - Shelf-life codes.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Shelf-life codes. 101-27...-Management of Shelf-Life Materials § 101-27.205 Shelf-life codes. Shelf-life items shall be identified by use of a one-digit code to provide for uniform coding of shelf-life materials by all agencies. (a)...

  10. Financial Development in 205 Economies, 1960 to 2010

    OpenAIRE

    Martin Čihák; Asli Demirgüč-Kunt; Erik Feyen; Ross Levine

    2013-01-01

    This paper describes our construction of the Global Financial Development Database and uses the data to compare financial systems around the world. The database provides information on financial systems in 205 economies over the period from 1960 to 2010 and includes measures of (1) size of financial institutions and markets (financial depth), (2) degree to which individuals and firms can and do use financial services (access), (3) efficiency of financial intermediaries and markets in intermed...

  11. Treatment of cultured glioma cells with the EGFR-TKI gefitinib (''Iressa'', ZD1839) increases the uptake of astatinated EGF despite the absence of gefitinib-mediated growth inhibition

    International Nuclear Information System (INIS)

    The EGFR-TKI (epidermal growth factor receptor tyrosine kinase inhibitor) gefitinib (''Iressa'', ZD1839), a reversible growth inhibitor of EGFR-expressing tumour cells, has been shown to enhance the antitumour effect of ionising radiation, and also to increase the uptake of radioiodinated EGF. Thus, combination of gefitinib treatment and radionuclide targeting is an interesting option for therapy of brain tumours that are difficult to treat with conventional methods. The aim of this study was to evaluate how pre-treatment with gefitinib affects binding of astatinated EGF (211At-EGF) to cultured glioma U343 cells, which express high levels of EGFR. The growth of U343 cells in the presence of gefitinib was investigated, and it was found that gefitinib does not significantly inhibit the growth of these cells. Nevertheless, the uptake of 211At-EGF in U343 cells was markedly increased (up to 3.5 times) in cells pre-treated with gefitinib (1 μM). This indicates that a combination of gefitinib treatment and radionuclide targeting to EGFR might be a useful therapeutic modality, even for patients who do not respond to treatment with gefitinib alone. (orig.)

  12. Completion report for Well Cluster ER-20-5

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-03-01

    The Well Cluster ER-20-5 drilling and completion project was conducted for the US Department of Energy, Nevada Operations Office (DOE/NV), in support of the Nevada Environmental Restoration Project at the Nevada Test Site (NTS) in Nye County, Nevada. Its primary tasks include collecting geological, geophysical, hydrological, and water chemistry data from new and existing wells to define groundwater quality in addition to pathways and rates of groundwater migration. A program of drilling wells near the sites of selected underground nuclear tests (near-field drilling) was implemented to obtain site-specific data about the nature and extent of migration of radionuclides that might have been produced by an underground nuclear explosion. Well Cluster ER-20-5 is the first near-field drilling project initiated at the NTS. This document presents construction data and summarizes the scientific data gathered during the drilling and well-installation phases for all three holes drilled at Well Cluster ER-20-5. Some of this information is preliminary and unprocessed, but was released so that drilling, geotechnical, well design, and completion data could be rapidly disseminated. Additional information about water levels, aquifer testing, and groundwater sampling will be reported after any of this work is performed. Any additional geologic and/or geophysical investigations conducted for this project is described in one or more analysis and interpretation reports. The lithologic and stratigraphic logs, however, are provided in final form.

  13. 48 CFR 31.205-43 - Trade, business, technical, and professional activity costs.

    Science.gov (United States)

    2010-10-01

    ... Contracts With Commercial Organizations 31.205-43 Trade, business, technical, and professional activity costs. The following types of costs are allowable: (a) Memberships in trade, business, technical,...

  14. Fundamental organometallic reactions: Applications on the CYBER 205

    Science.gov (United States)

    Rappe, A. K.

    1984-01-01

    Two of the most challenging problems of Organometallic chemistry (loosely defined) are pollution control with the large space velocities needed and nitrogen fixation, a process so capably done by nature and so relatively poorly done by man (industry). For a computational chemist these problems are on the fringe of what is possible with conventional computers (large models needed and accurate energetics required). A summary of the algorithmic modification needed to address these problems on a vector processor such as the CYBER 205 and a sketch of findings to date on deNOx catalysis and nitrogen fixation are presented.

  15. 5 CFR 179.205 - Waiver requests and claims to the General Accounting Office.

    Science.gov (United States)

    2010-01-01

    ... Accounting Office. 179.205 Section 179.205 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL... General Accounting Office. These regulations do not preclude an employee from requesting waiver of an... validity of a debt by submitting a subsequent claim to the General Accounting Office in accordance with...

  16. 15 CFR 2011.205 - Application for a specialty sugar certificate.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Application for a specialty sugar certificate. 2011.205 Section 2011.205 Commerce and Foreign Trade Regulations Relating to Foreign Trade Agreements OFFICE OF THE UNITED STATES TRADE REPRESENTATIVE ALLOCATION OF TARIFF-RATE QUOTA ON...

  17. 31 CFR 575.205 - Prohibited exportation and reexportation of goods, technology, or services to Iraq.

    Science.gov (United States)

    2010-07-01

    ... reexportation of goods, technology, or services to Iraq. 575.205 Section 575.205 Money and Finance: Treasury... goods, technology, or services to Iraq. Except as otherwise authorized, no goods, technology (including... U.S. jurisdiction, exported or reexported from a third country to Iraq, to any entity owned...

  18. 31 CFR 205.2 - What definitions apply to this part?

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false What definitions apply to this part? 205.2 Section 205.2 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued... State spend at least a specified amount of State funds for Federal assistance program purposes....

  19. 46 CFR 108.205 - Wash spaces; toilet spaces; and shower spaces.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Wash spaces; toilet spaces; and shower spaces. 108.205... DRILLING UNITS DESIGN AND EQUIPMENT Construction and Arrangement Accommodation Spaces § 108.205 Wash spaces... toilet, washing, or shower space that is accessible only from one single or double occupancy...

  20. Suppression of cell growth and invasion by miR-205 in breast cancer

    Institute of Scientific and Technical Information of China (English)

    Hailong Wu; Shoumin Zhu; Yin-Yuan Mo

    2009-01-01

    MicroRNAs (miRNAs) are endogenous, small, non-coding RNAs, which are capable of silencing gene expression at the post-transcriptional level. In this study, we report that miR-205 is significantly underexpressed in breast tumor compared to the matched normal breast tissue. Similarly, breast cancer cell lines, including MCF-7 and MDA-MB-231, express a lower level miR-205 than the non-malignant MCF-10A cells. Of interest, ectopic expression of miR-205 significantly inhibits cell proliferation and anchorage independent growth, as well as cell invasion. Furthermore, miR-205 was shown to suppress lung metastasis in an animal model. Finally, western blot combined with the luciferase reporter assays demonstrate that ErbB3 and vascular endothelial growth factor A (VEGF-A) are direct targets for miR-205, and this miR-205-mediated suppression is likely through the direct interaction with the putative miR-205 binding site in the 3'-untranslated region (3'-UTR) of ErbB3 and VEGF-A. Together, these results suggest that miR-205 is a tumor suppressor in breast cancer.

  1. 20 CFR 429.205 - What is not allowable under this subpart?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false What is not allowable under this subpart? 429.205 Section 429.205 Employees' Benefits SOCIAL SECURITY ADMINISTRATION ADMINISTRATIVE CLAIMS UNDER THE... receipts, insurance policies, baggage checks, and bank books, is not compensable. Loss of a thesis,...

  2. 30 CFR 204.205 - How do I obtain accounting and auditing relief?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How do I obtain accounting and auditing relief? 204.205 Section 204.205 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT ALTERNATIVES FOR MARGINAL PROPERTIES Accounting and Auditing Relief §...

  3. 14 CFR 221.205 - Justification and explanation for certain fares.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Justification and explanation for certain fares. 221.205 Section 221.205 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF... Justification and explanation for certain fares. Any carrier or its agent must provide, as to any new...

  4. 48 CFR 2131.205-1 - Public relations and advertising costs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Public relations and... REQUIREMENTS CONTRACT COST PRINCIPLES AND PROCEDURES Contracts With Commercial Organizations 2131.205-1 Public relations and advertising costs. The provisions of FAR 31.205-1 shall be modified to include the...

  5. 21 CFR 111.205 - What is the requirement to establish a master manufacturing record?

    Science.gov (United States)

    2010-04-01

    ... manufacturing record? 111.205 Section 111.205 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CURRENT GOOD MANUFACTURING PRACTICE IN MANUFACTURING, PACKAGING, LABELING, OR HOLDING OPERATIONS FOR DIETARY SUPPLEMENTS Production and Process...

  6. 49 CFR 40.205 - How are drug test problems corrected?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false How are drug test problems corrected? 40.205 Section 40.205 Transportation Office of the Secretary of Transportation PROCEDURES FOR TRANSPORTATION...), you must try to correct the problem promptly, if doing so is practicable. You may conduct...

  7. 7 CFR 400.205 - Denial or termination of contract and administrative reassignment of business.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Denial or termination of contract and administrative reassignment of business. 400.205 Section 400.205 Agriculture Regulations of the Department of Agriculture (Continued) FEDERAL CROP INSURANCE CORPORATION, DEPARTMENT OF AGRICULTURE GENERAL ADMINISTRATIVE REGULATIONS Agency Sales and...

  8. 33 CFR 263.23 - Small flood control project authority (Section 205).

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Small flood control project..., DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE CONTINUING AUTHORITIES PROGRAMS Flood Control Policy § 263.23 Small flood control project authority (Section 205). (a) Legislative authority. Section 205 of the...

  9. 40 CFR Appendix I to Subpart B of... - Appendix I to Subpart B of Part 205

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Appendix I to Subpart B of Part 205 I Appendix I to Subpart B of Part 205 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks...

  10. 40 CFR 205.54-1 - Low speed sound emission test procedures.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Low speed sound emission test procedures. 205.54-1 Section 205.54-1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks §...

  11. 40 CFR 205.57-7 - Acceptance and rejection of batch sequence.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Acceptance and rejection of batch sequence. 205.57-7 Section 205.57-7 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks §...

  12. 40 CFR 205.58-3 - Instructions for maintenance, use and repair.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Instructions for maintenance, use and repair. 205.58-3 Section 205.58-3 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks §...

  13. 40 CFR 205.57-6 - Acceptance and rejection of batches.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Acceptance and rejection of batches. 205.57-6 Section 205.57-6 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Medium and Heavy Trucks §...

  14. 12 CFR 205.18 - Requirements for financial institutions offering payroll card accounts.

    Science.gov (United States)

    2010-01-01

    ... offering payroll card accounts. 205.18 Section 205.18 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF... financial institutions offering payroll card accounts. (a) Coverage. A financial institution shall comply with all applicable requirements of the act and this part with respect to payroll card accounts...

  15. 45 CFR 205.45 - Federal financial participation in relation to State emergency welfare preparedness.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Federal financial participation in relation to State emergency welfare preparedness. 205.45 Section 205.45 Public Welfare Regulations Relating to Public Welfare OFFICE OF FAMILY ASSISTANCE (ASSISTANCE PROGRAMS), ADMINISTRATION FOR CHILDREN...

  16. 9 CFR 205.104 - Registration of buyer, commission merchant, or selling agent-minimum information.

    Science.gov (United States)

    2010-01-01

    ... merchant, or selling agent-minimum information. 205.104 Section 205.104 Animals and Animal Products GRAIN..., commission merchant, or selling agent—minimum information. (a) The minimum information necessary on a registration of a buyer, commission merchant, or selling agent is as follows: (1) Buyer, commission...

  17. 33 CFR 155.205 - Discharge removal equipment for vessels 400 feet or greater in length.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Discharge removal equipment for vessels 400 feet or greater in length. 155.205 Section 155.205 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) POLLUTION OIL OR HAZARDOUS MATERIAL POLLUTION...

  18. 23 CFR 420.205 - What is the FHWA's policy for research, development, and technology transfer funding?

    Science.gov (United States)

    2010-04-01

    ... technology transfer funding? 420.205 Section 420.205 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF... Technology Transfer Program Management § 420.205 What is the FHWA's policy for research, development, and technology transfer funding? (a) It is the FHWA's policy to administer the RD&T program activities...

  19. 48 CFR 31.205-16 - Gains and losses on disposition or impairment of depreciable property or other capital assets.

    Science.gov (United States)

    2010-10-01

    ... applicable to those assets was included (but see paragraph (f) of this subsection). However, no gain or loss... to the sale and leaseback limitations in 31.205-11(h)(1) or 31.205-36(b)(2)— (1) The gain or loss is... disposition of tangible capital assets, including those acquired under capital leases (see 31.205-11(h),...

  20. 40 CFR 57.205 - Submission of supplementary information upon relaxation of an SO2 SIP emission limitation.

    Science.gov (United States)

    2010-07-01

    ... upon relaxation of an SO2 SIP emission limitation. 57.205 Section 57.205 Protection of Environment... Application and the NSO Process § 57.205 Submission of supplementary information upon relaxation of an SO2 SIP emission limitation. (a) In the event an SO2 SIP limit is relaxed subsequent to EPA approval or issuance...

  1. 42 CFR 447.205 - Public notice of changes in Statewide methods and standards for setting payment rates.

    Science.gov (United States)

    2010-10-01

    ... SERVICES Payment Methods: General Provisions § 447.205 Public notice of changes in Statewide methods and standards for setting payment rates. (a) When notice is required. Except as specified in paragraph (b) of... standards for setting payment rates. 447.205 Section 447.205 Public Health CENTERS FOR MEDICARE &...

  2. Polarized proton collisions at 205 GeV at RHIC.

    Science.gov (United States)

    Bai, M; Roser, T; Ahrens, L; Alekseev, I G; Alessi, J; Beebe-Wang, J; Blaskiewicz, M; Bravar, A; Brennan, J M; Bruno, D; Bunce, G; Courant, E; Drees, A; Fischer, W; Gardner, C; Gill, R; Glenn, J; Haeberli, W; Huang, H; Jinnouchi, O; Kewisch, J; Luccio, A; Luo, Y; Nakagawa, I; Okada, H; Pilat, F; Mackay, W W; Makdisi, Y; Montag, C; Ptitsyn, V; Satogata, T; Stephenson, E; Svirida, D; Tepikian, S; Trbojevic, D; Tsoupas, N; Wise, T; Zelenski, A; Zeno, K; Zhang, S Y

    2006-05-01

    The Brookhaven Relativistic Heavy Ion Collider (RHIC) has been providing collisions of polarized protons at a beam energy of 100 GeV since 2001. Equipped with two full Siberian snakes in each ring, polarization is preserved during acceleration from injection to 100 GeV. However, the intrinsic spin resonances beyond 100 GeV are about a factor of 2 stronger than those below 100 GeV making it important to examine the impact of these strong intrinsic spin resonances on polarization survival and the tolerance for vertical orbit distortions. Polarized protons were first accelerated to the record energy of 205 GeV in RHIC with a significant polarization measured at top energy in 2005. This Letter presents the results and discusses the sensitivity of the polarization survival to orbit distortions. PMID:16712305

  3. Experience with the Karlsruhe vector computer Cyber-205

    International Nuclear Information System (INIS)

    In 1981, there was an investigation on extra EDP capacity required owing to programme needing particularly long computing times especially concerning the question of how and to what extent this need can be covered by the access to an array processor. As a result of the investigation, 5% of an array processor used as a high performance computer were, at the time, the latent need, together with a predicted need of 20% within the three years to come. This prognosis included the estimation of an array processor being superior to the KfK's most effective computer (IBM-3033) by a factor of at least 2 to 4. Practical experience with the Cyber-205 have not only confirmed these figures, but surpassed. This is exemplified in the article by chasing two completely different fields, i.e. the solution of partial differential equations and computer-assisted design. (CAD). (orig./RW)

  4. Allelic diversity within the high frequency Mamu-A2*05/Mane-A2*05 (Mane-A*06)/Mafa-A2*05 family of macaque MHC-A loci

    OpenAIRE

    Wu, Jin; Bassinger, Sue; Montoya, George D.; Chavez, Leonard; Jones, Carrie E.; Holder-Lockyer, Brigitte; Masten, Barbara; Williams, Thomas M.; Prilliman, Kiley R.

    2008-01-01

    Macaque species serve as important animal models of human infection and immunity. To more fully scrutinize their potential in both the analysis of disease pathogenesis and vaccine development, it is necessary to characterize the Major Histocompatibility Complex (MHC) class I loci of Macaca mulatta (Mamu), Macaca nemestrina (Mane), and Macaca fascicularis (Mafa) at the genomic level. The oligomorphic Mamu-A2*05/Mane-A2*05 (previously known as Mane-A*06) family of macaque MHC-A alleles has rece...

  5. Equilibrium and pre-equilibrium emissions in proton-induced reactions on 203,205Tl

    Indian Academy of Sciences (India)

    A Kaplan; A Aydin; E Tel; B Şarer

    2009-02-01

    In this study, the excitation functions for the reactions 203Tl(, )203Pb, 203Tl(, 3)203Pb, 203Tl(, 2)202Pb, 205Tl(, 4)202Pb, 203Tl(, 3)201Pb, 205Tl(, 5)201Pb, 203Tl(, 4)200Pb and 205Tl(, 6)200Pb have been calculated using pre-equilibrium and equilibrium reaction mechanisms. Calculated results based on hybrid model, geometry-dependent hybrid model and cascade-exciton model have been compared with the experimental data.

  6. Investigation of 203,205Hg with the (d,pγ) reaction - identification of the i13/2 neutron hole state in 205Hg

    International Nuclear Information System (INIS)

    Low lying levels in 203Hg and 205Hg were studied with the (d, p) deuteron break-up reaction at Ed=14 and 18 MeV. Gamma-rays and conversion-electrons were measured in coincidence with protons. In addition delayed spectra were recorded with μs and ms beam pulsing. The i13/2 neutron hole state was identified in 205Hg and confirmed in 203Hg. The known level structure of 205Hg below 2 MeV is confirmed and extended. For 203Hg we observe the γ-decay of several levels below 1.5 MeV, which were previously known from transfer reactions. (orig.)

  7. 5 CFR 892.205 - May I waive participation in premium conversion after the initial implementation?

    Science.gov (United States)

    2010-01-01

    ...-TAX PAYMENT OF HEALTH BENEFITS PREMIUMS Eligibility and Participation § 892.205 May I waive... annuitant. Employees who leave Federal service and are rehired after a three-day break in service or in...

  8. Tunable Narrow Linewidth, Low Noise 2.05 Micron Single Frequency Seeder Laser Project

    Data.gov (United States)

    National Aeronautics and Space Administration — We propose an all-fiber based 2.05-micron single frequency, narrow linewidth seeder laser with 10 nm tuning range and 5GHz frequency modulation for next generation...

  9. Tunable Single Frequency 2.05 Micron Fiber Laser Using New Ho-Doped Fiber Project

    Data.gov (United States)

    National Aeronautics and Space Administration — In this proposal, we propose to demonstrate and build a widely tunable, narrow linewidth, single frequency fiber laser near 2.05 micron by developing an innovative...

  10. 14 CFR 121.205 - Nontransport category airplanes: Landing limitations: Alternate airport.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Nontransport category airplanes: Landing... AND OPERATIONS OPERATING REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Airplane Performance Operating Limitations § 121.205 Nontransport category airplanes: Landing limitations:...

  11. BeppoSAX observations of the quasar Markarian 205

    International Nuclear Information System (INIS)

    We present the first BeppoSAX observation (0.1 to 220 keV) of the quasar Mrk 205. We have searched for the unusual Fe line profile claimed in the XMM-Newton spectrum which has been widely discussed in recent literature. We find no evidence for a broad, ionized Fe line component in our data. We find that if the continuum is modeled with a Compton reflection from cold material component, the line strength diminishes, in agreement with a recent re-analysis of the XMM-Newton data, but with better constraints on the reflection component thanks to the PDS instrument (15-220 keV). We interpret this fact as another indication for illumination of a distant and cold material rather than reprocessing in the highly ionized inner parts of an accretion disk. We detect for the first time a Compton hump in this object. However we cannot constrain the presence of a high energy cutoff. We confirm the existence of a variable soft excess

  12. Thoracic wall defects: surgical management of 205 consecutive patients

    Energy Technology Data Exchange (ETDEWEB)

    Pairolero, P.C.; Arnold, P.G.

    1986-07-01

    In this article, we review our experience during the past 9 years with 205 consecutive thoracic wall reconstructions. The 100 female and 105 male patients ranged in age from 12 to 85 years (mean, 53.4 years). One hundred fourteen patients had thoracic wall tumors, 56 had radiation necrosis, 56 had infected median sternotomy wounds, and 8 had costochondritis. Twenty-nine of these patients had combinations of the aforementioned conditions. One hundred seventy-eight patients underwent skeletal resection. A mean of 5.4 ribs were resected in 142 patients. Total or partial sternectomies were performed in 60. Skeletal defects were closed with prosthetic material in 66 patients and with autogenous ribs in 12. One hundred sixty-eight patients underwent 244 muscle flap procedures: 149 pectoralis major, 56 latissimus dorsi, 14 rectus abdominis, 13 serratus anterior, 8 external oblique, 2 trapezius, and 2 advancement of diaphragm. The omentum was transposed in 20 patients. The mean number of operations per patient was 1.9 (range, 1 to 8). The mean duration of hospitalization was 16.5 days. One perioperative death occurred (at 29 days). Four patients required tracheostomy. During a mean follow-up of 32.4 months, there were 49 late deaths, predominantly due to malignant disease. All 204 patients who were alive 30 days after operation had excellent surgical results at last follow-up examination or at the time of death due to causes unrelated to the reconstructive procedure.

  13. Thermal cracking in Lac du Bonnet granite during slow heating to 205 degrees celsius

    International Nuclear Information System (INIS)

    Acoustic emissions (AE) were recorded as drill core samples of Lac du Bonnet granite were slowly heated to between 66 and 205 degrees celsius to evaluate the effects of temperature on the properties of rock samples. Longitudinal and shear velocities of the samples were measured, and Young's moduli, shear moduli and Poisson's ratios were calculated. No significant AE activity was detected until temperatures reached approximately 73-80 degrees celsius. Above this 'threshold' temperature, calculated rock properties decreased, and at 205 degrees celsius calculated Young's modulus, shear modulus, and Poisson's ratio were reduced by 30, 26, and 29% respectively

  14. Nuclear orientation study of the decay of 205Bi in gadolinium matrix

    International Nuclear Information System (INIS)

    Angular distribution of gamma radiation from the decay of 205Bi oriented at low temperatures in gadolinium matrix was investigated. The orientation parameters B2 and B4 were determined. The spin 9/2 could be uniquely assigned to the positive-parity level at 2252.3 keV. No attenuation was observed for the isomeric level at 1013.8 keV. Seven new values of multipole mixing ratios of E2/M1 gamma-transitions in 205Pb were determined, two earlier measured values were confirmed. 8 refs.; 2 figs.; 2 tabs

  15. 25 CFR 162.205 - Can individual Indian landowners exempt their agricultural land from certain tribal leasing...

    Science.gov (United States)

    2010-04-01

    ... agricultural land from certain tribal leasing policies? 162.205 Section 162.205 Indians BUREAU OF INDIAN... leasing policies? (a) Individual Indian landowners may exempt their agricultural land from the application of a tribal leasing policy of a type described in § 162.203(b) through (c) of this subpart, if...

  16. 31 CFR 205.35 - What is the result of Federal Program Agency or State non-compliance?

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false What is the result of Federal Program Agency or State non-compliance? 205.35 Section 205.35 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT...

  17. 45 CFR 205.25 - Eligibility of supplemental security income beneficiaries for food stamps or surplus commodities.

    Science.gov (United States)

    2010-10-01

    ....25 Eligibility of supplemental security income beneficiaries for food stamps or surplus commodities... 45 Public Welfare 2 2010-10-01 2010-10-01 false Eligibility of supplemental security income beneficiaries for food stamps or surplus commodities. 205.25 Section 205.25 Public Welfare Regulations...

  18. 19 CFR 205.3 - Investigations under sections 131 and 503 of the Trade Act of 1974.

    Science.gov (United States)

    2010-04-01

    ... Trade Act of 1974. 205.3 Section 205.3 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION NONADJUDICATIVE INVESTIGATIONS INVESTIGATIONS TO DETERMINE THE PROBABLE ECONOMIC EFFECT ON THE ECONOMY OF THE...) INTERNATIONAL TRADE OR OF TAKING RETALIATORY ACTIONS TO OBTAIN THE ELIMINATION OF UNJUSTIFIABLE OR...

  19. 41 CFR 102-41.205 - Do we report all forfeited distilled spirits, wine, and beer to GSA for disposal?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Do we report all forfeited distilled spirits, wine, and beer to GSA for disposal? 102-41.205 Section 102-41.205 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION PERSONAL PROPERTY...

  20. 41 CFR 102-85.205 - What happens if a customer agency continues occupancy after the expiration of an OA?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What happens if a customer agency continues occupancy after the expiration of an OA? 102-85.205 Section 102-85.205 Public... expiration of an OA? A mutual goal of GSA and its customers is to have current OAs in place for all...

  1. 48 CFR 50.205-3 - Authorization of offers contingent upon SAFETY Act designation or certification before contract...

    Science.gov (United States)

    2010-10-01

    ... CONTRACTUAL ACTIONS AND THE SAFETY ACT Support Anti-terrorism by Fostering Effective Technologies Act of 2002 50.205-3 Authorization of offers contingent upon SAFETY Act designation or certification before... contingent upon SAFETY Act designation or certification before contract award. 50.205-3 Section...

  2. 48 CFR 50.205-4 - Authorization of awards made presuming SAFETY Act designation or certification after contract award.

    Science.gov (United States)

    2010-10-01

    ... CONTRACTUAL ACTIONS AND THE SAFETY ACT Support Anti-terrorism by Fostering Effective Technologies Act of 2002 50.205-4 Authorization of awards made presuming SAFETY Act designation or certification after... made presuming SAFETY Act designation or certification after contract award. 50.205-4 Section...

  3. Astatination of closo-dodecaborate(2-) anion

    Czech Academy of Sciences Publication Activity Database

    Orlova, A.; Lebeda, Ondřej; Tolmachev, V.; Lundquist, H.; Carlsson, J.; Sjöberg, S.

    Cambridge : The Royal Society of Chemistry , 2000 - (Davidson, M.; Hughes, A.; Marder, T.; Wade , K.), s. 144-147 [Conference "Contemporary Boron Chemistry ". Durham (GB), 11.07.1999-15.07.1999] Institutional research plan: CEZ:AV0Z1048901 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  4. 20 CFR 703.205 - Filing of Agreement and Undertaking; deposit of security.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Filing of Agreement and Undertaking; deposit... REGULATIONS Insurance Carrier Security Deposit Requirements § 703.205 Filing of Agreement and Undertaking... Agreement and Undertaking, in a form prescribed and provided by OWCP, in which the carrier shall agree...

  5. 7 CFR 330.205 - Disposal of plant pests when permits are canceled.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Disposal of plant pests when permits are canceled. 330... PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FEDERAL PLANT PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.205 Disposal...

  6. 12 CFR 205.9 - Receipts at electronic terminals; periodic statements.

    Science.gov (United States)

    2010-01-01

    ... applicable: (1) Transaction information. For each electronic fund transfer occurring during the cycle: (i... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Receipts at electronic terminals; periodic... RESERVE SYSTEM ELECTRONIC FUND TRANSFERS (REGULATION E) § 205.9 Receipts at electronic terminals;...

  7. 12 CFR 205.14 - Electronic fund transfer service provider not holding consumer's account.

    Science.gov (United States)

    2010-01-01

    ... consumer's account is subject to all requirements of this part if the person: (1) Issues a debit card (or... the periodic statement required by § 205.9(b) if the following conditions are met: (i) The debit card... concerning use of the debit card that is substantially similar to the notice contained in appendix A of...

  8. 45 CFR 150.205 - Sources of information triggering an investigation of State enforcement.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Sources of information triggering an investigation... § 150.205 Sources of information triggering an investigation of State enforcement. Information that may... complaint received by CMS. (b) Information learned during informal contact between CMS and State...

  9. 10 CFR 205.199A - Hearing for the purpose of oral argument only.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Hearing for the purpose of oral argument only. 205.199A... Hearing for the purpose of oral argument only. (a) A participant is entitled upon timely request to a... the purpose of receiving oral argument will generally be conducted only after the issues involved...

  10. 20 CFR 628.205 - Governor's coordination and special services plan.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Governor's coordination and special services... LABOR PROGRAMS UNDER TITLE II OF THE JOB TRAINING PARTNERSHIP ACT State Planning § 628.205 Governor's... seeking financial assistance under the Act shall submit to the Secretary, biennially, the...

  11. 9 CFR 205.105 - Master list and portion thereof distributed to registrants-format.

    Science.gov (United States)

    2010-01-01

    ... by any technology including, but not limited to, electronic recording on tapes or discs in machine... distributions. (Approved by the Office of Management and Budget under control number 0580-0016) ... product to a security interest (see § 205.102), in numerical order by social security number or...

  12. 7 CFR 205.102 - Use of the term, “organic.”

    Science.gov (United States)

    2010-01-01

    ..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) ORGANIC FOODS PRODUCTION ACT PROVISIONS NATIONAL ORGANIC PROGRAM Applicability § 205.102 Use of the term, “organic.” Any agricultural product that is sold, labeled, or represented as “100 percent organic,” “organic,” or “made with...

  13. 7 CFR 205.300 - Use of the term, “organic.”

    Science.gov (United States)

    2010-01-01

    ..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) ORGANIC FOODS PRODUCTION ACT PROVISIONS NATIONAL ORGANIC PROGRAM Labels, Labeling, and Market Information § 205.300 Use of the term, “organic.” (a) The term, “organic,” may only be used on labels and in labeling of raw or...

  14. 7 CFR 205.603 - Synthetic substances allowed for use in organic livestock production.

    Science.gov (United States)

    2010-01-01

    ... Water Act. (i) Calcium hypochlorite. (ii) Chlorine dioxide. (iii) Sodium hypochlorite. (8) Electrolytes... use under 7 CFR part 205, the NOP requires that poloxalene only be used for the emergency treatment of... medical treatments as applicable. (1) Alcohols. (i) Ethanol-disinfectant and sanitizer only, prohibited...

  15. 40 CFR 205.160-2 - Test sample selection and preparation.

    Science.gov (United States)

    2010-07-01

    ...) NOISE ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Motorcycles § 205.160-2 Test... performed by the manufacturer on like products during early production if the resulting testing is not... be installed on the vehicle if such equipment or fixtures have no effect on the noise emissions...

  16. 7 CFR 760.205 - Eligible producers, owners, and contract growers.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Eligible producers, owners, and contract growers. 760... Livestock, Honeybees, and Farm-Raised Fish Program § 760.205 Eligible producers, owners, and contract... payments, the participant must have owned, cash-leased, purchased, entered into a contract to purchase,...

  17. 48 CFR 1631.205-70 - FEHBP public relations and advertising costs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true FEHBP public relations and... COST PRINCIPLES AND PROCEDURES Contracts With Commercial Organizations 1631.205-70 FEHBP public relations and advertising costs. (a) The cost of media messages that are directed at advising current...

  18. 48 CFR 231.205-1 - Public relations and advertising costs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Public relations and... PROCEDURES Contracts With Commercial Organizations 231.205-1 Public relations and advertising costs. (e) See... public relations and advertising costs also include monies paid to the Government associated with...

  19. 7 CFR 205.203 - Soil fertility and crop nutrient management practice standard.

    Science.gov (United States)

    2010-01-01

    ... sludge (biosolids) as defined in 40 CFR part 503; and (3) Burning as a means of disposal for crop... 7 Agriculture 3 2010-01-01 2010-01-01 false Soil fertility and crop nutrient management practice... Requirements § 205.203 Soil fertility and crop nutrient management practice standard. (a) The producer...

  20. 24 CFR 15.205 - Method of production of material or provision of testimony.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Method of production of material or... AND TESTIMONY AND PRODUCTION OF INFORMATION BY HUD EMPLOYEES Production of Material or Provision of Testimony in Response to Demands in Legal Proceedings Among Private Litigants § 15.205 Method of...

  1. 40 CFR 205.171-8 - Passing or failing under SEA.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Passing or failing under SEA. 205.171... Passing or failing under SEA. (a) A failing exhaust system is one which, when installed on any motorcycle... equal to the number in Column A, the sample passes. (c) Pass or failure of a SEA takes place when...

  2. 40 CFR 205.160-6 - Passing or failing under SEA.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Passing or failing under SEA. 205.160... failing under SEA. (a) A failing vehicle is one whose measured noise level is in excess of the applicable... vehicles is less than or equal to the number in Column A, the sample passes. (c) Pass or failure of an...

  3. 12 CFR 268.205 - Employment of aliens; Access to sensitive information.

    Science.gov (United States)

    2010-01-01

    ... supervisory information of the Board, as defined in 12 CFR 261.2(c). Three internal security designations... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Employment of aliens; Access to sensitive... Complaints § 268.205 Employment of aliens; Access to sensitive information. (a) Definitions. The...

  4. 41 CFR 101-25.205 - Arrangement for performance of purchasing functions other than centralized.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Arrangement for... Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 25-GENERAL 25.2-Interagency Purchase Assignments § 101-25.205 Arrangement...

  5. 12 CFR 205.15 - Electronic fund transfer of government benefits.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Electronic fund transfer of government benefits... RESERVE SYSTEM ELECTRONIC FUND TRANSFERS (REGULATION E) § 205.15 Electronic fund transfer of government... consumer for use in initiating an electronic fund transfer of government benefits from an account,...

  6. 46 CFR 28.205 - Fireman's outfits and self-contained breathing apparatus.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Fireman's outfits and self-contained breathing apparatus... the Aleutian Trade § 28.205 Fireman's outfits and self-contained breathing apparatus. (a) Each vessel... equipped with at least two self-contained breathing apparatuses. (c) A fireman's outfit must consist of...

  7. 34 CFR 403.205 - What are the State's responsibilities for members of special populations?

    Science.gov (United States)

    2010-07-01

    ... APPLIED TECHNOLOGY EDUCATION PROGRAM What Are the Administrative Responsibilities of a State Under the State Vocational and Applied Technology Education Program? § 403.205 What are the State's... 34 Education 3 2010-07-01 2010-07-01 false What are the State's responsibilities for members...

  8. 48 CFR 6.205 - Set-asides for HUBZone small business concerns.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Set-asides for HUBZone... 6.205 Set-asides for HUBZone small business concerns. (a) To fulfill the statutory requirements... (see 19.1302) may set aside solicitations to allow only qualified HUBZone small business concerns...

  9. 40 CFR 205.163 - Recall of noncomplying motorcycles; relabeling of mislabeled motorcycles.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Recall of noncomplying motorcycles... Motorcycles § 205.163 Recall of noncomplying motorcycles; relabeling of mislabeled motorcycles. (a) Pursuant to section 11(d)(1) of the Act, the Administrator may issue an order to the manufacturer to...

  10. 48 CFR 50.205-2 - Pre-qualification designation notice.

    Science.gov (United States)

    2010-10-01

    ... REGULATION CONTRACT MANAGEMENT EXTRAORDINARY CONTRACTUAL ACTIONS AND THE SAFETY ACT Support Anti-terrorism by Fostering Effective Technologies Act of 2002 50.205-2 Pre-qualification designation notice. (a) Requiring... qualify for SAFETY Act protection, the requiring activity is responsible for requesting a...

  11. 49 CFR 173.205 - Specification cylinders for liquid hazardous materials.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Specification cylinders for liquid hazardous... Than Class 1 and Class 7 § 173.205 Specification cylinders for liquid hazardous materials. When § 172... use of any specification or UN cylinder, except those specified for acetylene, is...

  12. MicroRNA-205 downregulates mixed-lineage-AF4 oncogene expression in acute lymphoblastic leukemia

    Directory of Open Access Journals (Sweden)

    Dou L

    2013-08-01

    Full Text Available Liping Dou,1,* Jingxin Li,1,* Dehua Zheng,2,* Yonghui Li,1 Xiaoning Gao,1 Chengwang Xu,1 Li Gao,1 Lili Wang,1 Li Yu1 1Department of Hematology, Chinese PLA General Hospital, Beijing, People's Republic of China; 2Department of Hepatobiliary Surgery, Organ Transplant Center, Chinese PLA 309th Hospital, Beijing, People's Republic of China*These authors contributed equally to this workAbstract: Myeloid/lymphoid or mixed-lineage AF4 acute lymphoblastic leukemia (MLL-AF4 ALL is a pediatric leukemia that occurs rarely in adults. MLL-AF4 ALL is typically characterized by the presence of chromosomal translocation (t(4;11(q21;q23, leading to expression of MLL-AF4 fusion protein. Although MLL-AF4 fusion protein triggers a molecular pathogenesis and hematological presentations that are unique to leukemias, the precise role of this oncogene in leukemogenesis remains unclear. Previous studies have indicated that microRNAs (miRs might modulate the expression of MLL-AF4 ALL fusion protein, thereby suggesting the involvement of miR in progression or suppression of MLL-AF4 ALL. We have previously demonstrated that miR-205 negatively regulates transcription of an MLL-AF4 luciferase reporter. Here, we report that exogenous expression of miR-205 in MLL-AF4 human cell lines (RS4;11 and MV4-11 inversely regulates the expression of MLL-AF4 at both messenger RNA (mRNA and protein level. Furthermore, miR-205 significantly induced apoptosis in MLL-AF4 cells as evidenced by Annexin V staining using fluorescence-activated cell sorting (FACS analysis. The proliferative capacity of leukemic cells was suppressed by miR-205. The addition of an miR-205 inhibitor was able to restore the observed effects. In conclusion, these findings demonstrate that miR-205 may have potential value as a novel therapeutic agent in the treatment of MLL-AF4 ALL.Keywords: miR-205, MLL-AF4, leukemia, microRNA, oncogene expression, untranslated regions, proliferation

  13. MicroRNA-205‑5b inhibits HMGB1 expression in LPS-induced sepsis.

    Science.gov (United States)

    Zhou, Wenhai; Wang, Jing; Li, Zhifeng; Li, Jianguo; Sang, Ming

    2016-07-01

    Inflammatory cytokines belonging to high mobility group box (HMGB)1 play a key role in sepsis through yet unknown mechanisms. The inflammatory response is modulated by microRNAs (miRNAs or miRs) at multiple levels and is poorly understood. In this study, the regulation of HMGB1 by miRNAs was evaluated using 3-(2,4-dimethoxybenzylidene)anabaseine (GTS-21) to activate the cholinergic anti-inflammatory pathway (CAP) and decrease HMGB1 expression in RAW264.7 cells. Microarray-based miRNA expression profiling of RAW264.7 cells was used to screen target miRNAs through genetic screening, GO analysis and hierarchical clustering. The expression of miRNA targets in the serum, colon, spleen, livers and lungs of BALB/c mice was quantified by RT-qPCR. Serum protein levels were quantified by ELISA. Western blot analysis and RT-qPCR were used for verification in vitro. Using miRNA array analysis, we screened 3 miRNAs (miR‑205‑5b, miR‑196a and miR‑193b). Animal experiments with miR‑205‑5b indicated its high degree of expression in the serum, colon, spleen, liver and lungs following the downregulation of HMGB1 in the tissues. RAW264.7 cells transfected with miR‑205‑5b mimics downregulated HMGB1 protein expression, suggesting translational regulation. HMGB1 expression negatively correlated with miR‑205‑5b expression in LPS-induced sepsis. By contrast, HMGB1 expression in LPS-stimulated RAW264.7 cells was increased following transfection with miR‑205‑5b inhibitor. miR‑205‑5b is a critical mediator of cholinergic anti-inflammatory activity in late sepsis. The upregulation of miR‑205‑5b as a potential therapeutic target for the treatment of inflammatory diseases is a possible novel therapeutic strategy against late sepsis. The mechanisms involved include the by post-transcriptional suppression of HMGB1 in cells and tissues. PMID:27246725

  14. Effect of excitation current intensity on mechanical properties of ZL205A castings solidified under a traveling magnetic field

    OpenAIRE

    Xue-yi Fan; Liang Wang; Zhi-qiang Du

    2015-01-01

    The effect of excitation current intensity on the mechanical properties of ZL205A castings solidified under a traveling magnetic field was studied. The results of the experiment indicate that the excitation current intensity of the traveling magnetic field has a great influence on the mechanical properties of the ZL205A castings. When the excitation current intensity is 15 A, the tensile strength and elongation of ZL205A alloy castings increase 27.2% and 67.7%, respectively, compared with tho...

  15. 20 CFR 666.205 - What are the time frames under which States submit performance progress reports and apply for...

    Science.gov (United States)

    2010-04-01

    ... I OF THE WORKFORCE INVESTMENT ACT Incentives and Sanctions for State Performance § 666.205 What are... grants, in accordance with the criteria of § 666.230. We will publish the award amounts for each...

  16. 7 CFR 3015.205 - General provisions for grants and cooperative agreements with institutions of higher education...

    Science.gov (United States)

    2010-01-01

    ... agreements with institutions of higher education, other nonprofit organizations, and hospitals. 3015.205... General provisions for grants and cooperative agreements with institutions of higher education, other... higher education, other nonprofit organizations and hospitals that the recipient assure and...

  17. Compact, CO2-stabilized tuneable laser at 2.05 microns

    CERN Document Server

    Westergaard, Philip G; Henriksen, Martin R; Michieletto, Mattia; Triches, Marco; Lyngsø, Jens K; Hald, Jan

    2016-01-01

    We demonstrate a compact fibre-based laser system at 2.05 microns stabilized to a CO2 transition using frequency modulation spectroscopy of a gas-filled hollow-core fibre. The laser exhibits an absolute frequency accuracy of 5 MHz, a frequency stability noise floor of better than 7 kHz or 5e-11 and is tunable within +/-200 MHz from the molecular resonance frequency while retaining roughly this stability and accuracy.

  18. Compact, CO2-stabilized tuneable laser at 2.05 microns

    DEFF Research Database (Denmark)

    Westergaard, Philip G.; Thomsen, Jan W.; Henriksen, Martin Romme; Michieletto, Mattia; Triches, Marco; Lyngsø, Jens Kristian; Hald, Jan

    2016-01-01

    We demonstrate a compact fibre-based laser system at 2.05 microns stabilized to a CO2 transition using frequency modulation spectroscopy of a gas-filled hollow-core fibre. The laser exhibits an absolute frequency accuracy of 5 MHz, a frequency stability noise floor of better than 7 kHz or 5......×10−11 and is tunable within ±200 MHz from the molecular resonance frequency while retaining roughly this stability and accuracy....

  19. CD8+ CD205+ splenic dendritic cells are specialized to induce Foxp3+ regulatory T cells.

    Science.gov (United States)

    Yamazaki, Sayuri; Dudziak, Diana; Heidkamp, Gordon F; Fiorese, Christopher; Bonito, Anthony J; Inaba, Kayo; Nussenzweig, Michel C; Steinman, Ralph M

    2008-11-15

    Foxp3(+)CD25(+)CD4(+) regulatory T cells (Treg) mediate immunological self-tolerance and suppress immune responses. A subset of dendritic cells (DCs) in the intestine is specialized to induce Treg in a TGF-beta- and retinoic acid-dependent manner to allow for oral tolerance. In this study we compare two major DC subsets from mouse spleen. We find that CD8(+) DEC-205/CD205(+) DCs, but not the major fraction of CD8(-) DC inhibitory receptor-2 (DCIR2)(+) DCs, induce functional Foxp3(+) Treg from Foxp3(-) precursors in the presence of low doses of Ag but without added TGF-beta. CD8(+)CD205(+) DCs preferentially express TGF-beta, and the induction of Treg by these DCs in vitro is blocked by neutralizing Ab to TGF-beta. In contrast, CD8(-)DCIR2(+) DCs better induce Foxp3(+) Treg when exogenous TGF-beta is supplied. In vivo, CD8(+)CD205(+) DCs likewise preferentially induce Treg from adoptively transferred, Ag-specific DO11.10 RAG(-/-) Foxp3(-)CD4(+) T cells, whereas the CD8(-)DCIR2(+) DCs better stimulate natural Foxp3(+) Treg. These results indicate that a subset of DCs in spleen, a systemic lymphoid organ, is specialized to differentiate peripheral Foxp3(+) Treg, in part through the endogenous formation of TGF-beta. Targeting of Ag to these DCs might be useful for inducing Ag-specific Foxp3(+) Treg for treatment of autoimmune diseases, transplant rejection, and allergy. PMID:18981112

  20. miR-24 and miR-205 expression is dependent on HPV onco-protein expression in keratinocytes

    Energy Technology Data Exchange (ETDEWEB)

    McKenna, Declan J., E-mail: dj.mckenna@ulster.ac.uk [Biomedical Sciences Research Institute, University of Ulster, Coleraine, Co. Derry BT52 1SA (United Kingdom); Centre for Cancer Research and Cell Biology, School of Medicine, Dentistry and Biomedical Science, Queen' s University Belfast, Belfast BT9 7BL (United Kingdom); Patel, Daksha, E-mail: d.patel@qub.ac.uk [Centre for Cancer Research and Cell Biology, School of Medicine, Dentistry and Biomedical Science, Queen' s University Belfast, Belfast BT9 7BL (United Kingdom); McCance, Dennis J., E-mail: d.mccance@qub.ac.uk [Centre for Cancer Research and Cell Biology, School of Medicine, Dentistry and Biomedical Science, Queen' s University Belfast, Belfast BT9 7BL (United Kingdom)

    2014-01-05

    A screen of microRNA (miRNA) expression following differentiation in human foreskin keratinocytes (HFKs) identified changes in several miRNAs, including miR-24 and miR-205. We investigated how expression of Human Papilloma Virus Type-16 (HPV16) onco-proteins E6 and E7 affected expression of miR-24 and miR-205 during proliferation and differentiation of HFKs. We show that the induction of both miR-24 and miR-205 observed during differentiation of HFKs is lost in HFKs expressing E6 and E7. We demonstrate that the effect on miR-205 is due to E7 activity, as miR-205 expression is dependent on pRb expression. Finally, we provide evidence that miR-24 effects in the cell may be due to targeting of cyclin dependent kinase inhibitor p27. In summary, these results indicate that expression of both miR-24 and miR-205 are impacted by E6 and/or E7 expression, which may be one mechanism by which HPV onco-proteins can disrupt the balance between proliferation and differentiation in keratinocytes. - Highlights: • miR-24 and miR-205 are induced during keratinocyte differentiation. • This induction is lost in keratinocytes expressing HPV onco-proteins E6 and E7. • miR-205 is dependent upon pRb expression. • miR-24 targets p27 in cycling keratinocytes.

  1. Comparison and characterization of biosorption by Weissella viridescens MYU 205 of periodic group 12 metal ions.

    Science.gov (United States)

    Kinoshita, Hideki; Ohtake, Fumika; Ariga, Yuuki; Kimura, Kazuhiko

    2016-02-01

    Because heavy metals cause various health hazards, we studied biosorption by Weissella viridescens MYU 205. MYU 205 showed high biosorption for Cd (II) and Hg (II) and was low for Zn (II). The Hg (II) biosorption rate was high at about 80%. Different biosorptions were shown for each metal after successive incubation. About 20% of the Zn (II) biosorption was observed after 3 h. Cd (II) biosorption increased in a time-dependent manner until 3 h, then gradually decreased. Hg (II) was immediately sorbed at 79.6 ± 4.7% and decreased at 3 h to 52.9 ± 2.6%, and then gradually increased to 77.8 ± 3.6%. Using heat-killed cells, the rate of biosorption of Zn (II) and Cd (II) decreased whereas Hg (II) tended to increase. The metal resistance was high, that is Zn (II) > Cd (II) > Hg (II); while the affinity was opposite where MYU 205 showed high affinity to Hg (II) and low affinity to Zn (II). Our data shows lactic acid bacteria may be powerful heavy metal sorbents for detoxification. PMID:26223952

  2. ALMA observations of the T Tauri binary system AS 205: evidence for molecular winds and/or binary interactions

    Energy Technology Data Exchange (ETDEWEB)

    Salyk, Colette [National Optical Astronomy Observatory, 950 North Cherry Avenue, Tucson, AZ 85719 (United States); Pontoppidan, Klaus [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Corder, Stuartt [Joint ALMA Observatory, Av. Alonso de Córdova 3107, Vitacura, Santiago (Chile); Muñoz, Diego [Center for Space Research, Department of Astronomy, Cornell University, Ithaca, NY 14853 (United States); Zhang, Ke; Blake, Geoffrey A., E-mail: csalyk@noao.edu [Division of Geological and Planetary Sciences, Mail Code 150-21, California Institute of Technology, Pasadena, CA 91125 (United States)

    2014-09-01

    In this study, we present high-resolution millimeter observations of the dust and gas disk of the T Tauri star AS 205 N and its companion, AS 205 S, obtained with the Atacama Large Millimeter Array. The gas disk around AS 205 N, for which infrared emission spectroscopy demonstrates significant deviations from Keplerian motion that has been interpreted as evidence for a disk wind, also displays significant deviations from Keplerian disk emission in the observations presented here. Detections near both AS 205 N and S are obtained in 1.3 mm continuum, {sup 12}CO 2-1, {sup 13}CO 2-1, and C{sup 18}O 2-1. The {sup 12}CO emission is extended up to ∼2'' from AS 205 N, and both {sup 12}CO and {sup 13}CO display deviations from Keplerian rotation at all angular scales. Two possible explanations for these observations hold up best to close scrutiny—tidal interaction with AS 205 S or disk winds (or a combination of the two)—and we discuss these possibilities in some detail.

  3. ALMA observations of the T Tauri binary system AS 205: evidence for molecular winds and/or binary interactions

    International Nuclear Information System (INIS)

    In this study, we present high-resolution millimeter observations of the dust and gas disk of the T Tauri star AS 205 N and its companion, AS 205 S, obtained with the Atacama Large Millimeter Array. The gas disk around AS 205 N, for which infrared emission spectroscopy demonstrates significant deviations from Keplerian motion that has been interpreted as evidence for a disk wind, also displays significant deviations from Keplerian disk emission in the observations presented here. Detections near both AS 205 N and S are obtained in 1.3 mm continuum, 12CO 2-1, 13CO 2-1, and C18O 2-1. The 12CO emission is extended up to ∼2'' from AS 205 N, and both 12CO and 13CO display deviations from Keplerian rotation at all angular scales. Two possible explanations for these observations hold up best to close scrutiny—tidal interaction with AS 205 S or disk winds (or a combination of the two)—and we discuss these possibilities in some detail.

  4. Effects of abrogating expression of miR-205 on proliferation and migration of endometrial carcinoma Ishikawa cells and its mechanism%下调microRNA-205表达对人子宫内膜癌Ishikawa细胞增殖和侵袭的作用

    Institute of Scientific and Technical Information of China (English)

    苏宁; 陈一飞; 严沁; 万小平

    2012-01-01

    目的:探讨下调microRNA-205(miR-205)表达对人子宫内膜样腺癌细胞系Ishikawa增殖和侵袭的作用及可能的机制.方法:将miR-205抑制剂(miR-205 inhibitor)瞬时转染Ishikawa细胞,下调miR-205的表达;应用实时荧光定量PCR方法(qRT-PCR)检测miR-205的表达;噻唑蓝(MTT)法检测细胞增殖能力;Transwell小室法检测细胞侵袭能力.qRT-PCR和Western blot分别检测miR-205的预测靶基因ESRRG mRNA和蛋白表达水平.应用双荧光素酶分析方法鉴定miR-205和ESRRG 3UTR的表达调节关系.结果:miR-205在Ishikawa细胞中呈高表达;转染miR-205 inhibitor的Ishikawa细胞中,miR-205表达降低了86.9%,细胞增殖和侵袭能力下降,同时细胞ESRRG mRNA和蛋白表达升高;miR-205通过直接与ESRRG mRNA 3UTR结合负调节其表达.结论:下调miR-205表达可抑制Ishikawa细胞增殖、侵袭能力;miR-205的生物效应可能与调节潜在抑癌基因ESRRG有关.%Objective:To investigate the effects of down-regulated expression of hsa-miR-205 on the proliferation and migration of Ishikawa cells and its mechanism- Methods: miR-205 inhibitor was transiently transfected into Ishikawa cells to down-regulate expression of miR-205. The expression of miR-205 was detected using quantitative reverse transcription polymerase chain reaction (qRT-PCR). Cellular proliferation and migration abilities were analyzed by 3-(4,5-dimethylthi-azol -2-yl)-2,5-diphenyltetrazolium bromide(MTT) assay and transwell migration assay,respectively. qRT-PCR and Western blot were used to detect estrogen-related receptor gamma (ESRRG) mR-NA and protein expression,respectively,which was a putative target gene of miR-205. Luciferase assays were used to confirm the interaction between miR-205 and ESRRG, Results; miR-205 was expressed at higher levels in Ishikawa cells compared to 293T cells with a low level of miR-205. The miR-205 expression in miR-205 inhibitors transfected cells decreased 86.9%. The celluar

  5. The potential role of NGC 205 in generating Andromeda's vast thin co-rotating plane of satellite galaxies

    CERN Document Server

    Angus, Garry W; Gentile, Gianfranco; Diaferio, Antonaldo

    2016-01-01

    The Andromeda galaxy is observed to have a system of two large dwarf ellipticals and ~13 smaller satellite galaxies that are currently co-rotating in a thin plane, in addition to 2 counter-rotating satellite galaxies. We explored the consistency of those observations with a scenario where the majority of the co-rotating satellite galaxies originated from a subhalo group, where NGC 205 was the host and the satellite galaxies occupied dark matter sub-subhalos. We ran N-body simulations of a close encounter between NGC 205 and M31. In the simulations, NGC 205 was surrounded by massless particles to statistically sample the distribution of the sub-subhalos expected in a subhalo that has a mass similar to NGC 205. We made Monte Carlo samplings and found that, using a set of reference parameters, the probability of producing a thinner distribution of sub-subhalos than the observed NGC 205 + 15 smaller satellites (thus including the 2 counter-rotators, but excluding M32) increased from <1e-8 for the initial distr...

  6. Formation law and criterion of nebulous macroscopic segregation in ZL205A alloy castings

    Institute of Scientific and Technical Information of China (English)

    Li Yusheng; Zhai Hu; Feng Zhijun; Qu Xuahui

    2008-01-01

    The appearance of macroscopic segregation in ZL205A alloy castings bears a super resemblance to the appearance of shrinkage porosity, and the chemical composition of the segregation is Al2Cu whose microstructure is in the form of dentrite or skeleton crystal. According to the characteristic of nebulous segregation, the formation process could be divided into two steps by the eutectic temperature of Al2Cu. Then a criterion for each of the two steps is brought forward on the basis of the shrinkage porosity criterion of low pressure casting.

  7. Babcock and Wilcox Safety Anaysis Report (B-SAR-205). Volume 1

    International Nuclear Information System (INIS)

    The design of the BW-205 standard reactor with a plant output of 1295 and 1200 MW(e) is described. The reactor is arranged in two closed coolant loops connected in parallel to the reactor vessel, and is controlled by a coordinated combination of chemical shim and mechanical control rods. The coolant serves as a neutron moderator, reflector, and solvent for the soluble boron used in chemical shim reactivity control. The fuel elements consist of slightly enriched UO2 pellets enclosed in zircaloy tubes

  8. First detection of [N II] 205 micrometer absorption in interstellar gas

    CERN Document Server

    Persson, C M; Mookerjea, B; Black, J H; Olberg, M; Goicoechea, J R; Hassel, G E; Falgarone, E; Levrier, F; Menten, K M; Pety, J

    2014-01-01

    We present high resolution [NII] 205 micrometer ^3P_1-^3P_0 spectra obtained with Herschel-HIFI towards a small sample of far-infrared bright star forming regions in the Galactic plane: W31C (G10.6-0.4), W49N (G43.2-0.1), W51 (G49.5-0.4) and G34.3+0.1. All sources display an emission line profile associated directly with the HII regions themselves. For the first time we also detect absorption of the [NII] 205 micrometer line by extended low-density foreground material towards W31C and W49N over a wide range of velocities. We attribute this absorption to the Warm Ionised Medium (WIM) and find N(N^+)\\approx 1.5x10^17 cm^-2 towards both sources. This is in agreement with recent Herschel-HIFI observations of [CII] 158 micrometer, also observed in absorption in the same sight-lines (Gerin et al. 2012, 2014), if ~10-13% of all C^+ ions exist in the WIM on average. Using an abundance ratio of [N]/[H] = 6.76x10^-5 in the gas-phase we find that the mean electron and proton densities are ~0.2-2 cm^-3 assuming a WIM fil...

  9. Distribution of charge and matter in nuclei: Charge density difference of 206Pb and 205Tl

    International Nuclear Information System (INIS)

    We contrast two calculations of the charge density difference of 206Pb and 205Tl. In the simplest model this difference in charge density is due to the occupation of an additional 3s/sub 1/2/ orbital in 206Pb. A standard mean-field calculation of the charge difference does not yield a satisfactory result. One may modify this result by assigning the 3s/sub 1/2/ orbital an occupation probability of seventy percent, with a corresponding increase to thirty percent of the occupation probability of a 2d/sub 3/2/ orbital. However, this modification of the mean-field analysis, while solving one problem, is seen to create a new problem in the fit to the data. In this work we present an alternative analysis: We maintain unit occupation probability for the 3s/sub 1/2/ orbital but use the medium-modified proton electromagnetic form factor we have calculated previously. Our model is able to give a better fit to the data without the introduction of free parameters into the analysis. Medium-modified form factors have recently been shown to be effective in explaining the charge distribution of 208Pb and their application to the interpretation of the 206Pb-205Tl charge density difference yields a result which is consistent with the experimental data and superior to that obtained in the adjusted mean-field analysis described above

  10. Element segregation behavior of aluminum-copper alloy ZL205A

    Institute of Scientific and Technical Information of China (English)

    Fan Li; Hao Qitang; Xian Fuchao

    2014-01-01

    In aluminum-copper al oy, the segregation has a severe bad effect on the al oying degree, strength and corrosion resistance. A deeper understanding of element segregation behavior wil have a great significance on the prevention of segregation. In the study, the element segregation behavior of ZL205A aluminum-copper al oy was investigated by examining isothermal y solidified samples using scanning electron microscopy and energy dispersive spectroscopy. The calculated results of segregation coefficients show that Cu and Mn are negative segregation elements; while Ti, V and Zr are positive segregation elements. The sequence of element segregation degree from the greatest to the least in ZL205A al oy is Cu, Mn, V, Ti, Zr and Al. The density of residual liquid is expected to increase with a decrease in the quenching temperature ranging from 630 ºC to 550 ºC. The calculated results confirm that the quenching temperature has an insignificant effect on the liquid density;and the variation of density is mainly due to element segregation. Consequently, segregations of Al, Cu and Mn lead to an increase in density, but Ti, V and Zr present the opposite effect. The contribution of each element to the variation of the liquid density was analyzed. The sequence of contributions of al oying elements to the variation of total liquid density is Cu﹥Al﹥Mn﹥V﹥Ti﹥Zr.

  11. Validation of 205 MHz wind profiler radar located at Cochin, India, using radiosonde wind measurements

    Science.gov (United States)

    Kottayil, Ajil; Mohanakumar, K.; Samson, Titu; Rebello, Rejoy; Manoj, M. G.; Varadarajan, Rakesh; Santosh, K. R.; Mohanan, P.; Vasudevan, K.

    2016-03-01

    A novel Mini Wind Profiling radar at 205 MHz has been set up at Cochin (10.04°N, 76.33°E), India, with the main objective of studying the dynamics of the Indian summer monsoon. This paper presents the first time validation of this Mini Wind Profiler using collocated radiosonde wind measurements. The wind profiles within 1-6 km altitude range have been validated. The radar wind profiles match very well with the radiosondes both in terms of magnitude and direction and ideally captures the day-to-day wind variations. The correlation between radar and radiosonde's zonal and meridional wind is 0.91 and 0.85, respectively. The standard deviation of the difference between radiosonde and radar for zonal wind is found to be 1.95 m s-1 and 1.56 m s-1 for meridional wind. These observations are seen to agree quite well with other established wind profiler radars operating elsewhere in the world. The results show that the 205 MHz Wind Profiler is capable of providing high-quality wind data, and this could be pivotal for monsoon studies in years to come.

  12. CD8+ CD205+ splenic dendritic cells are specialized to induce Foxp3+ regulatory T cells1

    OpenAIRE

    Yamazaki, Sayuri; Dudziak, Diana; Heidkamp, Gordon F; Fiorese, Christopher; Bonito, Anthony J.; Inaba, Kayo; Nussenzweig, Michel C.; Steinman, Ralph M.

    2008-01-01

    Foxp3+CD25+CD4+ regulatory T cells (T reg) mediate immunological self-tolerance and suppress immune responses. A subset of dendritic cells (DCs) in the intestine is specialized to induce T reg in a transforming growth factor (TGF)-β and retinoic acid (RA) dependent manner to allow for oral tolerance. Here we compare two major DC subsets from mouse spleen. We find that CD8+ DEC-205/CD205+ DCs, but not the major fraction of CD8− dendritic cell inhibitory receptor-2 (DCIR2)+ DCs, induce function...

  13. Alpha-decay properties of /sup 205-208/Fr: Identification of 206Fr/sup m/

    International Nuclear Information System (INIS)

    Alpha-particle and γ-ray spectral measurements were made for /sup 205-208/Fr. A new a emitter (T/sub 1/2/ = 0.7 +- 0.1 sec and E/sub a/ = 6.930 +- 0.005 MeV) was observed and identified with the decay of a previously unknown isomer in 206Fr. From the a particle and g ray intensities, a decay branching ratios were deduced for /sup 205-208/Fr utilizing available information concerning the nuclides' (electron capture+positron) decay properties. Reduced widths were calculated and compared with those of neighboring nuclei

  14. The Ionized Gas in Nearby Galaxies as Traced by the [N II] 122 and 205 μm Transitions

    OpenAIRE

    Herrera-Camus, R.; Bolatto, A.; Smith, J. D.; Draine, B.; Pellegrini, E.; Wolfire, M.; Croxall, K.; De Looze, I.; Calzetti, D.; Kennicutt, R.; Crocker, A.; Armus, L.; van der Werf, P.; Sandstrom, K.; Galametz, M.

    2016-01-01

    The [N ii] 122 and 205 μm transitions are powerful tracers of the ionized gas in the interstellar medium. By combining data from 21 galaxies selected from the Herschel KINGFISH and Beyond the Peak surveys, we have compiled 141 spatially resolved regions with a typical size of ~1 kpc, with observations of both [N ii] far-infrared lines. We measure [N ii] 122/205 line ratios in the ~0.6–6 range, which corresponds to electron gas densities of n_e ~ 1–300 cm^(−3), with a median value of n_e = 30 ...

  15. 41 CFR 102-33.205 - When we use our aircraft to support other executive agencies, must we recover the operating costs?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false When we use our aircraft to support other executive agencies, must we recover the operating costs? 102-33.205 Section 102-33... Aircraft and Aircraft Parts Accounting for the Cost of Government Aircraft § 102-33.205 When we use...

  16. Complete Genome Sequence of Bacillus velezensis CBMB205, a Phosphate-Solubilizing Bacterium Isolated from the Rhizoplane of Rice in the Republic of Korea

    Science.gov (United States)

    Hwangbo, Kyeong; Um, Yurry; Kim, Ki Yoon; Madhaiyan, Munusamy; Sa, Tong Min

    2016-01-01

    Bacillus velezensis CBMB205 (= KACC 13105T = NCCB 100236T) was isolated from the rhizoplane of rice (Oryza sativa L. cv. O-dae). According to previous studies, this bacterium has several genes that can promote plant growth, such as the phosphorus-solubilizing protein-coding gene. Here, we present the first complete genome of B. velezensis CBMB205. PMID:27417835

  17. A Herschel Survey of the [N II] 205 micron Line in Local Luminous Infrared Galaxies --- The [N II] 205 micron Emission as a Star Formation Rate Indicator

    CERN Document Server

    Zhao, Yinghe; Xu, C Kevin; Gao, Yu; Lord, S; Howell, J; Isaak, K G; Charmandaris, V; Diaz-Santos, T; Appleton, P; Evans, A; Iwasawa, K; Leech, J; Mazzarella, J; Petric, A O; Sanders, D B; Schulz, B; Surace, J; van der Werf, P P

    2013-01-01

    We present, for the first time, a statistical study of [N II] 205 mciron line emission for a large sample of local luminous infrared galaxies using Herschel Spectral and Photometric Imaging Receiver Fourier Transform Spectrometer (SPIRE FTS) data. For our sample of galaxies, we investigate the correlation between the [N II] luminosity (LNII) and the total infrared luminosity (LIR), as well as the dependence of LNII/LIR ratio on LIR, far infrared colors (IRAS $f_{60}/f_{100}$) and the [O III] 88 micron to [N II] luminosity ratio. We find that LNII correlates almost linearly with LIR for non AGN galaxies (all having $L_{IR} < 10^{12} L_solar$) in our sample, which implies that LNII can serve as a SFR tracer which is particularly useful for high redshift galaxies which will be observed with forthcoming submm spectroscopic facilities such as the Atacama Large Millimeter/submillimeter Array. Our analysis shows that the deviation from the mean LNII-LIR relation correlates with tracers of the ionization parameter...

  18. Cytocompatibility of direct water synthesized cadmium selenide quantum dots in colo-205 cells

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez-Torres, Marcos R. [Universidad Metropolitana, Nanomaterials Science Laboratory, School of Science and Technology (United States); Velez, Christian; Zayas, Beatriz [Universidad Metropolitana, ChemTox Laboratory, School of Environmental Affairs (United States); Rivera, Osvaldo [Universidad Metropolitana, Nanomaterials Science Laboratory, School of Science and Technology (United States); Arslan, Zikri [Jackson State University, Department of Chemistry (United States); Gonzalez-Vega, Maxine N. [Universidad Metropolitana, Nanomaterials Science Laboratory, School of Science and Technology (United States); Diaz-Diestra, Daysi; Beltran-Huarac, Juan; Morell, Gerardo [University of Puerto Rico, Molecular Science Research Center (United States); Primera-Pedrozo, Oliva M., E-mail: oprimera1@suagm.edu [Universidad Metropolitana, Nanomaterials Science Laboratory, School of Science and Technology (United States)

    2015-06-15

    Cadmium selenide quantum dots (CdSe QDs), inorganic semiconducting nanocrystals, are alluring increased attraction due to their highly refined chemistry, availability, and super tunable optical properties suitable for many applications in different research areas, such as photovoltaics, light-emitting devices, environmental sciences, and nanomedicine. Specifically, they are being widely used in bio-imaging in contrast to organic dyes due to their high brightness and improved photo-stability, and their ability to tune their absorption and emission spectra upon changing the crystal size. The production of CdSe QDs is mostly assisted by trioctylphosphine oxide compound, which acts as solvent or solubilizing agent and renders the QDs soluble in organic compounds (such as toluene, chloroform, and hexane) that are highly toxic. To circumvent the toxicity-related factor in CdSe QDs, we report the synthesis of CdSe QDs capped with thioglycolic acid (TGA) in an aqueous medium, and their biocompatibility in colo-205 cancer cells. In this study, the [Cd{sup 2+}]/[TGA] ratio was adjusted to 11:1 and the Se concentration (10 and 15 mM) was monitored in order to evaluate its influence on the optical properties and cytocompatibility. QDs resulted to be quite stable in water (after purification) and RPMI cell medium and no precipitation was observed for long contact times, making them appealing for in vitro experiments. The spectroscopy analysis, advanced electron microscopy, and X-ray diffractometry studies indicate that the final products were successfully formed exhibiting an improved optical response. Colo-205 cells being exposed to different concentrations of TGA-capped CdSe QDs for 12, 24, and 48 h with doses ranging from 0.5 to 2.0 mM show high tolerance reaching cell viabilities as high as 93 %. No evidence of cellular apoptotic pathways was observed as pointed out by our Annexin V assays at higher concentrations. Moreover, confocal microscopy analysis conducted to

  19. Cytocompatibility of direct water synthesized cadmium selenide quantum dots in colo-205 cells

    International Nuclear Information System (INIS)

    Cadmium selenide quantum dots (CdSe QDs), inorganic semiconducting nanocrystals, are alluring increased attraction due to their highly refined chemistry, availability, and super tunable optical properties suitable for many applications in different research areas, such as photovoltaics, light-emitting devices, environmental sciences, and nanomedicine. Specifically, they are being widely used in bio-imaging in contrast to organic dyes due to their high brightness and improved photo-stability, and their ability to tune their absorption and emission spectra upon changing the crystal size. The production of CdSe QDs is mostly assisted by trioctylphosphine oxide compound, which acts as solvent or solubilizing agent and renders the QDs soluble in organic compounds (such as toluene, chloroform, and hexane) that are highly toxic. To circumvent the toxicity-related factor in CdSe QDs, we report the synthesis of CdSe QDs capped with thioglycolic acid (TGA) in an aqueous medium, and their biocompatibility in colo-205 cancer cells. In this study, the [Cd2+]/[TGA] ratio was adjusted to 11:1 and the Se concentration (10 and 15 mM) was monitored in order to evaluate its influence on the optical properties and cytocompatibility. QDs resulted to be quite stable in water (after purification) and RPMI cell medium and no precipitation was observed for long contact times, making them appealing for in vitro experiments. The spectroscopy analysis, advanced electron microscopy, and X-ray diffractometry studies indicate that the final products were successfully formed exhibiting an improved optical response. Colo-205 cells being exposed to different concentrations of TGA-capped CdSe QDs for 12, 24, and 48 h with doses ranging from 0.5 to 2.0 mM show high tolerance reaching cell viabilities as high as 93 %. No evidence of cellular apoptotic pathways was observed as pointed out by our Annexin V assays at higher concentrations. Moreover, confocal microscopy analysis conducted to evaluate

  20. 49 CFR 571.205(a) - Glazing equipment manufactured before September 1, 2006 and glazing materials used in vehicles...

    Science.gov (United States)

    2010-10-01

    ... with 49 CFR 571.205 instead of this standard. S2. Purpose. The purpose of this standard is to reduce... the vehicle windows in collisions. S3. Application. This standard applies to glazing equipment... vehicles, multipurpose passenger vehicles, trucks, buses, and motorcycles. This standard also applies...

  1. 7 CFR 205.303 - Packaged products labeled “100 percent organic” or “organic.”

    Science.gov (United States)

    2010-01-01

    ... (CONTINUED) ORGANIC FOODS PRODUCTION ACT PROVISIONS NATIONAL ORGANIC PROGRAM Labels, Labeling, and Market Information § 205.303 Packaged products labeled “100 percent organic” or “organic.” (a) Agricultural products... product, the following: (1) The term, “100 percent organic” or “organic,” as applicable, to modify...

  2. 76 FR 41838 - Order Approving Adjustment for Inflation of the Dollar Amount Tests in Rule 205-3 Under the...

    Science.gov (United States)

    2011-07-15

    ... Adviser Performance Compensation, Investment Advisers Act Release No. 3198 (May 10, 2011) [76 FR 27959... COMMISSION Order Approving Adjustment for Inflation of the Dollar Amount Tests in Rule 205-3 Under the... dollar amount thresholds to account for the effects of inflation in 1998.\\3\\ \\3\\ See Exemption To...

  3. 5 CFR 352.205b - Authority to return an SES employee to his or her former or successor agency.

    Science.gov (United States)

    2010-01-01

    ... less than the SES rate of basic pay as determined under 5 CFR part 534, subpart D at which the employee... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Authority to return an SES employee to... Between Executive Agencies During Emergencies § 352.205b Authority to return an SES employee to his or...

  4. 13 CFR 124.205 - Can an applicant ask SBA to reconsider SBA's initial decision to decline its application?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Can an applicant ask SBA to... DETERMINATIONS 8(a) Business Development Applying to the 8(a) Bd Program § 124.205 Can an applicant ask SBA to... raised in the initial decline, the applicant can ask for reconsideration as if it were an initial decline....

  5. Ultraviolet continuous-wave laser source at 205 nm for hydrogen spectroscopy

    Science.gov (United States)

    Galtier, Sandrine; Nez, François; Julien, Lucile; Biraben, François

    This paper reports on the generation of 15 mW of continuous narrow-band laser source at 205 nm. The infra-red light source provided by a Titanium-Sapphire (TiSa) laser is mixed with the fourth harmonic of a Nd:YVO4 laser by the use of a β-barium borate (BBO) non-linear crystal. This highly reliable and powerful ultraviolet (UV) source is an ideal tool for the 1S-3S hydrogen spectroscopy. Moreover, the wide tunability of the TiSa laser combined with this experimental set up makes the generation of bright deep ultra-violet (D-UV) sources possible. In particular, we plan to produce a 194 nm continuous light beam which is necessary to perform the 1S-4S transition in hydrogen.

  6. Structure in liquid KTl investigated by means of neutron diffraction using 205Tl isotope substitution

    International Nuclear Information System (INIS)

    In recent neutron diffraction measurements on liquid KTl, a prepeak was observed in the structure factor at a rather low value of the wave vector of 8 nm-1. It corresponds to a periodicity in real space of 0.93 nm. In solid KTl and K8Tl11, Tl clusters of, respectively, 6 and 11 atoms occur. It was concluded that parts of these clusters survive in the liquid state. In order to obtain more information on the structure of the clusters, we have performed an additional neutron diffraction experiment on D4 (ILL, Grenoble France) using 205Tl isotope substitution. From the additional data it is concluded that the prepeak occurs only in the Tl-Tl partial structure factor. Using RMC modelling of the isotopic data we are able to determine partial structure factors. The average Tl-Tl coordination number is 4.00.1. (orig.)

  7. Sequence polymorphism of the mitochondrial DNA hypervariable regions I and II in 205 Singapore Malays.

    Science.gov (United States)

    Wong, Hang Yee; Tang, June S W; Budowle, Bruce; Allard, Marc W; Syn, Christopher K C; Tan-Siew, Wai Fun; Chow, Shui Tse

    2007-01-01

    Mitochondrial DNA sequences of the hypervariable regions HV1 and HV2 were analyzed in 205 unrelated ethnic Malays residing in Singapore as an initial effort to generate a database for forensic identification purposes. Sequence polymorphism was detected using PCR and direct sequencing analysis. A total of 152 haplotypes was found containing 152 polymorphisms. Out of the 152 haplotypes, 115 were observed only once and 37 types were seen in multiple individuals. The most common haplotype (16223T, 16295T, 16362C, 73G, 146C, 199C, 263G, and 315.1C) was shared by 7 (3.41%) individuals, two haplotypes were shared by 4 individuals, seven haplotypes were shared by 3 individuals, and 27 haplotypes by 2 individuals. Haplotype diversity and random match probability were estimated to be 0.9961% and 0.87%, respectively. PMID:17150401

  8. Relationship Between Net Photosynthetic Rate of Cassava SC205 and Its Physio-ecological Factors

    Institute of Scientific and Technical Information of China (English)

    Yong SONG; Xuan LIN; Jinhui YANG; Yuping DENG; Xingyao XIONG

    2014-01-01

    [Objective]The aim was to measure photosynthetic characters of SC 205, a cassava cultivar, and explore the relationships of the net photosynthetic rate (Pn) with physiological and ecological factors. [Method] The diurnal variations of photosyn-thesis in leaves of SC205 were studied by LICOR-6400 portable photosynthesis system, and the relationships of the net photosynthetic rate (Pn) with physiological and ecological factors were studied by simple correlation analysis and path analysis. [Result] The curve of diurnal variation of Pn showed single peak at 10:00 am at 24.07 μ mol CO2 m2/s, without showing midday depression; the diurnal changes of stomatal conductance (Gs), transpiration rate (Tr), leaf temperature (Tl), air tempera-ture (Ta) and photosynthetic active radiation (PAR) al showed single peak curves, and there were positive relationships of Pn with Gs, Tr, Tl, Ta and PAR. The diur-nal variations of intercellular CO2 concentration (Ci), atmospheric CO2 concentration (Ca), relative humidity (RH) showed in a U-shape curve. There were highly signifi-cant positive correlation of Pn with Gs and PAR; the diurnal variation of Pn had highly significant negative correlations with Ci and Ca. The direct impact of physio-logical factors on Pn was as fol ows: Ci>Gs>Tl>Tr, and the direct impact of ecologi-cal factors was RH>PAR>Ca>Ta. [Conclusion] The research showed that Ci, Gs and Tr play very important roles in the changes of Pn among the physiological fac-tors, and PAR and Ca affect the changes of Pn among the ecological factors.

  9. 205 nm continuous-wave laser: application to the measurement of the Lamb shift in hydrogen

    International Nuclear Information System (INIS)

    The subject of this thesis is the construction of an experimental set-up, and in particular of a tunable continuous-wave laser at 205 nm, for the measurement of the ground state Lamb shift in atomic hydrogen. Chapter 1 deals with the Lamb shift from a historical point of view, and with the interest of its measurement, for metrology and test of quantum electrodynamics. Chapter 2 is devoted to the theory of the hydrogen atom. The principle of the experiment is based on the comparison of two frequencies which are in a ratio of 4: those of the two-photon transitions of 2S-6S or 2S-6D and 1S-3S. Chapter 3 describes the experimental set-up used to measure the 2S-6D transition which is excited by a titanium-sapphire laser at 820 nm. The 205 nm light required to excite the 1S-3S transition is generated by two frequency-doubling of the titanium-sapphire laser, made in non-linear crystals placed in enhancement cavities. Chapter 4 is entirely devoted to the frequency-doubling. After a recall of non-linear optics, the enhancement cavities are described in detail, as well as the results we achieved. At last chapter 5 describes the research for a signal on the 1S-3S transition: the construction of a ground state atomic beam, and the development of the detection system. This work has led to a preliminary measurement of the ground state Lamb shift in atomic hydrogen: L(1S) = 8172.850 (174) MHz whose result is in very good agreement with both the previous measurements and the most recent theoretical results. (author)

  10. Treatment with the C5a receptor/CD88 antagonist PMX205 reduces inflammation in a murine model of allergic asthma.

    Science.gov (United States)

    Staab, Elizabeth B; Sanderson, Sam D; Wells, Sandra M; Poole, Jill A

    2014-08-01

    Allergic asthma is a chronic inflammatory airway disease arising from an aberrant immune response following exposure to environmental stimuli in genetically susceptible persons. The complement component 5 (C5)/C5a Receptor (C5aR/CD88) signaling pathway has been implicated in both experimental allergic asthma and human asthmatic disease. Targeting the C5a/C5aR signaling pathway in rodent models has been shown to either enhance or reduce allergic asthma consequences. Treatment with a recombinant humanized monoclonal antibody directed against C5 has shown unclear results in patients with asthma. The objective of this proof-of-concept animal study was to determine whether the low molecular weight C5aR peptidomimetic antagonist, PMX205, would reduce experimental allergic asthma consequences in mice. PMX205 or vehicle control was administered subcutaneously to BALB/c mice prior to and during standard ovalbumin (OVA) allergen sensitization and aerosolized challenge phases. PMX205 substantially reduced OVA-induced total cell (60%), neutrophil (66%) and eosinophil (65%) influxes in lavage fluid sampling. There were also significant reductions in OVA-induced lavage fluid IL-13 protein and lung Th2 cytokine gene expression with PMX205 administration. PMX205 treatment also diminished OVA-induced lung parenchyma cellular infiltration. PMX205 administration did not reduce OVA-induced serum IgE levels or epithelial mucous/goblet cell generation. There was no evidence of toxicity observed with PMX205 treatment in saline or OVA-challenged animals. These data provide evidence that pharmacologic blockade of C5aR by a low molecular weight antagonist (PMX205) reduces airway inflammatory cell and cytokine responses in experimental allergic asthma, and suggests that PMX205 might represent a novel therapeutic agent for reducing asthmatic outcomes. PMID:24859057

  11. Downregulation of miR-205 modulates cell susceptibility to oxidative and endoplasmic reticulum stresses in renal tubular cells.

    Directory of Open Access Journals (Sweden)

    Shiyo Muratsu-Ikeda

    Full Text Available BACKGROUND: Oxidative stress and endoplasmic reticulum (ER stress play a crucial role in tubular damage in both acute kidney injury (AKI and chronic kidney disease (CKD. While the pathophysiological contribution of microRNAs (miRNA to renal damage has also been highlighted, the effect of miRNA on renal damage under oxidative and ER stresses conditions remains elusive. METHODS: We assessed changes in miRNA expression in the cultured renal tubular cell line HK-2 under hypoxia-reoxygenation-induced oxidative stress or ER stress using miRNA microarray assay and real-time RT-PCR. The pathophysiological effect of miRNA was evaluated by cell survival rate, intracellular reactive oxygen species (ROS level, and anti-oxidant enzyme expression in miRNA-inhibited HK-2 or miRNA-overexpressed HK-2 under these stress conditions. The target gene of miRNA was identified by 3'-UTR-luciferase assay. RESULTS: We identified 8 and 10 miRNAs whose expression was significantly altered by oxidative and ER stresses, respectively. Among these, expression of miR-205 was markedly decreased in both stress conditions. Functional analysis revealed that decreased miR-205 led to an increase in cell susceptibility to oxidative and ER stresses, and that this increase was associated with the induction of intracellular ROS and suppression of anti-oxidant enzymes. While increased miR-205 by itself made no change in cell growth or morphology, cell viability under oxidative or ER stress conditions was partially restored. Further, miR-205 bound to the 3'-UTR of the prolyl hydroxylase 1 (PHD1/EGLN2 gene and suppressed the transcription level of EGLN2, which modulates both intracellular ROS level and ER stress state. CONCLUSIONS: miR-205 serves a protective role against both oxidative and ER stresses via the suppression of EGLN2 and subsequent decrease in intracellular ROS. miR-205 may represent a novel therapeutic target in AKI and CKD associated with oxidative or ER stress in tubules.

  12. Search for extinct natural radioactivity of Pb205 via thallium-isotope anomalies in chondrites and lunar soil.

    Science.gov (United States)

    Huey, J. M.; Kohman, T. P.

    1972-01-01

    Thallium and Pb204 contents were determined by stable-isotope-dilution analysis in 16 chondrites, one achondrite, and Apollo 11 and 12 lunar fines. Meteoritic thallium contents vary over a large range, 0.02 to 100 ppb, corresponding to the fact that thallium is a highly fractionated volatile element. Lunar thallium contents are less than 5 ppb. The Tl205/Tl203 ratio was determined in most of the samples, with precision ranging from 0.03% to several percent depending mainly on the amount of thallium present. No variations from the terrestrial ratio were observed. The chondritic isochron slope for Pb205 (13.8-m.y. half-life) is less than or equal to 0.00009 (99% confidence level), corresponding to an interval of at least 60 m.y. and possibly exceeding 120 m.y. between the termination of s-process nucleosynthesis and the lead-thallium fractionations.

  13. Cuminaldehyde from Cinnamomum verum Induces Cell Death through Targeting Topoisomerase 1 and 2 in Human Colorectal Adenocarcinoma COLO 205 Cells

    OpenAIRE

    Kuen-daw Tsai; Yi-Heng Liu; Ta-Wei Chen; Shu-Mei Yang; Ho-Yiu Wong; Jonathan Cherng; Kuo-Shen Chou; Jaw-Ming Cherng

    2016-01-01

    Cinnamomum verum, also called true cinnamon tree, is employed to make the seasoning cinnamon. Furthermore, the plant has been used as a traditional Chinese herbal medication. We explored the anticancer effect of cuminaldehyde, an ingredient of the cortex of the plant, as well as the molecular biomarkers associated with carcinogenesis in human colorectal adenocarcinoma COLO 205 cells. The results show that cuminaldehyde suppressed growth and induced apoptosis, as proved by depletion of the mit...

  14. Cultivation and identification of colon cancer stem cell-derived spheres from the Colo205 cell line

    International Nuclear Information System (INIS)

    Our group established a method to culture spheres under serum-free culture condition. However, the biological characteristics and the tumorigenicity of spheres are unknown. Here, we demonstrate that sphere cells expressed high levels of the putative colorectal cancer stem cell markers CD133 and CD44. The CD133-positive rates were 13.27 ± 5.62, 52.71 ± 16.97 and 16.47 ± 2.45% in sphere cells, regular Colo205 cells and differentiated sphere cells, respectively, while the CD44-positive rates were 62.92 ± 8.38, 79.06 ± 12.10 and 47.80 ± 2.5%, respectively, and the CD133/CD44-double-positive rates were 10.77 ± 4.96, 46.89 ± 19.17 and 12.41 ± 2.27%, respectively (P < 0.05). Cancer sphere cells formed crypt-like structures in 3-D culture. Moreover, cells from cancer spheres exhibited more tumorigenicity than regular Colo205 cells in a xenograft assay. The cancer sphere cells displayed much higher oncogenicity than regular Colo205 cells to initiate neoplasms, as assayed by H&E staining, Musashi-1 staining and electron microscopy. Our findings indicated that the sphere cells were enriched with cancer stem cells (CSCs), and exhibited more proliferation capacity, more differentiation potential and especially more tumorigenicity than regular Colo205 cells in vitro and in vivo. Further isolation and characterization of these CSCs may provide new insights for novel therapeutic targets and prognostic markers

  15. In-beam gamma-ray studies of high-spin isomeric states in 205Tl and 206Hg

    International Nuclear Information System (INIS)

    The region of nuclei near 208Pb provide a good proving ground for the nuclear shell model. One of the most interesting features of nuclei in this and other closed shell regions is the existence of high-spin, long-lived isomeric states. Such states allow for a detailed study of the nature of the nucleons composing the nucleus and the forces which bind these nucleons together. In the present study two such nuclear isomers have been studied (one in 205Tl and one in 206Hg) using the techniques of in-beam gamma-ray spectroscopy in conjunction with the nuclear reactions 204Hg(t,2nν)205Tl and 204Hg(t,pν)206Hg. One of these nuclear isomers, a J/sup pi/ = 25/2+ state in 205Tl, had been observed in a previous study but the decay scheme was only partially correct. In the present study the decay scheme was corrected and the gyromagnetic ratio of the isomeric state was measured. From this gyromagnetic ratio measurement the gyromagnetic ratio was determined for a proton in the 1h/sub 11/2/ proton orbital and the anomalous orbital contribution deltag/sub l/. This measurement was then used with a previous measurement for the h/sub 9/2/ proton orbital to deduce the orbital gyromagnetic ratio for an h orbital. The isomer in 206Hg was observed for the first time in the present study. The decay scheme of the isomer was deduced and the isomeric state was determined to have a spin and parity of 5-. The gyromagnetic ratio was also measured for this isomeric state. With this measurement it was possible, using the results from the 205Tl study, to deduce the spin gyromagnetic ratio for a proton in the 3s proton orbital

  16. Lack of systematic effects of the 5-hydroxytryptamine 3 receptor antagonist ICS 205-930 on gastric emptying and antral motor activity in patients with primary anorexia nervosa.

    OpenAIRE

    Stacher, G; Bergmann, H; Granser-Vacariu, G V; Wiesnagrotzki, S; Wenzelabatzi, T A; Gaupmann, G; Kugi, A; Steinringer, H; Schneider, C; Höbart, J

    1991-01-01

    1. The 5-hydroxytryptamine 3 receptor antagonist, ICS 205-930, has been reported to have potent effects on gastric smooth muscle and to enhance gastric emptying in animals, but findings in man have been inconsistent. 2. This study investigated the effects of ICS 205-930 on gastric emptying of an isotopically labelled semisolid 1168 kJ meal and on antral contractility in patients with primary anorexia nervosa, a condition frequently associated with impaired gastric motor function. 3. Thirteen ...

  17. Overexpression of CYP3A4 in a COLO 205 Colon Cancer Stem Cell Model in vitro

    International Nuclear Information System (INIS)

    Cancer stem cells (CSCs) seem to constitute a subpopulation of tumor cells that escape from chemotherapy and cause recurrent disease. Low proliferation rates, protection in a stem cell niche and overexpression of drug resistance proteins are considered to confer chemoresistance. We established an in vitro colon CSC-like model using the COLO 205 cell line, which revealed transiently increased expression of CD133 when transferred to serum-free stem cell culture medium. Assessment of global gene expression of COLO 205 cells under these conditions identified a set of upregulated genes including cytochrome P450 3A4 (CYP3A4) and aldehyde dehydrogenase 1A1 (ALDH1A1), as confirmed by real-time qPCR. ALDH1A1 is a CSC marker for certain tumor entities and confers resistance to cyclophosphamide. CYP3A4 is expressed in liver and colon and its overexpression seems particularly relevant in colon cancer, since it inactivates irinotecan and other xenobiotics, such as taxols and vinca alkaloids. In conclusion, this COLO 205 model provides evidence for CD133 induction concomitant with overexpression of CYP3A4, which, together with ATP-binding cassette, subfamily G, member 2 (ABCG2) and others, may have a role in chemoresistant colon CSCs and a negative impact on disease-free survival in colon cancer patients

  18. Effect of excitation current intensity on mechanical properties of ZL205A castings solidified under a traveling magnetic field

    Directory of Open Access Journals (Sweden)

    Xue-yi Fan

    2015-05-01

    Full Text Available The effect of excitation current intensity on the mechanical properties of ZL205A castings solidified under a traveling magnetic field was studied. The results of the experiment indicate that the excitation current intensity of the traveling magnetic field has a great influence on the mechanical properties of the ZL205A castings. When the excitation current intensity is 15 A, the tensile strength and elongation of ZL205A alloy castings increase 27.2% and 67.7%, respectively, compared with those of the same alloy solidified under gravity. The improvement of mechanical properties is attributed to the decrease of micro-porosity in the alloy. Under the traveling magnetic field, the feeding pressure in the alloy melt before solidification can be enhanced due to the electromagnetic force. Moreover, the melt flow induced by the traveling magnetic field can decrease the temperature gradient. The feeding resistance will be increased because the temperature gradient decrease. So traveling magnetic field has an optimum effect on feeding.

  19. Overexpression of CYP3A4 in a COLO 205 Colon Cancer Stem Cell Model in vitro

    Energy Technology Data Exchange (ETDEWEB)

    Olszewski, Ulrike [Ludwig Boltzmann Cluster of Translational Oncology, c/o Balderichgasse 26/13, A-1170 Vienna (Austria); Liedauer, Richard [Department of Pathophysiology, Medical University of Vienna, Währinger Gürtel 18-20, A-1090, Vienna (Austria); Ausch, Christoph [Department of Surgery, Danube Hospital, A-1220 Vienna (Austria); Thalhammer, Theresia [Department of Pathophysiology, Medical University of Vienna, Währinger Gürtel 18-20, A-1090, Vienna (Austria); Hamilton, Gerhard, E-mail: gerhard.hamilton@toc.lbg.ac.at [Ludwig Boltzmann Cluster of Translational Oncology, c/o Balderichgasse 26/13, A-1170 Vienna (Austria)

    2011-03-22

    Cancer stem cells (CSCs) seem to constitute a subpopulation of tumor cells that escape from chemotherapy and cause recurrent disease. Low proliferation rates, protection in a stem cell niche and overexpression of drug resistance proteins are considered to confer chemoresistance. We established an in vitro colon CSC-like model using the COLO 205 cell line, which revealed transiently increased expression of CD133 when transferred to serum-free stem cell culture medium. Assessment of global gene expression of COLO 205 cells under these conditions identified a set of upregulated genes including cytochrome P450 3A4 (CYP3A4) and aldehyde dehydrogenase 1A1 (ALDH1A1), as confirmed by real-time qPCR. ALDH1A1 is a CSC marker for certain tumor entities and confers resistance to cyclophosphamide. CYP3A4 is expressed in liver and colon and its overexpression seems particularly relevant in colon cancer, since it inactivates irinotecan and other xenobiotics, such as taxols and vinca alkaloids. In conclusion, this COLO 205 model provides evidence for CD133 induction concomitant with overexpression of CYP3A4, which, together with ATP-binding cassette, subfamily G, member 2 (ABCG2) and others, may have a role in chemoresistant colon CSCs and a negative impact on disease-free survival in colon cancer patients.

  20. Optimizing production of Pb beams for 205,210Pb analysis by Accelerator Mass Spectrometry

    Science.gov (United States)

    Sookdeo, Adam; Cornett, Jack; Kieser, William E.

    2015-10-01

    The measurement of rare radioactive lead isotopes (205Pb or 210Pb) by AMS requires the production of strong Pb negative molecular anion beams from the ion source. This paper summarizes the results of tests of different target composition on the strength and stability of 208PbF3- currents and 210Pb counts. In an 834 SIMS-type Cs+ sputter source, the superhalogen, PbF3- had the largest current or ionization efficiency from a survey of Pb molecular anions. The target matrix that produced the largest current of PbF3- was composed of PbF2, AgF2 and CsF. The ratio of AgF2 and CsF does not affect the ionization efficiency of PbF3-. Chemically refluxed targets of PbF2, AgF2 and CsF increased the ionization efficiency of PbF3-. The count rate of the rare isotope, 210Pb, was increased with the addition of microgram quantities of stable PbF2 to the targets. In an SO-110 type Cs+ sputter source the ionization efficiency of PbF3- was increased with lower rather than higher Cs+ fluence.

  1. Results of the radiological survey at 205 Main Street, Lodi, New Jersey (LJ075)

    International Nuclear Information System (INIS)

    Maywood Chemical Works (MCW) of Maywood, New Jersey, generated process wastes and residues associated with the production and refining of thorium and thorium compounds from monazite ores from 1916 to 1956. MCW supplied rare earth metals and thorium compounds to the Atomic Energy Commission and various other government agencies from the late 1940s to the mid-1950s. Area residents used the sandlike waste from this thorium extraction process mixed with tea and cocoa leaves as mulch in their yards. Some of these contaminated wastes were also eroded from the site into Lodi Brook. At the request of the US Department of Energy (DOE), a group from Oak Ridge National Laboratory conducts investigative radiological surveys of properties in the vicinity of MCW to determine whether a property is contaminated with radioactive residues, principally 232Th, derived from the MCW site. The survey typically includes direct measurement of gamma radiation levels and soil sampling for radionuclide analyses. The survey of this site, 205 Main Street, Lodi, New Jersey (LJ075), was conducted during 1987 and 1988. Results of the survey indicated radioactivity in the range of normal background for the northern New Jersey area. Radiological assessments of soil samples from the site demonstrate no radionuclide concentrations in excess of DOE Formerly Utilized Sites Remedial Action Program criteria. 5 refs., 21 figs., 3 tabs

  2. MicroRNA-205 directly targets Krüppel-like factor 12 and is involved in invasion and apoptosis in basal-like breast carcinoma.

    Science.gov (United States)

    Guan, Bing; Li, Qing; Shen, Li; Rao, Qiu; Wang, Yan; Zhu, Yun; Zhou, Xiao-Jun; Li, Xiao-Hong

    2016-08-01

    We investigated microRNAs (miRs) specific to its target gene and exerting distinct biological functions for basal-like breast carcinoma (BLBC). Total RNA was extracted and subjected to miR microarray and bioinformatics analysis. Based on the comprehensive analysis, expression of miRs including its target was analyzed by quantitative reverse transcription-polymerase chain reaction (qRT-PCR), western blot analysis and immunohistochemistry (IHC). Further functional analyses were conducted including proliferation, invasion and apoptosis. miR-205 was identified as downregulated (less than 0.5-fold) in BLBC relatively to normal control (NC). Gene ontology (GO) analysis suggested miR-205 may directly targeted Krüppel-like factor 12 (KLF12; degree=4). Luciferase assay revealed miR-205 directly targeted KLF12 through binding its 3'-untranslated region (3'-UTR; p=0.0016). qRT-PCR and western blot analysis showed miR-205 expression was low in cells (p=0.007) and tumor tissues (n=6; p=0.0074), and KLF12 RNA/protein was observed at high levels in cells (p=0.0026; p=0.0079) and tumor tissues (n=9; p=0.0083); knock-up of miR-205 increased its expression (p=0.0021) but reduced KLF12 RNA/protein levels (p=0.0038; p=0.009) in cells. Modulation of miR-205 expression by transfecting its mimics in cells, was involved in invasion (p=0.00175) and apoptosis (p=0.006). In conclusion, our results supported that miR-205 was a miR specific to BLBC which functioned as tumor suppressor gene through directly targeting and negatively regulating proto-oncogene KLF12. miR-205 dysregulation was involved in invasion and apoptosis. miR-205 and KLF12 provided a potential diagnosis biomarker and therapeutic approach for BLBC. PMID:27278159

  3. Improved absorption cross-sections of oxygen in the wavelength region 205-240 nm of the Herzberg continuum

    Science.gov (United States)

    Yoshino, K.; Cheung, A. S.-C.; Esmond, J. R.; Parkinson, W. H.; Freeman, D. E.

    1988-01-01

    The laboratory values of the Herzberg continuum absorption cross-section of oxygen at room temperature from Cheung et al. (1986) and Jenouvrier et al. (1986) are compared and analyzed. It is found that there is no discrepancy between the absolute values of these two sets of independent measurements. The values are combined in a linear least-squares fit to obtain improved values of the Herzberg continuum cross-section of oxygen at room temperature throughout the wavelength region 205-240 nm. The results are compared with in situ and other laboratory measurements.

  4. Vortex states of Tl2Ba2CuO6+δ studied via 205Tl NMR at 2 tesla

    International Nuclear Information System (INIS)

    We report a 205Tl NMR study of vortex states in an aligned polycrystalline sample of an overdoped high-Tc superconductor, Tl2Ba2CuO6+δ (Tc - 85 K), at a magnetic field of 2 T along the c axis. We observed an imperfect vortex lattice, so-called Bragg glass, at T=5 K, the coexistence of vortex solid and vortex liquid between 10 and 60 K, and vortex melting between 65 and 85 K. No evidence for local antiferromagnetic ordering at vortex cores was found for our sample. (author)

  5. Bismuth absorption from 205 Bi-labelled pharmaceutical bismuth compounds used in the treatment of peptic ulcer disease

    International Nuclear Information System (INIS)

    The absorption of bismuth from five 205Bi-labelled pharmaceutically used bismuth compounds was studied in man. From single oral doses of all compounds under investigation only <0.1% bismuth was absorbed and excreted with the urine. A significantly higher absorption was observed from the colloidal bismuth subcitrate and the basic bismuth gallate than from the basic bismuth salicylate, nitrate and aluminate. No retention of bismuth in the whole body was found from the single dose experiment. The biologic fast-term half-lives of absorbed bismuth were calculated to be 0.12 and 1.5 days. 14 refs., 2 figs., 1 tab

  6. Bismuth absorption from sup 205 Bi-labelled pharmaceutical bismuth compounds used in the treatment of peptic ulcer disease

    Energy Technology Data Exchange (ETDEWEB)

    Dresow, B.; Fischer, R.; Gabbe, E.E.; Wendel, J.; Heinrich, H.C. (Eppendorf University Hospital, Hamburg (Germany))

    1992-04-01

    The absorption of bismuth from five {sup 205}Bi-labelled pharmaceutically used bismuth compounds was studied in man. From single oral doses of all compounds under investigation only <0.1% bismuth was absorbed and excreted with the urine. A significantly higher absorption was observed from the colloidal bismuth subcitrate and the basic bismuth gallate than from the basic bismuth salicylate, nitrate and aluminate. No retention of bismuth in the whole body was found from the single dose experiment. The biologic fast-term half-lives of absorbed bismuth were calculated to be 0.12 and 1.5 days. 14 refs., 2 figs., 1 tab.

  7. Process for producing astatine-211 for radiopharmaceutical use

    International Nuclear Information System (INIS)

    A one-step chemical manipulation is described in combination with a distillation and collection process for producing At-211 comprising; a. providing a target of irradiated Bismuth coated to a predetermined thickness of a backing member, b. providing a vapor-producing still operably connected with a condenser that has a water cooled condensate collector formed of a dry silica gel mesh maintained at a temperature above the freezing point of water, and providing an effluent gas filter that is operably connected to receive effluent gas from the condenser, c. heating the target in the still at a temperature in the range of about 6300-6800C for a time period in the range of 50 to 80 minutes, to evole At-211 vapor from the target, c. providing a dry carrier gas having an oxygen concentration that is sufficient to form Bi/sub 2/O/sub 3/ thereby to essentially preclude vaporization of Bi metal, passing the carrier gas through the still to carry the At-211 vapor to the condenser, and to carry effluent from the condenser to the effluent gas filter, e. eluting At-211 from the condensate collector of the condenser with a controlled volume of eluent containing predetermined solvents that are compatible with a given desired radiopharmaceutical procedure, and f. collecting the At-211 in the controlled volume of eluent for use in the given radiopharmaceutical procedure

  8. The Ionized Gas in Nearby Galaxies as Traced by the [NII] 122 and 205 \\mu m Transitions

    CERN Document Server

    Herrera-Camus, R; Smith, J D; Draine, B; Pellegrini, E; Wolfire, M; Croxall, K; de Looze, I; Calzetti, D; Kennicutt, R; Crocker, A; Armus, L; van der Werf, P; Sandstrom, K; Galametz, M; Brandl, B; Groves, B; Rigopoulou, D; Walter, F; Leroy, A; Boquien, M; Tabatabaei, F S; Beirao, P

    2016-01-01

    The [NII] 122 and 205 \\mu m transitions are powerful tracers of the ionized gas in the interstellar medium. By combining data from 21 galaxies selected from the Herschel KINGFISH and Beyond the Peak surveys, we have compiled 141 spatially resolved regions with a typical size of ~1 kiloparsec, with observations of both [NII] far-infrared lines. We measure [NII] 122/205 line ratios in the ~0.6-6 range, which corresponds to electron gas densities $n_e$~1-300 cm$^{-3}$, with a median value of $n_e$=30 cm$^{-3}$. Variations in the electron density within individual galaxies can be as a high as a factor of ~50, frequently with strong radial gradients. We find that $n_e$ increases as a function of infrared color, dust-weighted mean starlight intensity, and star formation rate surface density ($\\Sigma_{SFR}$). As the intensity of the [NII] transitions is related to the ionizing photon flux, we investigate their reliability as tracers of the star formation rate (SFR). We derive relations between the [NII] emission and...

  9. Planetary nebulae: the universal mass-metallicity relation for Local Group dwarf galaxies and the chemistry of NGC 205

    CERN Document Server

    Gonçalves, D R; Teodorescu, Ana M; Carneiro, Carolina M

    2014-01-01

    Here we study 16 planetary nebulae (PNe) in the dwarf irregular galaxy NGC 205 by using GMOS@Gemini spectra to derive their physical and chemical parameters. The chemical patterns and evolutionary tracks for 14 of our PNe suggest that there are no type I PNe among them. These PNe have an average oxygen abundance of 12+log(O/H)=8.08$\\pm$0.28, progenitor masses of 2-2.5M$_{\\odot}$ and thus were born ~1.0-1.7Gyr ago. Our results are in good agreement with previous PN studies in NGC 205. The present 12+log(O/H) is combined with our previous works and with the literature to study the PN metallicity trends of the Local Group (LG) dwarf galaxies, in an effort to establish the PN luminosity- and mass-metallicity relations (LZR and MZR) for the LG dwarf irregulars (dIrrs) and dwarf spheroidals (dSphs). Previous attempts to obtain such relations failed to provide correct conclusions because were based on limited samples (Richer & McCall 1995; Gon\\c{c}calves et al. 2007). As far as we are able to compare stellar wit...

  10. MiRNA-205 modulates cellular invasion and migration via regulating zinc finger E-box binding homeobox 2 expression in esophageal squamous cell carcinoma cells

    Directory of Open Access Journals (Sweden)

    Yamashita Shunichi

    2011-03-01

    Full Text Available Abstract Background Esophageal squamous cell carcinoma (ESCC is often diagnosed at later stages until they are incurable. MicroRNA (miR is a small, non-coding RNA that negatively regulates gene expression mainly via translational repression. Accumulating evidence indicates that deregulation of miR is associated with human malignancies including ESCC. The aim of this study was to identify miR that could be specifically expressed and exert distinct biological actions in ESCC. Methods Total RNA was extracted from ESCC cell lines, OE21 and TE10, and a non-malignant human esophageal squamous cell line, Het-1A, and subjected to microarray analysis. Expression levels of miR that showed significant differences between the 2 ESCC and Het-1A cells based on the comprehensive analysis were analyzed by the quantitative reverse transcriptase (RT-PCR method. Then, functional analyses, including cellular proliferation, apoptosis and Matrigel invasion and the wound healing assay, for the specific miR were conducted. Using ESCC tumor samples and paired surrounding non-cancerous tissue obtained endoscopically, the association with histopathological differentiation was examined with quantitative RT-PCR. Results Based on the miR microarray analysis, there were 14 miRs that showed significant differences (more than 2-fold in expression between the 2 ESCC cells and non-malignant Het-1A. Among the significantly altered miRs, miR-205 expression levels were exclusively higher in 5 ESCC cell lines examined than any other types of malignant cell lines and Het-1A. Thus, miR-205 could be a specific miR in ESCC. Modulation of miR-205 expression by transfection with its precursor or anti-miR-205 inhibitor did not affect ESCC cell proliferation and apoptosis, but miR-205 was found to be involved in cell invasion and migration. Western blot revealed that knockdown of miR-205 expression in ESCC cells substantially enhanced expression of zinc finger E-box binding homeobox 2

  11. Equilibrium binding constants for Tl+ with gramicidins A, B and C in a lysophosphatidylcholine environment determined by 205Tl nuclear magnetic resonance spectroscopy.

    OpenAIRE

    Hinton, J F; Koeppe, R E; Shungu, D; Whaley, W L; Paczkowski, J A; Millett, F S

    1986-01-01

    Nuclear Magnetic Resonance (NMR) 205Tl spectroscopy has been used to monitor the binding of Tl+ to gramicidins A, B, and C packaged in aqueous dispersions of lysophosphatidylcholine. For 5 mM gramicidin dimer in the presence of 100 mM lysophosphatidylcholine, only approximately 50% or less of the gramicidin appears to be accessible to Tl+. Analysis of the 205Tl chemical shift as a function of Tl+ concentration over the 0.65-50 mM range indicates that only one Tl+ ion can be bound by gramicidi...

  12. 23上205综采工作面过薄煤区回采对策与实践%Countermeasure and practice of 23 205 fully mechanized working face Mining through the Seam thinned area

    Institute of Scientific and Technical Information of China (English)

    宋崇崇; 朱朝领

    2014-01-01

    综合分析23上205综采工作面无煤区地质情况和现用回采设备技术参数,研究对策,制定安全开采措施与合理回采方案,实现不搬家不跳采且达到综采面安全回采的目的。%This paper comprehensively analyzed the geological conditions of no coal zone and the current mining equipment and technology parameters of 23205 fully mechanized working face, researched countermeasure, formulated the safety mining measures and reasonable mining scheme, and achieved the safety mining of fully mechanized mining face without moving and skip-mining.

  13. 205 nm continuous-wave laser: application to the measurement of the Lamb shift in hydrogen; Laser continu a 205 nm: application a la mesure du deplacement de lamb dans l'hydrogene

    Energy Technology Data Exchange (ETDEWEB)

    Bourzeix, S

    1995-01-15

    The subject of this thesis is the construction of an experimental set-up, and in particular of a tunable continuous-wave laser at 205 nm, for the measurement of the ground state Lamb shift in atomic hydrogen. Chapter 1 deals with the Lamb shift from a historical point of view, and with the interest of its measurement, for metrology and test of quantum electrodynamics. Chapter 2 is devoted to the theory of the hydrogen atom. The principle of the experiment is based on the comparison of two frequencies which are in a ratio of 4: those of the two-photon transitions of 2S-6S or 2S-6D and 1S-3S. Chapter 3 describes the experimental set-up used to measure the 2S-6D transition which is excited by a titanium-sapphire laser at 820 nm. The 205 nm light required to excite the 1S-3S transition is generated by two frequency-doubling of the titanium-sapphire laser, made in non-linear crystals placed in enhancement cavities. Chapter 4 is entirely devoted to the frequency-doubling. After a recall of non-linear optics, the enhancement cavities are described in detail, as well as the results we achieved. At last chapter 5 describes the research for a signal on the 1S-3S transition: the construction of a ground state atomic beam, and the development of the detection system. This work has led to a preliminary measurement of the ground state Lamb shift in atomic hydrogen: L(1S) = 8172.850 (174) MHz whose result is in very good agreement with both the previous measurements and the most recent theoretical results. (author)

  14. miR-184及miR-205在绵羊不同生长时期毛囊及其他组织中的表达研究%The Study on Expression of miR-184 and miR-205 at Different Developmental Stages of Hair Follicle and Other Tissues of Sheep

    Institute of Scientific and Technical Information of China (English)

    唐晓惠; 柳广斌; 杜小勇; 曹建华; 李新云; 罗章; 余梅; 赵书红

    2012-01-01

    In order to study the roles of miR-184 and miR205 in hair follicle development of sheep, the expression of miR-184 and miR-205 at three different developmental stages of hair follicle of sheep was detected by QPCR. The precursors of the two microRNAs was predicted and the sequences were mapped to genome of sheep. Furthermore target genes and pathways of the two microRNAs were predicted. The results indicated that the expression of miR-184 in hair follicle tissue showed increasing trend from anagen to telogen. However, the miR-205 was upregulated from anagen to catagen, and then downregulated from catagen to telogen. The expression of miR-205 was highest in catagen. miR-184 and miR-205 both express in many different tiusses. Moreover, the candidate target genes of the two microRNAs are involved in 15 different pathways and miR-184 and miR-205 probably regulate the hair follicle development through Wnt signaling pathway.%为了研究miR-184及miR-205在绵羊毛囊发育过程中的作用,本研究以绵羊为研究材料,检测了miR-184及miR-205在毛囊3个发育时期及不同组织中的表达情况,进行了基因组定位及前体预测,并预测了可能的靶基因及调控的基因通路.结果发现,miR-184的表达量从毛囊生长期到衰退期呈逐步上升的趋势,而miR-205则表现为先上升后下降,其在衰退期表达量最高.2个microRNA在绵羊的多个组织中均有表达.两者的候选靶基因涉及15个基因通路,可能通过Wnt通路调控毛囊的生长周期.

  15. 41 CFR 302-3.205 - If my transfer is involuntary (due to i.e., reduction in force, cessation, or transfer of work...

    Science.gov (United States)

    2010-07-01

    ... TYPE Types of Transfers Reduction in Force Relocation § 302-3.205 If my transfer is involuntary (due to i.e., reduction in force, cessation, or transfer of work), is it considered to be in the interest of... involuntary (due to i.e., reduction in force, cessation, or transfer of work), is it considered to be in...

  16. Inhibition of fibrin polymerization by synthetic peptides corresponding to Aalpha195-205 and gamma69-77 sites of fibrin molecule

    NARCIS (Netherlands)

    Pozniak, T.A.; Urvant, L.P.; Gritsenko, P.; Chernishov, V.I.; Pydiura, N.A.; Lugovskoi, E.V.; Komisarenko, S.V.

    2014-01-01

    Using the idea of "proline brackets" we have found four sites in fibrin amino acid sequence, and appropriate peptides were synthesized: gamma69NPDESSKPN77, Bbeta228QPDSSVKPY236, Bbeta455RPFFPQ460 and Aalpha195LPSRDRQHLPL205. Turbidity and electron-microscopy analyses have demonstrated that synthetic

  17. 7 CFR 1901.205 - Nondiscrimination in construction financed with FmHA or its successor agency under Public Law 103...

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 12 2010-01-01 2010-01-01 false Nondiscrimination in construction financed with FmHA... PROGRAM-RELATED INSTRUCTIONS Civil Rights Compliance Requirements § 1901.205 Nondiscrimination in construction financed with FmHA or its successor agency under Public Law 103-354 loan or grant. Executive...

  18. Structural aspects of B2O3-substituted (PbO)0.5(SiO2)0.5 glasses

    International Nuclear Information System (INIS)

    Lead borosilicate glasses having general formulae (PbO)0.5-x(SiO2)0.5(B2O3)x with 0.0≤x≤0.4 and (PbO)0.5(SiO2)0.5-y(B2O3)y with 0.0≤y≤0.5 have been prepared by a conventional melt-quench method and characterized by 29 Si, 11 B magic angle spinning (MAS) NMR techniques and infrared spectroscopy, as regards their structural features. From 29 Si NMR results, it has been inferred that with increasing concentration of boron oxide, (PbO)0.5-x(SiO2)0.5(B2O3)x glasses exhibit a systematic increase in the number of Q4 structural units of Si at the expense of Q2 structural units, along with the formation of Si-O-B linkages. On the other hand, for (PbO)0.5(SiO2)0.5-y(B2O3)y glasses, there is no direct interaction between SiO2and B2O3 in the glass network, as revealed by the 29 Si MAS NMR studies. Boron exists in both trigonal and tetrahedral configurations for these two series of glasses and for the (PbO)0.5(SiO2)0.5-y(B2O3)y series of glasses; the relative concentration of these two structural units remains almost constant with increasing B2O3 concentration. In contrast, for (PbO)0.5-x(SiO2)0.5(B2O3)x glasses, there is a slight increase in the number of BO3 structural units above x = 0.2, as there is a competition between SiO2 and B2O3 for interaction with Pb2+, thereby leading to the formation of BO3 structural units. For both series of glasses, the thermal expansion coefficient is found to decrease with increasing B2O3 concentration, the effect being more pronounced for the (PbO)0.5-x(SiO2)0.5(B2O3)x series of glasses due to the increased concentration of Q4structural units of silicon and better cross-linking as a result of the formation of Si-O-B-type linkages. (author)

  19. Dark clouds in the vicinity of the emission nebula Sh2-205: interstellar extinction and distances

    Science.gov (United States)

    Straižys, V.; Čepas, V.; Boyle, R. P.; Zdanavičius, J.; Maskoliūnas, M.; Kazlauskas, A.; Zdanavičius, K.; Černis, K.

    2016-04-01

    Results of CCD photometry in the seven-colour Vilnius system for 922 stars down to V = 16-17 mag and for 302 stars down to 19.5 mag are used to investigate the interstellar extinction in an area of 1.5 square degrees in the direction of the P7 and P8 clumps of the dark cloud TGU H942, which lies in the vicinity of the emission nebula Sh2-205. In addition, we used 662 red clump giants that were identified by combining the 2MASS and WISE infrared surveys. The resulting plots of extinction versus distance were compared with previous results of the distribution and radial velocities of CO clouds and with dust maps in different passbands of the IRAS and WISE orbiting observatories. A possible distance of the front edge of the nearest cloud layer at 130 ± 10 pc was found. This dust layer probably covers all the investigated area, which results in extinction of up to 1.8 mag in some directions. A second rise of the extinction seems to be present at 500-600 pc. Within this layer, the clumps P7 and P8 of the dust cloud TGU H942, the Sh2-205 emission nebula, and the infrared cluster FSR 655 are probably located. In the direction of these clouds, we identified 88 young stellar objects and a new infrared cluster. Full Tables 1 and 2 are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/590/A21

  20. A HERSCHEL SURVEY OF THE [N II] 205 μm LINE IN LOCAL LUMINOUS INFRARED GALAXIES: THE [N II] 205 μm EMISSION AS A STAR FORMATION RATE INDICATOR

    International Nuclear Information System (INIS)

    We present, for the first time, a statistical study of [N II] 205 μm line emission for a large sample of local luminous infrared galaxies using Herschel Spectral and Photometric Imaging Receiver Fourier Transform Spectrometer (SPIRE FTS) data. For our sample of galaxies, we investigate the correlation between the [N II] luminosity (L[NII]) and the total infrared luminosity (LIR), as well as the dependence of L[NII]/LIR ratio on LIR, far-infrared colors (IRAS f60/f100), and the [O III] 88 μm to [N II] luminosity ratio. We find that L[NII] correlates almost linearly with LIR for non-active galactic nucleus galaxies (all having LIR 12 L☉) in our sample, which implies that L[NII] can serve as a star formation rate tracer which is particularly useful for high-redshift galaxies that will be observed with forthcoming submillimeter spectroscopic facilities such as the Atacama Large Millimeter/submillimeter Array. Our analysis shows that the deviation from the mean L[NII]-LIR relation correlates with tracers of the ionization parameter, which suggests that the scatter in this relation is mainly due to the variations in the hardness, and/or ionization parameter, of the ambient galactic UV field among the sources in our sample.

  1. 2.05 μm ytterbium–holmium doped all-fiber gain-switched pulsed laser pumped at 1064 nm

    International Nuclear Information System (INIS)

    The novel, extremely simple to assemble, design of a ∼2.05 µm ytterbium–holmium co-doped all-fiber laser (YHDFL) oscillating in the gain-switching pulsed regime is reported. The YHDFL is pumped by a 1064 nm ytterbium doped fiber laser, while pulsing at ∼2.05 µm, is accomplished using an acousto-optic modulator placed between the two lasers. At the optimal conditions, the YHDFL produces a train of very stable, single per modulation period, pulses, 1 µJ in energy and 1 µs in duration at a 3 dB level, at repetition rates of 50…60 kHz. (letter)

  2. Surface display of an anti-DEC-205 single chain Fv fragment in Lactobacillus plantarum increases internalization and plasmid transfer to dendritic cells in vitro and in vivo

    OpenAIRE

    Christophe, Michon; Kuczkowska, Katarzyna; Langella, Philippe; Eijsink, Vincent; Mathiesen, Geir; Chatel, Jean-Marc

    2015-01-01

    Background Lactic acid bacteria (LAB) are promising vehicles for delivery of a variety of medicinal compounds, including antigens and cytokines. It has also been established that LAB are able to deliver cDNA to host cells. To increase the efficiency of LAB-driven DNA delivery we have constructed Lactobacillus plantarum strains targeting DEC-205, which is a receptor located at the surface of dendritic cells (DCs). The purpose was to increase uptake of bacterial cells, which could lead to impro...

  3. Characterization of novel human papillomavirus types 157, 158 and 205 from healthy skin and recombination analysis in genus γ-Papillomavirus.

    Science.gov (United States)

    Bolatti, Elisa M; Chouhy, Diego; Casal, Pablo E; Pérez, Germán R; Stella, Emma J; Sanchez, Adriana; Gorosito, Mario; Bussy, Ramón Fernandez; Giri, Adriana A

    2016-08-01

    Gammapapillomavirus (γ-PV) is a diverse and rapidly expanding genus, currently consisting of 79 fully characterized human PV (HPV) types. In this study, three novel types, HPV157, HPV158 and HPV205, obtained from healthy sun-exposed skin of two immunocompetent individuals, were amplified by the "Hanging droplet" long PCR technique, cloned, sequenced and characterized. HPV157, HPV158 and HPV205 genomes comprise 7154-bp, 7192-bp and 7298-bp, respectively, and contain four early (E1, E2, E6 and E7) and two late genes (L1 and L2). Phylogenetic analysis of the L1 ORF placed all novel types within the γ-PV genus: HPV157 was classified as a new member of species γ-12 while HPV158 and HPV205 belong to species γ-1. We then explored potential recombination events in genus γ-PV with the RDP4 program in a dataset of 74 viruses (71 HPV types with available full-length genomes and the 3 novel types). Two events, both located in the E1 ORF, met the inclusion criterion (p-values genus γ-PV. PMID:27108808

  4. Cuminaldehyde from Cinnamomum verum Induces Cell Death through Targeting Topoisomerase 1 and 2 in Human Colorectal Adenocarcinoma COLO 205 Cells.

    Science.gov (United States)

    Tsai, Kuen-Daw; Liu, Yi-Heng; Chen, Ta-Wei; Yang, Shu-Mei; Wong, Ho-Yiu; Cherng, Jonathan; Chou, Kuo-Shen; Cherng, Jaw-Ming

    2016-01-01

    Cinnamomum verum, also called true cinnamon tree, is employed to make the seasoning cinnamon. Furthermore, the plant has been used as a traditional Chinese herbal medication. We explored the anticancer effect of cuminaldehyde, an ingredient of the cortex of the plant, as well as the molecular biomarkers associated with carcinogenesis in human colorectal adenocarcinoma COLO 205 cells. The results show that cuminaldehyde suppressed growth and induced apoptosis, as proved by depletion of the mitochondrial membrane potential, activation of both caspase-3 and -9, and morphological features of apoptosis. Moreover, cuminaldehyde also led to lysosomal vacuolation with an upregulated volume of acidic compartment and cytotoxicity, together with inhibitions of both topoisomerase I and II activities. Additional study shows that the anticancer activity of cuminaldehyde was observed in the model of nude mice. Our results suggest that the anticancer activity of cuminaldehyde in vitro involved the suppression of cell proliferative markers, topoisomerase I as well as II, together with increase of pro-apoptotic molecules, associated with upregulated lysosomal vacuolation. On the other hand, in vivo, cuminaldehyde diminished the tumor burden that would have a significant clinical impact. Furthermore, similar effects were observed in other tested cell lines. In short, our data suggest that cuminaldehyde could be a drug for chemopreventive or anticancer therapy. PMID:27231935

  5. Cuminaldehyde from Cinnamomum verum Induces Cell Death through Targeting Topoisomerase 1 and 2 in Human Colorectal Adenocarcinoma COLO 205 Cells

    Directory of Open Access Journals (Sweden)

    Kuen-daw Tsai

    2016-05-01

    Full Text Available Cinnamomum verum, also called true cinnamon tree, is employed to make the seasoning cinnamon. Furthermore, the plant has been used as a traditional Chinese herbal medication. We explored the anticancer effect of cuminaldehyde, an ingredient of the cortex of the plant, as well as the molecular biomarkers associated with carcinogenesis in human colorectal adenocarcinoma COLO 205 cells. The results show that cuminaldehyde suppressed growth and induced apoptosis, as proved by depletion of the mitochondrial membrane potential, activation of both caspase-3 and -9, and morphological features of apoptosis. Moreover, cuminaldehyde also led to lysosomal vacuolation with an upregulated volume of acidic compartment and cytotoxicity, together with inhibitions of both topoisomerase I and II activities. Additional study shows that the anticancer activity of cuminaldehyde was observed in the model of nude mice. Our results suggest that the anticancer activity of cuminaldehyde in vitro involved the suppression of cell proliferative markers, topoisomerase I as well as II, together with increase of pro-apoptotic molecules, associated with upregulated lysosomal vacuolation. On the other hand, in vivo, cuminaldehyde diminished the tumor burden that would have a significant clinical impact. Furthermore, similar effects were observed in other tested cell lines. In short, our data suggest that cuminaldehyde could be a drug for chemopreventive or anticancer therapy.

  6. Along the N=126 closed shell: study of $^{205}$Au through its $\\pi h_{11/2}^{-1}$ isomeric decay

    CERN Multimedia

    2002-01-01

    Excited states have been identified in only three of the N=126 closed shell nuclei 'below' $^{208}$Pb, $^{207}$Tl, $^{206}$Hg and very recently $^{204}$Pt. We aim to extend our knowledge of the neutron-rich N=126 nuclei by observing the internal decay of the $\\pi h^{-1}_{11/2}$ excited state in $^{205}$Au, which is expected to be isomeric. In addition, the decay of the analogous states in the N=122 and N=124 $^{201,203}$Au will be studied. The lifetimes of the expected isomeric states are crucial for the success of the experiment, and they are estimated to be in the range of 0.3-20 s. These are long enough to enable the extraction from the source, but shorter than the $\\beta$-decay half-lives. Proton single-particle energies and transition rates will be extracted, providing information about the robustness of the N=126 shell-closure. Three days of beam-time is requested.

  7. A HERSCHEL SURVEY OF THE [N II] 205 {mu}m LINE IN LOCAL LUMINOUS INFRARED GALAXIES: THE [N II] 205 {mu}m EMISSION AS A STAR FORMATION RATE INDICATOR

    Energy Technology Data Exchange (ETDEWEB)

    Zhao Yinghe; Gao Yu [Purple Mountain Observatory, Chinese Academy of Sciences, Nanjing 210008 (China); Lu, Nanyao; Xu, C. Kevin; Lord, S.; Howell, J.; Appleton, P.; Mazzarella, J.; Schulz, B. [Infrared Processing and Analysis Center, California Institute of Technology, MS 100-22, Pasadena, CA 91125 (United States); Isaak, K. G. [ESA Astrophysics Missions Division, ESTEC, PO Box 299, 2200 AG Noordwijk (Netherlands); Charmandaris, V. [Department of Physics and ITCP, University of Crete, GR-71003 Heraklion (Greece); Diaz-Santos, T.; Surace, J. [Spitzer Science Center, California Institute of Technology, MS 220-6, Pasadena, CA 91125 (United States); Evans, A. [Department of Astronomy, University of Virginia, 530 McCormick Road, Charlottesville, VA 22904 (United States); Iwasawa, K. [ICREA and Institut de Ciencies del Cosmos (ICC), Universitat de Barcelona (IEEC-UB), Marti i Franques 1, E-08028 Barcelona (Spain); Leech, J. [Department of Physics, University of Oxford, Denys Wilkinson Building, Keble Road, Oxford OX1 3RH (United Kingdom); Petric, A. O. [Astronomy Department, California Institute of Technology, Pasadena, CA 91125 (United States); Sanders, D. B. [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States); Van der Werf, P. P., E-mail: yhzhao@ipac.caltech.edu [Leiden Observatory, Leiden University, PO Box 9513, 2300 RA Leiden (Netherlands)

    2013-03-01

    We present, for the first time, a statistical study of [N II] 205 {mu}m line emission for a large sample of local luminous infrared galaxies using Herschel Spectral and Photometric Imaging Receiver Fourier Transform Spectrometer (SPIRE FTS) data. For our sample of galaxies, we investigate the correlation between the [N II] luminosity (L{sub [N{sub II]}}) and the total infrared luminosity (L{sub IR}), as well as the dependence of L{sub [N{sub II]}}/L{sub IR} ratio on L{sub IR}, far-infrared colors (IRAS f{sub 60}/f{sub 100}), and the [O III] 88 {mu}m to [N II] luminosity ratio. We find that L{sub [N{sub II]}} correlates almost linearly with L{sub IR} for non-active galactic nucleus galaxies (all having L{sub IR} < 10{sup 12} L{sub Sun }) in our sample, which implies that L{sub [N{sub II]}} can serve as a star formation rate tracer which is particularly useful for high-redshift galaxies that will be observed with forthcoming submillimeter spectroscopic facilities such as the Atacama Large Millimeter/submillimeter Array. Our analysis shows that the deviation from the mean L{sub [N{sub II]}}-L{sub IR} relation correlates with tracers of the ionization parameter, which suggests that the scatter in this relation is mainly due to the variations in the hardness, and/or ionization parameter, of the ambient galactic UV field among the sources in our sample.

  8. 肌萎缩侧索硬化患者205例的神经传导特点分析%Nerve conduction studies in 205 patients with amyotrophic lateral sclerosis

    Institute of Scientific and Technical Information of China (English)

    冯新红; 崔丽英; 刘明生; 管宇宙; 李本红; 杜华

    2011-01-01

    Objective To investigate the F-wave and nerve conduction in patients with amyotrophic lateral sclerosis (ALS) and explore the correlation between these parameters and muscle strength, disease duration and onset site.Methods The data of outpatients and inpatients diagnosed with ALS were collected in Peking Union Medical College Hospital from January 1997 to May 2008.Standard sensory and motor nerve conduction study of the median nerve, ulnar nerve and tibial nerve was performed in 205 patients with ALS.F-wave velocity and frequency was measured in median nerve.Parameters for analyses included sensory conduction velocity and amplitude, distal motor latency (DML), and compound muscle action potential (CMAP) amplitude.Correlation between muscle strength and DML, CMAP amplitude or F-wave frequency were also explored.Results Delayed DML of the median nerve, ulnar nerve and tibial nerve were found in 24.9% (48/193), 15.3% (25/163), 21.2% (7/33) of patients respectively.Decreased CMAP amplitudes were found in 57.0% (110/193), 49.7% (81/163), 39.4% (13/33) of patients respectively.Decreased F-wave frequency of the median nerve was found in 68.9% (122/177) of patients.The abnormality of DML,CMAP amplitude and F-wave frequency of median nerve were increased in weaker muscles.Decreased median nerve CMAP amplitude (81.5% (53/65)) and F-wave abnormality (decreased persistence 70.9%(44/62), absent responses 45.1% (28/62)) in spinal onset groups were significantly higher than those in bulbar onset groups (CMAP 32.4% (11/34); F-wave: decreased persistence 38.2% (13/34), absent responses 14.7% (5/34); x2 = 23.629, 9.753, 9.029,all P <0.01).Compared with the bulbar onset group,the abnormality of DML in spinal onset group was higher, but not reach statistical significance.Logistic regression revealed a strong direct association between decreased CMAP amplitudes and upperextremity muscles strength, disease duration and onset symptom.Abnormality of F-wave frequency was associated with

  9. The theoretical analysis of the reaction N14 (p,) C11 at E 20.5 45 MeV

    International Nuclear Information System (INIS)

    The experimental angular distributions of the reaction N14 (p, )C11 leading to the ground and first three excited states in C11 at incident energies ranged from 20.5 to 45 MeV are examined and compared together. The examination and comparison processes show that, most of the angular distributions of the present reaction have the characteristics of the direct nuclear reactions. This leads to use the semi-microscopic DWBA-theory and the Kurath-Millener's SU(3) spectroscopic factor amplitudes for the transferred triton in the theoretical analysis of the lower four C11-states g. s. (3/2- ;1/2); 1.99 (1/2- ;1/2); 4.319 (5/2- ;1/2) and 4..804 MeV (3/2- ;1/2). The analysis process shows excellent fitting between the experimental angular distributions and the DWBA-theory's predictions for the four states. Coincidences are obtained between the theoretical spectroscopic factors (S) and both of experimental- and theoretical forward integrated cross-section values at Ep = 41 MeV. The values and orders of experimental excitation energies for the four investigated C11-states are also in good agreement with the corresponding theoretical values and their orders. Such coincidences between theoretical- and experimental data can be considered as a test and it is a success for the Kurath-Millener's spectroscopic-factors and also for the Cohen-Kurath wave-functions itself and their accuracy and model of calculations

  10. Structure of putative CutA1 from Homo sapiens determined at 2.05 Å resolution

    International Nuclear Information System (INIS)

    The X-ray structure of human CutA1 was solved in space group P212121, with unit-cell parameters a = 68.69, b = 88.84, c = 125.33 Å and six molecules per asymmetric unit. The structure of human brain CutA1 (HsCutA1) has been determined using diffraction data to 2.05 Å resolution. HsCutA1 has been implicated in the anchoring of acetylcholinesterase in neuronal cell membranes, while its bacterial homologue Escherichia coli CutA1 is involved in copper tolerance. Additionally, the structure of HsCutA1 bears similarity to that of the signal transduction protein PII, which is involved in regulation of nitrogen metabolism. Although several crystal structures of CutA1 from various sources with different rotation angles and degrees of interaction between trimer interfaces have been reported, the specific functional role of CutA1 is still unclear. In this study, the X-ray structure of HsCutA1 was determined in space group P212121, with unit-cell parameters a = 68.69, b = 88.84, c = 125.33 Å and six molecules per asymmetric unit. HsCutA1 is a trimeric molecule with intertwined antiparallel β-strands; each subunit has a molecular weight of 14.6 kDa and contains 135 amino-acid residues. In order to obtain clues to the possible function of HsCutA1, its crystal structure was compared with those of other CutA1 and PII proteins

  11. Anthocyanins extracted from Chinese blueberry (Vaccinium uliginosum L.) and its anticancer effects on DLD-1 and COLO205 cells

    Institute of Scientific and Technical Information of China (English)

    ZU Xiao-yan; ZHANG Zhen-ya; ZHANG Xiao-wen; YOSHIOKA Masahiro; YANG Ying-nan; LI Ji

    2010-01-01

    Background Vaccinium uliginosum L. is a type of blueberry found in the Chinese Changbai Mountains. We extracted Vaccinium uliginosurn Anthocyanins (Av.uli) to investigate its bioactivity on suppressing cancer cells.Methods Av.uli was extracted under different conditions of temperature (10℃-35℃), pH 1.0-3.0, and diatomaceous earth (1.0 g-3.0 g), followed by a HPLC analysis for the determination of the ingredients. Its anticancer bioactivities on human colon and colorectal cancer cells (DLD-1 and COLO205) were compared with those on Lonicera caerulea Anthocyanins (AL.cae) and Vaccinium myrtillus Anthocyanins (Av.myr), using cell viability assays, DNA electrophoresis and nuclear morphology assays.Results The optimum process of Av.uliextraction involved conditions of temperature 20℃, pH 2.0, and diatomaceous earth 1.0 g/50 g of fruit weight. Av.uli contained 5 main components: delphinidin (40.70±1.72)%, cyanidin (3.40±0.68)%,petunidin (17.70±0.54)%, peonidin (2.90±0.63)% and malvidin (35.50±1.11)%. The malvidin percentage was significantly higher (P <0.05) than it in Av.myr. Av.uli complied with a dose-dependent repression of cancer cell proliferation with an IC50 (50% inhibitory concentration) value of 50 μg/ml, and showed greater anticancer efficiency than AL. cae and Av. myr under the same cell treatment conditions. These observations were further supported by the results of nuclear assays.Conclusions The extraction protocol and conditions we used were effective for anthocyanin extraction. Av.uli could be a feasible practical research tool and a promising therapeutic source to suppress human colon or colorectal cancers.

  12. Determining the Total Volume of the 2.05 Ga Bushveld Magmatic Event: Correlation of the Molopo Farms Complex, Botswana

    Science.gov (United States)

    Escobar, E.; Gates, M.; Pitcavage, E.; Bybee, G. M.; Feineman, M. D.

    2015-12-01

    The Bushveld Igneous Complex (BIC) in South Africa, erupted 2.05 billion years ago, is the world's largest layered intrusion in the range of 710-1060 x 103 km3 conservatively. However, the total volume of the magmatic event that produced the BIC remains poorly known. Several other intrusions occurred approximately contemporaneously with the BIC, but a clear relationship between these multiple intrusions is yet to be determined. The Molopo Farms Complex (MFC) is a layered igneous complex of similar age 2.044 Ga ­± 24 Ma located in Botswana, 200km west of the far western limb of the BIC, with a total volume of 1300 km2. Using trace element analysis, this study makes an attempt to find a correlation between the magma that emplaced the Molopo Farms Complex with the Bushveld Igneous Complex. The MFC is related to the BIC and is located under approximately 200m of Kalahari sands, which prevents any direct sampling or observation. Unlike the BIC, the MFC is poorly studied creating a lack of information for the complex. Drill core samples from the MFC were analyzed to determine the trace element composition using an inductively coupled plasma mass spectrometer (ICP-MS). Using previously reported values for the BIC; a comparison can be made on both complexes to find possible correlations. The comparison of trace element schematics in the MFC and the BIC suggest that both complexes are derived from the same parental magma, often referred to as the "B1" magma. These comparisons allow for an assumption that the initial parental magma of the BIC may have also emplaced the MFC.

  13. Structure of putative CutA1 from Homo sapiens determined at 2.05 Å resolution

    Energy Technology Data Exchange (ETDEWEB)

    Bagautdinov, Bagautdin, E-mail: bagautdi@spring8.or.jp; Matsuura, Yoshinori; Bagautdinova, Svetlana; Kunishima, Naoki; Yutani, Katsuhide [Protein Structure Analysis Team, RIKEN SPring-8 Center, Harima Institute, 1-1-1 Kouto, Sayo-cho, Sayo-gun, Hyogo 679-5148 (Japan)

    2008-05-01

    The X-ray structure of human CutA1 was solved in space group P2{sub 1}2{sub 1}2{sub 1}, with unit-cell parameters a = 68.69, b = 88.84, c = 125.33 Å and six molecules per asymmetric unit. The structure of human brain CutA1 (HsCutA1) has been determined using diffraction data to 2.05 Å resolution. HsCutA1 has been implicated in the anchoring of acetylcholinesterase in neuronal cell membranes, while its bacterial homologue Escherichia coli CutA1 is involved in copper tolerance. Additionally, the structure of HsCutA1 bears similarity to that of the signal transduction protein PII, which is involved in regulation of nitrogen metabolism. Although several crystal structures of CutA1 from various sources with different rotation angles and degrees of interaction between trimer interfaces have been reported, the specific functional role of CutA1 is still unclear. In this study, the X-ray structure of HsCutA1 was determined in space group P2{sub 1}2{sub 1}2{sub 1}, with unit-cell parameters a = 68.69, b = 88.84, c = 125.33 Å and six molecules per asymmetric unit. HsCutA1 is a trimeric molecule with intertwined antiparallel β-strands; each subunit has a molecular weight of 14.6 kDa and contains 135 amino-acid residues. In order to obtain clues to the possible function of HsCutA1, its crystal structure was compared with those of other CutA1 and PII proteins.

  14. miRNA array analysis determines miR-205 is overexpressed in head and neck squamous cell carcinoma and enhances cellular proliferation

    Directory of Open Access Journals (Sweden)

    Howard JD

    2013-08-01

    Full Text Available MicroRNAs (miRNAs play a critical role in cell cycle and pro-survival signal regulation. Consequently, their deregulation can enhance tumorigenesis and cancer progression. In the current investigation, we determined whether cancer- or human papillomavirus (HPV-specific miRNA deregulation could further elucidate signal transduction events unique to head and neck squamous cell carcinoma (HNSCC. Twenty-nine newly diagnosed HNSCC tumors (HPV-positive: 14, HPV-negative: 15 and four normal mucosa samples were analyzed for global miRNA expression. Differential miRNA expression analysis concluded HNSCC is characterized by a general upregulation of miRNAs compared to normal mucosa. Additionally, miR-449a and miR-129-3p were statistically significant miRNAs differentially expressed between HPV-positive and HPV-negative HNSCC. The upregulation of miR-449a was also validated within an independent dataset obtained from TCGA containing 279 HNSCCs and 39 normal adjacent mucosa samples. To gain a better understanding of miRNA-mediated cell cycle deregulation in HNSCC, we functionally evaluated miR-205, a transcript upregulated in our cancer-specific analysis and a putative regulator of E2F1. Modulation of miR-205 with a miRNA mimic and inhibitor revealed miR-205 is capable of regulating E2F1 expression in HNSCC and overexpression of this transcript enhances proliferation. This study demonstrates miRNA expression is highly deregulated in HNSCC and functional evaluations of these miRNAs may reveal novel HPV context dependent mechanisms in this disease.

  15. Downregulation of COMMD1 by miR-205 promotes a positive feedback loop for amplifying inflammatory- and stemness-associated properties of cancer cells.

    Science.gov (United States)

    Yeh, D-W; Chen, Y-S; Lai, C-Y; Liu, Y-L; Lu, C-H; Lo, J-F; Chen, L; Hsu, L-C; Luo, Y; Xiang, R; Chuang, T-H

    2016-05-01

    Sustained activation of nuclear factor-κB (NF-κB) in cancer cells has been shown to promote inflammation, expansion of cancer stem cell (CSC) population, and tumor development. In contrast, recent studies reveal that CSCs exhibit increased inflammation due to constitutive NF-κB activation; however, the underlying molecular mechanism remains unclear. In the present study, the analysis of microarray data revealed upregulation of NF-κB-regulated pro-inflammatory genes and downregulation of copper metabolism MURR1 domain-containing 1 (COMMD1) during the enrichment for stemness in SAS head and neck squamous-cell carcinoma (HNSCC) cells. The 3'-UTR of COMMD1 mRNA contains microRNA (miR)-205 target site. Parallel studies with HNSCC and NSCLC cells indicated that miR-205 is upregulated upon NF-κB activation and suppresses COMMD1 expression in stemness-enriched cancer cells. COMMD1 negatively regulates the inflammatory responses induced by TLR agonists, IL-1β, and TNF-α by targeting RelA for degradation. The shRNA-mediated downregulation of COMMD1 in cancer cells enhanced inflammatory response, generating favorable conditions for macrophage recruitment. In addition, genes associated with stemness were also upregulated in these cells, which exhibited increased potential for anchorage-independent growth. Furthermore, COMMD1 downregulation promoted in vivo tumorigenesis and tumor growth, and tumors derived from COMMD1-knockdown cells displayed elevated level of NF-κB activation, increased expression of inflammatory- and stemness-associated genes, and contain expanded population of tumor-associated leukocytes and stemness-enriched cancer cells. These results suggest that COMMD1 downregulation by miR-205 promotes tumor development by modulating a positive feedback loop that amplifies inflammatory- and stemness-associated properties of cancer cells. PMID:26586569

  16. Expression of lacZ from the Promoter of the Escherichia coli spc Operon Cloned into Vectors Carrying the W205 trp-lac Fusion

    OpenAIRE

    Liang, Sung-Tzu; Dennis, Patrick P.; Bremer, Hans

    1998-01-01

    The expression of lacZ has been analyzed and compared in a series of promoter cloning vectors by measuring the amount of lacZ mRNA by hybridization and the amount of β-galactosidase by standard enzymatic assay. Expression was driven by the promoter, Pspc, of the spc ribosomal protein operon. The vectors contained either the standard W205 trp-lac fusion with the trp operon transcription terminator, trpt, located in the lacZ leader sequence, or a deletion derivative that functionally inactivate...

  17. Survey of new vector computers: The CRAY 1S from CRAY research; the CYBER 205 from CDC and the parallel computer from ICL - architecture and programming

    Science.gov (United States)

    Gentzsch, W.

    1982-01-01

    Problems which can arise with vector and parallel computers are discussed in a user oriented context. Emphasis is placed on the algorithms used and the programming techniques adopted. Three recently developed supercomputers are examined and typical application examples are given in CRAY FORTRAN, CYBER 205 FORTRAN and DAP (distributed array processor) FORTRAN. The systems performance is compared. The addition of parts of two N x N arrays is considered. The influence of the architecture on the algorithms and programming language is demonstrated. Numerical analysis of magnetohydrodynamic differential equations by an explicit difference method is illustrated, showing very good results for all three systems. The prognosis for supercomputer development is assessed.

  18. Nondegenerate parametric generation of 2.2-mJ, few-cycle 2.05-μm pulses using a mixed phase matching scheme

    International Nuclear Information System (INIS)

    We describe the production of 2.2-mJ, ∼6 optical-cycle-long mid-infrared laser pulses with a carrier wavelength of 2.05 μm in a two-stage β-BaB2O4 nondegenerate optical parametric amplifier design with a mixed phase matching scheme, which is pumped by a standard Ti:sapphire chirped-pulse amplification system. It is demonstrated that relatively high pulse energies, short pulse durations, high stability, and excellent beam profiles can be obtained using this simple approach, even without the use of optical parametric chirped-pulse amplification

  19. Fiber-Based 205-mW (27% Efficiency) Power-Delivery System for an All-Fiber Network with Optoelectronic Sensor Units

    Science.gov (United States)

    Peña, Rafael; Algora, Carlos; Matías, Ignacio R.; López-Amo, Manuel

    1999-04-01

    An optical fiber power-delivery system has been developed. An analysis of the spectral response of every component in the system has been carried out. Experimental measurements of the system are presented. We obtained 205 mW of power (5.4 V, 38.3 mA), yielding 27.4% efficiency. As an application, a sensor module is optically powered. This is an electrically isolated system, inasmuch as it also sends the measured data through a fiber. Several other applications are envisaged in the fields of aerospace, avionics, and domotics.

  20. Numerical Simulations of a 2.05 μm Q-switched Ho:YLF Laser for CO2 IPDA Space Remote Sensing

    OpenAIRE

    Pellegrino Jessica Barrientos; Edouart Dimitri; Gibert Fabien; Cenac Claire

    2016-01-01

    We report on numerical simulations of the performances of a 2.05 μm double pulse Q-switched Ho:YLF laser for the monitoring of CO2 from space. A Q-switched Holmium laser set-up based on a MOPA configuration is proposed to fulfill the requirements of a IPDA space-borne measurement. Double pulse operation is considered to obtain a 250 μs delay time between the ON and OFF pulse emissions. Numerical simulations results show that up to 40 mJ ON pulse can be extracted from the Ho:YLF laser at a rep...

  1. Contributions of cooling and warming rate and developmental stage to the survival of Drosophila embryos cooled to -205 degrees C.

    Science.gov (United States)

    Mazur, P; Cole, K W; Schreuders, P D; Mahowald, A P

    1993-02-01

    Because of their high susceptibility to chilling injury, permeabilized Drosophila embryos can not be cryobiologically preserved by slow freezing at rates low enough to prevent the formation of intraembryonic ice. Calculations indicated that to outrun the chilling injury they must be cooled and warmed rapidly at an estimated 20,000 degrees C/min or faster. Ordinarily, such cooling rates would inevitably produce lethal intracellular ice. To prevent this, embryos must contain and be surrounded by sufficiently high concentrations of glass-promoting solutes to induce vitrification on cooling and prevent devitrification on warming. Like Steponkus et al. (Nature 345, 170, 1990) we have used ethylene glycol as the solute and have exposed permeabilized 12-h embryos to it in two steps. (Permeabilization was effected by exposing dechorionated embryos to a mixture of 0.3% 1-butanol in n-heptane for 90 or 110 s.) The two steps were (i) a 30-min exposure to 2 M ethylene glycol at 23 degrees C and (ii) a 5-min exposure to 8.5 M ethylene glycol [+/- 10% polyvinylpyrrolidone (PVP)] at 5 degrees C. The volumetric response to the first step indicates that full permeation of the 2 M glycol has been approached by 30 min. The point of the second step is to raise the intraembryonic concentration of ethylene glycol to near 8.5 M ethylene glycol by osmotic dehydration. Survival based on hatching is some 45% at this point. When 12-h embryos in 8.5 M glycol containing 10% PVP are then cooled to -205 degrees C at approximately 100,000 degrees C/min and warmed at about that rate, an average of about 12% survive (hatch), although in about half the runs 15-29% survive. Survivals in the absence of PVP are usually poorer but have been as high as 40%. Currently, 5% of the surviving larvae develop to adult flies (Steponkus et al. reported 18% hatching and 3% development to adult). Embryos that develop but do not hatch show readily detectable abnormalities in mouth parts and dorsal closure. Very high

  2. Drama 105, 205, 305.

    Science.gov (United States)

    Manitoba Dept. of Education and Training, Winnipeg.

    This 3-year drama curriculum is designed to promote awareness, foster development, and encourage the use of imagination, creativity, co-operation, self-discipline, analysis and synthesis, self-expression, self-confidence, responsibility, communication, and cultural heritage. The curriculum is organized around a set of drama elements which are…

  3. 20.5.Epilepsy

    Institute of Scientific and Technical Information of China (English)

    1992-01-01

    920184 Clinical analysis of 25 cases ofchronic alcoholic intoxication with epilepsy.PANG Zhixing (庞治兴),et al.Dept Psychol,1stTeaching Hosp.Norman Bethune Med Univ,130021 Chin J Nerv & Ment Dis 1991; 17 (5):289-291.The clinical manifestations of 25 cases (male)

  4. 20.5.Epilepsy

    Institute of Scientific and Technical Information of China (English)

    1992-01-01

    920390 Clinical analysis of 36 cases ofepilepsy in the elderly with cerebrovasculardiseases.SHI Shangjin (石尚金),et al.DeptNeurol,General Hosp,Guangzhou Milit Com-mand.Chin J Geriatr 1991;10(4):206-208.

  5. The spatially-resolved correlation between [NII] 205 {\\mu}m line emission and the 24 {\\mu}m continuum in nearby galaxies

    CERN Document Server

    Hughes, T M; Schirm, M R P; Parkin, T J; Wu, R; De Looze, I; Wilson, C D; Viaene, S; Bendo, G J; Boselli, A; Cormier, D; Ibar, E; Karczewski, O Ł; Lu, N; Spinoglio, L

    2016-01-01

    A correlation between the 24 {\\mu}m continuum and the [NII] 205 {\\mu}m line emission may arise if both quantities trace the star formation activity on spatially-resolved scales within a galaxy, yet has so far only been observed in the nearby edge-on spiral galaxy NGC 891. We therefore assess whether the [NII] 205 - 24 {\\mu}m emission correlation has some physical origin or is merely an artefact of line-of-sight projection effects in an edge-on disc. We search for the presence of a correlation in Herschel and Spitzer observations of two nearby face-on galaxies, M51 and M83, and the interacting Antennae galaxies NGC 4038 and 4039. We show that not only is this empirical relationship also observed in face-on galaxies, but also that the correlation appears to be governed by the star formation rate (SFR). Both the nuclear starburst in M83 and the merger-induced star formation in NGC 4038/9 exhibit less [NII] emission per unit SFR surface density than the normal star-forming discs. These regions of intense star for...

  6. Pterostilbene inhibits triple-negative breast cancer metastasis via inducing microRNA-205 expression and negatively modulates epithelial-to-mesenchymal transition.

    Science.gov (United States)

    Su, Chih-Ming; Lee, Wei-Hwa; Wu, Alexander T H; Lin, Yen-Kuang; Wang, Liang-Shun; Wu, Chih-Hsiung; Yeh, Chi-Tai

    2015-06-01

    Breast cancer is the leading cause of cancer-related deaths among females in economically developing countries. Greater than 95% of breast malignancies are of epithelial origin; the induction of epithelial-to-mesenchymal transition (EMT) has been shown to initiate the metastatic process in breast carcinoma and remains the key target for drug development. Here, we examine the anti-metastatic potential of pterostilbene in modulating EMT process in breast cancer cells both in vitro and in vivo. The differential invasive ability among MCF7, Hs578t and MDA-MB-231 breast cancer cell lines were closely correlated with the expression of EMT markers, determined by Western blots and Matrigel-coated transwells assay. Pterostilbene inhibited the migratory and invasive potential of triple-negative MDA-MB-231 and Hs578t cells, accompanied by the up-regulation of E-cadherin and down-regulation of Snail, Slug, vimentin and ZEB1. Mechanistic investigations revealed a significant up-regulation of miR-205, which resulted in the reduction of Src expression in pterostilbene-treated breast cancer cells. Importantly, pterostilbene suppressed tumor growth and metastasis in MDA-MB-231-bearing NOD/SCID mice by reducing Src/Fak signaling; this observation was consistent with the negative correlations between miR-205 and Src expression in both normal and malignant breast tissues. Our findings provide supports for the usage of pterostilbene as an inhibitor of EMT process and potential candidate for adjuvant therapy. PMID:25792283

  7. Decontamination and dismantlement of the building 200/205 pneumatic transfer tube at Argonne National Laboratory-East project final report.

    Energy Technology Data Exchange (ETDEWEB)

    Wiese, E. C.

    1998-12-11

    The Building 200/205 Pneumatic Transfer Tube D&D Project was directed toward the following goals: Remove any radioactive and hazardous materials associated with the transfer tube; Survey the transfer tube to identify any external contamination; Remove the transfer tube and package for disposal; Survey the soil and sand surrounding the transfer tube for any contamination; and Backfill the trench in which the tube sat and restore the area to its original condition. These goals had been set in order to eliminate the radiological and hazardous safety concerns inherent in the buried transfer tube and to allow, upon completion of the project, the removal of this project from the ANL-E action item list. The physical condition of the transfer tube and possible nuclear fuel samples lost in the tube were the primary areas of concern, while the exact location of the transfer tube was of secondary concern. ANL-E health physics technicians collected characterization data from the ends of the Building 200/205 pneumatic transfer tube in January 1998. The characterization surveys identified contamination to a level of 67,000 dpm (1,117 Bq) ({beta}/{gamma}) and 20,000 dpm (333 Bq) {alpha} smearable at the opening.

  8. Uso de redes neurais artificais na predição de valores genéticos para peso aos 205 dias em bovinos da raça Tabapuã

    OpenAIRE

    R.V. Ventura; Silva, M. A.; T.H. Medeiros; N.L. Dionello; F.E. Madalena; A.B. Fridrich; B.D. Valente; Santos, G.G.; L.S. Freitas; R.R. Wenceslau; V.P.S. Felipe; G.S.S. Corrêa

    2012-01-01

    Dados de 19240 animais Tabapuã, provenientes de 152 fazendas localizadas em diversos estados brasileiros, nascidos entre 1976 e 1995, foram utilizados para predição do valor genético do peso aos 205 dias de idade (VG_P205) por meio de redes neurais artificiais (RNAs) e usando o algoritmo LM - Levenberg Marquardt - para treinamento dos dados de entrada. Por se tratar de rede com aprendizado supervisionado, foram utilizados, como saída desejada, os valores genéticos preditos pelo BLUP para a ca...

  9. Targeting human dendritic cells via DEC-205 using PLGA nanoparticles leads to enhanced cross-presentation of a melanoma-associated antigen

    Directory of Open Access Journals (Sweden)

    Saluja SS

    2014-11-01

    Full Text Available Sandeep S Saluja,1 Douglas J Hanlon,1 Fiona A Sharp,2 Enping Hong,2 David Khalil,1 Eve Robinson,1 Robert Tigelaar,1 Tarek M Fahmy,2,3 Richard L Edelson1 1Department of Dermatology, Yale University School of Medicine, 2Department of Biomedical Engineering, Yale University, 3Department of Immunobiology, Yale University School of Medicine, New Haven, CT, USA Abstract: Targeting antigen to dendritic cells (DCs is a powerful and novel strategy for vaccination. Priming or loading DCs with antigen controls whether subsequent immunity will develop and hence whether effective vaccination can be achieved. The goal of our present work was to increase the potency of DC-based antitumor vaccines by overcoming inherent limitations associated with antigen stability and cross-presentation. Nanoparticles prepared from the biodegradable polymer poly(lactic-co-glycolic acid have been extensively used in clinical settings for drug delivery and are currently the subject of intensive investigation as antigen delivery vehicles for vaccine applications. Here we describe a nanoparticulate delivery system with the ability to simultaneously carry a high density of protein-based antigen while displaying a DC targeting ligand on its surface. Utilizing a targeting motif specific for the DC-associated surface ligand DEC-205, we show that targeted nanoparticles encapsulating a MART-127–35 peptide are both internalized and cross-presented with significantly higher efficiency than isotype control-coated nanoparticles in human cells. In addition, the DEC-205-labeled nanoparticles rapidly escape from the DC endosomal compartment and do not colocalize with markers of early (EEA-1 or late endosome/lysosome (LAMP-1. This indicates that encapsulated antigens delivered by nanoparticles may have direct access to the class I cytoplasmic major histocompatibility complex loading machinery, overcoming the need for “classical” cross-presentation and facilitating heightened DC

  10. Microcalorimetric Studies on Gene Promoter Function of Cloned DNA Fragements from Halobacterium halobium J7 Plasmid pHH205 in Escherichia coli TG1

    Institute of Scientific and Technical Information of China (English)

    LEI,Ke-Lin; HOU,Han-Na; LIU,Yi; YE,Xue-Cheng; SHEN,Ping

    2007-01-01

    Halobacterium halobium is a typical kind of extremely halophilic bacterium. Combined with the antibiotic resistance assay, the microcalorimetric method was used to study the promoter function of the cloned DNA fragments from Halobacterium halobium J7 plasmid pHH205 in Escherichia coli TG1. The promoter probe vector, plasmid pKK232-8, was used to form the recombinants. The DNA fragment, which is the promoter for the chloramphenicol acetyl transferase (CAT) gene in plasmid pKK232-8, is about 800 bp, and the chloramphenicol resistance level presented by IC50 is about 200 μg·mL-1, which suggests a high promoter activity. The conclusions show that there probably exist double-function or trinary-function gene promoters in Halobacterium halobium, and Archaea may contain rich genetic resources.

  11. Lidar reflectance from snow at 2.05  μm wavelength as measured by the JPL Airborne Laser Absorption Spectrometer.

    Science.gov (United States)

    Spiers, Gary D; Menzies, Robert T; Jacob, Joseph C

    2016-03-10

    We report airborne measurements of lidar directional reflectance (backscatter) from land surfaces at a wavelength in the 2.05 μm CO₂ absorption band, with emphasis on snow-covered surfaces in various natural environments. Lidar backscatter measurements using this instrument provide insight into the capabilities of lidar for both airborne and future global-scale CO₂ measurements from low Earth orbit pertinent to the NASA Active Sensing of CO₂ Emissions over Nights, Days, and Seasons mission. Lidar measurement capability is particularly useful when the use of solar scattering spectroscopy is not feasible for high-accuracy atmospheric CO₂ measurements. Consequently, performance in high-latitude and winter season environments is an emphasis. Snow-covered surfaces are known to be dark in the CO₂ band spectral regions. The quantitative backscatter data from these field measurements help to elucidate the range of backscatter values that can be expected in natural environments. PMID:26974792

  12. Venus树脂修整切牙切端和关闭中切牙间隙205例临床体会

    Institute of Scientific and Technical Information of China (English)

    陈月来

    2010-01-01

    目的 观察维纳斯(Venus)树脂修复切矛切端缺损和关闭中切牙间隙中的美学效果.方法 对切牙切端缺损修复及直接在中切牙上贴面而加大中切牙牙体的方法关闭中切牙间隙,从而达到恢复功能和美容的目的.结果 205例病例经1~3年随访,满意率79.04%,基本满意11.63%,失败率9.33%.结论 维纳斯(Venus)树脂是一种较理想的切牙切端缺损修复和关闭中切牙间隙的材料.

  13. Numerical Simulations of a 2.05 μm Q-switched Ho:YLF Laser for CO2 IPDA Space Remote Sensing

    Science.gov (United States)

    Barrientos Pellegrino, Jessica; Edouart, Dimitri; Gibert, Fabien; Cenac, Claire

    2016-06-01

    We report on numerical simulations of the performances of a 2.05 μm double pulse Q-switched Ho:YLF laser for the monitoring of CO2 from space. A Q-switched Holmium laser set-up based on a MOPA configuration is proposed to fulfill the requirements of a IPDA space-borne measurement. Double pulse operation is considered to obtain a 250 μs delay time between the ON and OFF pulse emissions. Numerical simulations results show that up to 40 mJ ON pulse can be extracted from the Ho:YLF laser at a repetition rate of 350 Hz with an optical efficiency of 17 %.

  14. Thermal-hydraulic design calculations for the annular fuel element with replaceable test bundles (TOAST) on the test zone position 205 of KNK II/3

    International Nuclear Information System (INIS)

    Annular fuel elements are foreseen in KNK II as carrier elements for irradiation inserts and test bundles. For the third core a reloadable annular element on position 205 is foreseen, in which replaceable 19-pin test bundles (TOAST) shall be irradiated. The present report deals with the thermal-hydraulic design of the annular carrier element and the test bundle, whereby the test bundle required additional optimization. The code CIA has been used for the calculations. Start of irradiation of the subassembly is planned at the beginning of the third core operation. After optimization of the pin-spacer geometry in the test bundle, design calculations for both bundles were performed, whereby thermal coupling between both was taken into account. The calculated mass-flows and temperature distributions are given for the nominal and the eccentric element configuration. The calculated bundle pressure losses have been corrected according to experimental results

  15. A putative autonomous 20.5 kb-CACTA transposon insertion in an F3'H allele identifies a new CACTA transposon subfamily in Glycine max

    Directory of Open Access Journals (Sweden)

    Vodkin Lila

    2008-12-01

    Full Text Available Abstract Background The molecular organization of very few genetically defined CACTA transposon systems have been characterized thoroughly as those of Spm/En in maize, Tam1 of Antirrhinum majus Candystripe1 (Cs1 from Sorghum bicolor and CAC1 from Arabidopsis thaliana, for example. To date, only defective deletion derivatives of CACTA elements have been described for soybean, an economically important plant species whose genome sequence will be completed in 2008. Results We identified a 20.5 kb insertion in a soybean flavonoid 3'-hydroxylase (F3'H gene representing the t* allele (stable gray trichome color whose origin traces to a single mutable chimeric plant displaying both tawny and gray trichomes. This 20.5 kb insertion has the molecular structure of a putative autonomous transposon of the CACTA family, designated Tgmt*. It encodes a large gene that was expressed in two sister isolines (T* and tm of the stable gray line (t* from which Tgmt* was isolated. RT-PCR derived cDNAs uncovered the structure of a large precursor mRNA as well as alternatively spliced transcripts reminiscent of the TNPA-mRNA generated by the En-1 element of maize but without sequence similarity to the maize TNPA. The larger mRNA encodes a transposase with a tnp2 and TNP1-transposase family domains. Because the two soybean lines expressing Tgmt* were derived from the same mutable chimeric plant that created the stable gray trichome t* allele line from which the element was isolated, Tgmt* has the potential to be an autonomous element that was rapidly inactivated in the stable gray trichome t* line. Comparison of Tgmt* to previously described Tgm elements demonstrated that two subtypes of CACTA transposon families exist in soybean based on divergence of their characteristic subterminal repeated motifs and their transposases. In addition, we report the sequence and annotation of a BAC clone containing the F3'H gene (T locus which was interrupted by the novel Tgmt* element

  16. NITRATE + NITRITE CONTENT (CONCENTRATION), PHOSPHATE, NITRITE, SILICATE and other profile and discrete sample data collected in the Gulf of Alaska on the ALPHA HELIX and WECOMA cruises HX203, HX205 and others as part of the NEP project from 1998-03-08 to 2004-07-05 (NODC Accession 0115260)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0115260 includes profile, discrete sample and chemical data collected aboard the ALPHA HELIX and WECOMA during cruises HX203, HX205, HX208, HX211,...

  17. Application Results and Evaluation of Anti-slip Re-adhesion Control Based on Speed Sensor-less Vector Control and Disturbance Observer for Electric Multiple Units, Series 205-5000

    Science.gov (United States)

    Kadowaki, Satoshi; Hata, Tadashi; Hirose, Hiroshi; Ohishi, Kiyoshi; Iida, Norifumi; Takagi, Masashi; Sano, Takashi; Yasukawa, Shinobu

    The improvement of adhesion characteristics is important in electric motor coach. We have already proposed the anti-slip/skid re-adhesion control system based on disturbance observer and sensor-less vector control. The effectiveness of the proposed method has been confirmed by the experiment and the numerical simulation using the tested bogie system of electric motor coach. Then, we apply the proposed method to the actual electric multiple units, which is Series 205-5000. In the experimental results of Series 205-5000, this paper discusses that the proposed anti-slip/skid re-adhesion control system has the desired driving wheel torque response. Moreover, this paper proposes the evaluation method of re-adhesion control test results.

  18. Erratum to "Surface display of an anti-DEC-205 single chain Fv fragment in Lactobacillus plantarum increases internalization and plasmid transfer to dendritic cells in vitro and in vivo"

    OpenAIRE

    Michon, Christophe; Kuczkowska, Katarzyna; Langella, Philippe; Eijsink, Vincent G. H.; Mathiesen, Geir

    2015-01-01

    Background: Lactic acid bacteria (LAB) are promising vehicles for delivery of a variety of medicinal compounds, including antigens and cytokines. It has also been established that Lare able to deliver cDNA to host cells. To increase the efficiency of LAB-driven DNA delivery we have constructed Lactobacillus plantarum strains targeting DEC-205, which is a receptor located at the surface of dendritic cells (DCs). The purpose was to increase uptake of bacterial cells, which could lead to improve...

  19. Proyecto de mejora selvícola en el monte perímetro de Puebla N.205 del C.U.P. término municipal de Puebla de la Sierra (Madrid)

    OpenAIRE

    Barrionuevo Escribano, Esther

    2010-01-01

    La redacción del presente proyecto de mejoras selvícolas del monte nº 205 de perímetro de Puebla de la Sierra (Madrid) atiende a una finalidad didáctica. El proyecto pretende planificar una serie de tratamientos para mejorar la situación actual del monte, especialmente la reducción de espesura.

  20. Tunable diode laser measurement of pressure-induced shift coefficients of CO2 around 2.05 μm for Lidar application

    International Nuclear Information System (INIS)

    Atmospheric carbon dioxide (CO2) is one of the main contributors to the greenhouse effect. A global monitoring of CO2 from space is foreseen as a key issue to quantify its sources and sinks at a regional scale and to better predict future levels of CO2 and their effect on climate change. Differential Absorption Lidar (DiAL) is a promising and novel spectroscopic technique for remote sensing CO2 spatial and temporal concentration distribution with a high level of accuracy. However, a precise knowledge of spectroscopic parameters of CO2 molecular transitions and their dependence with temperature and pressure is required for reducing the uncertainty on DiAl measurements. Hence, to support remote sensing of carbon dioxide in the troposphere, we report on the accurate determination of air pressure-induced shift coefficients for eight absorption lines belonging to the R branch of (2001)III 00)I band of CO2 at 2.05 μm. Purposely, a high-resolution tunable diode laser absorption spectrometer (TDLAS) coupled to a cryogenically cooled optical cell was implemented. From these measurements, we have further determined the temperature-dependencies of the air pressure-induced shift coefficients.

  1. [CII] 158$\\mu$m and [NII] 205$\\mu$m emission from IC 342 - Disentangling the emission from ionized and photo-dissociated regions

    CERN Document Server

    Röllig, Markus; Güsten, R; Stutzki, J; Israel, F; Jacobs, K

    2016-01-01

    Aims: We investigate how much of the [CII] emission in the nucleus of the nearby spiral galaxy IC 342 is contributed by PDRs and by the ionized gas. We examine the spatial variations of starburst/PDR activity and study the correlation of the [CII] line with the [NII] 205{\\textmu}m emission line coming exclusively from the HII regions. Methods: We present small maps of [CII] and [NII] lines recently observed with the GREAT receiver on board SOFIA. In particular we present a super-resolution method to derive how unresolved, kinematically correlated structures in the beam contribute to the observed line shapes. Results: We find that the emission coming from the ionized gas shows a kinematic component in addition to the general Doppler signature of the molecular gas. We interpret this as the signature of two bi-polar lobes of ionized gas expanding out of the galactic plane. We then show how this requires an adaptation of our understanding of the geometrical structure of the nucleus of IC~342. Examining the starbu...

  2. Temperate membrane-containing halophilic archaeal virus SNJ1 has a circular dsDNA genome identical to that of plasmid pHH205.

    Science.gov (United States)

    Zhang, Ziqian; Liu, Ying; Wang, Shuai; Yang, Di; Cheng, Yichen; Hu, Jiani; Chen, Jin; Mei, Yunjun; Shen, Ping; Bamford, Dennis H; Chen, Xiangdong

    2012-12-20

    A temperate haloarchaeal virus, SNJ1, was induced from the lysogenic host, Natrinema sp. J7-1, with mitomycin C, and the virus produced plaques on lawns of Natrinema sp. J7-2. Optimization of the induction conditions allowed us to increase the titer from ~10(4) PFU/ml to ~10(11) PFU/ml. Single-step growth curves exhibited a burst size of ~100 PFU/cell. The genome of SNJ1 was observed to be a circular, double-stranded DNA (dsDNA) molecule (16,341 bp). Surprisingly, the sequence of SNJ1 was identical to that of a previously described plasmid, pHH205, indicating that this plasmid is the provirus of SNJ1. Several structural protein-encoding genes were identified in the viral genome. In addition, the comparison of putative packaging ATPase sequences from bacterial, archaeal and eukaryotic viruses, as well as the presence of lipid constituents from the host phospholipid pool, strongly suggest that SNJ1 belongs to the PRD1-type lineage of dsDNA viruses, which have an internal membrane. PMID:22784791

  3. 2n-emission from 205Pb* nucleus using clusterization approach at Ebeam˜14-20 MeV

    Science.gov (United States)

    Kaur, Amandeep; Sandhu, Kiran; Sharma, Manoj Kumar

    2016-05-01

    The dynamics involved in n-induced reaction with 204Pb target is analyzed and the decay of the composite system 205Pb* is governed within the collective clusterization approach of the Dynamical Cluster-decay Model (DCM). The experimental data for 2n-evaporation channel is available for neutron energy range of 14-20 MeV and is addressed by optimizing the only parameter of the model, the neck-length parameter (ΔR). The calculations are done by taking the quadrupole (β2) deformations of the decaying fragments and the calculated 2n-emission cross-sections find nice agreement with available data. An effort is made to study the role of level density parameter in the decay of hot-rotating nucleus, and the mass dependence in level density parameter is exercised for the first time in DCM based calculations. It is to be noted that the effect of deformation, temperature and angular momentum etc. is studied to extract better description of the dynamics involved.

  4. Clinical Outcomes of Volume-Modulated Arc Therapy in 205 Patients with Nasopharyngeal Carcinoma: An Analysis of Survival and Treatment Toxicities.

    Directory of Open Access Journals (Sweden)

    Rui Guo

    Full Text Available To investigate the clinical efficacy and treatment toxicity of volume-modulated arc therapy (VMAT for nasopharyngeal carcinoma (NPC.205 VMAT-treated NPC patients from our cancer center were prospectively entrolled. All patients received 68-70 Gy irradiation based on the planning target volume of the primary gross tumor volume. Acute and late toxicities were graded according to the Common Terminology Criteria for Adverse Events v3.0 and Radiation Therapy Oncology Group Late Radiation Morbidity Scoring Criteria.The median follow-up period was 37.3 months (range, 6.3-45.1 months. The 3-year estimated local failure-free survival, regional failure-free survival, locoregional failure-free survival, distant metastasis-free survival, disease-free survival and overall survival were 95.5%, 97.0%, 94.0%, 92.1%, 86.8% and 97.0%, respectively. Cox regression analysis showed primary gross tumor volume, N stage and EBV-DNA to be independent predictors of VMAT outcomes (P < 0.05. The most common acute and late side effects were grade 2-3 mucositis (78% and xerostomia (83%, 61%, 34%, and 9% at 3, 6, 12 and 24 months after VMAT, respectively.VMAT for the primary treatment of NPC achieved very high locoregional control with a favorable toxicity profile. The time-saving benefit of VMAT will enable more patients to receive precision radiotherapy.

  5. Sub-Doppler two-photon spectroscopy of 33 Rydberg levels in atomic xenon excited at 205–213 nm: diverse isotopic and hyperfine structure

    International Nuclear Information System (INIS)

    Isotope energy shifts and hyperfine structure have been measured for 33 high-energy Rydberg levels of atomic xenon by sub-Doppler two-photon excitation spectroscopy, using narrowband pulses of coherent ultraviolet light at 205–213 nm generated by nonlinear-optical conversion processes. Rydberg levels are accessed at two-photon excitation energies in the 97 300–94 100 cm−1 range where isotope energy shifts and hyperfine structure have rarely been resolved; these Rydberg levels are 5p5 np [1/2]0 (n = 9–13), 5p5 np [3/2]2 (n = 9–13), 5p5 np [5/2]2 (n = 9–17), 5p5 nf [3/2]2 (n = 6–14) and 5p5 nf [5/2]2 (n = 6–10). The sub-Doppler spectra display diverse hyperfine-coupling effects, for which least-squares-fit spectroscopic parameters reflect the influence of angular momentum. (paper)

  6. Involvement of protein kinase C in the mechanism of action of Escherichia coli heat-stable enterotoxin (STa) in a human colonic carcinoma cell line, COLO-205

    International Nuclear Information System (INIS)

    The present study was undertaken to determine the involvement of calcium-protein kinase C pathway in the mechanism of action of Escherichia coli heat stable enterotoxin (STa) apart from STa-induced activation of guanylate cyclase in human colonic carcinoma cell line COLO-205, which was used as a model cultured cell line to study the mechanism of action of E. coli STa. In response to E. coli STa, protein kinase C (PKC) activity was increased in a time-dependent manner with its physical translocation from cytosol to membrane. Inhibition of the PKC activity in membrane fraction and inhibition of its physical translocation in response to IP3-mediated calcium release inhibitor dantrolene suggested the involvement of intracellular store depletion in the regulation of PKC activity. Among different PKC isoforms, predominant involvement of calcium-dependent protein kinase C (PKCα) was specified using isotype-specific pseudosubstrate, which showed pronounce enzyme activity. Inhibition of enzyme activity by PKCα-specific inhibitor Goe6976 and immunoblott study employing isotype-specific antibody further demonstrated the involvement of calcium-dependent isoform of PKC in the mechanism of action of E. coli STa. Moreover, inhibition of guanylate cyclase activity by PKCα-specific inhibitor Goe6976 suggested the involvement of PKCα in the regulation of guanylate cyclase activity

  7. Evaluation of a Wet Chemistry Method for Isolation of Cyclotron Produced [211At]Astatine

    Directory of Open Access Journals (Sweden)

    Shigeki Watanabe

    2013-09-01

    Full Text Available A “wet chemistry” approach for isolation of 211At from an irradiated bismuth target is described. The approach involves five steps: (1 dissolution of bismuth target in conc. HNO3; (2 removal of the HNO3 by distillation; (3 dissolution of residue in 8 M HCl; (4 extraction of 211At from 8 M HCl into DIPE; and (5 extraction of 211At from DIPE into NaOH. Results from 55 “optimized” 211At isolation runs gave recovery yields of approximately 78% after decay and attenuation corrections. An attenuation-corrected average of 26 ± 3 mCi in the target provided isolated (actual yields of 16 ± 3 mCi of 211At. A sixth step, used for purification of 211At from trace metals, was evaluated in seven runs. In those runs, isolated 211At was distilled under reductive conditions to provide an average 71 ± 8% recovery. RadioHPLC analyses of the isolated 211At solutions, both initial and after distillation, were obtained to examine the 211At species present. The primary species of 211At present was astatide, but astatate and unidentified species were also observed. Studies to determine the effect of bismuth attenuation on 211At were conducted to estimate an attenuation factor (~1.33 for adjustment of 211At readings in the bismuth target.

  8. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  9. Astatination of nanoparticles containing silver as possible carriers of 211At

    Czech Academy of Sciences Publication Activity Database

    Lebeda, Ondřej; Kučka, Jan; Hrubý, Martin; Koňák, Čestmír; Kozempel, Ján

    2006-01-01

    Roč. 64, - (2006), s. 201-206. ISSN 0969-8043 R&D Projects: GA AV ČR KJB4048302; GA AV ČR KJB4050408 Institutional research plan: CEZ:AV0Z1048901 Keywords : nanoparticles * 211AT * Atalpha particle therapy Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.924, year: 2006

  10. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  11. [C II] 158 μm and [N II] 205 μm emission from IC 342. Disentangling the emission from ionized and photo-dissociated regions

    Science.gov (United States)

    Röllig, M.; Simon, R.; Güsten, R.; Stutzki, J.; Israel, F. P.; Jacobs, K.

    2016-06-01

    Context. Atomic fine-structure line emission is a major cooling process in the interstellar medium (ISM). In particular the [C II] 158 μm line is one of the dominant cooling lines in photon-dominated regions (PDRs). However, it is not confined to PDRs but can also originate from the ionized gas closely surrounding young massive stars. The proportion of the [C II] emission from H II regions relative to that from PDRs can vary significantly. Aims: We investigate the question of how much of the [C II] emission in the nucleus of the nearby spiral galaxy IC 342 is contributed by PDRs and by the ionized gas. We examine the spatial variations of starburst/PDR activity and study the correlation of the [C II] line with the [N II] 205 μm emission line coming exclusively from the H II regions. Methods: We present small maps of [C II] 158 μm and [N II] 205 μm lines recently observed with the GREAT receiver on board SOFIA. We present different methods to utilize the superior spatial and spectral resolution of our new data to infer information on how the gas kinematics in the nuclear region influence the observed line profiles. In particular we present a super-resolution method to derive how unresolved, kinematically correlated structures in the beam contribute to the observed line shapes. Results: We find that the emission coming from the ionized gas shows a kinematic component in addition to the general Doppler signature of the molecular gas. We interpret this as the signature of two bi-polar lobes of ionized gas expanding out of the galactic plane. We then show how this requires an adaptation of our understanding of the geometrical structure of the nucleus of IC 342. Examining the starburst activity we find ratios I( [C II] ) /I(12CO(1-0)) between 400 and 1800 in energy units. Applying predictions from numerical models of H II and PDR regions to derive the contribution from the ionized phase to the total [C II] emission we find that 35-90% of the observed [C II] intensity

  12. Novel Interplay between High-Tc Superconductivity and Antiferromagnetism in Tl-Based Six-CuO2-Layered Cuprates: 205Tl- and 63Cu-NMR Probes

    Science.gov (United States)

    Mukuda, Hidekazu; Shiki, Nozomu; Kimoto, Naoki; Yashima, Mitsuharu; Kitaoka, Yoshio; Tokiwa, Kazuyasu; Iyo, Akira

    2016-08-01

    We report 63Cu- and 205Tl-NMR studies on six-layered (n = 6) high-Tc superconducting (SC) cuprate TlBa2Ca5Cu6O14+δ (Tl1256) with Tc ˜ 100 K, which reveal that antiferromagnetic (AFM) order takes place below TN ˜ 170 K. In this compound, four underdoped inner CuO2 planes [n(IP) = 4] sandwiched by two outer planes (OPs) are responsible for the onset of AFM order, whereas the nearly optimally-doped OPs responsible for the onset of bulk SC. It is pointed out that an increase in the out-of-plane magnetic interaction within an intra-unit-cell causes TN ˜ 45 K for Tl1245 with n(IP) = 3 to increase to ˜170 K for Tl1256 with n(IP) = 4. It is remarkable that the marked increase in TN and the AFM moments for the IPs does not bring about any reduction in Tc, since Tc ˜ 100 K is maintained for both compounds with nearly optimally doped OP. We highlight the fact that the SC order for n ≥ 5 is mostly dominated by the long-range in-plane SC correlation even in the multilayered structure, which is insensitive to the magnitude of TN and the AFM moments at the IPs or the AFM interaction among the IPs. These results demonstrate a novel interplay between the SC and AFM orders when the charge imbalance between the IPs and OP is significantly large.

  13. Cinnamomum verum component 2-methoxycinnamaldehyde: a novel antiproliferative drug inducing cell death through targeting both topoisomerase I and II in human colorectal adenocarcinoma COLO 205 cells

    Science.gov (United States)

    Tsai, Kuen-daw; Cherng, Jonathan; Liu, Yi-Heng; Chen, Ta-Wei; Wong, Ho-Yiu; Yang, Shu-mei; Chou, Kuo-Shen; Cherng, Jaw-Ming

    2016-01-01

    Background Cinnamomum verum is used to manufacture the spice cinnamon. In addition, the plant has been used as a Chinese herbal medication. Methods We investigated the antiproliferative effect of 2-methoxycinnamaldehyde (2-MCA), a constituent of the cortex of the plant, and the molecular biomarkers associated with tumorigenesis in human colorectal adenocarcinoma COLO 205 cells. Specifically, cell viability was evaluated by colorimetric assay; apoptosis was determined by flow cytometry and morphological analysis with bright field, acridine orange, and neutral red stainings, as well as comet assay; topoisomerase I activity was determined by assay based upon DNA relaxation and topoisomerase II by DNA relaxation plus decatentation of kinetoplast DNA; lysosomal vacuolation and volume of acidic compartments (VACs) were determined by neutral red staining. Results The results demonstrate that 2-MCA inhibited proliferation and induced apoptosis as implicated by mitochondrial membrane potential (ΔΨm) loss, activation of both caspase-3 and -9, increase of annexin V+PI+ cells, as well as morphological characteristics of apoptosis. Furthermore, 2-MCA also induced lysosomal vacuolation with elevated VAC, cytotoxicity, and inhibitions of topoisomerase I as well as II activities. Additional study demonstrated the antiproliferative effect of 2-MCA found in a nude mice model. Conclusions Our data implicate that the antiproliferative activity of 2-MCA in vitro involved downregulation of cell growth markers, both topoisomerase I and II, and upregulation of pro-apoptotic molecules, associated with increased lysosomal vacuolation. In vivo 2-MCA reduced the tumor burden that could have significant clinical impact. Indeed, similar effects were found in other tested cell lines, including human hepatocellular carcinoma SK-Hep-1 and Hep 3B, lung adenocarcinoma A549 and squamous cell carcinoma NCI-H520, and T-lymphoblastic MOLT-3 (results not shown). Our data implicate that 2-MCA could be a

  14. First detection of [N II] 205 μm absorption in interstellar gas. Herschel-HIFI observations towards W 31C, W 49N, W 51, and G34.3+0.1

    Science.gov (United States)

    Persson, C. M.; Gerin, M.; Mookerjea, B.; Black, J. H.; Olberg, M.; Goicoechea, J. R.; Hassel, G. E.; Falgarone, E.; Levrier, F.; Menten, K. M.; Pety, J.

    2014-08-01

    We present high resolution [N ii] 205 μm (3P1 - 3P0) spectra obtained with Herschel-HIFI towards a small sample of far-infrared bright star forming regions in the Galactic plane: W 31C (G10.6-0.4), W 49N (G43.2-0.1), W 51 (G49.5-0.4), and G34.3+0.1. All sources display an emission line profile associated directly with the H ii regions themselves. For the first time we also detect absorption of the [N ii] 205 μm line by extended low-density foreground material towards W 31C and W 49N over a wide range of velocities. We attribute this absorption to the warm ionised medium (WIM) and find N(N+) ≈ 1.5 × 1017 cm-2 towards both sources. This is in agreement with recent Herschel-HIFI observations of [C ii] 158 μm, also observed in absorption in the same sight-lines, if ≈7-10% of all C+ ions exist in the WIM on average. Using an abundance ratio of [N] / [H] = 6.76 × 10-5 in the gas phase we find that the mean electron and proton volume densities are ~0.1-0.3 cm-3 assuming a WIM volume filling fraction of 0.1-0.4 with a corresponding line-of-sight filling fraction of 0.46-0.74. A low density and a high WIM filling fraction are also supported by RADEX modelling of the [N ii] 205 μm absorption and emission together with visible emission lines attributed mainly to the WIM. The detection of the 205 μm line in absorption emphasises the importance of a high spectral resolution, and also offers a new tool for investigation of the WIM. Appendix A is available in electronic form at http://www.aanda.orgHerschel is an ESA space observatory with science instruments provided by European-led Principal Investigator consortia and with important participation from NASA.

  15. Measurements of Neutron-Induced Fission Cross Sections of 205Tl, 204, 206, 207, 208Pb, and 209Bi using Quasi-Monoenergetic Neutrons in the Energy Range 35 - 174 MeV

    Science.gov (United States)

    Tutin, Gennady A.; Ryzhov, Igor V.; Eismont, Vilen P.; Mitryukhin, Andrey G.; Oplavin, Valery S.; Soloviev, Sergey M.; Blomgren, Jan; Condè, Henri; Olsson, Nils; Renberg, Per-Ulf

    2005-05-01

    Cross sections for neutron-induced fission of 205Tl, 204, 206, 207, 208Pb, and 209Bi were measured in the energy range from 35 MeV to 174 MeV. The experiments were done at the neutron beam facility of The Svedberg Laboratory, using a multi-section Frisch-gridded ionization chamber for detection of the fission fragments. The neutron-induced fission cross section of 238U was employed as a reference. The results of the measurements are compared with existing experimental data.

  16. Measurements of neutron-induced fission cross-sections of 205Tl, 204,206,207,208Pb and 209Bi with a multi-section Frisch-gridded ionization chamber

    Science.gov (United States)

    Ryzhov, I. V.; Tutin, G. A.; Mitryukhin, A. G.; Oplavin, V. S.; Soloviev, S. M.; Blomgren, J.; Renberg, P.-U.; Meulders, J. P.; El Masri, Y.; Keutgen, Th.; Prieels, R.; Nolte, R.

    2006-06-01

    Neutron-induced fission cross-sections of 205Tl, 204,206,207,208Pb and 209Bi have been measured in the energy range from 30 to 180 MeV. The measurements were performed with quasi-monoenergetic neutron beams using a multi-section Frisch-gridded ionization chamber. The neutron-induced fission cross-sections of 238U were used as reference data. The experimental techniques are described in detail as well as the data processing. The results are compared with existing experimental data.

  17. Reply to ''Comment on 'Paramagnetic and ferromagnetic resonance studies on dilute magnetic semiconductors based on GaN' '' [Phys. Status Solidi A 205, 1872 (2008)

    Energy Technology Data Exchange (ETDEWEB)

    Kammermeier, T. [Institut fuer Energie und Umwelttechnik e.V. (IUTA), Luftreinhaltung and Nachhaltige Nanotechnologie Unit, Bliersheimer Strasse 60, 47229 Duisburg (Germany); Fakultaet fuer Physik und CeNIDE, Universitaet Duisburg-Essen, 47057 Duisburg (Germany); Ney, A. [Fakultaet fuer Physik und CeNIDE, Universitaet Duisburg-Essen, 47057 Duisburg (Germany); Wieck, A.D. [Angewandte Festkoerperphysik, Ruhr-Universitaet Bochum, Universitaetsstr. 150, NB Building, 44780 Bochum (Germany)

    2011-08-15

    In a comment by Gehlhoff et al. on our work on ''Paramagnetic and ferromagnetic resonance studies on dilute magnetic semiconductors based on GaN'' [Phys. Status Solidi A 205, 1872 (2008)] the authors claim a contradictory explanation of angular dependent magnetic resonance measurements. Here we discuss their - solely based on computer simulations - claims. We show that an interpretation limited on magnetic impurities can hardly be used to explain the complex magnetic behavior. (Copyright copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  18. Fuel and fuel pin behaviour in a high burnup fast breeder fuel subassembly: Results of destructive post-irradiation examinations of the KNK II/1 fuel subassembly NY-205

    International Nuclear Information System (INIS)

    The report gives a summarizing overview of the design characteristics, of the irradiation history and of the results of the destructive post-irradiation examinations of the fuel pins of the high-burnup fuel subassembly NY-205 of the KNK II first core. This element was operated for about 10 years and reached a maximum local burnup of 175 MWd/kg(HM) and a maximum neutron dose of 67 dpa-NRT. The main design data of this subassembly agree with those of the SNR 300 Mark-Ia, and it reached more than twice of the burnup and a similar neutron dose as foreseen for the SNR 300 fuel subassemblies

  19. Measurements of neutron-induced fission cross-sections of 205Tl, 204,206,207,208Pb and 209Bi with a multi-section Frisch-gridded ionization chamber

    International Nuclear Information System (INIS)

    Neutron-induced fission cross-sections of 205Tl, 204,206,207,208Pb and 209Bi have been measured in the energy range from 30 to 180 MeV. The measurements were performed with quasi-monoenergetic neutron beams using a multi-section Frisch-gridded ionization chamber. The neutron-induced fission cross-sections of 238U were used as reference data. The experimental techniques are described in detail as well as the data processing. The results are compared with existing experimental data

  20. miR-29b, miR-205 and miR-221 enhance chemosensitivity to gemcitabine in HuH28 human cholangiocarcinoma cells.

    Directory of Open Access Journals (Sweden)

    Kinya Okamoto

    Full Text Available BACKGROUND AND AIMS: Cholangiocarcinoma (CCA is highly resistant to chemotherapy, including gemcitabine (Gem treatment. MicroRNAs (miRNAs are endogenous, non-coding, short RNAs that can regulate multiple genes expression. Some miRNAs play important roles in the chemosensitivity of tumors. Here, we examined the relationship between miRNA expression and the sensitivity of CCA cells to Gem. METHODS: Microarray analysis was used to determine the miRNA expression profiles of two CCA cell lines, HuH28 and HuCCT1. To determine the effect of candidate miRNAs on Gem sensitivity, expression of each candidate miRNA was modified via either transfection of a miRNA mimic or transfection of an anti-oligonucleotide. Ontology-based programs were used to identify potential target genes of candidate miRNAs that were confirmed to affect the Gem sensitivity of CCA cells. RESULTS: HuCCT1 cells were more sensitive to Gem than were HuH28 cells, and 18 miRNAs were differentially expressed whose ratios over ± 2log2 between HuH28 and HuCCT1. Among these 18 miRNAs, ectopic overexpression of each of three downregulated miRNAs in HuH28 (miR-29b, miR-205, miR-221 restored Gem sensitivity to HuH28. Suppression of one upregulated miRNA in HuH28, miR-125a-5p, inhibited HuH28 cell proliferation independently to Gem treatment. Selective siRNA-mediated downregulation of either of two software-predicted targets, PIK3R1 (target of miR-29b and miR-221 or MMP-2 (target of miR-29b, also conferred Gem sensitivity to HuH28. CONCLUSIONS: miRNA expression profiling was used to identify key miRNAs that regulate Gem sensitivity in CCA cells, and software that predicts miRNA targets was used to identify promising target genes for anti-tumor therapies.

  1. Metformin lowers the threshold for stress-induced senescence: a role for the microRNA-200 family and miR-205.

    Science.gov (United States)

    Cufí, Sílvia; Vazquez-Martin, Alejandro; Oliveras-Ferraros, Cristina; Quirantes, Rosa; Segura-Carretero, Antonio; Micol, Vicente; Joven, Jorge; Bosch-Barrera, Joaquim; Del Barco, Sonia; Martin-Castillo, Begoña; Vellon, Luciano; Menendez, Javier A

    2012-03-15

    We have tested the hypothesis that the antidiabetic biguanide metformin can be used to manipulate the threshold for stress-induced senescence (SIS), thus accelerating the onset of cancer-protective cellular senescence in response to oncogenic stimuli. Using senescence-prone murine embryonic fibroblasts (MEFs), we assessed whether metformin treatment modified the senescence phenotype that is activated in response to DNA damaging inducers. Metformin significantly enhanced the number of MEFs entering a senescent stage in response to doxorubicin, an anthracycline that induces cell senescence by activating DNA damage signaling pathways (e.g., ATM/ATR) in a reactive oxygen species (ROS)-dependent manner. Using WI-38 and BJ-1 human diploid fibroblasts (HDFs), we explored whether metformin supplementation throughout their entire replicative lifespan may promote the early appearance of the biomarkers of replicative senescence. Chronic metformin significantly reduced HDFs' lifespan by accelerating both the loss of replicative potential and the acquisition of replicative senescence-related biomarkers (e.g., enlarged and flattened cell shapes, loss of arrayed arrangement, accumulation of intracellular and extracellular debris and SA-β-gal-positive staining). Metformin functioned as a bona fide stressful agent, inducing monotonic, dose-dependent, SIS-like responses in BJ-1 HDFs, which are highly resistant to ROS-induced premature senescence. Metformin-induced SIS in BJ-1 fibroblasts was accompanied by the striking activation of several microRNAs belonging to the miR-200s family (miR-200a, miR-141 and miR429) and miR-205, thus mimicking a recently described ability of ROS to chemosensitize cancer cells by specifically upregulating anti-EMT (epithelial-to-mesenchymal transition) miR-200s. Because the unlimited proliferative potential of stem cells results from their metabolic refractoriness to SIS, we finally tested if metformin treatment could circumvent the stress (e.g., ROS

  2. Rede de infarto com supradesnivelamento de ST: sistematização em 205 casos diminui eventos clínicos na rede pública

    Directory of Open Access Journals (Sweden)

    Ana Christina Vellozo Caluza

    2012-11-01

    Full Text Available FUNDAMENTO: A principal causa de óbitos na cidade de São Paulo (SP é por eventos cardíacos. Em hospitais periféricos de São Paulo estima-se a mortalidade hospitalar no infarto agudo entre 15% e 20%, pelas dificuldades existentes. OBJETIVO: Descrever a mortalidade intra-hospitalar do Infarto Agudo do Miocárdio com Supradesnivelamento de ST (IAMCSST de pacientes admitidos via ambulância ou hospitais periféricos, como resultado da organização de uma estruturada rede de treinamento. MÉTODOS: Equipes de quatro prontos-socorros (Ermelino Matarazzo, Campo Limpo, Tatuapé e Saboya e das ambulâncias avançadas do Serviço de Atendimento Móvel de Urgência (Samu foram treinadas para uso de tenecteplase (TNK ou para encaminhamento para angioplastia primária. Uma central de leitura de eletrocardiogramas foi usada quando necessário. Após uso de trombolítico, um hospital terciário recebia o paciente que era submetido a cinecoronariografia imediata (trombólise sem sucesso ou entre 6 e 24 h, caso estável. Variáveis quantitativas, qualitativas foram avaliadas em análise uni e multivariável. RESULTADOS: De janeiro 2010 a junho 2011, 205 pacientes consecutivos utilizaram a rede de atendimento, ocorrendo 87 infartos de parede anterior, 11 bloqueios de ramo esquerdo, 14 bloqueios atrioventricular total, e em 14 houve reanimação pós-parada cardiorrespiratória inicial. A mortalidade intra-hospitalar foi de 6,8% (14 casos, a maioria por choque cardiogênico, um por acidente vascular encefálico hemorrágico e um por sangramento. CONCLUSÃO: A organização em instituições públicas de uma rede de tratamento, envolvendo diagnóstico, reperfusão, transporte imediato e hospital de retaguarda resultou em melhora imediata dos resultados de IAMCSST.

  3. Locus: 205 [ASTRA[Archive

    Lifescience Database Archive (English)

    Full Text Available Hs.408846 H. sapiens + S: gi|29824572|ref|NC_000001.4|NC_000001 NC_000001 Homo sapiens sema doma ... SEMA4A), mRNA development | integral to membrane | neurogenesis ... | receptor activity 5'end: 3 ...

  4. The miR-200 family and miR-205 are repressed by Twist1 and concurrently silenced and DNA hypermethylated in invasive bladder cancer

    DEFF Research Database (Denmark)

    Wiklund, Erik Digman

    MicroRNAs (miRNA) are small non-coding RNAs commonly deregulated in cancer. The miR-200 family (miR-200a, -200b, -200c, -141 and -429) and miR-205 are encoded in three separate genomic loci and are frequently silenced in advanced cancer. The miR-200 family and miR-205 have been implicated in tumour...... invasion and metastasis by negatively regulating the transcriptional repressors of E-cadherin, ZEB1 and ZEB2. Loss of miR-200 expression leads to silencing of E-cadherin, thereby promoting epithelial to mesenchymal transition (EMT) and loss of cell adhesion. However, little is known about the...... transcriptional regulation of the miR-200s. Here we show that the three miR-200 loci are concurrently silenced and gain promoter hypermethylation in muscle invasive bladder tumors and undifferentiated bladder cell lines. Furthermore, we report that the mesoderm transcription factor Twist1 and miR-200 expression...

  5. Avaliação de Métodos de Padronização dos Pesos Corporais às Idades de 205, 365 e 550 Dias Evaluation of Body Weight Standardization Methods for 205, 365 and 550 Days of Age

    Directory of Open Access Journals (Sweden)

    Raimundo Nonato Braga Lôbo

    2002-07-01

    Full Text Available Foram comparados métodos de padronização dos pesos corporais às idades de 205, 365 e 550 dias. Utilizaram-se informações de animais da raça Nelore, criados na região Nordeste e controlados pela Associação Brasileira dos Criadores de Zebu (ABCZ. Compararam-se os métodos: MET1 - utilizado pela ABCZ; MET2 - curvas individuais de regressão linear para cada animal; MET3 - curvas individuais de regressão quadrática; MET4 - curvas individuais de Brody; MET5 - utilizado pelo Programa de Melhoramento Genético da Raça Nelore (PMGRN; e MET6 -- curvas individuais de Richards. Houve diferenças entre as médias dos pesos corporais calculadas pelos diferentes métodos. Foram verificadas altas correlações entre os métodos. As estimativas de variâncias e de parâmetros genéticos foram diferentes entre os métodos. Os métodos em execução no Brasil apresentam diferenças quanto à sua aproximação em representar a curva de crescimento dos animais. Apesar das altas correlações genéticas e de classificação dos animais por seus valores genéticos, as diferenças nesta classificação podem influenciar o processo de seleção e a resposta esperada à esta seleção.Methods of standardization of body weight for 205, 365 and 550 days of age were compared. It was used information of animals of the Nellore breed, raised in the Northeast Brazil, and controlled by the Brazilian Zebu Breeders Association (ABCZ. The following methods were compared: MET1 - used by ABCZ; MET2 - individual curves of linear regression for each animal; MET3 - individual curves of quadratic regression; MET4 - individual Brody curve; MET5 - used by the Program of Genetic Improvement of the Nellore breed (PMGRN; and MET6 -- individual Richards curves. There were differences among the means of the body weights calculated by the different methods. High correlations were verified among the methods. The variance and genetic parameters estimates were different among the

  6. Effect of the selective 5-HT3 receptor antagonists ICS 205-930 and MDL 72222 on 5-HTP-induced head shaking and behavioral symptoms induced by 5-methoxy-N,N,dimethyltryptamine in rats: comparison with some other 5-HT receptor antagonists.

    Science.gov (United States)

    Shearman, G T; Tolcsvai, L

    1987-01-01

    The effect of the selective 5-HT3 receptor antagonists ICS 205-930 and MDL 72222 on head shaking behavior induced by L-5-HTP and behavioral symptoms induced with 5-methoxy-N,N,-dimethyltryptamine (5-MeODMT) in rats was evaluated. Both drugs dose-dependently reduced L-5-HTP-induced head shaking but were at least 600 times less potent than pirenperone and ketanserin and at least 50 times less potent than methysergide. ICS 205-930 and MDL 72222 were more than 1000 times less potent than pirenperone or methysergide and 100 times less potent than ketanserin in blocking 5-MeODMT-induced forepaw treading and tremor. Since it appears that head shakes induced by L-5-HTP are mediated by 5-HT2 receptors, these data suggest that ICS 205-930 and MDL 72222 do not significantly interact with 5-HT2 receptors in the brain. Furthermore, the data suggest that ICS 205-930 and MDL 72222 lack appreciable antagonistic activity at the 5-HT receptor(s) mediating those behavioral effects induced by 5-MeODMT. PMID:3114804

  7. Food sources of total omega 3 fatty acids (18:3 + 20:5 + 22:6), listed in descending order by percentages of their contribution to intake, based on data from the National Health and Nutrition Examination Survey 2005-2006

    Science.gov (United States)

    Food sources of total omega 3 fatty acids (18:3 + 20:5 + 22:6), listed in descending order by percentages of their contribution to intake, based on data from the National Health and Nutrition Examination Survey 2005-2006

  8. Millimeter- and submillimeter-wave surveys of Orion A emission lines in the ranges 200.7-202.3, 203.7-205.3, and 330-360 GHz

    International Nuclear Information System (INIS)

    A continuous spectral line survey of the Orion A position from 330.5 to 360.1 GHz was carried out. This survey covers nearly the entire 870 micron atmospheric window accessible from ground-based observations. Approximately 160 distinct spectral features composed of about 180 lines were detected, 29 of which could not be readily identified. In addition, Orion A from 200.7 to 202.3 GHz and from 203.7 to 205.3 GHz and 42 distinct new spectral lines were detected, including four that are unidentified at present. These data sets are the first thorough survey results in these spectral regions. The new interstellar lines in the survey bands are tabulated and displayed graphically. Moreover, the data are being made available to the Astronomical Data Center at the Goddard Space Flight Center for distribution by request to the astronomical community. 14 refs

  9. Hb H disease resulting from the association of an αº-thalassemia allele [-(α20.5] with an unstable α-globin variant [Hb Icaria]: first report on the occurrence in Brazil

    Directory of Open Access Journals (Sweden)

    Elza M. Kimura

    2009-01-01

    Full Text Available Hb H Disease is caused by the loss or inactivation of three of the four functional a-globin genes. Patients present chronic hemolytic anemia and splenomegaly. In some cases, occasional blood transfusions are required. Deletions are the main cause of this type of thalassemia (α-thalassemia. We describe here an unusual case of Hb H disease caused by the combination of a common αº deletion [-(α20.5] with a rare point mutation (c.427T > A, thus resulting in an elongated and unstable α-globin variant, Hb Icaria, (X142K, with 31 additional amino-acid residues. Very high levels of Hb H and Hb Bart's were detected in the patient's red blood cells (14.7 and 19.0%, respectively. This is the first description of this infrequent association in the Brazilian population.

  10. Circulating miR-19a and miR-205 in serum may predict the sensitivity of luminal A subtype of breast cancer patients to neoadjuvant chemotherapy with epirubicin plus paclitaxel.

    Directory of Open Access Journals (Sweden)

    Qian Li

    Full Text Available The luminal A subtype of breast cancer has a good prognosis and is sensitive to endocrine therapy but is less sensitive to chemotherapy. It is necessary to identify biomarkers to predict chemosensitivity and avoid over-treatment. We hypothesized that miRNAs in the serum might be associated with chemosensitivity.Sixty-eight breast cancer patients received neoadjuvant chemotherapy with epirubicin plus paclitaxel. The serum of the patients was collected before chemotherapy and stored at -80°C. The samples were classified into two groups in term of the chemosensitivity. We identified the differential expression patterns of miRNAs between the chemotherapy sensitive and resistant groups using microRNA profiling. Four miRNAs that were differentially expressed between the two groups were further validated in another 56 samples. We created a model fitting formula and a receiver operating characteristics (ROC curve using logistic regression analysis to evaluate the prediction potency.We identified 8 miRNAs differentially expressed between the two groups: 6 miRNAs were up-regulated, and 2 miRNAs were down-regulated in the resistant group compared with the sensitive group. The expression of miR-19a and miR-205 were determined to have significant differences between the two groups (P<0.05. A predictive model of these two miRNAs was created by the logistic regression analysis. The probability of this model was 89.71%. Based on the ROC curve, the specificity was 75.00%, and the sensitivity was 81.25%.The combination of miR-19a and miR-205 in the serum may predict the chemosensitivity of luminal A subtype of breast cancer to epirubicin plus paclitaxel neoadjuvant chemotherapy.

  11. КРИМИНАЛЬНЫЙ СУИЦИД В ВОПРОСАХ КВАЛИФИКАЦИИ ПРЕСТУПЛЕНИЙ ПО СТ. 205 И 205.1 УК РФ

    OpenAIRE

    Гавло, Вениамин; Градусова, Марина

    2011-01-01

    Рассматривается использование террористическими организациями метода суицидальных террористических атак. Показано, что среди мотивированных причин суицида присутствуют криминальные или доведение до самоубийства. Предлагается применить термин «криминальный суицид» в практике определения составов преступлений по ст. 205 и 205.1 УК РФ, в отношении субъекта смертника, совершившего террористический акт, «криминальный суицидент»....

  12. Microstructure, magnetic, and low-field magnetotransport properties of self-assembled (La0.7Sr0.3MnO3)0.5:(CeO2)0.5 vertically aligned nanocomposite thin films

    International Nuclear Information System (INIS)

    Two-phase (La0.7Sr0.3MnO3)0.5:(CeO2)0.5 (LSMO:CeO2) heteroepitaxial nanocomposite films were grown on SrTiO3 (STO) (001) by pulsed laser deposition (PLD). X-ray diffraction (XRD) and transmission electron microscopy (TEM) results show that LSMO:CeO2 films epitaxially grow on STO as self-assembled vertically aligned nanocomposite (VAN). Magnetic and magnetotransport measurements demonstrate that the LSMO phase in the VAN structure behaves differently from its epitaxial single-phase counterpart, e.g. greatly enhanced coercivity (HC) and low-field magnetoresistance (LFMR). The enhanced properties in the VAN system are attributed to the interaction between the perovskite and the secondary phase or phase boundary. The results suggest that the growth of functional oxide in another oxide matrix with vertical heteroepitaxial form is a promising approach to achieve new functionality that may not be easily realized in the single epitaxial phase.

  13. A search for $t\\bar{t}$ resonances with the ATLAS detector in 2.05 fb$^{-1}$ of proton-proton collisions at $\\sqrt(s)$ = 7 TeV

    CERN Document Server

    Aad, Georges; Abdallah, Jalal; Abdel Khalek, Samah; Abdelalim, Ahmed Ali; Abdinov, Ovsat; Abi, Babak; Abolins, Maris; AbouZeid, Ossama; Abramowicz, Halina; Abreu, Henso; Acerbi, Emilio; Acharya, Bobby Samir; Adamczyk, Leszek; Adams, David; Addy, Tetteh; Adelman, Jahred; Adomeit, Stefanie; Adragna, Paolo; Adye, Tim; Aefsky, Scott; Aguilar-Saavedra, Juan Antonio; Agustoni, Marco; Aharrouche, Mohamed; Ahlen, Steven; Ahles, Florian; Ahmad, Ashfaq; Ahsan, Mahsana; Aielli, Giulio; Akdogan, Taylan; Åkesson, Torsten Paul Ake; Akimoto, Ginga; Akimov, Andrei; Alam, Mohammad; Alam, Muhammad Aftab; Albert, Justin; Albrand, Solveig; Aleksa, Martin; Aleksandrov, Igor; Alessandria, Franco; Alexa, Calin; Alexander, Gideon; Alexandre, Gauthier; Alexopoulos, Theodoros; Alhroob, Muhammad; Aliev, Malik; Alimonti, Gianluca; Alison, John; Allbrooke, Benedict; Allport, Phillip; Allwood-Spiers, Sarah; Almond, John; Aloisio, Alberto; Alon, Raz; Alonso, Alejandro; Alvarez Gonzalez, Barbara; Alviggi, Mariagrazia; Amako, Katsuya; Amelung, Christoph; Ammosov, Vladimir; Amorim, Antonio; Amram, Nir; Anastopoulos, Christos; Ancu, Lucian Stefan; Andari, Nansi; Andeen, Timothy; Anders, Christoph Falk; Anders, Gabriel; Anderson, Kelby; Andreazza, Attilio; Andrei, George Victor; Anduaga, Xabier; Anger, Philipp; Angerami, Aaron; Anghinolfi, Francis; Anisenkov, Alexey; Anjos, Nuno; Annovi, Alberto; Antonaki, Ariadni; Antonelli, Mario; Antonov, Alexey; Antos, Jaroslav; Anulli, Fabio; Aoun, Sahar; Aperio Bella, Ludovica; Apolle, Rudi; Arabidze, Giorgi; Aracena, Ignacio; Arai, Yasuo; Arce, Ayana; Arfaoui, Samir; Arguin, Jean-Francois; Arik, Engin; Arik, Metin; Armbruster, Aaron James; Arnaez, Olivier; Arnal, Vanessa; Arnault, Christian; Artamonov, Andrei; Artoni, Giacomo; Arutinov, David; Asai, Shoji; Asfandiyarov, Ruslan; Ask, Stefan; Åsman, Barbro; Asquith, Lily; Assamagan, Ketevi; Astbury, Alan; Aubert, Bernard; Auge, Etienne; Augsten, Kamil; Aurousseau, Mathieu; Avolio, Giuseppe; Avramidou, Rachel Maria; Axen, David; Azuelos, Georges; Azuma, Yuya; Baak, Max; Baccaglioni, Giuseppe; Bacci, Cesare; Bach, Andre; Bachacou, Henri; Bachas, Konstantinos; Backes, Moritz; Backhaus, Malte; Badescu, Elisabeta; Bagnaia, Paolo; Bahinipati, Seema; Bai, Yu; Bailey, David; Bain, Travis; Baines, John; Baker, Oliver Keith; Baker, Mark; Baker, Sarah; Banas, Elzbieta; Banerjee, Piyali; Banerjee, Swagato; Banfi, Danilo; Bangert, Andrea Michelle; Bansal, Vikas; Bansil, Hardeep Singh; Barak, Liron; Baranov, Sergei; Barbaro Galtieri, Angela; Barber, Tom; Barberio, Elisabetta Luigia; Barberis, Dario; Barbero, Marlon; Bardin, Dmitri; Barillari, Teresa; Barisonzi, Marcello; Barklow, Timothy; Barlow, Nick; Barnett, Bruce; Barnett, Michael; Baroncelli, Antonio; Barone, Gaetano; Barr, Alan; Barreiro, Fernando; Barreiro Guimarães da Costa, João; Barrillon, Pierre; Bartoldus, Rainer; Barton, Adam Edward; Bartsch, Valeria; Bates, Richard; Batkova, Lucia; Batley, Richard; Battaglia, Andreas; Battistin, Michele; Bauer, Florian; Bawa, Harinder Singh; Beale, Steven; Beau, Tristan; Beauchemin, Pierre-Hugues; Beccherle, Roberto; Bechtle, Philip; Beck, Hans Peter; Becker, Anne Kathrin; Becker, Sebastian; Beckingham, Matthew; Becks, Karl-Heinz; Beddall, Andrew; Beddall, Ayda; Bedikian, Sourpouhi; Bednyakov, Vadim; Bee, Christopher; Begel, Michael; Behar Harpaz, Silvia; Beimforde, Michael; Belanger-Champagne, Camille; Bell, Paul; Bell, William; Bella, Gideon; Bellagamba, Lorenzo; Bellina, Francesco; Bellomo, Massimiliano; Belloni, Alberto; Beloborodova, Olga; Belotskiy, Konstantin; Beltramello, Olga; Benary, Odette; Benchekroun, Driss; Bendtz, Katarina; Benekos, Nektarios; Benhammou, Yan; Benhar Noccioli, Eleonora; Benitez Garcia, Jorge-Armando; Benjamin, Douglas; Benoit, Mathieu; Bensinger, James; Benslama, Kamal; Bentvelsen, Stan; Berge, David; Bergeaas Kuutmann, Elin; Berger, Nicolas; Berghaus, Frank; Berglund, Elina; Beringer, Jürg; Bernat, Pauline; Bernhard, Ralf; Bernius, Catrin; Berry, Tracey; Bertella, Claudia; Bertin, Antonio; Bertolucci, Federico; Besana, Maria Ilaria; Besjes, Geert-Jan; Besson, Nathalie; Bethke, Siegfried; Bhimji, Wahid; Bianchi, Riccardo-Maria; Bianco, Michele; Biebel, Otmar; Bieniek, Stephen Paul; Bierwagen, Katharina; Biesiada, Jed; Biglietti, Michela; Bilokon, Halina; Bindi, Marcello; Binet, Sebastien; Bingul, Ahmet; Bini, Cesare; Biscarat, Catherine; Bitenc, Urban; Black, Kevin; Blair, Robert; Blanchard, Jean-Baptiste; Blanchot, Georges; Blazek, Tomas; Blocker, Craig; Blocki, Jacek; Blondel, Alain; Blum, Walter; Blumenschein, Ulrike; Bobbink, Gerjan

    2012-01-01

    A search for top quark pair resonances in final states containing at least one electron or muon has been performed with the ATLAS experiment at the CERN Large Hadron Collider. The search uses a data sample corresponding to an integrated luminosity of 2.05 fb$^{-1}$, which was recorded in 2011 at a proton-proton centre-of-mass energy of 7 TeV. No evidence for a resonance is found and limits are set on the production cross-section times branching ratio to $t\\bar{t}$ for narrow and wide resonances. For narrow Z' bosons, the observed 95% credibility level limits range from 9.3 pb to 0.95 pb for masses in the range of $m_Z'$ = 500 GeV to $m_Z'$ = 1300 GeV. The corresponding excluded mass region for a leptophobic topcolour Z' boson (Kaluza-Klein gluon excitation in the Randall-Sundrum model) is $m_Z'$ < 880 GeV ($m_{g_KK}$ < 1130 GeV).

  14. High resolution spectroscopy in the second excited torsional state of $CH_{3}/OD$ and the atlas of the Fourier transform spectrum in the range 20-205 cm$^{-1}/$...

    CERN Document Server

    Mukhopadhyay, I

    1999-01-01

    In this work, the reduced eighth order Hamiltonian that has been used for the determination of the molecular parameters-using the high resolution Fourier transform far-infrared (FIR) assigned transitions in the ground and first $9 excited torsional states of CH/sub 3/OD-has been applied to assign and refine the model for the second excited torsional state. The data set consisted of 1220 FIR transitions with the rotational angular momentum J<21 and K<7 in the $9 second excited torsional state. It should be noted that the second excited torsional states of methanol are almost at the top of the torsional barrier. Thus it was interesting to see how the large amplitude motion is taken care of by $9 the eighth order Hamiltonian. We are in the process of a global fit including all the assigned transitions up to the second excited state. Additionally, in this paper we present the detailed Fourier transform spectral map of CH/sub $9 3/OD in the range 20-205 cm/sup -1/, as was done for the parent species. This sp...

  15. Structure of Bacteroides thetaiotaomicron BT2081 at 2.05 Å resolution: the first structural representative of a new protein family that may play a role in carbohydrate metabolism

    International Nuclear Information System (INIS)

    The crystal structure of BT2081 from B. thetaiotaomicron reveals a two-domain protein with a putative carbohydrate-binding site in the C-terminal domain. BT2081 from Bacteroides thetaiotaomicron (GenBank accession code NP-810994.1) is a member of a novel protein family consisting of over 160 members, most of which are found in the different classes of Bacteroidetes. Genome-context analysis lends support to the involvement of this family in carbohydrate metabolism, which plays a key role in B. thetaiotaomicron as a predominant bacterial symbiont in the human distal gut microbiome. The crystal structure of BT2081 at 2.05 Å resolution represents the first structure from this new protein family. BT2081 consists of an N-terminal domain, which adopts a β-sandwich immunoglobulin-like fold, and a larger C-terminal domain with a β-sandwich jelly-roll fold. Structural analyses reveal that both domains are similar to those found in various carbohydrate-active enzymes. The C-terminal β-jelly-roll domain contains a potential carbohydrate-binding site that is highly conserved among BT2081 homologs and is situated in the same location as the carbohydrate-binding sites that are found in structurally similar glycoside hydrolases (GHs). However, in BT2081 this site is partially occluded by surrounding loops, which results in a deep solvent-accessible pocket rather than a shallower solvent-exposed cleft

  16. Cause Analysis and Countermeasures of Tube Rupture in the Low Temperature Superheater of 1 205 t/h Boiler Made in Japan%日产1205t/h锅炉低温过热器爆管原因分析与技术措施

    Institute of Scientific and Technical Information of China (English)

    李东雄; 景江峰

    2006-01-01

    对河津电厂日产1 205 t/h锅炉低温过热器爆管原因进行了分析,指出对尾部竖井设置均流板的∏型布置锅炉,当靠近两侧墙的管屏出现个管偏离管屏时,容易导致偏离管磨损爆破,进而影响相邻管段.其事故和处理措施对同类型锅炉有借鉴作用.

  17. Frontiers Of Change And Governance In Contractual Agreements: The Possible Role Of Exploitation - Uniting Reformed Church De Doorns V President Of The Republic Of South Africa 2013 5 Sa 205 (Wcc

    Directory of Open Access Journals (Sweden)

    Luanda Hawthorne

    2014-12-01

    Full Text Available In the South African common law of contract there appears to be support for the open norm of public policy as a general clause to ameliorate the effects of unfair contracts and terms which are contrary to public policy. The courts have on several occasions held that contracts or terms would be regarded as contrary to public policy had they come about where the parties were in an unequal bargaining relationship and this inequality was linked with another factor(s. In this case note it is argued that the element of unequal bargaining position may be contrary to public policy if it is linked with exploitation as the other factor. The element of exploitation was highlighted in the recent court decision of Uniting Reformed Church, De Doorns v President of the Republic of South Africa 2013 5 SA 205 (WCC. In this case the applicant church owned three properties on which were three schools under the control of the State. The church and the State had concluded 20-year notarial leases in respect of each of the properties. A term in the contract provided that after the expiration of the lease period the church would transfer the properties to the State free of charge. After the expiration of the leases the State demanded the transfer of the properties. The church disputed the claim, averring that the term was unenforceable because the parties had been in an unequal bargaining position and that the enforcement of the term constituted expropriation in contravention of the property clause of the Constitution. It is submitted that expropriation without compensation is not only contrary to section 25 of the Constitution but constitutes exploitation. It is suggested that where exploitation results from an unequal bargaining relationship it provides the "further factor" that, together with the inequality in bargaining power, is sufficient to establish that the term or contract is in conflict with public policy. This contributes to giving meaning to the term

  18. 24 CFR 266.205 - Ineligible projects.

    Science.gov (United States)

    2010-04-01

    ... HOUSING FINANCE AGENCY RISK-SHARING PROGRAM FOR INSURED AFFORDABLE MULTIFAMILY PROJECT LOANS Program... into account growth in the civilian economy and normal changes in the housing inventory, cause...

  19. 24 CFR 180.205 - Authority.

    Science.gov (United States)

    2010-04-01

    ... SECRETARY FOR EQUAL OPPORTUNITY, DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT EMPLOYMENT AND BUSINESS... reasonable standards of orderly and ethical conduct, or refusing to act in good faith; (i) Issue subpoenas...

  20. 12 CFR 205.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... that is directly or indirectly established through an employer and to which electronic fund transfers... Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM ELECTRONIC FUND TRANSFERS..., that may be used by the consumer to initiate electronic fund transfers. (2) An access device becomes...

  1. 12 CFR 205.3 - Coverage.

    Science.gov (United States)

    2010-01-01

    ... due to the amount of the transaction or due to other factors, then, except as otherwise provided in... transaction or due to other factors, the posted notice may explain how the fee will be determined, but the...-time electronic fund transfer (in providing a check to a merchant or other payee for the MICR...

  2. 48 CFR 16.205-2 - Application.

    Science.gov (United States)

    2010-10-01

    ... pricing period should be at least 12 months. (b) The contract may provide for a ceiling price based on evaluation of the uncertainties involved in performance and their possible cost impact. This ceiling...

  3. 45 CFR 205.10 - Hearings.

    Science.gov (United States)

    2010-10-01

    ... State plan; (D) The recipient has been placed in skilled nursing care, intermediate care or long-term... a result of a judicial determination, or voluntarily placed in foster care by his legal guardian; (H... program, or has failed to request such a hearing after notice of intended action for such refusal,...

  4. 10 CFR 205.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... communication, or any other participation in the proceeding. EPAA means the Emergency Petroleum Allocation Act.... Order means a written directive or verbal communication of a written directive, if promptly confirmed in... male gender shall include the female gender. (Emergency Petroleum Allocation Act of 1973, Pub. L....

  5. 49 CFR 399.205 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... within the 5th percentile female adult through the 95th percentile male adult of anthropometric measures... by reference was approved by the Director of the Federal Register on July 17, 1979. These...

  6. 24 CFR 891.205 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... shopping, laundry, or getting to and from activities such as going to the doctor and shopping, but must be mobile. The mobility requirement does not exclude persons in wheelchairs or those requiring...

  7. QTL Information Table: 205 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available dn1a Morphological trait Panicle/flower density Mixture C)Interval RIL Zhenshan 97 Minghui 63 A ... ment interaction for rice panicle characteristics. Yi ... Chuan Xue Bao 28, 439-446. ...

  8. 27 CFR 26.205 - Certificate.

    Science.gov (United States)

    2010-04-01

    ... OF THE TREASURY LIQUORS LIQUORS AND ARTICLES FROM PUERTO RICO AND THE VIRGIN ISLANDS Products Coming... the district director of customs at the port of entry, at the time of entry summary, as provided...

  9. 19 CFR 351.205 - Preliminary determination.

    Science.gov (United States)

    2010-04-01

    ... determinations, postponement of preliminary determinations, notices of preliminary determinations, and the... its injury determination. (e) Postponement at the request of the petitioner. A petitioner must submit a request for postponement of the preliminary determination (see section 703(c)(1)(A) or section...

  10. 7 CFR 1416.205 - Payment calculation.

    Science.gov (United States)

    2010-01-01

    ... livestock in any county provided in § 1416.2(d) that was not an eligible county according to 7 CFR 760.101... livestock in any county provided in § 1416.2(d) that was not an eligible county according to 7 CFR 760.101... an eligible county according to 7 CFR 760.101 for eligible livestock owners are as follows:...

  11. 40 CFR 205.174 - Remedial orders.

    Science.gov (United States)

    2010-07-01

    ...), have a concrete or sealed asphalt surface, and be free from snow, soil or other extraneous -material..., deceleration and stopping of the motorcycle. (2) The test site must be flat, open space free of large sound... conducted before the testing to familiarize the rider with the test procedure and operating conditions...

  12. 21 CFR 205.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ...; (2) The purchase or other acquisition by a hospital or other health care entity that is a member of a... reasons includes transfers of prescription drugs by a retail pharmacy to another retail pharmacy to... hospital, health care entity, or charitable institution in accordance with § 203.23 of this chapter; or...

  13. 13 CFR 500.205 - Application process.

    Science.gov (United States)

    2010-01-01

    ... independent Certified Public Accountants; (8)(i) An independent oil and gas company, as defined in section 201... statements and associated notes must be submitted as well. (ii) A service company, as defined in section 201... realized production costs. If the loan funds are to be used to purchase substantial assets of an...

  14. 13 CFR 400.205 - Application process.

    Science.gov (United States)

    2010-01-01

    ..., cash flow, average realized prices and average realized production costs. If the loan funds are to be... its financial needs, as reflected in the financial or business plan of that company. The Lender must... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Application process....

  15. 24 CFR 1006.205 - Development.

    Science.gov (United States)

    2010-04-01

    ... assisted and unassisted units are not comparable, the actual costs may be determined based upon a method of cost allocation. If the assisted and unassisted units are comparable in terms of size, features,...

  16. 19 CFR 205.4 - [Reserved

    Science.gov (United States)

    2010-04-01

    ... INTERNATIONAL TRADE COMMISSION NONADJUDICATIVE INVESTIGATIONS INVESTIGATIONS TO DETERMINE THE PROBABLE ECONOMIC EFFECT ON THE ECONOMY OF THE UNITED STATES OF PROPOSED MODIFICATIONS OF DUTIES OR OF ANY BARRIER TO (OR OTHER DISTORTION OF) INTERNATIONAL TRADE OR OF TAKING RETALIATORY ACTIONS TO OBTAIN THE ELIMINATION...

  17. 50 CFR 648.205 - VMS requirements.

    Science.gov (United States)

    2010-10-01

    ... Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE FISHERIES OF THE NORTHEASTERN UNITED STATES Management Measures for the Atlantic... begin fishing. Atlantic herring carrier vessels are not required to have VMS. At least 1 hr prior...

  18. 32 CFR 205.6 - Procedures.

    Science.gov (United States)

    2010-07-01

    ... USD(A). The notification will contain a description of the item and the limitations to be imposed by the exporting government. The USD(A) shall coordinate with the USD(P), providing at least 14 days for review. If appropriate, the USD(P) shall coordinate with the Department of State. The USD(A) shall...

  19. 48 CFR 5.205 - Special situations.

    Science.gov (United States)

    2010-10-01

    ...) Architect-engineering services. Contracting officers must publish notices of intent to contract for... Competitive Sourcing Official, name of the contracting officer, name of the Agency Tender Official,...

  20. 48 CFR 31.205-11 - Depreciation.

    Science.gov (United States)

    2010-10-01

    ...) Contractors having contracts subject to 48 CFR 9904.409, Depreciation of Tangible Capital Assets, shall adhere... standard for all other contracts. All requirements of 48 CFR 9904.409 are applicable if the election is... deliverable items on all open negotiated Government contracts. (c) For contracts to which 48 CFR 9904.409...

  1. 23 CFR 650.205 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... transporting of soil particles by water or wind, including actions that limit the area of exposed soil and minimize the time the soil is exposed. Permanent erosion and sediment control measures and practices are... quality when added to surface or ground waters in sufficient quantity. Sediment control measures...

  2. 40 CFR 205.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... Institute, Inc., 1430 Broadway, New York, New York 10018. (8) Sound Pressure Level means in decibels, 20... understood to be that of a root-mean-square pressure. The unit of any sound level is the decibel, having the unit symbol dB. (9) dB(A) means the standard abbreviation for A-weighted sound levels in decibels....

  3. 7 CFR 205.2 - Terms defined.

    Science.gov (United States)

    2010-01-01

    ... District of Columbia, and the Commonwealth of Puerto Rico. State certifying agent. A certifying agent... (40 CFR 152.3(m)). Information panel. That part of the label of a packaged product that is immediately..., and biological features of a production operation, including soil, water, wetlands, woodlands,...

  4. 18 CFR 375.205 - Closed meetings.

    Science.gov (United States)

    2010-04-01

    ... arbitration, or the initiation, conduct, or disposition by the Commission of a particular case: (i) Of formal... files and similar files; (7) Disclose investigatory records compiled for law enforcement purposes, or... personal privacy; (iv) Disclose the identity of a confidential source and, in the case of a record...

  5. 31 CFR 536.205 - Exempt transactions.

    Science.gov (United States)

    2010-07-01

    ... created and completed, provision of services to market, produce or co-produce, create or assist in the creation of information and informational materials, and payment of royalties to a specially designated... not involve the transfer of anything of value. (b) Information and informational materials. (1)...

  6. 24 CFR 964.205 - Eligibility.

    Science.gov (United States)

    2010-04-01

    ... childhood development, parent involvement, volunteer services, parenting skills, before and after school... other housing (including HUD owned or held single or multi-family) affordable for purchase by...

  7. 18 CFR 385.205 - Tariff or rate filings (Rule 205).

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Tariff or rate filings... COMMISSION, DEPARTMENT OF ENERGY PROCEDURAL RULES RULES OF PRACTICE AND PROCEDURE Pleadings, Tariff and Rate Filings, Notices of Tariff or Rate Examination, Orders To Show Cause, Intervention, and...

  8. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  9. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE,CERN

    OpenAIRE

    Rothe, Sebastian

    2012-01-01

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spec...

  10. Inactivation of human osteosarcoma cells in vitro by {sup 211}At-TP-3 monoclonal antibody: Comparison with astatine-211 and external-beam X rays

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, R.H. [Univ. of Oslo (Norway)]|[Institute for Cancer Research, Oslo (Norway); Bruland, O.S. [Institute for Cancer Research, Oslo (Norway); Hoff, P.; Alstad, J. [Univ. of Oslo (Norway); Lindmo, T. [Institute for Cancer Research, Oslo (Norway); Rofstad, E.K. [Norwegian Institute of Technology, Trondheim (Norway)

    1994-08-01

    The potential usefulness of {alpha}-particle radioimmunotherapy in the treatment of osteosarcoma was studied in vitro by using the monoclonal antibody TP-3 and cells of three human osteosarcoma cell lines (OHS, SAOS and KPDX) differing in antigen expression. Cell survival curves were established after treatment with (a) {sup 211}At-TP-3 of different specific activities, (b) {sup 211}At-labeled bovine serum albumin (BSA), (c) free {sup 211}At and (d) external-beam X rays. The three osteosarcoma cell lines showed similar survival curves, whether treated with external-beam X rays, {sup 211}At-BSA or free {sup 211}At. The D{sub o}`s were lower for free {sup 211}At than for {sup 211}At-BSA. The survival curves for {sup 211}At-TP-3 treatment, on the other hand, differed significantly among the cell lines, suggesting that sensitivity to {sup 211}At-TP-3 treatment was governed by cellular properties other than sensitivity to external-beam X rays. The cellular property most important for sensitivity to {sup 211}At-TP-3 treatment was the antigen expression. Cell inactivation after {sup 211}At-TP-3 treatment increased substantially with increasing specific activity of the {sup 211}At-TP-3. At high specific activities, the cytotoxic effect of {sup 211}At-TP-3 was significantly higher than that of {sup 211}At-BSA. In conclusion, {sup 211}At-TP-3 has the potential to give clinically favorable therapeutic ratios in the treatment of osteosarcoma. 39 refs., 5 figs., 2 tabs.

  11. 米非司酮配伍米索前列醇终止不同孕周中期妊娠205例临床分析%Clinical analysis on the effect of the compatibility of mifepristone plus misoprostol to terminate midterm gestation

    Institute of Scientific and Technical Information of China (English)

    俞倩君; 邵延龄

    2000-01-01

    Objective To explore the effect and safety of the compatibility of mifepristone with misoprostol toterminate the gestation during the period of 12 to 16 weeks and 16.1 to 26 weeks of pregnancy. Methods Divide thewhole group 205 pregnant women for termination of gestation into two groups according to their ages. Took orally 50mg mifepriston every 12 hours, a total of four times then insert 0.6 mg misoprostol deep into vagina every 12 hours, amaximum of 3 times. Results The successful rates of induced labor were 98.2 % and 97.86 % respectively for bothgroups; the rates were 82.88% and 79.78% when misoprostol was used once only, (P>0.05). Duration of placentaldischarge was proportionate to vaginal haemorrhage. When the duration of placenta discharge lasted more than 30 min-utes, vaginal haemorrhage increased significantly, (P>0.05 ). Conclusions Compatibility of 200 mg mifepristone(taken orally) plus misoprostol (vaginally) is an effective method to terminate gestation during the period of 12 to 26weeks, and it is also proven to be a safe and successful method for induceing labor during the period of 16. 1 to 26weeks of pregnancy. Here we suggest an immediate womb clearance once the duration of placental discharge lasting formore than 30 minutes. (Shanghai Med J, 2000,23:738-740)%目的 探索米非司酮配伍米索前列醇终止不同孕周中期妊娠(12~16周和17~26周)的效果及安全性。方法将符合条件药物终止妊娠的妇女205例,根据孕龄分成两组,给患者服用米非司酮50 mR,12 h1次,共4次,总量200 mg,第3天阴道放置米索前列醇0.6 mg,每12 h重复1次,最多3次。结果两组的引产成功率分别为98.20%和97.86%,两组单次米索前列醇用药的成功率分别是82.88%和79.78%,P>0.05,胎盘排出时间与阴道出血的关系呈正比。胎盘排出>30 min者阴道出血量明显增多(P<0.05)。结论口服米非司酮200 mg合并阴道放置米索前列醇是终止12

  12. 10 CFR 205.5 - Computation of time.

    Science.gov (United States)

    2010-01-01

    ... by verbal or written communication, to the person directly affected, and shall run without... rescinded. When a written order is transmitted by verbal communication, the written order shall be served...

  13. 48 CFR 31.205-10 - Cost of money.

    Science.gov (United States)

    2010-10-01

    ...) Refers to— (i) Facilities capital cost of money (48 CFR 9904.414); and (ii) Cost of money as an element of the cost of capital assets under construction (48 CFR 9904.417). (b) Cost of money is allowable, provided— (1) It is measured, assigned, and allocated to contracts in accordance with 48 CFR 9904.414...

  14. 24 CFR 291.205 - Competitive sales of individual properties.

    Science.gov (United States)

    2010-04-01

    ... accept the bid producing the greatest net return to HUD and otherwise meeting the terms of HUD's offering... this section. The greatest net return is calculated based on the net offer, as described in paragraph... considered as offers from investor purchasers. (2) Noncomplying bids will be returned to the broker with...

  15. Dicty_cDB: VHE205 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e 2002.10.25 Translated Amino Acid sequence wptgnni*in*NKHSLDSVKEKKKKKKKKKKKKKKKKXFXKKKXXPPPKXFFXGGGGXXX GXX...XXXKKXFFXGKXFXXKKXFFXXKXGXXPPFFXKKXGVXXXGGGXXGXXPPXXXFXXX IFFXXXXXFXXXGGXXGGGXK--...ame A: laywkqyinqlk*tltr*ckrkkkkkkkkkkkkkkkkxfxxkkxxpppxxxfxggggxxx ggxkxxkkxffxgxxffxkkxxfxxxxgx...kxpxfxkkxggfxxrggxpgxxxpxxxxxxx nffxxgxxfxxxggxxxggxx--- ---hi*wkevsh*ih*priwkcllnvsnvnielv*...pnggwiwlkplkislfsl*mtlpl Frame B: wptgnni*in*NKHSLDSVKEKKKKKKKKKKKKKKKKXFXKKKXXPPPKXFFXGGGGXXX GXXXXXKKXFFXGKXFXXKKXFFXXKXGX

  16. 12 CFR 205.17 - Requirements for overdraft services.

    Science.gov (United States)

    2010-01-01

    ...) A line of credit or other transaction exempt from the Federal Reserve Board's Regulation Z (12 CFR..., and other types of transactions on the consumer affirmatively consenting to the institution's payment...) Decline to pay checks, ACH transactions, and other types of transactions that overdraw the...

  17. 12 CFR Supplement I to Part 205 - Official Staff Interpretations

    Science.gov (United States)

    2010-01-01

    ... bonus, other incentive-based payment, or reimbursement, or the transaction does not represent a transfer... other teller transactions), but not for performing internal functions (such as investigating account... the transaction or due to other factors, such as the number of days the underlying transaction is...

  18. 12 CFR 205.11 - Procedures for resolving errors.

    Science.gov (United States)

    2010-01-01

    ... subject to Regulation T (Securities Credit by Brokers and Dealers, 12 CFR part 220); (ii) Informs the...-sale debit card transaction; or (C) Occurred within 30 days after the first deposit to the account...

  19. Nursing in the Pediatric Intensive Care Unit, Nursing 205.

    Science.gov (United States)

    Varton, Deborah M.

    A description is provided of a course, "Nursing in the Pediatric Intensive Care Unit," offered for senior-level baccalaureate degree nursing students. The first section provides information on the place of the course within the curriculum, the allotment of class time, and target student populations. The next section looks at course content in…

  20. 42 CFR 422.205 - Provider antidiscrimination rules.

    Science.gov (United States)

    2010-10-01

    ...: (1) Refusal to grant participation to health care professionals in excess of the number necessary to..., reimbursement, or indemnification, against any health care professional who is acting within the scope of his...